GenomeNet

Database: RefSeq
Entry: NC_007266
LinkDB: NC_007266
Original site: NC_007266 
LOCUS       NC_007266             912845 bp    DNA     linear   CON 16-JUN-2017
DEFINITION  Leishmania major strain Friedlin complete genome, chromosome 25.
ACCESSION   NC_007266 CT005264
VERSION     NC_007266.2
DBLINK      BioProject: PRJNA15564
            BioSample: SAMEA3138173
            Assembly: GCF_000002725.2
KEYWORDS    RefSeq; complete genome.
SOURCE      Leishmania major strain Friedlin
  ORGANISM  Leishmania major strain Friedlin
            Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae;
            Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Rogers,M.B., Hilley,J.D., Dickens,N.J., Wilkes,J., Bates,P.A.,
            Depledge,D.P., Harris,D., Her,Y., Herzyk,P., Imamura,H., Otto,T.D.,
            Sanders,M., Seeger,K., Dujardin,J.C., Berriman,M., Smith,D.F.,
            Hertz-Fowler,C. and Mottram,J.C.
  TITLE     Chromosome and gene copy number variation allow major structural
            change between species and strains of Leishmania
  JOURNAL   Genome Res. 21 (12), 2129-2142 (2011)
   PUBMED   22038252
REFERENCE   2
  AUTHORS   Ivens,A.C., Peacock,C.S., Worthey,E.A., Murphy,L., Aggarwal,G.,
            Berriman,M., Sisk,E., Rajandream,M.A., Adlem,E., Aert,R.,
            Anupama,A., Apostolou,Z., Attipoe,P., Bason,N., Bauser,C., Beck,A.,
            Beverley,S.M., Bianchettin,G., Borzym,K., Bothe,G., Bruschi,C.V.,
            Collins,M., Cadag,E., Ciarloni,L., Clayton,C., Coulson,R.M.,
            Cronin,A., Cruz,A.K., Davies,R.M., De Gaudenzi,J., Dobson,D.E.,
            Duesterhoeft,A., Fazelina,G., Fosker,N., Frasch,A.C., Fraser,A.,
            Fuchs,M., Gabel,C., Goble,A., Goffeau,A., Harris,D.,
            Hertz-Fowler,C., Hilbert,H., Horn,D., Huang,Y., Klages,S.,
            Knights,A., Kube,M., Larke,N., Litvin,L., Lord,A., Louie,T.,
            Marra,M., Masuy,D., Matthews,K., Michaeli,S., Mottram,J.C.,
            Muller-Auer,S., Munden,H., Nelson,S., Norbertczak,H., Oliver,K.,
            O'neil,S., Pentony,M., Pohl,T.M., Price,C., Purnelle,B.,
            Quail,M.A., Rabbinowitsch,E., Reinhardt,R., Rieger,M., Rinta,J.,
            Robben,J., Robertson,L., Ruiz,J.C., Rutter,S., Saunders,D.,
            Schafer,M., Schein,J., Schwartz,D.C., Seeger,K., Seyler,A.,
            Sharp,S., Shin,H., Sivam,D., Squares,R., Squares,S., Tosato,V.,
            Vogt,C., Volckaert,G., Wambutt,R., Warren,T., Wedler,H.,
            Woodward,J., Zhou,S., Zimmermann,W., Smith,D.F., Blackwell,J.M.,
            Stuart,K.D., Barrell,B. and Myler,P.J.
  TITLE     The genome of the kinetoplastid parasite, Leishmania major
  JOURNAL   Science 309 (5733), 436-442 (2005)
   PUBMED   16020728
REFERENCE   3  (bases 1 to 912845)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 912845)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR796421.
            On Jun 1, 2012 this sequence version replaced NC_007266.1.
            Data release policy www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..912845
                     /organism="Leishmania major strain Friedlin"
                     /mol_type="genomic DNA"
                     /strain="Friedlin"
                     /db_xref="taxon:347515"
                     /chromosome="25"
     gene            complement(<10328..>11632)
                     /gene="LPG1"
                     /locus_tag="LMJF_25_0010"
                     /db_xref="GeneID:5652730"
     mRNA            complement(<10328..>11632)
                     /gene="LPG1"
                     /locus_tag="LMJF_25_0010"
                     /product="beta galactofuranosyl transferase"
                     /transcript_id="XM_001683701.1"
                     /db_xref="GeneID:5652730"
     CDS             complement(10328..11632)
                     /gene="LPG1"
                     /locus_tag="LMJF_25_0010"
                     /codon_start=1
                     /product="beta galactofuranosyl transferase"
                     /protein_id="XP_001683753.1"
                     /db_xref="GeneID:5652730"
                     /db_xref="GOA:Q9NC61"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q9NC61"
                     /translation="MAPRRWHHNCRRMASFVRIGLYTLLFLMGYIVPLIIFYNRSGTE
                     TFEDTPRPGERFISDENFFHCIAERLSYKDQHPARIPYVLIPVTMDYQDIKQLFCNIT
                     VPMTYIMFINNGMFRPLRSLLDRLAVELRDYVDQNLFIIHHPENIGYASAVNEGLRHA
                     LNFSVAQVPWIFITNADVRFAPGLMDEFVSQAHIRTQGQLERIRRLDEEIVAEIKTLK
                     NVPDPRFAFRSSRHPIVTASSLPYRIRTMPPEQMKKQFADAYGIFFTDHKEFMATFAL
                     SRLAIATLGFFDENFYPAYGEDHDYMWRMNALGYRKYFSERGKYVHFQNANLNVGGSA
                     KNRGVFKDTAYFVQNVKFWRMNNELFRLQYRHAKWFPDDVTIYRGVRRRPLPFNGTIP
                     VDMWVLDAERQRSIWQIGESMRCHRDYKPYSTKLLDFAVDPS"
     gene            complement(<12292..>12975)
                     /gene="ARD1"
                     /locus_tag="LMJF_25_0020"
                     /db_xref="GeneID:5652415"
     mRNA            complement(<12292..>12975)
                     /gene="ARD1"
                     /locus_tag="LMJF_25_0020"
                     /product="putative n-terminal acetyltransferase complex
                     ard1 subunit"
                     /transcript_id="XM_001683702.1"
                     /db_xref="GeneID:5652415"
     CDS             complement(12292..12975)
                     /gene="ARD1"
                     /locus_tag="LMJF_25_0020"
                     /EC_number="2.3.1.-"
                     /codon_start=1
                     /product="putative n-terminal acetyltransferase complex
                     ard1 subunit"
                     /protein_id="XP_001683754.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652415"
                     /db_xref="GOA:Q4QA94"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:Q4QA94"
                     /translation="MLPSVVPLPFLSRFSCLRVRKERQKVNVNRAVVQQGDRRRTMTT
                     YRRMTLCDTLQFNFVNLDQLTETYNTSFYGEYVTHWPEYQRVCVHPTTGIPMAYTLGK
                     AEGQGEDYHGHVSAVSVAPTFRRVALGETLMVELAQMSELVHNAYFVDLFVRKSNQVA
                     QDMYHRLGYIVYRTVLNYYHGDGPKGPFKSDEDALDMRLALRRDKERRKSSVIPLDRP
                     IKPEELEWV"
     gene            complement(<13195..>14946)
                     /locus_tag="LMJF_25_0030"
                     /db_xref="GeneID:5652416"
     mRNA            complement(<13195..>14946)
                     /locus_tag="LMJF_25_0030"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683703.1"
                     /db_xref="GeneID:5652416"
     CDS             complement(13195..14946)
                     /locus_tag="LMJF_25_0030"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683755.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652416"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR019446"
                     /db_xref="UniProtKB/TrEMBL:Q4QA93"
                     /translation="MPQASRDEGTRTIGPAAHVLPDRLFILLVGEGNLSFAYALVKRL
                     SRSAVVRRATQNEGVAGERRRGIIVEVIATTFDSEAEVSRKYPEAVGFLAYFAAKRRV
                     RVGYYGDVNATSLSSAAAPLRDHPFHLLIFNNPHIGFEDLYRQIALLSHFFRSARELH
                     TRAPTEDFPQEIVVTLCNDQAQRWDLLGCAARSGYICVAAVPMRSADFPEYTNRRHQR
                     HAAFPFRIMVQYYFVAPQAALHGVLRDLSAEMTLWEQERQSRLHEGLPCSYTCVEWLR
                     VAKSYFAYSSQVADATTEVSGSAATNPCVLSGDDFSVNGSACSAQQPLPLLHPTLVAR
                     VVGAAAMAPFFSDPSEDHTEAFMPYLPSSTWIRLYRAQRVAERRCSCSVALAPSTAPP
                     LPPHLDSSILGRLLTSKEASKLQRYLTGYGAAMRAKAQQRRQAETQAACAWSCRECHP
                     ARTFETEDDLRQHQIAKHCGATPLAPTLYARVHEQVETASRRLEEALAGLDIEDGGDN
                     NYCEVCGLRFKSGDAYEEHLRYLSPLPGDDAADLVCHVCQPAKCFTDRRALEQHRATK
                     HAPAFSATREETTPANI"
     gene            complement(<15712..>19515)
                     /locus_tag="LMJF_25_0040"
                     /db_xref="GeneID:5652413"
     mRNA            complement(<15712..>19515)
                     /locus_tag="LMJF_25_0040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683704.1"
                     /db_xref="GeneID:5652413"
     CDS             complement(15712..19515)
                     /locus_tag="LMJF_25_0040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683756.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652413"
                     /db_xref="UniProtKB/TrEMBL:Q4QA92"
                     /translation="MEVSTSSPAAGRQALARVEAAVAAATLPLLMTPHRSSVEQREAF
                     LNQVYTDYAELQRQREEIDSRKRQMDFTMFESNRQDIYDVLFANVDAGDGALGDWDTW
                     ERVEAVVKRYAYGKPPHTAHEKKEMGAMQSRLDNLCQVLTEKTATVQSLTFNLDAVQK
                     ELAGVLKLLCLKESEIRKLNSQNSTAKLQLRHLERECAELRGFRSENKPSVLKKDFGF
                     LIEANKALEQENSQLRRRLNAQESAAGAALTHKAFLDEEAATPCQSPHEGDEAPSFGV
                     TNESLDQCMEDDSYRRKLLRDNIPLSGAIVDAKSEVELWKRRLEAEVSCAMEMLDRDA
                     QLAQHMACMPGGLGGMQEALLRENDVLVSYARYENIAETRPCLKTLSVAVAAALPSFA
                     SPSAAAQQRASTVALMDTTTAVPSRTTATSLQDVAPSPEHPLEPLQEQKKSLKSRSST
                     RASRHKKTASTAAATTAPAASHHLDPPAAASTSLSTKRDIARGPGGGHASAATASAPA
                     SSTSAAWMHLKSTVLQCAELSRANALRRELLHAQWFRQQLQGERERVASLVAAQLHSA
                     AQSAEATRRDDAPQSEQVQSVSPTAEHEPVSPALPIVSQERAEALSLGASSSISSAPV
                     RLRHLVQESRPSTRQGDMDGGEVDGCPMGSASDGSGEAGLSASPRRPLRSTSAALHAR
                     TSVTWRNPSAQPICTAHARNEPENTTVTLDVLQTSAPCAHAVAAAVSSFTQDGGQVAG
                     GTVTGGAGTGSKTAGARRRGVRAGGLALQADWLRQQVQQLALEAATFGKEVQEALGLL
                     SMLFAQQQLRVRHTPEAEVMYTMKATAQQALEEAAIARAVHLLEQHCGAKLHDLHAVT
                     PKSLPEKATDEEWLAHELRLAALEMLRETPQSHAMCGGDGREYSAGATSKAAGSTPSR
                     WPFFTGAKEDGAGRRAHQFFDEDILQLCPPSPRGTFGTANRWNTPVANGSGGHRGYVE
                     KTREGDDADGMGLRQHVVHEGRRTRGSALQPVPSPPLDWYWVARNFLGVELPGADHQE
                     ASQEPRMRVGGFRATAILPPTSAWWHAPPPDIESLRPTVLRYDFGAARRQAQERVSEH
                     VKQATAYICGSSFDDFVRQYIVPIISTATRVTSGSGMDAALRAAVRQLREKARQQCKR
                     DVRLLLTRVANNIRTRNLLRSRVVHGEGFVSYVGVLYNRWRNTLEQERRQVRAEQRAG
                     QASVLSLMHLQAPAGSSMANLRPPMRSSALAPDSGISGDGACLPHCPLQPSSYHFDRV
                     KFGNT"
     gene            complement(<20248..>20763)
                     /locus_tag="LMJF_25_0050"
                     /db_xref="GeneID:5652414"
     mRNA            complement(<20248..>20763)
                     /locus_tag="LMJF_25_0050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683705.1"
                     /db_xref="GeneID:5652414"
     CDS             complement(20248..20763)
                     /locus_tag="LMJF_25_0050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683757.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652414"
                     /db_xref="UniProtKB/TrEMBL:Q4QA91"
                     /translation="MELASNFSLLHAKLSKLGFRDWDSVSEGDVMTGNPHTYSLFLRF
                     LYHRFPAATAALIRKHDWFILEHSDGNVGAATVRLLAAETGEVHGFSGVQFGRCKYAS
                     AKVAMCHSLLRLLRSLTPQPSTERPPARVPIASRPPREACKLATALPAQPFAAALVDK
                     RRRALNSLQRS"
     gene            complement(<21387..>21845)
                     /locus_tag="LMJF_25_0060"
                     /db_xref="GeneID:5652410"
     mRNA            complement(<21387..>21845)
                     /locus_tag="LMJF_25_0060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683706.2"
                     /db_xref="GeneID:5652410"
     CDS             complement(21387..21845)
                     /locus_tag="LMJF_25_0060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683758.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652410"
                     /db_xref="GOA:Q4QA90"
                     /db_xref="InterPro:IPR007305"
                     /db_xref="InterPro:IPR011691"
                     /db_xref="UniProtKB/TrEMBL:Q4QA90"
                     /translation="MSAVEINEAATAPLNDNDQCFKDLTWTQRIQGFCVLMSLALFST
                     MMSWFALGMGAYWKYSMLSSLGSFLSMLSTVILMGPSAQLAYMFDEYRFNATVLYIAS
                     MFLTFLVAVTFKSVLLCFLCGVLQYSALVWYSLSYVPYGRETLVNIVLRR"
     gene            complement(<23732..>24625)
                     /locus_tag="LMJF_25_0070"
                     /db_xref="GeneID:5652411"
     mRNA            complement(<23732..>24625)
                     /locus_tag="LMJF_25_0070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683707.1"
                     /db_xref="GeneID:5652411"
     CDS             complement(23732..24625)
                     /locus_tag="LMJF_25_0070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683759.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652411"
                     /db_xref="UniProtKB/TrEMBL:Q4QA89"
                     /translation="MRRGGTVVFQRHRVSGGISRANEMSAFARLRGGQQKTETDWVPT
                     LLLSGETPPPIARPAETAAFFLASFDPFVFSYCMFDFPTILHHAGELSEHELLDYPGS
                     MLMSPRSLFLQPTAHLRFGSERQQRMAVVLQSLLDRHDESERSPVPCARALGVQCPLF
                     VPFLRGVCLCVETQHPFAPQAAYVFEELLASGFVSSTLYLDGTYVDRNRTLAQIVQLA
                     AREFGSESALFTGLLLDEEHASPPETIAVGRLVAQTLAAADRRRLDWALKTRGAVRQR
                     LVPQHGWTLGPSPSLLSTAQQ"
     gene            complement(<26287..>27921)
                     /gene="PABP3"
                     /locus_tag="LMJF_25_0080"
                     /db_xref="GeneID:5652412"
     mRNA            complement(<26287..>27921)
                     /gene="PABP3"
                     /locus_tag="LMJF_25_0080"
                     /product="poly(A)-binding protein 3"
                     /transcript_id="XM_001683708.1"
                     /db_xref="GeneID:5652412"
     CDS             complement(26287..27921)
                     /gene="PABP3"
                     /locus_tag="LMJF_25_0080"
                     /codon_start=1
                     /product="poly(A)-binding protein 3"
                     /protein_id="XP_001683760.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652412"
                     /db_xref="GOA:Q4QA88"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR002004"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4QA88"
                     /translation="MVAPAQRTSVYVGDLPIDLPRPEEAINNLFSTVAPVVSVKVCRD
                     MATQRSLGYGYVNFQTTADAEKVIDALNYTGIAPGRQIRVMFSIRDPLQRKSGMNNVF
                     VKKLDTAINAKELQAAFSKCGRVLSCKVALDSAGNSKGYGFVQFETADGTKAALEMNG
                     SKLGDSEVVVAPFVRRVDREAMAAKSFRNIYIKNITASATEADVKAIVEEFGKVDSLF
                     LSEHARFPTKFALVAFEEHQAAVQAIAALNESEESGLTEKAVKLVVCRALSKSERDRE
                     KKKAASLYQNHGRNLYIKHLPDDITDDRLREIFEPFGKITSCAIMKEPNGTLKGFAFV
                     CFEDKQHASAALRSLNGHPLEHSAKPLYVSHAEQKDMRIRLLQQRRAAMRHQSRMAPL
                     MNTFPQQWPRHPFPHMVPPMMPPPPPPNMGMPQFMSGPMIRRPVMEPHLMQGEPMRPP
                     NRYTQAREQYPPQQRQDGVDMNYLSTLSPEQQKNYLGELLYSRILPLESSNAAKITGM
                     LLEMSREEIFEILADHFALLSKIQEANAVLQQHTGN"
     gene            complement(<30307..>30669)
                     /locus_tag="LMJF_25_0090"
                     /db_xref="GeneID:5652417"
     mRNA            complement(<30307..>30669)
                     /locus_tag="LMJF_25_0090"
                     /product="putative Qc-SNARE protein"
                     /transcript_id="XM_001683709.1"
                     /db_xref="GeneID:5652417"
     CDS             complement(30307..30669)
                     /locus_tag="LMJF_25_0090"
                     /codon_start=1
                     /product="putative Qc-SNARE protein"
                     /protein_id="XP_001683761.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652417"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="UniProtKB/TrEMBL:Q4QA87"
                     /translation="MQSSLYGNSKAAKVSTNPTNRYEHMEEEIHRENESMLRALGSSV
                     AHMKAMAGHLNREAEEQNELLKSLDKVFQTARGGVNSAVSSVKSVMGRYGWKHTAAFG
                     CMGFFLLYFIYVVFLKRV"
     gene            complement(<33608..>33823)
                     /locus_tag="LMJF_25_0100"
                     /db_xref="GeneID:5652418"
     mRNA            complement(<33608..>33823)
                     /locus_tag="LMJF_25_0100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683710.1"
                     /db_xref="GeneID:5652418"
     CDS             complement(33608..33823)
                     /locus_tag="LMJF_25_0100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683762.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652418"
                     /db_xref="UniProtKB/TrEMBL:Q4QA86"
                     /translation="MPTSAVARMRARSRQSQQRLTEDEKLRRREERENKKSAVPQWLV
                     WSMIVIVVGSSLVNIYFSVAQSPKMKD"
     gene            complement(<34486..>35910)
                     /locus_tag="LMJF_25_0110"
                     /db_xref="GeneID:5652419"
     mRNA            complement(<34486..>35910)
                     /locus_tag="LMJF_25_0110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683711.1"
                     /db_xref="GeneID:5652419"
     CDS             complement(34486..35910)
                     /locus_tag="LMJF_25_0110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683763.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652419"
                     /db_xref="UniProtKB/TrEMBL:Q4QA85"
                     /translation="MRRTYYVAKISPVPVKDVAYASSKAYHPRYAVPRQMTLSSSFNT
                     VTDKNRFTSLDLLLQKLSGYVGRRQYKMASDLTQHLEKFKKLGIDWHELKFLQRDELV
                     ELLSGPIRLNHAERAVLLVALDAKVCGVLCRDTTRHSTKLCMNPGLAEHGWRCGQDGH
                     TNDVYFEGKVQANPAVLQLAHRSAARVARRDGVDVEVRHEPDFSIVGRNSAQLNPRIW
                     NAPEHNTFVVTPIGFEFRVHPDDPRALHQIEEAAAEWELHLEVVQQVIAEVLELYAVE
                     RGEQPLHLVPGEIGEPDVPEVYSSGFHARRSSSSQTKADDTIIEHRMMTASGAEKPWF
                     QTPLPQRFKRGVPELLPLAPTIILHSAFRSIERDMSSADVNCRLMQPVVDVSCLVHPN
                     ACFWWNAEEEERSTRLILDYAKRMPFALPFNLYFRVDSAKVLRAKPAMVEERDSLLRA
                     KLPLFDLRQFRSVARTAAADSDNP"
     gene            complement(<38650..>39426)
                     /locus_tag="LMJF_25_0120"
                     /db_xref="GeneID:5652420"
     mRNA            complement(<38650..>39426)
                     /locus_tag="LMJF_25_0120"
                     /product="putative electron transfer flavoprotein"
                     /transcript_id="XM_001683712.1"
                     /db_xref="GeneID:5652420"
     CDS             complement(38650..39426)
                     /locus_tag="LMJF_25_0120"
                     /codon_start=1
                     /product="putative electron transfer flavoprotein"
                     /protein_id="XP_001683764.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652420"
                     /db_xref="GOA:Q4QA84"
                     /db_xref="InterPro:IPR012255"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR014730"
                     /db_xref="UniProtKB/TrEMBL:Q4QA84"
                     /translation="MFRTIPNYLKVAVCVKRVVDYTVKVRVKDNKVQTANSKMSVNPF
                     DEIAIEEAIQLKEKKIADEVVAITIGGKKAEEVLRTAMALGCDKAVHVVIPDTAVDSV
                     EPLAVAQILQKLHEEIMPDIWVLGKQAVDGDFGCTAQLLAGLLDVPQGTFASKVEVKD
                     KKVTVTREVDAGRQVVELSMPCVLAADLRLNTPRFPKLPNIMKARKKPIDTKDVKALG
                     VDITPRLSTETVTEPAARKAGVKVKTVDEFYDKLLAAKVL"
     gene            complement(<40832..>42736)
                     /locus_tag="LMJF_25_0130"
                     /db_xref="GeneID:5652421"
     mRNA            complement(<40832..>42736)
                     /locus_tag="LMJF_25_0130"
                     /product="putative elongation factor"
                     /transcript_id="XM_001683713.1"
                     /db_xref="GeneID:5652421"
     CDS             complement(40832..42736)
                     /locus_tag="LMJF_25_0130"
                     /codon_start=1
                     /product="putative elongation factor"
                     /protein_id="XP_001683765.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652421"
                     /db_xref="GOA:Q4QA83"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006298"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QA83"
                     /translation="MRRFFASSLCVSAALARWMHTRDDVRNIAVIAHVDHGKTTLVDS
                     MLSQSGTVANAHNRVMDSKDQERERGITILAKNTAILLDNGKRRINIVDTPGHLDFSG
                     EVERALQMVEGIILLVDAKEGVRPGTRYVLRKALSLHLRPIVCLNKIDKDDLNIAKTE
                     QAVEDLFLEAAEDENQLDMKFLYGSGRSGYMNEDPKKEGTLTPLFDTIFSTVPAPKTD
                     DDQALQMLVAQVDEDEKNNTKLAIGRIYNGTVQTGDVVTVALEDKQTDALVKSIHLYC
                     GVQKMPVTSASYGDICILELQEPIGIKVPLKIGGTIGKQGAVKLFPYKKPDDPTYSLV
                     LQESEASWKGKEAAESMGNITAIQRRLDREAMVNTALQLKSLNAKQITMYGRGPLHLS
                     VIIEDMRREGYEFEIQAPRVLTRVIDGVECEPFERLLLEFKDNLVSAVVSFLSSKMGE
                     IGEIEPLSNGRVLMECVMPVRLMSNVPLKFHTLTGGDGVMNHHFDSYRPMAAIETERD
                     TGALISVDNGEVTDWSLSGFSTQGRFFVLPGDQVHYGQIVGENQKTALQNLGVNVCKR
                     NEQLGGMRANANDKANSKRGAYSAARYNFEDCVAWVTDDELVTVTPKSIRMRKPGFNG
                     KTSMRSLRKK"
     gene            complement(<43719..>44108)
                     /locus_tag="LMJF_25_0140"
                     /db_xref="GeneID:5652422"
     mRNA            complement(<43719..>44108)
                     /locus_tag="LMJF_25_0140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683714.1"
                     /db_xref="GeneID:5652422"
     CDS             complement(43719..44108)
                     /locus_tag="LMJF_25_0140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683766.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652422"
                     /db_xref="GOA:Q4QA82"
                     /db_xref="InterPro:IPR006110"
                     /db_xref="InterPro:IPR006111"
                     /db_xref="InterPro:IPR012293"
                     /db_xref="InterPro:IPR020708"
                     /db_xref="UniProtKB/TrEMBL:Q4QA82"
                     /translation="MLRSEVLDAEVAKSVEAYSTAVTPFVERRSGLYLTKFEVARIIG
                     ERAKQIASGAAMSLPGTGSGLDSVETAERCTNPRSLAVDPVMMAKYDLLQRKIRMLVR
                     RVWPDGAVETIPVNELMVDVTMLDLQY"
     gene            complement(<44885..>47026)
                     /locus_tag="LMJF_25_0150"
                     /db_xref="GeneID:5652423"
     mRNA            complement(<44885..>47026)
                     /locus_tag="LMJF_25_0150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683715.1"
                     /db_xref="GeneID:5652423"
     CDS             complement(44885..47026)
                     /locus_tag="LMJF_25_0150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683767.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652423"
                     /db_xref="UniProtKB/TrEMBL:Q4QA81"
                     /translation="MDSADAATTAAWAFAAAPAEGVPALELLVHEYAWLSALPFDDLL
                     THSGSHQGRLTGARELMSSLLSVSMPCPSPAQGSLYVVLASRVYVALYLDTVERKRRL
                     LHSERSDTFACVDEGFFLARVHATMQAWTRDLVPFLVHSVLPCLHLRDAEPTTVRASN
                     PLDRSPTAPGLASDDDTESKPAEQQRDLLEALHVYRVREELVRLVVALHSTTGDEDDA
                     VGALLLAAYATLCSTEVCPSLALPRPPLRGSTTATLQQWRARFLQEMSPTAPSNVAAG
                     RQAPSETEVDGDLGASFTQCLARLRGVAGEVHCYPSGDSLSFALAAVQASGLSGRHRG
                     TLHLADVERGTAPPDSTAASLAVEHDREVEASTLVALDAVDAHSGEAAAGSPEECFSS
                     PLCRQGALLLLSDMLRHQLTAAAQPSFAYSVSASSLLLGVADVYIVALRCARSAAALL
                     RHFLFLHDLLSAVPKYTLCCAEEAQLRELQAGGQGGLDSCHTRRYEALFAVARELLTI
                     SALCPVDEHRRMARTVALELLERLEERTRVRMHGSLIALCPYPSIARFFLEELLREWR
                     AAQSEGNHLTEGQASPVHSLMPLVIRECVQAFLTQVSMGTSGFVDPLVVALNFVRVEV
                     SQQTWIRSSCTPAAMSAADDNDASVRCAWCQLLRALREQLLPRCHTLMTNASTASEEH
                     QTKSFAVEVSLTPLDLFSLSCAVEGLEEVLA"
     gene            complement(<47823..>48470)
                     /locus_tag="LMJF_25_0160"
                     /db_xref="GeneID:5652424"
     mRNA            complement(<47823..>48470)
                     /locus_tag="LMJF_25_0160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683716.1"
                     /db_xref="GeneID:5652424"
     CDS             complement(47823..48470)
                     /locus_tag="LMJF_25_0160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683768.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652424"
                     /db_xref="UniProtKB/TrEMBL:Q4QA80"
                     /translation="MADAADTLLLSLEVEAAAARNAELSQTIEMLQDEVLRLRRANAS
                     LLACDARHCPKVSLQPVETPSATADVSRDESSAAADAREVFVILDDLLFEMADIRSRI
                     ILDERVDLTPRAFDSEATVAAHARRCLEEARKLKEAFVVKQHSTAAQVSELRRALGEQ
                     AEANQKQTAASALQCAMLERKYDELKRRYDEAVSRQDELVLDGVIQSPSQMLPRS"
     gene            complement(<49750..>52236)
                     /locus_tag="LMJF_25_0170"
                     /db_xref="GeneID:5652425"
     mRNA            complement(<49750..>52236)
                     /locus_tag="LMJF_25_0170"
                     /product="putative cleavage and polyadenylation
                     specificity factor"
                     /transcript_id="XM_001683717.1"
                     /db_xref="GeneID:5652425"
     CDS             complement(49750..52236)
                     /locus_tag="LMJF_25_0170"
                     /codon_start=1
                     /product="putative cleavage and polyadenylation
                     specificity factor"
                     /protein_id="XP_001683769.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652425"
                     /db_xref="GOA:Q4QA79"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR022712"
                     /db_xref="InterPro:IPR025069"
                     /db_xref="InterPro:IPR027075"
                     /db_xref="UniProtKB/TrEMBL:Q4QA79"
                     /translation="MLRASAGSIQFTPVYECTTPNAPYAYLVDIDGVRILFDCGWNDE
                     FDTSFLNKLKPHLPTVHAVVLSSPHITACGALPFVLSHISPGTFVAAAGGTSKIGVHS
                     VLHSFLYQYPNSHTFTLADGEAFTMTVDSIYHSFRSLREPYGGKVTVKNDDVEVNCFA
                     VFAGRMLGGYSWTIKYQIDELFYCPDFSVKPSYALKPFDVPTTANIVLASSFPFHMTG
                     ANRTTKYEEQLKSLFKEFQHTLRGGSDVLVPVNVAGRGLEVLNIIVHLLAEQGGDKYK
                     VVLVAAQAQELLDKAGTMTEALQDYLILDDKRLFASVLTCRSAEEVLPIQGPKICVAD
                     GASLDFGPSAELLEYFVKGNRDGADHLIVLTEPPLPGTNAAVVTAAADGERLHMQITR
                     RSRLSGEELEEYYIELEHEMEQRRRELEAQSAFQIVQDDDEAATAKGEENDDDEDDGE
                     WAAAAAAGHGGATEKAAAGVGATDAGAAGAGGAAGAASKAKAATTLGLVLPPPLHYHS
                     KHLSFPVLETTSTLSAAALKRVDVTYGLPVSEEEQVVLQKRAPARQHSDAGPEALQVE
                     NDAQRLANIPSKVSRVAVQVNRRCRVVLSDLSGYPDALTMKSVLKTKWTFAKKIVGLR
                     GSAEDGRAFLHFCRADKAMKCGSNVFSITSSGVPLELATHVYSYAVQLESSLARSLSR
                     GLRRVRETKSKSTWEVGWVNGELSGVRAEADLEEPEMQRRRSDRAIYSLASVTADKSQ
                     ACATQREQRGLQSGSFFVGDMDLRRLRETSRQESGLYSEFHKKAPLLVFDEGVCVRKG
                     ADGTVTISSIATPALFDLRRTVYRQYSQAL"
     gene            complement(<53232..>56381)
                     /locus_tag="LMJF_25_0180"
                     /db_xref="GeneID:5652426"
     mRNA            complement(<53232..>56381)
                     /locus_tag="LMJF_25_0180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683718.1"
                     /db_xref="GeneID:5652426"
     CDS             complement(53232..56381)
                     /locus_tag="LMJF_25_0180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683770.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652426"
                     /db_xref="UniProtKB/TrEMBL:Q4QA78"
                     /translation="MALSHAMITGPRLYRPSCAALRQSVCTVPQSRRCSTLGQIQSVF
                     KALRQAKGVRGGAVRLCITEDMRVVVEHQPSSEGGAQEVVHEVAAWQGTFSTTVQEAV
                     GHLSHSDELRTSTSPLQSSPTPPVSRDGFTIVDLTRVNTDETRRVMKFLEQRYPQLRL
                     LVRHTSGQDLQGTQLHTASVELVPRSTGVQAAPLAAEQQRLTELFKGEAAGEGYHGCV
                     RRALRDAFSAADLPYPSSSVVSTAALSVLSLYTKAWSSDGFSLCLVPHVTPGHVECSL
                     RHGATGKSLASTAVALTSDGLRALLKFCDDTTSEYYPHCHASIQQRLRSAPLHLVLPR
                     SHLRVKHLLRKLLLYYYGIGEEKVVFQAETVSGSMHKVQVQVCLDLPTVAALSGDTPG
                     FFVLGKATGRSKSFTAELVTVQALQTVFPDVFEREIAYHPEVRAILESSKATASDDAA
                     PHPGQGLEHQLRWALQRHKATFVLETLMLKANSLHPEWGVATGATPVWLSQLYIVRGH
                     ADAKAADRSDAGVAVTRELCCFAFDGRKARSEQKAMAAALAQRFPNLCHGSVEQARDK
                     MLIDADGAPAPCAGVKALQDANVKILTAALSSDPFIRFLDPHKSTQPQPLPPVQTADS
                     ALERYWCATKAYTSFLGSIRVVREADRAVYVARCMRVSAVHDSPERVIAEAAGSTEIG
                     ALFALVRDMQKLPEVVCRDLSSTAASEPCLMAELPSTLPDASPLQSCAEAIARLYGLQ
                     CSVCVRQDGATCAAELWGATPPNSAVSLPHSRFSTNPFSADRSFHLGRGYANTPRLAV
                     VRAAQQVFEMHIRVHHRAFGDEVVMRGQVRLQPDAQGSLTRLRDAVVTEIMSASDRTV
                     SDNWLLFNFEHDQLSDLSFHVTSQERSVMLEHVVGKNLLSCARELATRISHETNDTFL
                     LPAHLSDVVAQTAEQLLGKLCLQAYGLRLRVDTCQRGQMWHCRMSVPMSDEVAHCIAQ
                     ASGLRKRDTVEAAAVAALREYFVEELPHLHSFATLPAVTALQRPDGISGEAAAKSSCE
                     AYAFRVQEGACAPEPECHS"
     gene            complement(<58187..>58888)
                     /locus_tag="LMJF_25_0190"
                     /db_xref="GeneID:5652427"
     mRNA            complement(<58187..>58888)
                     /locus_tag="LMJF_25_0190"
                     /product="putative ubiquitin carboxyl-terminal hydrolase"
                     /transcript_id="XM_001683719.1"
                     /db_xref="GeneID:5652427"
     CDS             complement(58187..58888)
                     /locus_tag="LMJF_25_0190"
                     /EC_number="3.4.19.12"
                     /codon_start=1
                     /product="putative ubiquitin carboxyl-terminal hydrolase"
                     /protein_id="XP_001683771.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652427"
                     /db_xref="GOA:Q4QA77"
                     /db_xref="InterPro:IPR001578"
                     /db_xref="UniProtKB/TrEMBL:Q4QA77"
                     /translation="MWFPLESNPQVMNRYISTLGLTEAKVEFVDVYGVSGDLLEMVPS
                     PVHALLLVYPICEATERRLAEQQAAQTEEVAALRQAHPFFFTHQLVPNACGTIAIAHA
                     LMNNRDKLGEIAAGSILDGPWVNAAKTSEDPKIIGKLIAEDTSLASAHAAAAQEGATA
                     NQHIDADINLHFVCFIPVGGRCVELDGRKENPTLHGSCTDNKSFLTAAAAAIQERIEL
                     NPSSYEFGITALVNK"
     gene            complement(<60086..>64216)
                     /locus_tag="LMJF_25_0200"
                     /db_xref="GeneID:5652428"
     mRNA            complement(<60086..>64216)
                     /locus_tag="LMJF_25_0200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683720.1"
                     /db_xref="GeneID:5652428"
     CDS             complement(60086..64216)
                     /locus_tag="LMJF_25_0200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683772.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652428"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4QA76"
                     /translation="MGLTQQFVISSADVGRGHVVQALHPSAPLIAVTGSKGRVLILNK
                     LGKVEHQFPMPGVVDMAWECGSDTLAIITKNSSDVHLFTHHTRHTDTIDTKMSDLRFI
                     CWSHSQPQFAIGAKSGQFVVYNRRTLRLVPVVGTHTQQLLSGVWTPAPDSRLLIISAD
                     RSFSISDAEGKMLKTIPLPSAPQSVCVSGAASSPKRLSLAAVNLGNAVLVVDLRSFST
                     SAGQFNTGLGLITSLTAGINGEFVAGFKSGAVGLLDLAGSEVRLRSSVSVAKSAVHMV
                     NFGEGSGLVAAVAENRVCLLRINDDGIAATGDEAAFESDKGVPDLLAWSRDGQQLLLG
                     TDQGNVTVFTLKVLNVSASFGTLVFSFISTRIIGVKNLQDNRMVCTVPVNSDPTFVSA
                     GMAMLGVGANNQVSYYEYFIPNSLPYPMADPAKNVAEASQQAHSGFLRTVEYPSAVTD
                     LKVNSQLAAVVYDGRVQLSPIRDTPQAAAPVYFPQSGDTRLVSIGLSEAFFLYATTNR
                     VSVYALHNLQQVATFTCSTGLKRAFPNPACTRVAYVDESNSLFNLNLVTEVANKAEGF
                     EPDQKTVLWDQAEATVFITHDSQKCVTFVNTPHSRHGATCESVLVKDSTNANLYTPLP
                     PNYTPITLFRGTVVCQTPNGTLDTVPLQTHTNIFLRTPNAEAFYNNFSLNRLRWSSNN
                     ISTPQEAEDLAVKALHMLDVELAIRVYRQLSQPSLVLCLEKIRHIHEKNLLLGHVSMI
                     MGYMKDAQNFFLRSSQPLCALEMRRDMMQWERALTLAAQLAPEEVPVISREYAQQLEY
                     RGVYAKALEMFQQGHRQLPTGQASTELAVTMQEVERHNEQCRQGAARCQIRTGNIADA
                     MKMAKESTEMSFVKECAKLCEDNQKHEEAAQLYEKAGDLEWAATIYIERCKNLKAAGR
                     LMPLIKSRNIIGIYAQGKEAEGAFAEAEKAYLQAEDWDNAVRLRLEKLNDLHGAYIIV
                     RKTRSANAAALVAKKCKSQNEYGMAVEFLVLAKSLDEAFELAKAHDCMFHFESALLSQ
                     VQLKDGVAPLANQADFNMIAEYYDNEGKAGQAGMYYHTSGNYAKALKKYLESGQPEDI
                     EKAVEVVGKAHSDSLTNKFIDYLMGETDGEPKDPSYIFKLYLAMGSYEKAAKTSVIIA
                     AKEQEMGNYKSAHKTLVEAYSILQQKNMRVPNDLRRALMLLHSYIIVKDLLKIMKNED
                     TACRMLLRVSRNIQKFPKHIATIVTTTVLQCIKSNFKKSAFEYACFLIQNEKYRTEMT
                     EKSRKKVEGIVRRHSKDDAVDPVEPMLPCPYCDAPVAETELDCGACKNTIPFCIVTGK
                     HIVKNDYTATPCCGFPATFSALMTRLSETLTCPICGATIDISKVNRETEPELKALL"
     gene            complement(<66499..>67410)
                     /locus_tag="LMJF_25_0210"
                     /db_xref="GeneID:5652429"
     mRNA            complement(<66499..>67410)
                     /locus_tag="LMJF_25_0210"
                     /product="putative mitochondrial carrier protein"
                     /transcript_id="XM_001683721.1"
                     /db_xref="GeneID:5652429"
     CDS             complement(66499..67410)
                     /locus_tag="LMJF_25_0210"
                     /codon_start=1
                     /product="putative mitochondrial carrier protein"
                     /protein_id="XP_001683773.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652429"
                     /db_xref="GOA:Q4QA75"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q4QA75"
                     /translation="MNTDDAREMLAGSLGGASATVVEYPMDTIKVRLQDDGKRYGGVL
                     QCIRAIAKEEGVVNGFFRGLPAPVIGAACENAILFVSYRSAIEGFQKVTYGYCGPSNQ
                     EPYLAVSVAGATGGIVVSQVLTPAELIKCKMQIQNTLPVDERIYKNSLDCAAATYRRR
                     GIRGLFRGHMAMMVREAVGCGLYFLVFQSVIRPFLSEGQRFHEAPAWVHFLGGGCAGV
                     AFWTSTYPVDAVKTKQQTMKADYLKLNFRQACTRLYKTEGMRGLFRGYSVTAVRAFPG
                     NAILIAVYERVNALWEYSTKATHKKMV"
     gene            complement(<69662..>71803)
                     /locus_tag="LMJF_25_0220"
                     /db_xref="GeneID:5652430"
     mRNA            complement(<69662..>71803)
                     /locus_tag="LMJF_25_0220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683722.1"
                     /db_xref="GeneID:5652430"
     CDS             complement(69662..71803)
                     /locus_tag="LMJF_25_0220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683774.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652430"
                     /db_xref="UniProtKB/TrEMBL:Q4QA74"
                     /translation="MSLSGACDAIAGISDTTTHAQVTAIARQCEAHLGNVNELLDALE
                     NTLSTSAGAQRLMLWFLVDRLAKQHTLFGDALRPMLIHLCTHYAPAPTSDEWQDFVTL
                     LKSSLSITFGQTMVSLILLQLGEDARASGPAKDGNKQHAQHKQRGSTALTVHSKALRT
                     TGAFTTKAIAVERTAEHKHSLQVKTMDSQMAMSVSSSYAPSRPVEIVVPEMRPDANAP
                     RGFMQALPEGYMENYQEARRKRLREMMERSREEQDRKQERDMLKRVRQDTASAAAGTH
                     SGTSIFGSSAEGADVPYPDFSDIQMPLEFPRDEHGVKRGNFPLGVRFIRDAVAACGGA
                     VELDVLVGRIATLANREAVAEFGNVREFLLIHSPTFRLVHEGGQWIVRLTNDKNADEA
                     TWKSLQCPACSKVVRGRNFARHYNCRQCITAQIALGLQDDAEGRGPIAELAHAAKRVL
                     SLREACDDGDLDALADCLARAAAVKRFRLGSTRQFAPIMKAMRVVRDCWLAKKGVEEV
                     ADAVVTAADVSLGNVFRIFGENIHRLPIAWIEMGDVIDMCHRFTEKVAHPFNPPPRPA
                     DPRISLQNEYPGFLLCESEVDDEDLPSDNEDEFSDDEAPAFTFAPPVDVAESLFTAGF
                     ERDTKRLQHRMRTAPPMVLQRVLQTDGTQTQTEMYAEFTKTTRTHSGHHQGHGGGNGN
                     SSRNRHGHGGGPGRSGGGGYQGRDFPRPRVN"
     gene            complement(<73269..>74255)
                     /locus_tag="LMJF_25_0230"
                     /db_xref="GeneID:5652431"
     mRNA            complement(<73269..>74255)
                     /locus_tag="LMJF_25_0230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683723.1"
                     /db_xref="GeneID:5652431"
     CDS             complement(73269..74255)
                     /locus_tag="LMJF_25_0230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683775.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652431"
                     /db_xref="GOA:Q4QA73"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR020422"
                     /db_xref="InterPro:IPR024950"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q4QA73"
                     /translation="MQSAVGGSHPFTQEEESRLGLLQQRADGGGSLTEAESLELSQLK
                     RRHHTFIEEGKQLLRAGTRAQANGGGTTTLEEGEWSTSATLSRAGKAAYFWGSLMATA
                     LPGYVGRVTGVTTDFLHWNWITDNVVLGAIPVVTQVGSSGDHLSQLRAQLDERNQTLG
                     LVIACLEEEELNGFGMNVIQFAKEAEWRKLVNSQVEYMHVPMTDTTANASLAAVGEAV
                     MRMEACIKQRKQTVYVHCKAGKGRSWMVTMCYLTTFGGMSFAEAVEFIRQKRVQVNPS
                     PSQRRFAEEFPFRFAQLRSLLDINKADGHHHNGGAHHHHPHETCHHGTTAAP"
     gene            complement(<75043..>75603)
                     /locus_tag="LMJF_25_0240"
                     /db_xref="GeneID:5652432"
     mRNA            complement(<75043..>75603)
                     /locus_tag="LMJF_25_0240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683724.1"
                     /db_xref="GeneID:5652432"
     CDS             complement(75043..75603)
                     /locus_tag="LMJF_25_0240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683776.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652432"
                     /db_xref="InterPro:IPR018609"
                     /db_xref="UniProtKB/TrEMBL:Q4QA72"
                     /translation="MSGAPAKRRRLDSEDDEDEYVAVRLSSPLLQHATSTRFPTDEVP
                     TLEDGEGASDVAERLASSRAPAPATYVEADDPADVARSTAAVPAAEHLNAADAPKPHL
                     FFEEDGDVPAEYEGLLSAELLNVLFVPLDYICKQRSCTDQLLSQYAPTAAASHSAAER
                     KSYHNTYGIAPGFRWDGVVRGRGPVD"
     gene            complement(<76265..>78898)
                     /locus_tag="LMJF_25_0250"
                     /db_xref="GeneID:5652433"
     mRNA            complement(<76265..>78898)
                     /locus_tag="LMJF_25_0250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683725.1"
                     /db_xref="GeneID:5652433"
     CDS             complement(76265..78898)
                     /locus_tag="LMJF_25_0250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683777.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652433"
                     /db_xref="UniProtKB/TrEMBL:Q4QA71"
                     /translation="MLVCVREFDKSELSARHGKSLTTHHFERYYTLYRTETSFTIVDV
                     VDNRARKTVNYDVFTNSSTQLYDQVVEPLLATVLTPNRASQAVVVVDGQSGNRRHTLL
                     DPVEGILARTARAAVAHPGVTSVSVSAVTLEDNNTLTDIMPDRNSDAAREQPTILEDT
                     CEQFTSVEDAHYLVLDSEVTWEGVLHRMTAAFAELKHQVISFIFAFHESTGLPNTTMQ
                     FVSFTVNEVARGLKSSRHAVSSAAALVECRSPTLTFTATKLLYLLKPTLLGQQPGAWV
                     ASFSPVSLLEAAEHETFQEAFAVAQTAARLYSSRIALLNGSLPPANGGRVAPTAGVGL
                     DMERAGESAPLPAVEDGGADMTGAASRLRPGEKSPPSFRTWSRGTSTNPQPGDPGRSP
                     AFQHDLVDTPAAAQDRATESVSGHAVASAAAPSSDDSRDVGENCAAQTDPDVYAAPAP
                     VESIQRGASEERSAARYELDTYRVVMERAMSKLRAEMREYAGALRDTRKDVRWQQKKS
                     RELESELEAMRSSYDAAVSENNRLREALRAGNIASDSAQLAALQSGASASAAQRSRQE
                     PAAKQAPANQPGDDHAARFWRSDLAILEARVEELTELVAFHQREIQAHVANEHRYRQR
                     ILDLEAELREKERDAIADKAAVKEARRAADVARAAAETPPALSRAVHTSSSTEQEDRR
                     FVEERATEVEYRLREALDALQRERTQRLRLEHLMKRREEEEVLHAAPPGDNDLLRSMQ
                     CTYEMQLRELRSDMSDLRAELLRHLTKPSVPQNLGDASSYGATPVGRQGRDDPAVVNP
                     QRPTPPRMSPIPDASLTHFSHAGDDVSAHSSRGGDAAPSPLQQPRQRSAQSFEQFMQE
                     EPRYKLHCASFLRRRPRTPAT"
     gene            complement(<79760..>80029)
                     /locus_tag="LMJF_25_0260"
                     /db_xref="GeneID:5652434"
     mRNA            complement(<79760..>80029)
                     /locus_tag="LMJF_25_0260"
                     /product="putative Dynein light chain 1, cytoplasmic"
                     /transcript_id="XM_001683726.1"
                     /db_xref="GeneID:5652434"
     CDS             complement(79760..80029)
                     /locus_tag="LMJF_25_0260"
                     /codon_start=1
                     /product="putative Dynein light chain 1, cytoplasmic"
                     /protein_id="XP_001683778.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652434"
                     /db_xref="GOA:Q4QA70"
                     /db_xref="InterPro:IPR001372"
                     /db_xref="UniProtKB/TrEMBL:Q4QA70"
                     /translation="MSERKPDVKLADISPEMQTDALDIATKAIKEHHLEKDMAAHIKR
                     EFDKRYFPTWHCIVGRNFGADVEHEAKNFIYLYVGQVSVLLWKTA"
     gene            complement(<81070..>84540)
                     /locus_tag="LMJF_25_0270"
                     /db_xref="GeneID:5652435"
     mRNA            complement(<81070..>84540)
                     /locus_tag="LMJF_25_0270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683727.1"
                     /db_xref="GeneID:5652435"
     CDS             complement(81070..84540)
                     /locus_tag="LMJF_25_0270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683779.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652435"
                     /db_xref="UniProtKB/TrEMBL:Q4QA69"
                     /translation="MIRPQGEHAVSGDSAAAQGRFKRQREREAEAKRQEQRTEDVLAH
                     TTHIVDTIASINGKYVLSLNGERARLAHQVTELQKRLTKHQLQHAEDTTQRVLSDLAR
                     LRGAVTSGVKDQLIESLLVEAERGRGYAFDAVCAHVDEALHGSLAVAEAELSSERQLN
                     RTLVQQLKSYAQTMLREVTVATSRAFKAEVEVMQRDVLVAKLRAACTFAENRLVRHEQ
                     EVDALMRVVAQLAEKSRYAESARADVRRAKHHVRLLEQHLGLNEIVAAVRAEVARASS
                     AAYAEMQRGSAPPAPPDPSLRSSAPHYYALKMLEHKEMTLTDLVDSWQQQESRIMEAE
                     QRYTCLEGVVKRVQHDALVVHQRYLEEKQRREIADRRITDMVRERLHPQNDPAISQEV
                     QRLRWAYTEVVDDAAQLAVNLKVCRDELRRAQEDAACLSAQVLQLQRDAEMDQVALAI
                     QELRSEYTARVRVLEEASTRAEMQLRLAQSVSTQYGAAATEATAALQRAAQANAELSK
                     AALQVVPDDRGSVARSNAAWREDVERIEKQSENVLAMIKLMAGFESSQGNLYDAQVKE
                     LMRQWTLAREAEKEAMASSAAADGLHSAGGLMAVSREAVDDGTESCTLVSSSIAAEES
                     MDKMNAVLGASQFALREALVLLNTSLQSTDVERSHLVDASLSDAQCVSELMAEVRRVT
                     AERDRLRAQVKVCQELLEKNHVTVVERALMHDVPVEDSLNVAEATERIEVLKNQLAAA
                     KQVCERSLNEVKQVTAEKDDVELRLTQLKREHEVLQGHSSRLKDKLHRSLARESELME
                     KNMALQTQLTDLVQPPGAPAQEAEASSTALQTTATHLTELFSSLQESLGTLNAEIIAL
                     RRVRVDDASIDADVGSGGNTGAGAEDTEDTLLVDSLSRSGMMNIVRVLKDTLHKAGLL
                     KASLRGFAGAQAIGLCAAAKVCESGAEGSGGAAAASIVPHPSPETQQRALEYRSSLLE
                     AKLASMAAERLDMRERVQKAEKTTADMEAANQRLLTISKSMMEKHSMLKTENEQLRVQ
                     LLQLTATTNAASAPRPEPHAASSAPDMHAAEAPVSSQHVVLSATPAPTSSTSATQPSA
                     PVARDGLPAANACMAESPAPSAQEQGEEEEEAERAPESAAANMAIVLPSAPMDEALVP
                     ETGSLTGSQT"
     gene            complement(<85863..>87938)
                     /locus_tag="LMJF_25_0280"
                     /db_xref="GeneID:5652436"
     mRNA            complement(<85863..>87938)
                     /locus_tag="LMJF_25_0280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683728.1"
                     /db_xref="GeneID:5652436"
     CDS             complement(85863..87938)
                     /locus_tag="LMJF_25_0280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683780.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652436"
                     /db_xref="UniProtKB/TrEMBL:Q4QA68"
                     /translation="MSGNWSFSSASTPPPRRRHSPSSMIAASRVDALFEPPVRAAFID
                     DAVLCDAGECDVEDVTMMSRETWAKNNSGYLHQCRSCQDTRRLRNSLKRIEAQYVAEI
                     ESLRLQLQEAVAQRTAAVRERNELLTSTDMSVARILQMEQDTQSLRMELVQVSQEKEQ
                     LRRRVQELGKQSVAASERHAQLARVVVEDAEAAGRDHVESAEKGEALLFVQLRAAEWA
                     RVAEIAHRMPDETRGHGAVAAAGGAVGARCVSPRGSVSGGFSPESVSAVSSEETPHRR
                     TCSPRPSQRRSLTVPVDTHCLSLCAYSSPGRSGGENAAATSRRPRGSATAVAGATAAA
                     GDDSARKRIQQLESDLERQQRFHEMQLAEERALTTEMQAEMDDLIENELVLLEANGRV
                     ALERDWAEAAIDVVRCLLERLGAALCSGLVTFAEAFKVDTTLPRATSLTCPGASDGGS
                     CAAPVSPTTKQTSRRPGRLGGEPIECEELMAGALSAMDEAKRGVHDLRDDIARCHAAV
                     GNTGTQQERMEALLCRVLAEVAGQRRKADEAHTMLRRFARISTHNDNALFRAVRRVEE
                     TLKTPTPAAALVQDGEAGRETSGANRTAVVDPSPPLRTEVLPRRTAMDVARSTTTTGH
                     SAADVSHDLRQLPSRSRFVAADDDLFDPSHVQVDSNVAAQKMAALLLEDPLSDPSDGD
                     VPQTPYDDF"
     gene            complement(<91488..>93242)
                     /locus_tag="LMJF_25_0290"
                     /db_xref="GeneID:5652437"
     mRNA            complement(<91488..>93242)
                     /locus_tag="LMJF_25_0290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683729.1"
                     /db_xref="GeneID:5652437"
     CDS             complement(91488..93242)
                     /locus_tag="LMJF_25_0290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683781.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652437"
                     /db_xref="GOA:Q4QA67"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4QA67"
                     /translation="MMSSDAVSASASTPMPFVYVNGDRLSLMEDYRLPLYQYFPEGTK
                     LFDPTHVPPREVPLSTSADETGVTLPKLLPNAQYHAFFKDPRTGSLYATATKYVCIYV
                     SNLPFNTTPEMLGRYFETFDMVKEADVFPGPNVNCNGRGWVILQDPSKLLIIPRVLQF
                     YGKQFIYTELSDREPAREKIYHLLSEPVLPPPPPSRAHIIPHRIDVPPPPPPLPPQHN
                     PNVPAPRSSIMVERRLLPAALTPIGGGLDYDGPTLPAPRSQQRLQASTAVASTGSSSS
                     PLAAAAAASLHGNGVAKAQQAATFITYITEKDAEDAVRDEYFWPNPVFADEMQSCMEA
                     RGSAFVVFLLSSPPTVFGYARVLPKGAPARREAKTCPIEWLQHHCAISEASTRSLDGV
                     LLFKQRDGSRLRLDTGTQLLDLIESHCGKAEQYFVPSPTGPSIPLPRGRGGVVRGGRS
                     VARPPPPPPPIGRGRGVGCMTNPPAPISDSGLAIPVPASRRNQANNSSTNANGSTSPP
                     GGTGSGNSREQSPTSLSIKLPAPASARAAAVAVAVGAVTSNGHGLGGSSNGNSSSHDG
                     SSSPTVPPAPRSKKSYVH"
     gene            complement(<94915..>96753)
                     /locus_tag="LMJF_25_0300"
                     /db_xref="GeneID:5652438"
     mRNA            complement(<94915..>96753)
                     /locus_tag="LMJF_25_0300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683730.1"
                     /db_xref="GeneID:5652438"
     CDS             complement(94915..96753)
                     /locus_tag="LMJF_25_0300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683782.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652438"
                     /db_xref="InterPro:IPR002761"
                     /db_xref="InterPro:IPR013813"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:Q4QA66"
                     /translation="MKTIALLSGGKDSILAMLMAHRYGHEPVVIANMAPVLESDGALR
                     GAAENGTHGHDIDSYMYQTVGFEAVDSIAACLGLPLRRGRVRRGLAKDQSLLYSEQPP
                     EEDEVESLYSLIRTVKEEFPEVQGLTSGAILSNYQRNRVELICDRLGLESLAYLWMRQ
                     PDEILDMADALHVQAILVKTASIGLMPRCLIGKTLEEARPTLEKMAELYHSHLAGEGG
                     EYETIVLNCPLFHAEHLTVTALEVVMQDDNDISPSGHGLLTVARVPKSVEQQAKEAEV
                     LARVRAGAVTFPSDTMPLLRSCAVYPLALSATASARGPGETIDLPLPATIRSALFLGS
                     GTAAARDGIAHHTYASPLEAGASAAEALNACLTVLQTWAAERSLTPFYYHFSLPEPSW
                     EVSCRAAYAGKVSHVCPPGLLVTVRDSRSRSAAAVEAEVLAAPTAAIQQHVLHAQSRS
                     CWALGEPGPHSQARRVGLATGTSRLFVSATPGRVPATREVATASDLPAVCQQCITALA
                     AAQHGEETSAALTDIAAQFVVAMSNCERYLTLFGCSFGDVDRAAVVATDDVPVSLLPA
                     LWQWTTQNTGALPFERVCQVVVVGALSGTEKIRVSMECVEVRGGGG"
     gene            complement(<97536..>97808)
                     /locus_tag="LMJF_25_0305"
                     /db_xref="GeneID:5652439"
     mRNA            complement(<97536..>97808)
                     /locus_tag="LMJF_25_0305"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683731.1"
                     /db_xref="GeneID:5652439"
     CDS             complement(97536..97808)
                     /locus_tag="LMJF_25_0305"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683783.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0305"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0305"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652439"
                     /db_xref="UniProtKB/TrEMBL:Q4QA65"
                     /translation="MSAAEAEHTEKTVTVNEDTTSTSAKTSPKEASGKALLPWSLTPA
                     ERRGLIMVVAVALLQEVHSNVVCGAVVGAASAAIIYNQLSRLRRSP"
     gene            complement(<98476..>101724)
                     /locus_tag="LMJF_25_0310"
                     /db_xref="GeneID:5652440"
     mRNA            complement(<98476..>101724)
                     /locus_tag="LMJF_25_0310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683732.1"
                     /db_xref="GeneID:5652440"
     CDS             complement(98476..101724)
                     /locus_tag="LMJF_25_0310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683784.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652440"
                     /db_xref="UniProtKB/TrEMBL:Q4QA64"
                     /translation="MWGGLHFFVSIETLVSFCIPPSLCHDGATSATSEPGEKVCAVKR
                     DGNPTVRRLHFTRERRLTPVFAFPNATLFLQVLFSSGNKVHLMTPWDKEDTTTILKSF
                     GWVSFLADARRVSVVPGSAQFSFSSLGIDPADYTRIVLVVEDALRWSSATTMQLIEVR
                     HTSEGQDVADSMELLYALSRCILFSEWYLRYPSSSIASCAALSDTTVFAFCRFLLDGA
                     APDADLMRLLCYHGGRIVHTAAEATHILVLPPPPAERGASSTTSSSTASSSSSSSGDD
                     SGSESDEPGCSVHSTNTDTSDEGRESSASVPHQKSGGQSVGDGDARRSSFVAPALGTE
                     GTASLPAPRPSATTLQRPAAGPSSETLAAVAQSSSVASSTATNASLQPSTVTPSWVHR
                     CVRALRLVPIDGAPTAPAPRADEEKGQRPGRPKGGGKAEVVRTTGALLCALLPPADAR
                     PLLWTTLHSIASQHGYDTAALVQHTTTASPFKTVTAACVLEALTSSVFSDVVEVRLQP
                     LPVAGKPTDASSTSSRSRGVPVTRRTLDSLKLSTASSELGRIALHRFERRRDKEAVFA
                     HLQLIASQFLYSFDYVQRQRSQSLHCHAGTQTSGVRRAFMGTMTEAQLPPASRLLPAD
                     EEETAGAKETSAAVTGNTQLKERDSTSSSAMTAAAKTAEPITSDAAGAVDEKEWRHHL
                     RNVEGKLLTSHVHAREMSDRETKRFKDGGPRSRGVGDAEVCAKVVRAPATQYIEHVEK
                     TELPKAMTDEGFTLAPPYSPKIVAEASREEPLPVWPPPAPSLLKPPSSLLPLPPMAKP
                     MDDGRGGADASLAGFTSCFIPTSVLTADQQCDFYAFLCSLPLFESAELGNSVVRVADG
                     VRCRFADRKGAKDFLRIEFIEFLSLHLPIYPALDDSIDVEDLHKTIMDFPFLPLPTAP
                     EASQEEAQSLWTAPSLPEATACASPPAVRPPTSYPSETDPRALRRSPRPPSAHPRSPK
                     NRGGDSTSASRAGPHAPQSDTRAESRWKRDRDDDSVEEPPLPADRHRYRDRYRGDRHR
                     GSSLRHVKSSSSSHRRHYGDDRSDRHRLLRDDADRGSRSSGHHRQHSRRERR"
     gene            complement(<102381..>102932)
                     /locus_tag="LMJF_25_0320"
                     /db_xref="GeneID:5652441"
     mRNA            complement(<102381..>102932)
                     /locus_tag="LMJF_25_0320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683733.1"
                     /db_xref="GeneID:5652441"
     CDS             complement(102381..102932)
                     /locus_tag="LMJF_25_0320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683785.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652441"
                     /db_xref="InterPro:IPR010796"
                     /db_xref="UniProtKB/TrEMBL:Q4QA63"
                     /translation="MSELHIVGEIACGHDFGDSSYFCSYEIITGTQWTAVEGRTSGST
                     HVMRSGSDGIPWNYPIDVHYSFNSVQGWPKIAIQVWQLDDYGCKDIGGYGTAYLPMPG
                     GGEQELCLSTWRPNLWSSSALVRLWQTLRLSVMGGYPVLRDNSLIADNEQRFKLHTVT
                     SGTVKMSFTVMGRGMKQAGLIYA"
     gene            complement(<104223..>106280)
                     /locus_tag="LMJF_25_0330"
                     /db_xref="GeneID:5652442"
     mRNA            complement(<104223..>106280)
                     /locus_tag="LMJF_25_0330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683734.1"
                     /db_xref="GeneID:5652442"
     CDS             complement(104223..106280)
                     /locus_tag="LMJF_25_0330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683786.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652442"
                     /db_xref="GOA:Q4QA62"
                     /db_xref="InterPro:IPR006032"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:Q4QA62"
                     /translation="MISAEGFLSALSLGGDEQRPSPFPSAIPHSGTPSPVRDASALLS
                     YTEAMTPNLYSALSASATYPSVYLSDPYISSAASASHAVPSPLSSNPYTYGSWTAPAP
                     PLRSAVAAGPSAEAEARAALSEAERQRQILQLERELAEEQRQRLEACLSPSSSSAARL
                     SVSVPGGRVLSSEAAGDASRYGGSEASSSPPPESAHDELGEELRGFSMEAPAPPSSPS
                     PPSAHAQARLYVWGANGGVDASRPHAAIGKRPQEQPAEPSVPLSPSLATPAAATNGFD
                     EGSATSPQPHPSQTPSPPRFSPQPRTPPKEAVPSLSTSEPCASADMTRAGTSSPSPKR
                     APARSEERRTPRRPAPSPPPSERDRSRASPRKPNSAQRAVADMQEDEERRLYEAYKQK
                     LAHIQEALRPSTGSGVLCATVSLEAYRAHQRRNRLTTPALCLSTPPALPLSSPPLRAT
                     GELPLVRRAPSTGSCADPVAPLRCGRQQRLRWDIAHSGNIVVSSDGRVCKADATDALA
                     LIEREYEGRLEDVLQRLVIPFYAMGSFGVTRGYLTFAFRWESPTTMHRASERQRRGRV
                     GGGGRARRAPALAFGFATRAFTGYGTEAPAFLYLSTGAIAQGVGTTTSAGAERPYGAP
                     YAPGSELAARLDLERGELEFYVEGVAMGVAFRFCPARHPAPLFPVAVFSAEMDVAELL
                     YSA"
     gene            complement(<111183..>113168)
                     /locus_tag="LMJF_25_0340"
                     /db_xref="GeneID:5652443"
     mRNA            complement(<111183..>113168)
                     /locus_tag="LMJF_25_0340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683735.1"
                     /db_xref="GeneID:5652443"
     CDS             complement(111183..113168)
                     /locus_tag="LMJF_25_0340"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683787.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652443"
                     /db_xref="GOA:Q4QA61"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q4QA61"
                     /translation="MPLYMPSAFSCHGIDTSIRQITTAQALERTQQLWEIVKQRSTED
                     GLLPRSMYVEVLRYTARRILVKLEDAGFDADTWRTYTSFLTQAILAYGTAEAQSYLCI
                     VERLMSAVLAFPTRPVPLLKEYLHCAVAQSTQRNEELLVYMANKPFGKLPPLARLPDL
                     EYGDDFVARVAPHSVMDVMSVLERLPSQLTFAHSHAIVHLKLCNPLKIPGCGYVSAGY
                     FCDTCRLRGIRVGFQAMVYDNEGADGAQSKCSVRSDAQINHRKSYGFDVCMACAVFFY
                     AQQQQHLLALMHAPHFAYAFGHAAGVTVLSASCRARWHSVRHDSTSFQHLGVTAASLS
                     SHKASNNSIAATEAHERSDNLLGAVVGYTISSFDPDEGVAVPKSMAIKRPPVRPPVRK
                     VNGNATAAPQPPVTRCVASAGFVVSFTLSLAPYGARPIAWVLSDADKRVDMQHMDEML
                     AQRLGPESDWRSCVAVRRKTQMPLRAGVTRRSAADMPAATPHSAKPAKSSHASHRLFG
                     DKTLPHGPKLLPQVLGTSSRLVDVNDDLDTCAICLCPVEGENPIIETTCHHWFHVGCI
                     EEHTHTAGDVCPLCRATHILPDMSRAAALARNIYHVEVTLTDEECLSPCVDVCVGVIL
                     TRDGNYHDATSIAAAECVRLYPIQMKGSGQQVSQACP"
     gene            complement(<114859..>117483)
                     /locus_tag="LMJF_25_0350"
                     /db_xref="GeneID:5652444"
     mRNA            complement(<114859..>117483)
                     /locus_tag="LMJF_25_0350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683736.1"
                     /db_xref="GeneID:5652444"
     CDS             complement(114859..117483)
                     /locus_tag="LMJF_25_0350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683788.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652444"
                     /db_xref="InterPro:IPR010733"
                     /db_xref="UniProtKB/TrEMBL:Q4QA60"
                     /translation="MRVRRDSLRHPYSDKSTLVSKGHLLPGFLFASHCPEVVRVRVGA
                     TDLSLRRLHALSSSSVPPLTLSLGGSSVSLVPRCTPHRRTPHDVRGGELLRTQTLTHL
                     PLSRRLPTARLLSISLRTFIMDQLYEAMPIRSSGDDEDALEASRLDVSSHASSASSRS
                     RSCTHSADATSPVSSDAAGEAPGGDTDTFGKDLYAAQHGQGQGHGRHQEVFTTSSSPH
                     ALCAFLVQLLRVAEDLHSRLECLLADKVAFVSTATPYSQTSHPENDSRGSQTISGRAR
                     ASRQRLTSSAYKGIAKLRSRLRKETANVRRAVEGLSAAGCTHVRPSSTSPDSLVVPPA
                     IFEAAVACAQCNSLSHYDGVITCLERERDITGVYVPVSGHVGPLQYAPSASMSRSNTA
                     HRPSFRGHMRIEVDVVSSSEHRWIKVKTTTARNLELEAEALEVNGATPFTDMLLALVE
                     RAKRICLPHRRAAQVAVVLLHPPPPALEKFFAAHGVVWASLSADHTAQVLRRRIRAQG
                     PQVAPARSATTWIPPLAPSPAVICLDTTALVTLCSQSCYEDGLPHNVRMERLAPFRVL
                     REQQRKEVVECRAVVEVLEPALRSHTVWYTRDVLEQMIRHALLLQCDNAAADAEPSVA
                     VKQPGQAIPAVLIVPTELDWLGPLEAAARERFSDSADENAHKGTAIATATAAAPSATV
                     PLDESTLLVEYSGRAERAAASALPSSHQQPNWVMADITYEEFKWILETIAGPREIARA
                     ARLLRLVSVVDTTFLRHHICSGGGYEGGDGAPSVTGRATAAPHSCPWPPPPPIFTSVE
                     YLRLSGKVSLRNKIVFGLADAVNAIIVTANEQVCHAAREQGVHIEACFHPSRSLTEQK
                     MYRLQRRDGPRKPPVITP"
     gene            complement(<117925..>118299)
                     /locus_tag="LMJF_25_0360"
                     /db_xref="GeneID:5652445"
     mRNA            complement(<117925..>118299)
                     /locus_tag="LMJF_25_0360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683737.1"
                     /db_xref="GeneID:5652445"
     CDS             complement(117925..118299)
                     /locus_tag="LMJF_25_0360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683789.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652445"
                     /db_xref="UniProtKB/TrEMBL:Q4QA59"
                     /translation="MSRTNVFGPNSLYSFTKFGALNRSNGVVLSKRMKDTFRLENQKH
                     MRKDFDRERRYRLCQRCGITSVTVNFDQVPSARVGLWGRCVDGKDYTHHRFVELSQRE
                     YEQLRDWPIEKRLNWWRYEGDE"
     gene            complement(<119539..>120078)
                     /locus_tag="LMJF_25_0370"
                     /db_xref="GeneID:5652446"
     mRNA            complement(<119539..>120078)
                     /locus_tag="LMJF_25_0370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683738.1"
                     /db_xref="GeneID:5652446"
     CDS             complement(119539..120078)
                     /locus_tag="LMJF_25_0370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683790.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652446"
                     /db_xref="InterPro:IPR014810"
                     /db_xref="UniProtKB/TrEMBL:Q4QA58"
                     /translation="MPASGTSDSVADMMAKAVTSSGDFYGGRNGVQGIQDRKDAVREK
                     RREQKNTLSQWYGMKKRPLSEDQRQEIELLKYRNFVDPERQHHAPKKAAGVGESEFME
                     FGYFADVGRNKRRRYKSFADEWIEENPQFEEVVATRIKRNTKVNQRSRAVAAKKAAVE
                     AAKAKEKRASKRKSKHDVF"
     gene            complement(<120980..>123541)
                     /locus_tag="LMJF_25_0380"
                     /db_xref="GeneID:5652447"
     mRNA            complement(<120980..>123541)
                     /locus_tag="LMJF_25_0380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683739.1"
                     /db_xref="GeneID:5652447"
     CDS             complement(120980..123541)
                     /locus_tag="LMJF_25_0380"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683791.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652447"
                     /db_xref="UniProtKB/TrEMBL:Q4QA57"
                     /translation="MSTVASIASSAHGAAASAPPTALPTTEDDAAWYTSSIVQLPPTV
                     PELIQCLEHQQERCAQLTRCLERVHTQTSRLVASSAGTSAENRYTALLSAAENGAAKS
                     SSPLAECSPTTSTPPPPPLFASQVRPAADASSAPAAVVARGVPATTATGASSPASHAV
                     AGRVVRGTALTGKVVGAAGETSTAATAVRAVVVAAEPSTVTPSCARATAPFSEEVAEL
                     RVRAVALDAAEGLLTSTRSELSTTQTALAMERERVEAALAELADLRKVLLADMNTTSL
                     SLPQAGTTPISPAHQLADMQARLAERETEVRAARLRHESAAYALAQLRQAMSTMTSEK
                     AFLQEKNTHLEGQLQRLLTSSMEAAAHPAPRPAATAPRLTASEAYQKEALEKQISDLH
                     AMTDRLTRDAKKQAARRAKAEEVAQALQKENAELKASALLYRRQVNESELELERAISR
                     KEEDERLRQLERDASRLRIALRDRTDQYRQEKTEWERQLLALSRRARVNEAAVKQLLK
                     RVLACQVREAVWKQCLHSSTQRGDRDTATNTAAANESSKVAPEPVTRTVAAASSSTSS
                     RIEDATVTTLHVAVPSPSVPYSPVFGAAADTAVLVHRERQLEELKHTFEQRIALVEAQ
                     RKAEMQQLLALNKELRQALTVSQEGLSEKTRLLEEVQRRLPPSAVVPLSNAPAAATTT
                     SQRPSFSGSWQDTSAAWVCRSDGESGPAAASVADLDSDDPLPSTHPLVVASPRQVTDI
                     EQRYNPEHMSTWEAVQVENEALLDRLTTMQEEKWKLTTVIEDLQLRCAALKGELKRNA
                     STMNQLLAAGVFTPAAVSRGGEEGRLRSLQCLLQETLQAKLELEERLQEATRQLR"
     gene            complement(<124940..>125659)
                     /locus_tag="LMJF_25_0390"
                     /db_xref="GeneID:5652448"
     mRNA            complement(<124940..>125659)
                     /locus_tag="LMJF_25_0390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683740.1"
                     /db_xref="GeneID:5652448"
     CDS             complement(124940..125659)
                     /locus_tag="LMJF_25_0390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683792.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652448"
                     /db_xref="UniProtKB/TrEMBL:Q4QA56"
                     /translation="MLVGSLCSLPLRCRSRNGVPHSLFSFPIRSSPLPLSLQMGSLGG
                     APYVARVQQAATAADALAAVQSGLADASVFFYGALLSALQTCMRKQNAAVVPARTSDT
                     IALLKLLTFNTVADVDATSDGVKALLAQQPELMTKLRLLSFLTLCSQHVLTPDGVCLS
                     YGDAERALGVQDTVSVQRTVLHAVQQRLCVARLNERERQVRVYSYESRNVTPDDMEKL
                     RERVVQWTAYAKAHLRDIQPS"
     gene            complement(<126448..>126750)
                     /locus_tag="LMJF_25_0400"
                     /db_xref="GeneID:5652449"
     mRNA            complement(<126448..>126750)
                     /locus_tag="LMJF_25_0400"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683741.1"
                     /db_xref="GeneID:5652449"
     CDS             complement(126448..126750)
                     /locus_tag="LMJF_25_0400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683793.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652449"
                     /db_xref="UniProtKB/TrEMBL:Q4QA55"
                     /translation="MQGFFKSLVYKTFVSEASNTPLVQRAAEKAARMERDVTGEKLGL
                     WLGAAAREVSNDIRSSYNIVRAYLNRDAVQKPQQSLSTAGGQTGSVGNGPKPPEGR"
     gene            complement(<128189..>129076)
                     /locus_tag="LMJF_25_0410"
                     /db_xref="GeneID:5652450"
     mRNA            complement(<128189..>129076)
                     /locus_tag="LMJF_25_0410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683742.1"
                     /db_xref="GeneID:5652450"
     CDS             complement(128189..129076)
                     /locus_tag="LMJF_25_0410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683794.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652450"
                     /db_xref="GOA:Q4QA54"
                     /db_xref="InterPro:IPR001950"
                     /db_xref="UniProtKB/TrEMBL:Q4QA54"
                     /translation="MGRNKKSKATAHAQACSDGEREEEHGAVPTTTLPARAEGCEEEN
                     GASAAAADGAQGTPDHHSGRCSERGRDSDDDAPKTKKEYRGNRLKKLEVQRKKGKGKG
                     ANEDDKAEEAAREGDAHEEPLVVTRQRAVEVLYCPICTFPAEMCEFSGIVEKCRPWLL
                     EHAADLADAEERGRKRRILTEKDRLEAMLEGRGVKKALERIVVLEVEKRTGRRMITSV
                     FGMDLFGFNLKDVSRDWRKRFSCGAGVRAAEEGKHQDCIDIQGNVVDQLADMLITKYK
                     IPKESVYLMEGKKKVPYPY"
     gene            complement(<130359..>135596)
                     /locus_tag="LMJF_25_0420"
                     /db_xref="GeneID:5652451"
     mRNA            complement(<130359..>135596)
                     /locus_tag="LMJF_25_0420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683743.1"
                     /db_xref="GeneID:5652451"
     CDS             complement(130359..135596)
                     /locus_tag="LMJF_25_0420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683795.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652451"
                     /db_xref="UniProtKB/TrEMBL:Q4QA53"
                     /translation="MSGEGVHSLTQRLLSLEDIIRQQEQTISAVLQRLRDVEQYAAAE
                     SHNREQAQQQVYALLSDRGGTTAETVSHMQALLQNHNDRLSALQAEVQGHGVALRGVN
                     DKHDAAFRGMEQRLQADANSAHQRAQTGEAASAEAMRAIQAQLQSLANATQAIEARNH
                     DNLLALQQQMSAEIAAQRQRSDNLESAMRDGLRDVHGSLSGDVQSAGAQQRGDLEGAV
                     QRMNQQLESLDQRTRIDMNQLHNTEQADVGDLRRRMGELESSLCEMVQAATNGLAREV
                     AQVVQHSQMLDKRQETAHQAILQELAKHDSHLETVDLNWRASVTDLSVKIREDVAATQ
                     HRAAAGDQALQSQIGAAQDLFAAATDKLRRDLTELATTVQENCVKPLQQAHHALSIQE
                     QRMSRIADDYASMQDYLRTFVSHVDNDVTQLKHVFEAAVRSAHSDLLERINLIAASNA
                     IDQDREMLRAEVNRGLGRLWEDAKSMFLTQRSLNDIQKQLAMLESAVRVELCALAERN
                     TDVWRTVDELRIGRHRAAHGPVTSAVATRIAPEKRPSRDSAAANAVTSAMTTPVADSS
                     SRVPMSQVSVVRADVSKAPPEQIRAAATAATAVLWSSISEKPSRASSAAEKVEEIDRD
                     SDEHSERLRQHEEDIKALRASLQRLRIAQAQEFSKSASANQWNSASPRSTAAAAAVQV
                     DDASGEARSAAREAAEYLEATELAQDESVRAAKELSLDLERVDALEESLQMPLAELKA
                     VRAAAAPVHEAQSSQSSLPSKKSEGPVAAPFSTKATSSRSVSFKGLAVREEEAATHEA
                     EGEAATHEAEGEAATHEAEGEAATHEAESEAATHEAEGEAATHEAGGEAATHEAEGEA
                     ATHEAEGEAATHEAEGEAATHEAEGEAATHEAEGEAATHEAGGEAATHEAEGEAATHE
                     AEGEAATHEAEGEAATHEAEGEAATHEAEEDEHGVRDTVASTISYPSEKAKTHTGLSA
                     DAAAAPEDNLVEVPGKLTGEVFILRQDTLGVPSPVSVRVRPATAGSATIPAKPVASSD
                     AFVKSNSRESVVKKPLPSRGTTLSEVLLPTCQFVRKREYANFRDFTKREIDAVWVELL
                     NMRRTRSLSKEELLLHISRSKEEMLNTVLKIVQQQERELLGMLTSIKTHLTAMYHNPH
                     SMREIRVFPIDGGQRLEEFVRSLSGQLKDMPIVTEPAPASTPISTAGLSEGGGQKTLS
                     QPATHELGERRTVTSPTAAVAPSGQSLLSTPRGDQGGVDTTLSSAPSSSPMEPQLIHP
                     MVHRHVSHPTLKPESQGVLHVSIDEMDPSKLDGSLQCKPSHCLAPKRASSTDQAQVRQ
                     STAATFVNPELAAPAPPLSEPEGSRLHPLPAGTFSTSAQLSQTQLPLPSLTTIGVEPH
                     PSLNGSPAAASAGSRPGSGSEPSCYVSVHADRTGPPLDLLRRRSDSAIRGCVGDDPAR
                     YVKGTSSPCSWTGSPIHLNPLHGVRVTNCLPPVETEARRASIVTAAPGTASAAQSMGG
                     GLQLLDDVRQPDTWAPPHQRSRDLSCSRAAAQAEKSDAPRQNDALPEAHHFSHICQES
                     EAYYQSVENMRPSRSGVRRRSTGTAVPTSAIDGASPLCARETGHLYHRETPMWRQPQP
                     YAPPHHLPFPVPQPQPHDYSSAPSGCSNPVPIGIDPARPPAQVHSLSSTGTIHLGPYG
                     RPAGAYTGGCNGGSSARDVHSTSQSFSSTTQEQRRSSAKVSSNAVAVRVLDDLVSGAD
                     VSSRSDQSLAVTIHPYHEH"
     gene            complement(<136951..>140004)
                     /locus_tag="LMJF_25_0430"
                     /db_xref="GeneID:5652452"
     mRNA            complement(<136951..>140004)
                     /locus_tag="LMJF_25_0430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683744.1"
                     /db_xref="GeneID:5652452"
     CDS             complement(136951..140004)
                     /locus_tag="LMJF_25_0430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683796.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652452"
                     /db_xref="GOA:Q4QA52"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR013934"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q4QA52"
                     /translation="MDGKNCFRTRWTQEPIFSGGALASLALPVSAPAASSALSTSAAV
                     EECLVVACGDTVNVVRATSGEVLCRYTLPVEDVILHIDAVTVPEASDDDGKDAAVADE
                     GEARGKRDAGAAEKSATAKKSPKKKARAGKRVKPSEGDEENAVQAEKKVATPSVAPSS
                     SDAAASRGDRELAAPAGSYVAVGTRSLQVYVLRVDARVELSASPSSSPSAEKGAAADA
                     ASEEGNTAEAEGDDADVVGAATATGTLVQYSIELQRNWTAAQHAISVVHFSQSGTYLV
                     SGATDGSVKVWNVFHHHLTHNLVCPHSSLVQSVCLDPSEAYLAVGSFEGHVTVFDFVA
                     KRIVAAGRPHVQAVESMIFNDALTHIYSIARDRRLALGKMMFIENRKSTELKEVRAIV
                     VKEHVSSAAFESAGLLHVGAMDGVVSTYRVSEGEAVQVVRRLPKPPSADAEDGAEEAF
                     VRSLLVAGTPKGTGMRRLRGFVVHDVPHAPDTSSLYVGDAGFNIQHLRPSSAERSRYE
                     VTRTVVGFLDQLLDVKLFPEASPLHRAVVTNSKDVRLYASDGCVSSKTLRGHSDVVLC
                     CAVSSDGAWIATGAKDKEVRVWSTESCETVVRGVGGHTAEVTSLSFNGKQTDTYLLLF
                     SVSSDENVRMWDIGVPLAERASAKQPLSRVEEIQHRSGVNAAHTGPIYTVAVAPNDQY
                     VATGGKDKSVNVWNISGKKMYREASLKGHRRGISSLAFSPVDRVLASASNDGSVRLWS
                     LVSLTCLKSMQVDRTSVLQLSFFNNGTQIVTSNAEGVLRVWAIASSESVWAAEAHTEK
                     IWALAVEERPSSGETIFYSGAADGVLIATEDYTAEEVARIKEDRHQMILQEQALSNAL
                     RKGEFSEAFMLALRLSHPRHLRQVLVRWCAKDARQCESTLRGELLPALDAEQMTRLLQ
                     YTREWITNSRHCMVATLVLYVLISSRHFEAVAQVPSMASLIEPLLAYTRKHSQRQHDL
                     LRRTYYIDYVIRGLAPNVLTSLPPFVHQGEGRREEPPLAKRMRVE"
     gene            complement(<140947..>143058)
                     /locus_tag="LMJF_25_0440"
                     /db_xref="GeneID:5652453"
     mRNA            complement(<140947..>143058)
                     /locus_tag="LMJF_25_0440"
                     /product="putative transcription factor"
                     /transcript_id="XM_001683745.1"
                     /db_xref="GeneID:5652453"
     CDS             complement(140947..143058)
                     /locus_tag="LMJF_25_0440"
                     /codon_start=1
                     /product="putative transcription factor"
                     /protein_id="XP_001683797.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652453"
                     /db_xref="GOA:Q4QA51"
                     /db_xref="InterPro:IPR000812"
                     /db_xref="InterPro:IPR013150"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR029529"
                     /db_xref="UniProtKB/TrEMBL:Q4QA51"
                     /translation="MSSCTHPTSALFVDRQNGRTTCTICGDVVTTDQYELDPIFAQGG
                     RQPASGGGLRGLAGSFRPATSYKGTHTGVIHSHSRPTIDKARREMLNISRQLEISEDT
                     VERALGIYKVALNLNAVSGTRPSVLCACLYAACRRERTSHVIYDFSEINGEDPHTILS
                     QMKYICHATHTEVPVIDPSCYVQRFAEQMDLGPQTTDVVVCALKVLRAMQDDWISCGR
                     RPMGVCAAALLVACYVFGISRTPEQVCGMVRLTSNTIGKRLTEFAATPTARLENIDDY
                     QPSHETLPPAFNDSSRKSTEEDVHASMRELSAIFYELVSEAKTSQPATPERCDKWRRF
                     IMKHCELEGITPLEENLDLKGLPPAQQLHILGLPHTKPIPLEEVARSVKREEHRLLVK
                     REASLQNGSDAGGSMSGARQGAVAGLLNNADVSSNGIPLYLLPDESLASSLAQASPAM
                     GYADDGGMHSSSAAVGAASMDSPEQLRWMTDEYTRLLNSNAEVMHLRNDFDFADEDDA
                     NGAGGSSGGGAVAPPVSHPTQNQPFSCGLSQLRGGSPPPGTPAEEDPFGFFDRDDEGT
                     RLALEEILYDRERRHALPWEFLVLPRVEEDDCTDILSYLVLDNEERLRRERIGVSLYG
                     EKWKRGRARTDEEIQKLEEARASKRRRRSVIAEPAVDVPTAMERALRGRGAGTVNISQ
                     IGELLPGMLEFLEDEPQADWD"
     gene            complement(<144228..>145559)
                     /locus_tag="LMJF_25_0450"
                     /db_xref="GeneID:5652454"
     mRNA            complement(<144228..>145559)
                     /locus_tag="LMJF_25_0450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683746.1"
                     /db_xref="GeneID:5652454"
     CDS             complement(144228..145559)
                     /locus_tag="LMJF_25_0450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683798.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652454"
                     /db_xref="GOA:Q4QA50"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QA50"
                     /translation="MHHMPTCTFSCTSPLPVLHTHTHTHTHTHTHTHTYTYTYTHKLT
                     SLCHRPPFHPFCFLLATYRMLTRSLVCRASLQSRRRWEQRIVSVLSENKEEGVDAVAK
                     RFQRVYKERRYTPVEEAFPPLAAAAAAPGLRSSAAKESVESVQQPANPLVLRVAFLGP
                     QNAGKTSLVNSMALSNVGAVSNRYGSTKDWTKAVATVHETQLLLLDTPGIVPRDTQRV
                     RRKFASGTAKAYDALFVSDLVVLALPVGVGFVEKEHKVVATEVVRRAAGRELPVVIAM
                     TMMDKVQTPWHRELYFAMRTDLESLGLPTAATHEVSVKGGSGLVELKDCLCQYAKPGA
                     WEHYRREATDLNPPQRVAELLRQTFMELLPHEIPHCMRHRVLGWTRKESGTTEVVVEA
                     FFDRPAYMFTFYGKLEAICLRAQQVTERELAPQRFRFVFQAFIAPGGLSNS"
     gene            complement(<147478..>147879)
                     /locus_tag="LMJF_25_0460"
                     /db_xref="GeneID:5652455"
     mRNA            complement(<147478..>147879)
                     /locus_tag="LMJF_25_0460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683747.1"
                     /db_xref="GeneID:5652455"
     CDS             complement(147478..147879)
                     /locus_tag="LMJF_25_0460"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683799.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652455"
                     /db_xref="UniProtKB/TrEMBL:Q4QA49"
                     /translation="MHSVAKRKEQSIPVAVMAASPMYMHGDAPIDIPDEPMATEEELR
                     AWSELEHSRPTTPSPAGGNGAWRLPKRYQGVFQERYILMLLALTLMLFVASTFQMDTK
                     TELEEIKRMYGIEEPMKSSTERAGNMKEKSV"
     gene            complement(<151002..>154415)
                     /locus_tag="LMJF_25_0470"
                     /db_xref="GeneID:5652456"
     mRNA            complement(<151002..>154415)
                     /locus_tag="LMJF_25_0470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683748.1"
                     /db_xref="GeneID:5652456"
     CDS             complement(151002..154415)
                     /locus_tag="LMJF_25_0470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683800.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652456"
                     /db_xref="InterPro:IPR000001"
                     /db_xref="InterPro:IPR013806"
                     /db_xref="UniProtKB/TrEMBL:Q4QA48"
                     /translation="MCAPTSVAGAVITLAAAVLLLLVGAAVEPANAARAAVAGSACGS
                     LTHVYYLPDGQDFRGTVHVNESGFPCQLRSSQTPHSHEVPLDFATGVGHRNHCRDAGG
                     LGRPGCLAATPGAAYQFCAVSAVCAARSLAAPTVQFWSVSGTKRAVDGSSSYLAISCH
                     PRPCSIHYVFGDETIASATSPVYTQPLLLEQSTTVRTYVRYETAEPMCAQARYTVTPT
                     ATSTPATSIQFTPSDAVVYSHPILVELQGITNASEVLLFWDDDFMNPTTYTGGAFRLE
                     RSTSVVAVVNSTYVVSASYRLDITAPPLNVYPPSGTYVGGVTVLVSDPQPPATYYMYV
                     NRSTDLQSLGTLLFPWTAIGTSELDVHALHVEGIESVEKVVYEVVPATPPTILPDPFI
                     AHHRPINVTCTAPLGTPVALSVYRDAVMQDAVAEGVFSAVLSEPGAYMVSCTYADDLH
                     ATHTTTAILQLVAVPMQPPTFTPACGTSFPAIALSLQTGLNVSNLLPGDLATSWCVSA
                     SASGGARIPVITRCADDDGLFVYDVLQSRSIQEPTTMEVYVTAHSLNPLEADSPRTSC
                     TYSLYPLGASATPYFSAIPDCATTSAPASPSCIMALKLQLASCLHCYSTELLSIDAVG
                     PIVAMRMTGLAAAIQADMYTRIGECLTGLQHRGVLSDVRNETSGEIMLATSWHVATPT
                     RMAAQVYTDLPITVHVSGFHADAGAYHLVRSDYSCEDIGVLPAAVLETPPYPPTAAGS
                     SRVSPSIDGSAYLTFRVPIAGQYKLCSYISNALYEVPFSFSTGGAATPAVNQYLDVVA
                     QPWPSVAAAPAEECGGLVPPEMEGVAFSLSMAAVPAGAYASLAYSFNSAGWGSVPFPI
                     DAATQLGGAASVSIGPLNRYTRPLEVFDASLGPTTGAAQTCIFFVSAANASVPRDEIT
                     YLFYKMNSSEVPAGLTGVMLLLQGQFYPAEMIVIDVYENVTSDSTAAEKSASLQLLRR
                     VTARPSAATAFAAALPDAILGLPAGVQHIPYVIHVTLDGMHVTAAPLTVALSPLALAM
                     EASSACTSGLALEGQCLCRNKRTKVVSVCGTEIEDSSSSADSSSRSTTDSGDDTDMKT
                     VSLGERLAFLFAYLGLLAAIAGYILISIKRGGARRQRARCAEDVTVENS"
     gene            complement(<156676..>161202)
                     /locus_tag="LMJF_25_0480"
                     /db_xref="GeneID:5652457"
     mRNA            complement(<156676..>161202)
                     /locus_tag="LMJF_25_0480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683749.1"
                     /db_xref="GeneID:5652457"
     CDS             complement(156676..161202)
                     /locus_tag="LMJF_25_0480"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683801.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652457"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QA47"
                     /translation="MCRAAFWACSSVSSGTAAADRTPPQQCAAKSSRPRASQDWMLHD
                     ILVTPLYVCVNPAAVVPLNTSADLLLLRRVASGGVPVDAAEVTAASSAALDVLLRESP
                     TCGALVYGLLLQQRQWTVHNTVAPPLSILDSSACIVAEGGDFTPYEEALAADVYVSAV
                     PSLPAASPSTRPPRTRSPTETTQLATSPSASPEEEGDDVLDHSFGAWAAKLSQQLLRR
                     WACLPSQTVLCCGERQATLRHRRGLVLRHAADVRGGTTPASATQSDSYVRRLRAALYL
                     LDALRPVGSVPGRYACERGETNSSVVVDALDVVLEECEDDDRRCEPLELQRCYRLLRG
                     RVRRVAAFAPVAALGWSADGSRLTPEPDYLQLPWCAAHSTALALTAAQAYATPSSMPS
                     YAHVSLSGLDACMDTLQFTAEQQTCLHELAYSVLYLASLTFTSQRGPSGGPAAVSAKS
                     LPALSAAAQLLRLPASELVAALTTVAARDGVQSTSAATRHALNCAGAMQMQRTLVTHL
                     GGLVVRTLMHLINAALHVDGRVATEARTLTLAAVADTEDTAAQEQHTHMPGAHEERHE
                     GSGGGLTKWYAAYVRCHAALTVRDRLVCALQREACYEGVELEVDSWLDELSAASTAST
                     ATALRLGRVAAEVREVATRVMMPSAKQRGKGTVLTTHTAAGAYDFVDTTCDIPVVAEL
                     AHILEAVTSRCIGADVSAEPPLSSPEAVQRLLTEQLQALVASMRQATASEEVDNAKRV
                     AEEVVCTWEGTASADSSACDGALVLTFPRGLHPPLRLSVRCLAADIFAAARLCLTGTT
                     PAMQQIIGGVSKRCVSWTSAGISPKGGERGEAQMVQSPLYHVYRGRGGEEDMSASPKL
                     TPCSAHAAVQSILARRHQSHSSMANIAMDVGHRGGHAAPLASDFWYVILAVPVLAETA
                     SWGPLRDAGDLDQHQWSSAGAYPFLEPVLPHDAPVSPAPAPRVALTRDDALTTHLHER
                     DPLLLALFFWSRLCHCHICPVPVFAKVCAVPLLTSYAQWRPSKRASPHNTAATSWAAV
                     EGREDFLSESTARAVTDASSSAPLRTPRLRMRAMAPDDAAAEFLNRVRYLQHQARYRE
                     LCLLALAEVPCCSDGGVVLGVSAVFLRSAAVAAIRSCCTELRETAVRCLQETGRGFLA
                     RRRLCFAHEQQRQQRQQEHRRSLRLANSCLGNAAVPASAEMREREALEHARDAQLTQA
                     AHERTHALTCSTRHLSHNVSQLQQGWTETLELLEGELVGAVVQINAYETQRRSAEDAA
                     RQEARLTLRVHEEAWSEVWAGAKELRTRRQAALAERRRRRRPSPLARSASQGPVAIEE
                     GIRRATAAAHHTSQLRREAVQSAEAALLSQLIRASRREDAQSLADHVRRQEARATRLA
                     DSRRQDKSGVVASEEAQRHEGQRESEITATLPQHVESPTDFSRRQYSNPEGLVLARPC
                     RSSDQRSTGVTLTRPLGEGRTRSISVSRSERGGVGRTPIASIERTTTATADSSEWAVQ
                     RDLMSLWESSRMSV"
     gene            complement(<169437..>169970)
                     /locus_tag="LMJF_25_0490"
                     /db_xref="GeneID:5652458"
     mRNA            complement(<169437..>169970)
                     /locus_tag="LMJF_25_0490"
                     /product="putative RNA-binding protein, UPB1"
                     /transcript_id="XM_001683750.1"
                     /db_xref="GeneID:5652458"
     CDS             complement(169437..169970)
                     /locus_tag="LMJF_25_0490"
                     /codon_start=1
                     /product="putative RNA-binding protein, UPB1"
                     /protein_id="XP_001683802.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652458"
                     /db_xref="GOA:Q4QA46"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR002343"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4QA46"
                     /translation="MSQQMTPPQQQPQQQQPQQQPPQQQPPQQVYNPEPEALRNLMVN
                     YIPTTVDEVQLRQLFERFGPIEGVKIVCDRETRQSRGYGFVKYHSAASAQQAVNELNG
                     FNILNKRLKVALAASGNQRQRNYNPHQNANPAANMGYYGGNFAAGYPQANPYAQQQMM
                     AMQQQYMMQQPGQQPRQ"
     gene            complement(<179434..>179937)
                     /locus_tag="LMJF_25_0500"
                     /db_xref="GeneID:5652459"
     mRNA            complement(<179434..>179937)
                     /locus_tag="LMJF_25_0500"
                     /product="putative RNA-binding protein, UPB2"
                     /transcript_id="XM_001683751.1"
                     /db_xref="GeneID:5652459"
     CDS             complement(179434..179937)
                     /locus_tag="LMJF_25_0500"
                     /codon_start=1
                     /product="putative RNA-binding protein, UPB2"
                     /protein_id="XP_001683803.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652459"
                     /db_xref="GOA:Q4QA45"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR002343"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4QA45"
                     /translation="MAQHMAPQQQPPQQQPPQQVYNPEPEALRNLMVNYIPTTVDEVQ
                     LRQLFERFGPIEGVKIVCDRETRQSRGYGFVKYHSAASAQQAVNELNGFNILNKRLKV
                     ALAASGNQRQRNYNPHQNANPAANMGYYGGNFAAGYPQANPYAQQQMMAMQQQYMMQQ
                     PGQQPRQ"
     gene            complement(<181342..>183036)
                     /locus_tag="LMJF_25_0510"
                     /db_xref="GeneID:5652460"
     mRNA            complement(<181342..>183036)
                     /locus_tag="LMJF_25_0510"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683752.1"
                     /db_xref="GeneID:5652460"
     CDS             complement(181342..183036)
                     /locus_tag="LMJF_25_0510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683804.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652460"
                     /db_xref="UniProtKB/TrEMBL:Q4QA44"
                     /translation="MPFFQLCSAAADSRATCDKAPKVLLTTPTAVGNCGPKCVESASA
                     TTGDAGDANWLPLSILHVFHLAHVAITVDTDVSPCVEEMSTAELATSVRRVLCMGQSK
                     SCSSASTASKQEATAPYVARVLLVRLHGVVEAHERFLTWMRTRSMAAVPGALDGVVRE
                     DAFLADAATFLRTLPLPDALQTAAPSPPATERRASSRRSSYAQLLSANLYAISTFVEA
                     AVIAATVTSPPAPDSPSATLHRELCFVPPPLERAALSLLYYLITLTVDVVETSVLCCC
                     RLEGLPSVHEDDRQLVCFPQGLADFSAASTPGAQFTASPSYCPATPSLRVVLYTVLQQ
                     EGSHLLALLLRCEQCEGQCPGEMSDADPTHRRLLTRHLLRRLGHLFFHPLRGDRTCVG
                     VTTCTTAVAASDRTDAAILTWMAGRLQHIVCLSAPMTEGEGPGSTSRGFAAALAGEEH
                     RPCRFEAEILAELLRLLIAQIDADAATSPSGGAPECECSNGVVVSSGSIARSASAAAD
                     AVIDLSQQIGALVLLPPAIEAAPALGSGTLSRAPARETLVTARECVVQFALKLTMQ"
     gene            complement(<184634..>185356)
                     /locus_tag="LMJF_25_0520"
                     /db_xref="GeneID:5652461"
     mRNA            complement(<184634..>185356)
                     /locus_tag="LMJF_25_0520"
                     /product="putative RNA-binding protein"
                     /transcript_id="XM_001683753.1"
                     /db_xref="GeneID:5652461"
     CDS             complement(184634..185356)
                     /locus_tag="LMJF_25_0520"
                     /codon_start=1
                     /product="putative RNA-binding protein"
                     /protein_id="XP_001683805.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652461"
                     /db_xref="GOA:Q4QA43"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4QA43"
                     /translation="MSFAQNGTAPSTPAQQSKPEPDASPVAGEGSTSGRCAFDPEALR
                     NLIVNYLPPLMNEAQVYELFGQFGRIESVKIIYDKITGESRGYGFVKYYFFFSATYAV
                     SCLNRFEIGGKKLKVAYANAPAAKEAYDMLRLSAVALSVQQQQAMQSMYYHQMVLAQE
                     QQGASAASSVAASAPMVGGADYGPYMNRVGGGYAMRQRESGAGYAQGMYPGMVAGGSV
                     YLAGPFASGSRIVTPAIAPIGF"
     gene            complement(<188970..>190940)
                     /gene="ABCB1"
                     /locus_tag="LMJF_25_0530"
                     /db_xref="GeneID:5652462"
     mRNA            complement(<188970..>190940)
                     /gene="ABCB1"
                     /locus_tag="LMJF_25_0530"
                     /product="putative ATP-binding cassette protein subfamily
                     B,member 1"
                     /transcript_id="XM_001683754.1"
                     /db_xref="GeneID:5652462"
     CDS             complement(188970..190940)
                     /gene="ABCB1"
                     /locus_tag="LMJF_25_0530"
                     /codon_start=1
                     /product="putative ATP-binding cassette protein subfamily
                     B,member 1"
                     /protein_id="XP_001683806.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652462"
                     /db_xref="GOA:Q4QA42"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QA42"
                     /translation="MRSSSRLAWQPVSCTALTSVRRLASDIRLRTDYGNATPAQRPKA
                     SKGLIYVTEPATRKGSFARYVRSARDQAPYIAGAVVGVCIYSAATLAIPAGFGALIDQ
                     ASRGQMPLGTSMQLLGWFSLCATGNYLRLYCIGYAGENIIAKLRRALYSGILRQPAAF
                     FDSTENRTGALVQRLSMDCNVVGSSLTEAVTNGSKNLLQTIGSISVMLYYSPLLTSVI
                     VCMIPPVAIFAGSYGRYIRKLQHNMQDALADMGTVAEERLSNIRTVKSFGTEAQEESW
                     YDKGVQRVFDLSMRMVRWNSVYVASLQTVGYGAMYCIMWAGSMLVTSGHLTPGVLFSF
                     MLYTVYCGIGLMGLTNLATEINKGYGASLRLFDILDKAEALRQTHTTCKQLTPITCNW
                     RVTFKDVSFAYPTRPEALIYRNMSLTIEPSRCTCVVGSSGSGKSSLAMLLLKLYEPTA
                     GLVQLGEHDLRDISSQWLHEHIGYVGQEPVLFGGSIAQNIAYGAPGRNWDDPIDRWLY
                     AAVVEAARKANAHDFISALPDGYDTFVGESGRSLSGGQKQRIAIARALMRHPRITILD
                     EATSALDSESEVVVHDAISRLIEESKDSKRQHTVLMFAHKLSMIRKADHILVLDKGQV
                     AVEGTFAKVSKNKLFCDLVGLVGTPQVGAGTS"
     gene            complement(<198313..>199200)
                     /locus_tag="LMJF_25_0540"
                     /db_xref="GeneID:5652463"
     mRNA            complement(<198313..>199200)
                     /locus_tag="LMJF_25_0540"
                     /transcript_id="XM_001683755.1"
                     /db_xref="GeneID:5652463"
     CDS             complement(198313..199200)
                     /locus_tag="LMJF_25_0540"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_001683807.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652463"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR025609"
                     /db_xref="InterPro:IPR025761"
                     /db_xref="InterPro:IPR025762"
                     /db_xref="InterPro:IPR025768"
                     /db_xref="UniProtKB/TrEMBL:Q4QA41"
                     /translation="MQNSVGDVINLISKSEIRYEGKLHSINTEENTVSLSNVRIYGTE
                     GRKGGGVEEVPPTEQLFEFIVFRGSDIKDLTVFRDSSSPQARDPAIVEVHAPARGRGG
                     RAAAAAPAASATAASSAATRGSRSFYDEAQPYSRGGGGGRRGGYGAGRYNNNNGGGSN
                     NSNSNRNHRGGYGGRGGSGNYRRNYRDYHTGQDFKPADIGATEKFEGDFDFAKCREEF
                     EKKKSEFEKAKEDAKSHAKAYDKSSFFDTISCDQKEKNNMNRAEMRKADTETFGPEMV
                     SSMRGFRRGRGGRGRYQQR"
     gene            complement(<200525..>202558)
                     /locus_tag="LMJF_25_0550"
                     /db_xref="GeneID:5652464"
     mRNA            complement(<200525..>202558)
                     /locus_tag="LMJF_25_0550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683756.1"
                     /db_xref="GeneID:5652464"
     CDS             complement(200525..202558)
                     /locus_tag="LMJF_25_0550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683808.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652464"
                     /db_xref="UniProtKB/TrEMBL:Q4QA40"
                     /translation="MTGTQAAHAGGAANSRRGVSQRTSTAAAFSPSSNMRPAVAHPTA
                     VDAAAKQRAQRRLRAKWRAAAAAPQLRGRRAAAWLSVWDSDCAAQRVSMLEALKALHS
                     ASNSNALEEDLGDAAPLLLTRITSWWKLRYGTWVSDAVSSAAAASMKAAAAATAVSAM
                     QKTAAKSGAASAPPLSTTALDFSTNASANGSSEAGTSASAAPSSELLAQVEAITIFLR
                     GSRFLLQFVEGGGAATLTHCLETTASPPLPLSTPLTASGGAAAAAASSPAPALLVQER
                     RAITLLLLHVVNAGRVYREMVGDKEGLLHVLRTLQRETDVLVAAPLTELLAVLGQGHP
                     RLASRIQTGLLRVLADAVKPAQESTATDATSSAGSRRVSEVVVLHTARAIRALQLQRE
                     QHHYAQFYLGDCAEAVLEAGVDYVPIVGMDCAVKTCSFAGMTAGEPPGSSSACDPLLR
                     SLSRSEYLDTLFQLALADQDMALQVEGCQLLSLAAKNLHFTQDILTRCLDAVDDDEYV
                     IHSDQEDANVQQERLRRQRQQLSCGRTTALLLISRPMTRQRRELLLRLVSQRSGHLSF
                     LKHLRLAAHGDTATVVDCCHALQFIVRAAAEMQRQHMDFGGVSRLQAVSGAGGDCTSS
                     AALWLRVTEAVQAALGESMFQLLLFQKLSESDCMAVLRAARATAVPLGGAEAC"
     gene            complement(<203625..>204218)
                     /locus_tag="LMJF_25_0560"
                     /db_xref="GeneID:5652465"
     mRNA            complement(<203625..>204218)
                     /locus_tag="LMJF_25_0560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683757.1"
                     /db_xref="GeneID:5652465"
     CDS             complement(203625..204218)
                     /locus_tag="LMJF_25_0560"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683809.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652465"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:Q4QA39"
                     /translation="MRSCAIVLHRGPVSVRVRPLLLGAALRSVSSRRQVQFAASTGAV
                     HATGVAVSALGEQRRTQYAQMPGKREQEAFLSQFDPLEVLDLPSDSTVEDIDAAFEKA
                     KAKYGPNGKYPDAKMVDRVFQAYEILKDPDSPYYLKAHSSQTDRQRLQFQLLPKSKRR
                     LIEFQVCLLMLIVFGVAVLVMRLVLRPMNRSIRAATR"
     gene            complement(<205172..>206194)
                     /locus_tag="LMJF_25_0570"
                     /db_xref="GeneID:5652466"
     mRNA            complement(<205172..>206194)
                     /locus_tag="LMJF_25_0570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683758.1"
                     /db_xref="GeneID:5652466"
     CDS             complement(205172..206194)
                     /locus_tag="LMJF_25_0570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683810.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652466"
                     /db_xref="InterPro:IPR004861"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q4QA38"
                     /translation="MKVIPPNFGYVEEGIFRCGAPEPRHYGFLASLGLRTCILLTDIH
                     DEAFVHWLQESGVTIFCPLVSESQACSTFRGAAQAYTLITAVDDVTRGNTIGVLSSGP
                     ANANVSNAGKIKKEGREGTTASCSGADGNRPYMDPLGNGNASQVEGDGWPDGNGEGIK
                     EERGAPTGGQSWPATSTGTATAGTSNAVRFLQENVGDRQNGSKFSPVHIPAPLYFPTN
                     GPRDNGGGSGSFEAAAPSYEGKLHGLMTLSEAVVVSILHILLDPQYYPLLITCSKGRY
                     RSGIVCGCLRKLQGWNLVSILEEYRRFAGNKSRADNEEFIELFDEELVSLELSDGRRP
                     TILYNA"
     gene            complement(<207009..>207581)
                     /locus_tag="LMJF_25_0580"
                     /db_xref="GeneID:5652467"
     mRNA            complement(<207009..>207581)
                     /locus_tag="LMJF_25_0580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683759.1"
                     /db_xref="GeneID:5652467"
     CDS             complement(207009..207581)
                     /locus_tag="LMJF_25_0580"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683811.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652467"
                     /db_xref="UniProtKB/TrEMBL:Q4QA37"
                     /translation="MRRVQRTPLRLGAFVVTRRTIIPGHIPTEGPNSNGGNHGWEMRR
                     GHHLQSSVGLHTPIKTACGREFNPQVYYEVLQACCDQQWLVAIQRELRTDTEYVNYLR
                     QHGGAAKDMRMLTDGVQHDDEFMAKLKEKLKTDEKMSLTLCAVQESYVRIRKKRDLHE
                     TQVAADGGRDPYTSLKASRKGDFGSQMPHF"
     gene            complement(<209160..>209708)
                     /locus_tag="LMJF_25_0590"
                     /db_xref="GeneID:5652468"
     mRNA            complement(<209160..>209708)
                     /locus_tag="LMJF_25_0590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683760.1"
                     /db_xref="GeneID:5652468"
     CDS             complement(209160..209708)
                     /locus_tag="LMJF_25_0590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683812.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652468"
                     /db_xref="UniProtKB/TrEMBL:Q4QA36"
                     /translation="MSPSAAPTRGTPDSCRCCHDTTRSSPLLGHVSACCLNDSCESTA
                     HRNSACLLFQSGVSSFLLSSSGYTYVHTSTAHRNTVTAVMSVSSSAAKVAPKTLNQFR
                     NFSYLVVAWLGFNKGFREKAANDAEWVAHQQRVRQQNVERHQAAQAMAEAKQSAGLET
                     TIPAMVPEGLHEVYKDVEKAMH"
     gene            complement(<212269..>213516)
                     /locus_tag="LMJF_25_0600"
                     /db_xref="GeneID:5652469"
     mRNA            complement(<212269..>213516)
                     /locus_tag="LMJF_25_0600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683761.1"
                     /db_xref="GeneID:5652469"
     CDS             complement(212269..213516)
                     /locus_tag="LMJF_25_0600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683813.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652469"
                     /db_xref="UniProtKB/TrEMBL:Q4QA35"
                     /translation="MPIRRPALTAMEVVLAREACEPVLSSVTHRLLRGGFAEYVKFRW
                     AYAKECERAVASAKPTSTGLPSTGVFQPPPPQTMRVAPVSAATAHPAGLSSSSSAPTQ
                     QIRRRRINPEGLKGVFAQSGVLLTSDDYAATVLAYSDPVGFVLADDLLEALHPCRQAP
                     PALTQSVSEVVLSTFFSTLLLPCVAVTMDSVRDALSAVFAAELSREEESAVDVQTAAD
                     QLSALVVAQADVKATFTSTVYAEGAAVPCDDVTTFIVLTLQQHPCLSAIMPARCSSVA
                     ASLRLVPAPSPLGQGAASPIAASTASGTSGPALFSIRHTGSTTQRKFERYEEDKDRRD
                     EWIRGREEADARSTYMCHAAGYGGHLPEYQYHFGRTFHVIEEDLPQLTKPKPPLEPVP
                     ADWYGPGVELKDSRMNAHHYQLA"
     gene            complement(<214575..>218990)
                     /locus_tag="LMJF_25_0610"
                     /db_xref="GeneID:5652470"
     mRNA            complement(<214575..>218990)
                     /locus_tag="LMJF_25_0610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683762.1"
                     /db_xref="GeneID:5652470"
     CDS             complement(214575..218990)
                     /locus_tag="LMJF_25_0610"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683814.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652470"
                     /db_xref="GOA:Q4QA34"
                     /db_xref="InterPro:IPR004083"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR029347"
                     /db_xref="UniProtKB/TrEMBL:Q4QA34"
                     /translation="MLNRRRNADQRRGPGAAVASPPGAAATAAGTAVASSSGATNSAS
                     VIVPAAGPSSHAHEIHSSTALDEVINERVAAFAPCNLPSLVNDDTMDEASGGVGTLGD
                     VALVGETTRYRVRITQAVVLMYLHIGSDPPGFLRVEPCAKMECWVDPMVAHVAKSAHR
                     GGCGSGAGGGSDSIAETLERQYRSVLRDDVGFIRVVEASLEVSKSALAKSRRIARSSR
                     ILIHYNGHGMPRATDLGEVWVFDKERTHYVPLNITEMTELVGTPAIYVFDCNSAGSLL
                     QRWCRDRLHEKRPHDLFVCACSPGETLPLSPALPADLLTSCLTTPLRMALEWYIGFSF
                     HAMLLPHVTEDMIRNMPGDCNDRKSPRGELNWILNAVTDTIAWCTLPPAQFHYLFRQG
                     TSIKGIFRNCILADRLLRESGCTPMTYPALSEEAHLHPMWELWEYTVDKCVSQLPRLL
                     SATDEAPAAYEPSSFFDDQLTAFEVWVEWGDMAEVPEQLPCVLLALTQVLYRVRAFTL
                     LAKYLDSGRTAGKRAILCGILPYMSKLVTQAPEVFLIVTVLWMQVIRADPAEGCNEMQ
                     KCQGEKYFTSLLKLEEASTLIEYVEYGQMVNYARVESPQMPSPNFSPTAATAAPRQKR
                     AEFQPRSQTWASTTSLDGATDAGEQPLQPMQPMRSPLAEAPSPPPAQSGLAAAKLNSV
                     ANHLVNPGHTVYFLMKDVNLSRCKSMACYVLCQFLQRGERQCILSWNNRLLNAAFPCL
                     SSTNAELRSWACLVLSRLFLGLRHAKKFASKECASRLDLFTRLLQDRSPVVRSSCVTL
                     LASIVGVRVDLLPHDQQVRRLQMEKSLLIKLREYIFDASMNVREELIFFCCEVLHAYR
                     GVLSLAHRENIAEYVLEVGQQGNRWALEEAQVGVKSQLNAARPTVSSLFDDTVVFDTS
                     FLTADDPLPPTREVEASKLSPAALQMVEGLLHDAALVLCMLYANCDGALVNKALRCLS
                     TGAPPQSQRFASEALRTMSRVASAESAEYWSEADRTRATWNTDIMRQLVLDMRDRKLE
                     PHRRYAYTGSSPLLSQDSNGHLGTKGNGAASAEALSVSCRNAEAERHLVLRSAVRPDT
                     VVCTAFRALEASMVVATKNQRISYISYDNYNSQQELHSFPVQLSGPLHDVHVINDLSE
                     QSGLLLVDKRGGFTLMKGCWAPYSVPTEAAVFSACPPPPANRWLDLKSTYRSSAAVLF
                     YGGPIATDGGTAIHMVSLAEEQVVQRLSVSGNPVLTSLETHTTQRALLAGFSDGVVRY
                     YDDRQRQGQMGAVGMVSCRAPGAAVTAAVEAVVGAGPVATNTGFSIAAATRSAFFIFD
                     PRKLSEPQLSVTHQDLYYGYGGLEGASLDIGGIGADAAAASLSSSLPNTSTVPVPCPP
                     SAPRIARCSVGIHTGLVGLCFQNNTYAAFNTKGLILNERPLAVMVGGVEEPALSQQQQ
                     QGRQSSGPSILPGSCVAHPLRPLMTFGGELMFLQL"
     gene            complement(<220863..>225713)
                     /locus_tag="LMJF_25_0620"
                     /db_xref="GeneID:5652471"
     mRNA            complement(<220863..>225713)
                     /locus_tag="LMJF_25_0620"
                     /product="putative RNA polymerase I second largest
                     subunit"
                     /transcript_id="XM_001683763.1"
                     /db_xref="GeneID:5652471"
     CDS             complement(220863..225713)
                     /locus_tag="LMJF_25_0620"
                     /EC_number="2.7.7.6"
                     /codon_start=1
                     /product="putative RNA polymerase I second largest
                     subunit"
                     /protein_id="XP_001683815.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652471"
                     /db_xref="GOA:Q4QA33"
                     /db_xref="InterPro:IPR007120"
                     /db_xref="InterPro:IPR007121"
                     /db_xref="InterPro:IPR007641"
                     /db_xref="InterPro:IPR007644"
                     /db_xref="InterPro:IPR007645"
                     /db_xref="InterPro:IPR009674"
                     /db_xref="InterPro:IPR015712"
                     /db_xref="UniProtKB/TrEMBL:Q4QA33"
                     /translation="MSSRSSHYSAKSLSSSAGESMVTSHSTGSSSRHRRTGTVCIHEP
                     RAPPMKMTAMELLQHIRNSITRLKYICERQYHTAALDQASEVAVTSFFERLRKKLSKL
                     EFSRSHIGTPETGGPQQLKYIAKEARQLMSTAQEVVRDTANTSVTATCVYEGMQHHHM
                     QEAMAELEELSALLAERPNEQPSRVSVDLLADLVAFHIDEFDAFMALRVEAFVREMQS
                     EGAFYTGPVMTDASQKATPVGVCSAVLLDVAVGVRPARSARIVLEHARHQISKVENRL
                     HAADIALQECQLAGEVAAEGQQRQRAEVQRREFTIMKERIRHALRQLDRVQQAWLEEE
                     QSIFTRAASGSHDLAALMQTKHLHEAEVIEEVQRLHDQTIHACLPFATPQYHRRYGET
                     YGQPCHVRLGFHFLPDANTAAEMAAAAGSTNAAAPSSLMLRTLSTEYFALMRQLRVAP
                     VDYDTYDYLVPSKEQFWVNFASFPEMVKGARCALRNVDARLDHFRALEEQKEVGGYFI
                     MNGGERILRALLMQRCNVPINIYREKFVTQGPHFSAKAVVIRCKRPSGLTAQNYFYYT
                     TQGEVIFSFARKVVWHLPAPLLLNAMSTQSVSAVELQRLLTIGMPDGNHVARVEALLQ
                     HHRRKPYGDLRHFIDYITVLGRMYREYHQNSSTFHFLPLYAKGSTCQHDAWYGMFMVR
                     RHVLPHLNSCDVATPDLAPDATAQKLLAWLSPALLAELDRKFDAMIAITRQLYLFIDG
                     AVEHQGNDVPAYQELFTVSQVLMGAFEVCLNRYMRGFVYRLARHLPAALFRRILSLRT
                     LLPPVDAEDTMRQVRQFAEFCGRHGGSDPLDQLARLLVTGNINLDREEDFYCPQTSGW
                     VVMAEHLNFYRFFEQLRCVHRGKTIADMRSSEVRKYPCEAYGFICMVQSPDGEDCGVL
                     NHLSVSTISSNSPDAAMTAQLREIVRKAVPGVRSRATLSTVVDQLCETVPVWMEGELL
                     GYLSPADAVEAAATLRERKALTLRSQVHVTGIVRRKDASPLHTLEVVYVAPKSKDPAG
                     LYVFYDCGRLMRPVQRLESSVRKDATHLPFPLVFIGTWEQSWLDIAAVPSDPLDAVVQ
                     LNRKYEYMEQNGTNLISLTSATIPFFEHNCSPRNLFQCGLSKQSSGTQLQALAWRKEA
                     KLFRTYCPQRYISRTLPMDYYGLDDVNLGVNAVIAILAYTGYDMDDAVIINSTAAQRG
                     MLTAGVTVAKIVTASGKGSDKDDVFVFHNLLSTGERFTAELEANGLPPKRANASLDAF
                     SFDRDHKYPGLRDNNDVYCCAKRVERVDPFTNKAVYEYTRHHATKWRHFDKGEDAWVQ
                     QVIPLVYSGPDPTSVLMIFRIPRPPTVGDKFSSRHGQKGTLPLHIRSHDLPFATASGI
                     TPDVIINPHAFPSRMTVGMVLEIMTAKVGAIEGRFIDNSAWSTVDEQPRVAELIGEAL
                     VKAGYNRYGREHLIDGISGEEMKADVFMGICGYQRLRHMVSDKWQARARTDAHTYRAV
                     TKTGQPVKGRKRHGGVRVGEMERDGLLSHGISEVVVDRLLHVSDKTKAFICPRCGSLL
                     SLYERHATEYGTWRTCRFCGAGADESTDSIAMVEIPQVLRLWAAELTSIGIRVVLKTS
                     ELSDFV"
     gene            complement(<226919..>227995)
                     /locus_tag="LMJF_25_0630"
                     /db_xref="GeneID:5652472"
     mRNA            complement(<226919..>227995)
                     /locus_tag="LMJF_25_0630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683764.1"
                     /db_xref="GeneID:5652472"
     CDS             complement(226919..227995)
                     /locus_tag="LMJF_25_0630"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683816.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652472"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="UniProtKB/TrEMBL:Q4QA32"
                     /translation="MRSRDCEWELRNENGHGCIATTTSHTQAKQTQLAVLYLYVSVGF
                     LSRVRPSVVCTRRMRACQLLRRGHMDVEPWMGVSCYPVGPLLVGGVPTIRAGYDHFKF
                     MRPQAPLRAVGLDKPLPPVLFNRMDQIVLIENALALQRTENQISVTLSQLALGIRNAE
                     NFLEKHLMNKEVRPSIHTLWFHEGGLREHPHVLSGLAAHHLVPLFSLISYDVERGKMT
                     VFQAEELYEELMDCSVAQPKIVQRELANQMVRVYCLNDDYNKAIRVVDEMWAKHIRRT
                     FVTYAPLFRMIRGKRDVEQQIKLLSYMCKTEGGRLPKFLFIDVPRMLYMFGVFARYNW
                     IPINVCFTVVCTALTLQYMNYAKW"
     gene            complement(<228586..>229074)
                     /locus_tag="LMJF_25_0640"
                     /db_xref="GeneID:5652473"
     mRNA            complement(<228586..>229074)
                     /locus_tag="LMJF_25_0640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683765.1"
                     /db_xref="GeneID:5652473"
     CDS             complement(228586..229074)
                     /locus_tag="LMJF_25_0640"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683817.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652473"
                     /db_xref="UniProtKB/TrEMBL:Q4QA31"
                     /translation="MSEAVVRAERELYAYVVALQNVLHAATEDAMPQSLWDGAREKDG
                     ELSDPVADGNPHSEMPDTLIQQVERETALERRRIHELVRRQLAPQRAALRAAIVQLGG
                     GQDASGNIIDVPVALLDQEIAAAATESAELGRRMVELYDEAALLATRIEAEVMGKSVP
                     PL"
     gene            complement(<229569..>231569)
                     /locus_tag="LMJF_25_0650"
                     /db_xref="GeneID:5652474"
     mRNA            complement(<229569..>231569)
                     /locus_tag="LMJF_25_0650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683766.1"
                     /db_xref="GeneID:5652474"
     CDS             complement(229569..231569)
                     /locus_tag="LMJF_25_0650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683818.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652474"
                     /db_xref="GOA:Q4QA30"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="UniProtKB/TrEMBL:Q4QA30"
                     /translation="MSLDCEGDGAPCVECGEFDFLPYACPRCCGTFCAAHATCHHIPA
                     HVAPTAPRASSTFPLNKAADDAIMSSSAPLCTPPQEALLTLTEAGATLTSNASSALHQ
                     QRCVVCESVLCALAPCPQCGDCYCAAHRFHGHKDVAPKARQQRRANQRAVSFGPQDRN
                     GATTVDPVAAFCAPFTPAHPLVLAPVGYRSRRTGVLALIVAPPTAAATNLIGSAVGGS
                     EAPTYTIGVCSLIVATEMSVGQLRDRLVGFLRDALVPAVEQEQDSEATGRMLSSGWSE
                     WVSSAHATLFSVAPAATATDSAAAVESRLRCVPALSLVQLPVDAILRKAPIVNATVLL
                     SLINATTAGHTAPEERVALQRLMITFLYGKATCPSAPSSSTAAPSTSARTSAHRDDRV
                     KALATRLYLQHQQLLRRTAAGTREGGVGAAGTAAGNAEGLNSQPPEDRAGASAPETGA
                     LPEPALDAEGDVTPSSTTAIDVAGNVTPLPVASVWPFQHAPPLNSFDFFNTKLSPCGA
                     SAICPATAPRVVVAVFVADAAMPVTLMPMCIALGRDWPLARAVDRLREEVGEQQMAQH
                     RDARAMLNTFSVYRLGSGSGAAAASAGTEGELACLWSGRSSTSTSSAPVTLQNGDVLL
                     LCPADLPGAEAAVKDEVQRLRGLTGKAKSALKADQMKKCAVM"
     gene            complement(<232487..>232774)
                     /locus_tag="LMJF_25_0660"
                     /db_xref="GeneID:5652475"
     mRNA            complement(<232487..>232774)
                     /locus_tag="LMJF_25_0660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683767.1"
                     /db_xref="GeneID:5652475"
     CDS             complement(232487..232774)
                     /locus_tag="LMJF_25_0660"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683819.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652475"
                     /db_xref="UniProtKB/TrEMBL:Q4QA29"
                     /translation="MLRRTCASRGHATSNLFAPPHSGRWFNPPHQWTMSDTFVPAFFL
                     GFSPMAICVYLYHAAYMPQYSHYQEKNYYPAQVYTKEFIHKYNRLERWRWY"
     gene            complement(<235728..>237509)
                     /locus_tag="LMJF_25_0670"
                     /db_xref="GeneID:5652476"
     mRNA            complement(<235728..>237509)
                     /locus_tag="LMJF_25_0670"
                     /product="putative epsin"
                     /transcript_id="XM_001683768.1"
                     /db_xref="GeneID:5652476"
     CDS             complement(235728..237509)
                     /locus_tag="LMJF_25_0670"
                     /codon_start=1
                     /product="putative epsin"
                     /protein_id="XP_001683820.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652476"
                     /db_xref="InterPro:IPR001026"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR013809"
                     /db_xref="UniProtKB/TrEMBL:Q4QA28"
                     /translation="MNFTQQLWSVKEWGRVMATRSEYVQIVHDATNDEKWGPTGPQMD
                     AVCNAYPRGGPEILNELRTRLNNRDKSWRPCYKSLLVIDYLARNVDDRYLPEISALVP
                     IIRTISTSFYYTNPKGVDHGVSVRERAKKVADLLSDGLQLREERMVAAQIKAKLSHNA
                     SDGGGPNSDAPYSGAGSYGGSRDCDRYRSYVKGSRQAYDSYRSSPPPSAVLSRPRTKE
                     EQERCDMEMALRLQRDEERRSGVSAEQLEEMYATKVRQRQSEAERQKVTAEDDERLAM
                     RLQQEEEERARREGVSLPTLNSDKPSSTPVKAPSPNPPATNALDELFAPALFSQPAVA
                     APASSPGPFNSFLNSRSGLPPEQNSWVQPQQQPTRVQNEWGQPQTANDAWGAPQQAPQ
                     QSVPPLQQQQFTPWGQSATVSTSNSWGQPQQQQSNSWGQPQQGPSQQQHVGNNGSAGS
                     WGRVPSSQPRDPWDQPQQTPQPQQASQPRQASQPQQASQPRQASQPQQASQPRQASQP
                     QQASQPQQASQPRQASQTSNSWSKFQQQPQPGDWGQTSAPPPQLSDTWGQPLASDTAR
                     TLDSTNSRGNLGSMWGNLDQFSNQQHK"
     gene            complement(<241220..>246400)
                     /locus_tag="LMJF_25_0680"
                     /db_xref="GeneID:5652477"
     mRNA            complement(<241220..>246400)
                     /locus_tag="LMJF_25_0680"
                     /product="myosin heavy chain kinase c-like protein"
                     /transcript_id="XM_001683769.1"
                     /db_xref="GeneID:5652477"
     CDS             complement(241220..246400)
                     /locus_tag="LMJF_25_0680"
                     /EC_number="2.7.11.7"
                     /codon_start=1
                     /product="myosin heavy chain kinase c-like protein"
                     /protein_id="XP_001683821.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652477"
                     /db_xref="GOA:Q4QA27"
                     /db_xref="InterPro:IPR004166"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4QA27"
                     /translation="MWPGVTELLDRLQNTSSSNLSASRNSKVSLSHRMDLSPLQLHDE
                     AASQRSSTGLAATFGGLSPPLPSHRQSIDQPRRHKNDKHHHHTSCDSSLNPTMGSCSG
                     GVPTSQASLPLLAGMMASRKELFTELAIPSTQSMNGQQQGQGTSSSLVDAAQPPTPQG
                     RVGTASRALSPRALSTLGSLGPSGPVAGLLGTSPSGKDLPNAALRGGFLSESISLVES
                     SVSSISRSALRLHRGRVRDRLPSDREDSSGMDGGRNDVPSQVQLPLITRSLTSACASL
                     QGRQLPTTLQELEGSSAGVELPTLSCTFSLNSMPHEDEGPCLAPALKIVLEASAAVGQ
                     PPRPLHPADLPQSRDERCDVDSIKPSSSFALVQSAGRATVMDMGSDDDAKTREHRPTP
                     IEISDRGGGTSMLATAPVSLTVEASPLTLAGGLTGQSSSQNSTGMAQTTCASTPASPF
                     ARNAAVTPIANSGFSRLDTAVLGGGDYVQEATRPPTGERSSGPKHGSLQSLDHDNYTT
                     AARGATGQQRPSDSIENDDAAHQKRAKRRLKKTRKKGKAKRQKNDEAVAEGESGVAFD
                     ALKAVAVAHRSASALARKRQRKRQLKQEKMKEMSSEERRQYKAEHQRRRAAKKAMRSS
                     AAAASPHLERGDHGDWSGSRPHHSSDPSASFSPAPVPAAGAVKHHPPLSSSPELPQPL
                     APVTAASADPAAKMTSSHARQSSTKSEVEQSVPNLVDRCSSEDLAATLSPQVLASTCS
                     ATTNALADGSSSSLKALQGRRCTSASGGGAPVVPSTTHPFKSMSSTPAPFRRRFFTDI
                     AGRQQHQGGANSFLHESSSTPANVSGLEGQLQARKADAEGFGVERDATLGANGGSADN
                     YDANESRGPPRRQPMDESGAVVGVVPEGAPMSDGSALSLAPHLPAAAAGSGTAAILEL
                     KQQQGVQQRHRLPSLAAGSSSLTAVFVSVANANGDVASADASNVSLMTASASECGADH
                     CQGSSLPLRPDAEASQSVEPGLNQSPTGDALTGAVTKGTAAISVTSMSYCSAYSRSHT
                     NDGVPEAVEPVAKGAGGAEGCGAGQNALTPVAAVSAAVAAARKARQSPSSSCSSLRSR
                     SSDDESADGSTGYSYSSYSSSGSLVPEVLQLVGGCTVPPPVAAFSDLKYRCSCVPQLH
                     SYAEPAIIHEWNLTEGCWGSVETSVVLSPQPFSKGNMRASYYMIDMRRLNCLLVAKRY
                     LRSTVKDDQYFDDVSMHSIAGHWARVFNTMQPPKEVRFVPAAVLILPKRNPPLILAME
                     PQLTGKFVKYNNNCGYVRRKARWTPQAFSHFTYHASDHELMVVDIQGVDDYYTDPQIL
                     SSDGEGYGRGNLGEEGIRRFLESHKCNEVCRAVGLPPLQRNAKGAVIAPLASPGSGRS
                     SAGPGTPAAKDRLNTAIPCAPGLKEERLPPKAFMHARRASSGNTPGHEHNGVQLGSRQ
                     PSEGALKLSPAPPPRQTLHTGSRPSSPSPLAAAPSALTPGPLPHRVGPVQNGGVKYVR
                     YPRQALVRPQSQYFVSTVAGGLMSVPQQGSGVPNGCGNGSFFSALQSYPPASEQSGGK
                     VGGSPTSGSAGAPSGMAGVGHASASPPPQGSVMVAVPLLRPPAGGRPGYAGAQSSVSP
                     EGFHLLTAPRSGENVGSLHQTPHVRPSGTINLGGGVPNFYSHPPLTGAVGSPTGRCAS
                     HQSSFAAVASAIQATEEVAMAHRPRSRRQSFSRRPVFSAVEEMPKRSESRNHGHPHLH
                     "
     gene            complement(<253351..>256587)
                     /locus_tag="LMJF_25_0690"
                     /db_xref="GeneID:5652478"
     mRNA            complement(<253351..>256587)
                     /locus_tag="LMJF_25_0690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683770.1"
                     /db_xref="GeneID:5652478"
     CDS             complement(253351..256587)
                     /locus_tag="LMJF_25_0690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683822.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652478"
                     /db_xref="UniProtKB/TrEMBL:Q4QA26"
                     /translation="MRSVERESCTPTRKRPFYSSMSSAAAAQLQRLLDGYVSASLDGH
                     ERKLLPNGNSACAMSSHTLALDAADVMSCLPFFLSVFGAAGRSVASRRVLRLAPSQAF
                     MAAIGPVTRPTVDEARASNTLSSFILYLGDVVERHLNAFMLAVSVGPPFSTLHFAVEL
                     RHGNASDGRSNKESSSYDCRVCERGHRGGGGPYVNFVAWVALEVYRLLARGAESRQRE
                     RRAAGGATSADAGARTDAYIRWEREIGERVSAAVVAAQQLGTKPPDCSDVSWENILRT
                     ISSAPDAHLDDVFATYPHFFYLFMCAELLPDLQRHLRRCGELPLVRLREALRSTAAVA
                     HMDDQQPTHRARSFSTAFWADTVSLLCCEPTAAASRIGAETAVCNESGFTPTATTPAQ
                     TSIFVAAAVASFLAAPLLRPACRWINRVTSFTSAATPHSQGHPIVADEQNRAQAVMHI
                     LDVCMRSLQLVPLPMYDGCDADMPLSLGSCEMAGNWLIPSTSSPLHVRPMPLFGLQRQ
                     RRAVVLPGLSIAATRIRSLAAAYSGKASTVDAAAPDVSAPAGTCAWSPAGSLAQVLWA
                     ETQLSSSAVAPCCDDTNAPFTSVSAVPHSRLHPVELLLLFEDVPSDAEALARLRAALD
                     VEAREGWVVLAVQASVPKAAQQCIESTWGTDARPVLLLSAVGQWGLQQLALRFNVQPN
                     TSATDLRCLRGVRHRLCRDSGAGHPQERRGCGIAALPLRGQQYAPSSSLSANDGAQHQ
                     QHGKGYSRHARYAAAFVEGREHYLFVVGECTDALEPSACNASAAMESGCTTGTVADCA
                     AAVSQARSTALQLQCSPPTLFPSSISMHFRDDSGESSSSESSDSRSFSSGSTFSDTTA
                     AAAMEASGSDERVMRAWYGDPAVPPIPFVVASVLVGAATRGAQHELVYDIGYHWRLLL
                     HQLVLPEPLCCRVPMSGERGATAMAIRKLDSLLQSPLPNGFASAFPAGVPKAYTPEQL
                     RVLGALRDALLSYELLSLQHGPEGRTLDESWQALQRYTEPTTSPHEGCTEAPAESWLA
                     VQSAYLAVADCLDELCLTVVLGGGNDASANNGESQDSAARGLYFFPVI"
     gene            complement(<257374..>258999)
                     /locus_tag="LMJF_25_0700"
                     /db_xref="GeneID:5652479"
     mRNA            complement(<257374..>258999)
                     /locus_tag="LMJF_25_0700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683771.1"
                     /db_xref="GeneID:5652479"
     CDS             complement(257374..258999)
                     /locus_tag="LMJF_25_0700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683823.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652479"
                     /db_xref="UniProtKB/TrEMBL:Q4QA25"
                     /translation="MSHRGGSFKARAGKAATAAADEPGNTVPLTSPSDALSDRKGADL
                     ATGEATTSGEEFVCVRAIAQAGSSSSAQLTVVHRLLKSVLSAAGNVVRGTDSQRKFTS
                     LYTEFCISAVRSLADVEDAVYELSNPGCRAADAADCEIEGIDDAEFLKQVAAYVAMHT
                     SALGVAYLEHVGRSALEKLQKQQRKRERSTTTGSGSAATSGHRPAKVSRTLIARGAGA
                     QAAHGGAAVDMHGSSHFDSLGLVDAQETMRYALQTIERDKQTAASTPIDAAAASRRGL
                     QAFATTQLGLRYSDARPSGVFLSRAPGGLSAAATTSGGTPLGNGTVAYELHDPHLKLS
                     SIPELSTRMQPWTIPLPSSGVYLDRVTMERDRRGGNASSNGTSTASAAVEPTKAALEV
                     CLAPTPMEFLRQWESREAALAAEQQQQPSSVPAFVGGPYSVVPYAGSGSRAGGPSTGG
                     SPRSTAPLSTPPLCLSPNSNPLGHHPPFLPESEARTSGADVDPISAFSSAFFPAVRDK
                     RTTTSLPTYVMANLSHYGVSKMEYVYTMGLTSK"
     gene            complement(<263490..>264575)
                     /locus_tag="LMJF_25_0710"
                     /db_xref="GeneID:5652480"
     mRNA            complement(<263490..>264575)
                     /locus_tag="LMJF_25_0710"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683772.1"
                     /db_xref="GeneID:5652480"
     CDS             complement(263490..264575)
                     /locus_tag="LMJF_25_0710"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683824.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652480"
                     /db_xref="GOA:Q4QA24"
                     /db_xref="InterPro:IPR007273"
                     /db_xref="UniProtKB/TrEMBL:Q4QA24"
                     /translation="MFQGSSETQELRALYNFEPESANNGRNGTLPAQTPQQVSDGDGG
                     DGENANSGAAIYSPREEQSYEAPTSPAAFGTGGDVSVTIAATSGGDAVTKTKTKVSKT
                     GVLKEVFGVNRKSTRGMTEEQKKTVNLEQRWQNALLEEQRLNDLEQRISREEVVTAEL
                     GQTPNFPPKFLCIHPLVHHSISTVPEHRQLFVKMAFWDWVAVCILLLANCGIAIGVSS
                     APVRSNIVVHDDINKAQNGVLAILHLTGIPLSFLIWYWRIYQGCSTGRPPQHILALSG
                     LLVALAHAIFALVGPKNYGLSGIALAKWIQATRESGVAAPVAIMAVLWAAQAVFTGFM
                     IFKVFVFYRRDLAARRAARRYGMNVVG"
     gene            complement(<265924..>266766)
                     /locus_tag="LMJF_25_0715"
                     /db_xref="GeneID:5652481"
     mRNA            complement(<265924..>266766)
                     /locus_tag="LMJF_25_0715"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683773.1"
                     /db_xref="GeneID:5652481"
     CDS             complement(265924..266766)
                     /locus_tag="LMJF_25_0715"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683825.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0715"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0715"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652481"
                     /db_xref="UniProtKB/TrEMBL:Q4QA23"
                     /translation="MTSVEAENQPVEDPETFVVMEENGAPRDPQVAVSALDEAAEEGA
                     VSGGEREPAAAGDDLSNPHVFKVAAREVDEGYMSVIRGLSAFGRADEEVCRNAVDICK
                     DIIAMEQSLFSEVPSYVTNYASMQRAKTVVLNKAVRPHWTIPTPEGPPRTWEEQRAYV
                     DPGVPLMLPYSAERFKKEHPERALVEGTYHNLFYGDGTQVVFTASADNKRKQIEEEKR
                     KHPHPSYHGPYVFEPQQKKPMRVASDFVPSCAEPDRLRVDLRKKPVTKAKAEKSQKKK
                     VTTK"
     gene            <269321..>269821
                     /gene="EIF5A1"
                     /locus_tag="LMJF_25_0720"
                     /db_xref="GeneID:5652482"
     mRNA            <269321..>269821
                     /gene="EIF5A1"
                     /locus_tag="LMJF_25_0720"
                     /product="putative eukaryotic initiation factor 5a"
                     /transcript_id="XM_001683774.1"
                     /db_xref="GeneID:5652482"
     CDS             269321..269821
                     /gene="EIF5A1"
                     /locus_tag="LMJF_25_0720"
                     /codon_start=1
                     /product="putative eukaryotic initiation factor 5a"
                     /protein_id="XP_001683826.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0720"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652482"
                     /db_xref="GOA:Q4QA21"
                     /db_xref="InterPro:IPR001884"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR019769"
                     /db_xref="InterPro:IPR020189"
                     /db_xref="UniProtKB/TrEMBL:Q4QA21"
                     /translation="MSDEDHDFSHQGGGDNASKTYPLPAGALKKGGYVCINGRPCKVI
                     DLSVSKTGKHGHAKVSIVATDIFTGNRLEDQAPSTHNVEVPFVKTFTYSVLDIQPNED
                     SSLPSHLSLMDDEGESREDLDMPPDAALAAQIKEQFDSGKEVLVVVVSAMGTEQVLQT
                     KNAAEK"
     gene            <270206..>270706
                     /gene="EIF5A2"
                     /locus_tag="LMJF_25_0730"
                     /db_xref="GeneID:5652483"
     mRNA            <270206..>270706
                     /gene="EIF5A2"
                     /locus_tag="LMJF_25_0730"
                     /product="putative eukaryotic initiation factor 5a"
                     /transcript_id="XM_001683775.1"
                     /db_xref="GeneID:5652483"
     CDS             270206..270706
                     /gene="EIF5A2"
                     /locus_tag="LMJF_25_0730"
                     /codon_start=1
                     /product="putative eukaryotic initiation factor 5a"
                     /protein_id="XP_001683827.1"
                     /db_xref="GeneID:5652483"
                     /db_xref="GOA:Q4QA21"
                     /db_xref="InterPro:IPR001884"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR019769"
                     /db_xref="InterPro:IPR020189"
                     /db_xref="UniProtKB/TrEMBL:Q4QA21"
                     /translation="MSDEDHDFSHQGGGDNASKTYPLPAGALKKGGYVCINGRPCKVI
                     DLSVSKTGKHGHAKVSIVATDIFTGNRLEDQAPSTHNVEVPFVKTFTYSVLDIQPNED
                     SSLPSHLSLMDDEGESREDLDMPPDAALAAQIKEQFDSGKEVLVVVVSAMGTEQVLQT
                     KNAAEK"
     gene            <272222..>275500
                     /locus_tag="LMJF_25_0740"
                     /db_xref="GeneID:5652484"
     mRNA            <272222..>275500
                     /locus_tag="LMJF_25_0740"
                     /product="putative DNA repair protein"
                     /transcript_id="XM_001683776.1"
                     /db_xref="GeneID:5652484"
     CDS             272222..275500
                     /locus_tag="LMJF_25_0740"
                     /codon_start=1
                     /product="putative DNA repair protein"
                     /protein_id="XP_001683828.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652484"
                     /db_xref="GOA:Q4QA20"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001510"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QA20"
                     /translation="MSNFAKHPDLTLNERLVWRPAKGKEHVYNYIVQKSPTARARCRK
                     CSQLIPKGEMRVGVPIRHNAGDNGWISAWQHLGCTRMERSESEDYKNTMHGFAALQPE
                     EQAHVVNEVHSTEMPEHLKPLDPEDLVHRGKMEQMAPPSTLLRHLLPYQKEGMGWMVR
                     QEVESPVKGGILADEMGMGKTIQTVGMMLAHRINGPTLVVCPVSSMLQWEAEIKEHVV
                     PGSLSVVVVYRTTKVTKEELESADVVLTTYPMLEQAWRALISEIKVPCPYCELLFIPR
                     QLVVHNKYFCGPRAKKTQKQAKREKHTTPAAASSSRSVQCAETIRKGLRTLHVDMGDE
                     EDAEKEVNAPNATTAQPQRKRGRKGAVNIEGDPGGKVNGCGTPTAKKGKQEEWGSKVA
                     NGCRSSPEKANRKCPVKAEDHNDEGAALAQKGKVLQPAAASRGVVGPIGMYQELMREA
                     GRTVLSRWDAARKDDESSSDEEVEDESSEESDSDASNLSYNSAAAAAEEAAAAEQASK
                     ALEAFRCAACHFQLLRYPFCPRNGQHHVVREELRDIIERDTGGDDVDLDASIFHSIKW
                     ARVILDEAHRIKGRTTSTARSAFALAAEYRWCLTGTPLQNRVGDLYSLLRFLRMRPYA
                     HYYCETEGCSCASLSHPFSSTSLHQCVFCGHGPLQHHSYFNRYILNPINRYGYIGDGR
                     RGMMMLSNDVFSRAMLRRTKVERAADLQLPSLTIQVHCIKLTKEERNFYESLYKKSTA
                     EFDTFVHKGTVLHNYAHIFQLLSRLRQALDNPLLVMEGMDVGPVVNVKGVCGICGDGI
                     EGESALKVHPCRHQFHRLCLGQFLESAPDKELHCPTCFVRINVDLRQLRQDAEGDDDE
                     GVGGFAAALPPELEDEVNSEISEDDEQTQALQHVESKVKRRTAHARPTKKEQRGIFAR
                     LDPQKPLHGTKLDAIANYIEEVPKDEKVVVFSQFGSMLDLTQYWLQRRSIRAVKLCGS
                     LTLTQRQSVLQAFLHDQNVRVILISLKAGGEGLNLQVANHVVLTDPWWNPAVEMQAVQ
                     RAHRIGQTRPVHAVRFVTEHSVEERMVDLQDKKMLVFEGTIDGKLQSLNKLTEEDLQF
                     LFTR"
     gene            <277696..>278916
                     /gene="PP2C"
                     /locus_tag="LMJF_25_0750"
                     /db_xref="GeneID:5652485"
     mRNA            <277696..>278916
                     /gene="PP2C"
                     /locus_tag="LMJF_25_0750"
                     /product="putative protein phosphatase"
                     /transcript_id="XM_001683777.1"
                     /db_xref="GeneID:5652485"
     CDS             277696..278916
                     /gene="PP2C"
                     /locus_tag="LMJF_25_0750"
                     /EC_number="3.1.3.16"
                     /codon_start=1
                     /product="putative protein phosphatase"
                     /protein_id="XP_001683829.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652485"
                     /db_xref="GOA:Q4QA19"
                     /db_xref="InterPro:IPR000222"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:Q4QA19"
                     /translation="MGIPLPKPVMTQLQERYGNTIFRCGSNCVNGYRETMEDAHLTYL
                     TDSWGFFGVFDGHVNDQCSQYLERAWRSAIEKESIPMTDERMKELALQIDQEWMDSGR
                     EGGSTGTFFVALKEGNKVHLQVGNVGDSRVVACIDGVCVPLTEDHKPNNEGERQRIEN
                     CAGRVENNRVDGSLAVSRAFGDREYKLGSGSQLEQKVIALADVQHKDLTFNSNDFVLL
                     CCDGVFEGNFPNEEVVAYVKQQLETCNDLAEVAGSVCEEAIERGSRDNISCMIVQFKD
                     GSDYAAAPHTTVVPGPFSAPRNSGFRKAYESMADKGNTTVGALLEKRYDTLKAAEALT
                     PEETEELSQFENGPEAKLTGAERQKWFSNYFQKLCEAASNGPSDQMERLQSLQQQAGI
                     PLSILLSLMGEQTQ"
     gene            <285374..>286420
                     /locus_tag="LMJF_25_0760"
                     /db_xref="GeneID:5652486"
     mRNA            <285374..>286420
                     /locus_tag="LMJF_25_0760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683778.1"
                     /db_xref="GeneID:5652486"
     CDS             285374..286420
                     /locus_tag="LMJF_25_0760"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683830.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652486"
                     /db_xref="UniProtKB/TrEMBL:Q4QA18"
                     /translation="MACLSEPSFLLRHIRRCGADEPRQTSQHTTASTTGATSDSSYTT
                     EVFLKVGVPASFVPADSSSGTASPAPVCYMCPAYILQAGCPALRELLADAFEGDPGGV
                     RGVGDKVGANSAATVALRSSSPVAVPLPFLDKDVFDVVAVYLEHFHALDYTTSASIAA
                     AEAHPSPTFLSSPARVPSSLQRPLNFQDLYALSTWEHYYVLCQLLGLERSQVDSLRLV
                     ECGAWVDLLGGATAVPLPKGETQQQQQRQVTVAHEVALSQQRAECFSLANRRRMWSRL
                     CHVLGAASQLGMPTLRLLCATVAADMLVDLDEAGLARLMQPSGDGGSGSGIPPFTAQA
                     RAQVLERFPWLTPR"
     gene            <286874..>288424
                     /locus_tag="LMJF_25_0770"
                     /db_xref="GeneID:5652487"
     mRNA            <286874..>288424
                     /locus_tag="LMJF_25_0770"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683779.1"
                     /db_xref="GeneID:5652487"
     CDS             286874..288424
                     /locus_tag="LMJF_25_0770"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683831.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652487"
                     /db_xref="UniProtKB/TrEMBL:Q4QA17"
                     /translation="MFSWCTTLSLSLSFFLLSSSSTHMRTYMCSRACNLFRVQFRPPP
                     TPPPTRPSPSSSSSRFGAFWLFYSVVSSTHVLQVFRAKYKNQQCHRLTVKRMGQSASS
                     SQENPSTGEGFVASATHYEPRRAGRAESPAMEVQSMLCTLNFPPSASGAGAEGVYSPP
                     FTASSAVNANGAAAVIPILCLDASALDIRQLFKSLELPPAQCAKALQEASRKASGVLL
                     HAPANTSVDVLRQFLLSQTTLSAPANTVDSGALTLHLFALRRPLLSIADGAAADVTPS
                     CATAEASSNSLVALAESMELSELSMNNQLFVFPLLGSSETDCNPLAKDHGGVGATDSY
                     WAALRREEAEVEEAAAASFSVGAGDPPTTRRALVLLYTHETRFGFDGDDLLLLGCCTS
                     ICACIAAGICCCMNAAKDNQQPNHVNTKPNYYGGNGVPQYYHNGAGNAYYGQQPQQNY
                     YNSAAPGYGMPPNAYANTNANVLQPQLLHQNYYGGGYQYQPQNQQMNGIPIQSATYVP
                     SAPAAGPL"
     gene            <291321..>292244
                     /locus_tag="LMJF_25_0780"
                     /db_xref="GeneID:5652488"
     mRNA            <291321..>292244
                     /locus_tag="LMJF_25_0780"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683780.1"
                     /db_xref="GeneID:5652488"
     CDS             291321..292244
                     /locus_tag="LMJF_25_0780"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683832.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652488"
                     /db_xref="UniProtKB/TrEMBL:Q4QA16"
                     /translation="MADRGKIAPVAASAPMEGAGESLVSVLCVEATYKIQRVFDRALS
                     AAATGSAAATEELRKLPGMQLCMSPDTPIHAIRAFLQEQEAVALSSSDRRAAAADKEQ
                     QNTNSLANAHFFAILVPPVSSEGAEAVEAFLPLQNTATLRDVLASGPVLRCTDDASAD
                     AAEQMLLLVYMRESEYGLDGGDFLLCALCAGLCACCIALCASGAGRSSREKRDRRECE
                     QQQQQPQYPQQPYYANNVASPPNPGYYPGNMPAGQPYSYGAPPEYPVPQPAYYNYSGQ
                     PGQEQLPQPGYQKQVPGALSPSTNADAPAPL"
     gene            <296961..>300059
                     /locus_tag="LMJF_25_0790"
                     /db_xref="GeneID:5652489"
     mRNA            <296961..>300059
                     /locus_tag="LMJF_25_0790"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683781.1"
                     /db_xref="GeneID:5652489"
     CDS             296961..300059
                     /locus_tag="LMJF_25_0790"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683833.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652489"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q4QA15"
                     /translation="MSVAANLENPPAPPLPGSPNAPAVASRLRGSRSASSWSDKGDSL
                     ASSPTTAYIRAACRRVLEPVQAVLTQLNSDKLHVGASVVDLAVQHPLPCLRVELVRLL
                     LLFKRWNWSMCAPVAVAAGVGDMDVLTRLLSVEELEPNLGYPLRVAVQCHQNEQVLPF
                     LLSHHRIKPNYGSAFYAAVVMGNVEAMYILGATAGVNVNSFVNSEGTSALLYALRQFL
                     MCSSIAAAAQQPSPTTASAAVHSRKPQRGITPPSSPLPSTAEQGVATISPFLAGAVSG
                     GARAPAKHGLCNLPSGDADGSGAASYAAAAAAPYSGAPSASVSSKAMGPLWQCDKTLF
                     SNASAAWAMDDGHEGVTAVAHGEDRGEKHGPSFRQDTATHRLRTAQHWKAVLLYLLDH
                     PAIEVNAGFYTTPLQIAVLAGNVEVIAWLLQHPHLCPNRLPKAASVLQDSHCLVQRQS
                     LSEDALKRLIATPVEMAVQLHQVEAFQLLVGDQRVRMPVRLTMDLERLAWSAEAIPYL
                     TILAQYRADWEGWGWRSRRQCLLIATAASCVVALCSWAVWCAWYDSLQVCGVVLVYTY
                     AVQVVMAIILFAWEAYMVRATSSAAQQSAAKPAPVLVAFVQHLVPAWSGARQCSASAV
                     LLLCPGMVPVLDLLCAWSLYKIHRSRRPLQTAARAGVAAPAASPQQRPFGPTDSSTSH
                     AGLSHASRERVDRSRRQSMWFSSAARGWCGLSVASNVSGHDSFTEAPCTANFSLKENF
                     SCPRPATVRTRRQVLTGGGVQRRLHAGGGSPASAAAEGVAPASAHRLIACTAGHATAS
                     DGEFVFRTVSPIVTNSITFSPSVRRRDPWVVPGRPSRFAVSTEYHAPDLTLRALAYVT
                     YDWLLVAPRLLLSIVGIFMFTHMVFPSSPPASSSPPAAMVGNGSVLGVGRATPPRSST
                     LVSDGTATHSIFTLHHYARPLSAVPTGAAAMTVETNPADLPHFTTMMGLVGLCGLVAS
                     IVNGAVLLAMATSLRTITTQSFFASPKGKCSADVGRGVDGLVLRHCEWDGPRRAADSR
                     AD"
     gene            <300558..>301289
                     /locus_tag="LMJF_25_0800"
                     /db_xref="GeneID:5652490"
     mRNA            <300558..>301289
                     /locus_tag="LMJF_25_0800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683782.1"
                     /db_xref="GeneID:5652490"
     CDS             300558..301289
                     /locus_tag="LMJF_25_0800"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683834.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652490"
                     /db_xref="GOA:Q4QA14"
                     /db_xref="InterPro:IPR007853"
                     /db_xref="InterPro:IPR024158"
                     /db_xref="UniProtKB/TrEMBL:Q4QA14"
                     /translation="MLHRPALLSVSRRPVVHRGSHVGTRVANALAPRLQPALRAQLPR
                     ASFSAASLVASSRRWCSTGLSSSDTPSRDHSEVKTPLTDTSVAGLTGLAAHDNATAST
                     TTVAEHLKHLSPEDQQRIIAALQAPEKEKSSVMGGSGIGPADGDMVAAFTCGPCDYRM
                     VKRFSKHAYTKGIVIVECPNCRAKHLLADNLGWMEDTATNIEDILKAKGESFVRIGGT
                     EGDYQVVVDPGPAASSTSFAATQQP"
     gene            <305307..>308375
                     /locus_tag="LMJF_25_0810"
                     /db_xref="GeneID:5652491"
     mRNA            <305307..>308375
                     /locus_tag="LMJF_25_0810"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683783.1"
                     /db_xref="GeneID:5652491"
     CDS             305307..308375
                     /locus_tag="LMJF_25_0810"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683835.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652491"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="UniProtKB/TrEMBL:Q4QA13"
                     /translation="MSTAVFQLFSKLAGVTSTDQQRTSSAFEMAPPQMLLPTDEECVL
                     YGQKKPIVFFYEPRGAQQLASGAADGNSGPGAGAAVTSSSRTNLLQGWPAELSAAQLT
                     SPGTAVHALRVTNAEDDFHKTLSTQEVWADWPQTIRGWQLCPMSHLCAVVRTNGAAPH
                     LYLLASRYELVGTSAVYERYLLLTPPSKDSGRDAASNVLVRAATAADSASISVTELRT
                     LRRIACLCRCFCSSGAEAQPRTARSRGVSNDTLAPPPPLADYVLHLVPTSLQYTFCFA
                     ATALLSAADEERCQSWAMTATALSRLKFSSHHQSCSTIEAANTSGALSDGGHTTYFES
                     ATQSRDRSTSAVRVVEGGGGGTTSASGAGFSEDPRSAPSTPARPLFAMGRMDEQRGDS
                     LSAARHHEDMHEDGESILEERLPPSQRWRAMALRRLLDTSFYDEQVPAGWRRWRYASS
                     GILCRPLVVDSLDGIVRYIHGSRLAFYTAVAFLDRFIAVTVDPLANFFAYKRQLQRGR
                     SRQEMDCRMLAMHGTRPTDPPIAAELHAEQLCDSGLDGGVQAREICSFLTQVIVVCIM
                     LGSKTVDLYPPRIRSLMGCVEDTAPISEEDFVILEFHVLLTLGFPVHPVTLFEAVGAL
                     LTFSTSDDLYGTLTASHTTRRLLEEHQDRGHLIDDVDRLMQEEAEEEEAAAVAGSAQP
                     HPALRAAALTPAGRRAINDWLRLRLFTCFICDEVIRANAGGSAASSSASASSASDSTP
                     RHRGGGVSSRMAAEEESKVPDGGFSVLQFSPVLVAAAALVIAAEQLRVPLPAPMLRLV
                     PAPMQARLREAPADGSSDVGRSSGGSSSGRVMAASRRRDQSMSTCEVVMEESNMLGRG
                     AGADAGHNEASTGLRLTAGATDDHYKVLVELSLLLEQELNRLSDDSGLYGPPPLASVP
                     AAGATPTSINLEVEEEQVGAGSCGAAAVAGPSPCPTHPYTGALSRGGTARRGAPLTSA
                     ASPRVRPASTRAIDMFGRIIAHAKAIHYRSRESCPPVLLHRYQPLFRDGV"
     gene            <310856..>311239
                     /locus_tag="LMJF_25_0820"
                     /db_xref="GeneID:5652492"
     mRNA            <310856..>311239
                     /locus_tag="LMJF_25_0820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683784.1"
                     /db_xref="GeneID:5652492"
     CDS             310856..311239
                     /locus_tag="LMJF_25_0820"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683836.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652492"
                     /db_xref="GOA:Q4QA12"
                     /db_xref="InterPro:IPR002777"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="InterPro:IPR016661"
                     /db_xref="UniProtKB/TrEMBL:Q4QA12"
                     /translation="MTTMVKKNDVPIDVTWEDQRNICVFSRLHRRAQTLNRRLKLLRD
                     DIEKLDDASTEAMICDEVKYVFGEAFVDVECDQAVDLLDEEKQRIESEKEEVEAELKD
                     LDVTLTELKAQLYAKFGSQIYLEEK"
     gene            <314250..>317447
                     /locus_tag="LMJF_25_0830"
                     /db_xref="GeneID:5652493"
     mRNA            <314250..>317447
                     /locus_tag="LMJF_25_0830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683785.1"
                     /db_xref="GeneID:5652493"
     CDS             314250..317447
                     /locus_tag="LMJF_25_0830"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683837.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652493"
                     /db_xref="UniProtKB/TrEMBL:Q4QA11"
                     /translation="MHLACFPSLLSRPFRAPSFCVVVMQYEKPAGVMHEVIRRAFDEL
                     RLHNNAQGAITIVTHAFANAEGLPLLKSGKDLNGNTPPSTPRAVLSRSDGVVSRVRDA
                     TASIVGAPTLSSMSENGYNHSTFRPRLGGSSSMTRATQAASMQWLSAGSIGASAPLPT
                     STASATAIASLPAGSAECFSKHHYFNRTQALRLLLIRCEAYSVMKQHNRALQDALNAV
                     EVSEGQSAEAYFAVGREQRRQFNIVESASAFDTAEALLHSMQQAIAAGKNVVDGWIQE
                     PTSEEDFWAERGYQMSEVRALGITRREYELQERAAHRDSLSNSDSPPLSPLGRARTDP
                     LSPVISGSSWRGHGHGFEPSFADTGGSVLEVPTSLNDSATTLSFAGESGADGGAAGAG
                     NYVRDLLRCGMSLNELAMWRRLSNESRALLAMRQSHTVPSTLLGATMTLLDRRIASVR
                     GGLIISIENNLSVPLHFIGVVAPDGLYHDAFSFPDVIAKTHCGVSMLHPRGWGGYSGC
                     VCYELHEQLSCFFYFECPLLGSLKCGVRFVEHRASDLRRAFAEMYKETGIYGIEGGTT
                     PSAIKSPPHTNSGAASGHNGARIGGNVSIRGATTPLATTLANMNAARAAIRTPPSGTW
                     IASHTAASASRRPIKATGRLNGTQDIAFSLSEVLAVRLRSVELAPALEYVGAATLKKL
                     SCVSHRYRELVNNLPPPMFYGTGRRSYPDYCVASDRYSSPWIVRDMQPVTWKLVFDGR
                     LADQEEFSISDESDVQKHILCFSADAQTKVTGYVYFGDKRCLQYIIKESWIPFSNTLY
                     ISTPVGRTFASCVATNNQTQFTLSLTSSGGGGNTKGGAAKGGDDVLYSARKRVPPAGD
                     VATPSARAGTTAVTATTMSTGVGGGNGSTLHSRGSLAPAALGVESDAATGIVEGANNV
                     GVSATRRATAADAASSTIGGSSGGLGMLTLPVTTGGIAKATLYSPNVTIHPSPGKPSS
                     ETAFNGTLTAVSVASGKPEYYSIWRSQRVSGGAVVRSTSPATTNGGADIVAEVKVNPV
                     LYGMVTKGYCAAEITLYPGADAMLVSLMSFLMTRW"
     gene            <319744..>320880
                     /locus_tag="LMJF_25_0840"
                     /db_xref="GeneID:5652494"
     mRNA            <319744..>320880
                     /locus_tag="LMJF_25_0840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683786.1"
                     /db_xref="GeneID:5652494"
     CDS             319744..320880
                     /locus_tag="LMJF_25_0840"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683838.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652494"
                     /db_xref="UniProtKB/TrEMBL:Q4QA10"
                     /translation="MFTKKGWRRRYALATHEGLGLCRANPRDKVSVLAGRPLKILHAK
                     SFIPFAKKRNGEVEMQPAYVVDDVSAARHPEAPQKSHNGICSGAVSLAEGGSSTASVR
                     DLTSNDNKCTYYYFGLSFEEHRKRYLLLLRTFSPQDYIIWSTYLPLCGHEGSTSRIVP
                     TGHPLEADRPQPIDHNYRRLTEKRESMLPSTVTLYLDPNPCTVGERVKVRRLCLDWDE
                     GERRRIFTTAVDRVRSLCGISESTGSASIAKMQDKSEEECRKVVSSLFEELSPAMPKS
                     EDTHPPRRKDTTMPKRGVATTASVGMAARSSGAAHPHATHIDTAEGAANGLSMRERSK
                     QSASQCFFPNLLVSSDGAGSGSKEVRKHPKLENGGAAACSSLKS"
     gene            <323812..>327255
                     /locus_tag="LMJF_25_0850"
                     /db_xref="GeneID:5652495"
     mRNA            <323812..>327255
                     /locus_tag="LMJF_25_0850"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683787.1"
                     /db_xref="GeneID:5652495"
     CDS             323812..327255
                     /locus_tag="LMJF_25_0850"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683839.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652495"
                     /db_xref="UniProtKB/TrEMBL:Q4QA09"
                     /translation="MGCHTSRTLCTDAHGTAAATGAATQLSTYAGAPLDAVVAYERAA
                     LRLSHDLNHLRRSAETTTEIALVRSIASTPTGGNGPATASQPPRRPLLQFCIDVQKAL
                     RQQHEPRQHHRHTYEKEVVAVETAYQDGVPVLLQELAWEWCSSAAEERQGKTSNAGRP
                     SALSAEQMAAWKTHTAQLLYAYVSSRRYKKALRRARKAAATGARVLHPAVASAVGRGG
                     EARSDGERGAPEPRVFRTLFKSYAGLGRSLTTSHSAAAGAAARSSSAVNSRSAVTPSM
                     WCAALCQFVSALPEPLMPSLCSRRLEPFAGAPPSRSAAATAPTSTAHATYVEVRRVVS
                     ESFISTDVVAYITFCYVLDLVREHRAELTGDEVEAVAKAIVREPSLPQTTREVAHACD
                     PEARMFWPPRTSVAVSSTAAAAAAAMVRGKVPGEDGRRSGNSIKDGSGRKGVAAAGGG
                     ETGTHSQLAAAKPAVCAAVEVVVKAPTPSTTPAAAGGGMRRPSTSSSSATGSEEDDSA
                     SERHPPAAAACAIPAAAQRTEDMHRAPPVSQQGSSKTGAAAVSHPQPDRKERFIASSE
                     APFVKGTSSVGENSSSVASVHRRQVAQRSATQLMPPSGDENVQRSSVLASRPDLTALS
                     MSRLNSALYSSALEDPAAVEAEAEDLRCALQRFSDSSLPAAASIRNHDDDGDGIHSRS
                     PSGESGSPQDSSIDDVSTPLAPVPPRPPQLSSPHRVPLTSTSSQRDEPHLLPKCGGAA
                     TPTPAVALLPLPLAQRTAAPLPATAFRAQAEQPLLTALMVAKQHFLAAVKMTPARGAA
                     AALSPPQTAEVVGRTAAGGKGCSGSFVDRRLENVMARAREMGWTSPESLIESLKAAQW
                     HSHGKTPAIAEAEAAALPSPHVPAFKPDALSSSSDRHAQPRLPQPRDETPHQARKGAA
                     VSGANSSITECWSGHGPVSQQPHTPHQGADACRAFPSSRTESADSAMRVEATRVLCSG
                     GAAHAGLPSESLLSPPAAESSRVAGTGHAYPPAPLQGHEGLVSSGLTNPLTRLTMPTS
                     ATAGAAAAQPLIELEQELVKLRHLVRTLESKQFVHAHQSSAQASELQAQCAELQHQQL
                     AQAKELRLALARLISVGNELEGLRDVKTHLQMQLTASQQESARLRDALLMGETRARDV
                     Q"
     gene            <328042..>331416
                     /locus_tag="LMJF_25_0860"
                     /db_xref="GeneID:5652496"
     mRNA            <328042..>331416
                     /locus_tag="LMJF_25_0860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683788.1"
                     /db_xref="GeneID:5652496"
     CDS             328042..331416
                     /locus_tag="LMJF_25_0860"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683840.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652496"
                     /db_xref="UniProtKB/TrEMBL:Q4QA08"
                     /translation="MLSAPYRPRVVPLLASDGQQLMEKAADAAAGDFGTYPALQRPTS
                     NVRNRIGGMGSSSADDPQTSPPRCGISWNRLHGASAYSSPLGHQYHADEVPPSSSVVE
                     AVPSTAASRRYQQLAAQHLYGAAGSIPAAVSAPSSITPATSGSGAAVRSVPFSELRYT
                     DSRGHPLPSAHESGCLLHGAKRGGGSGGPALDNPAVGSSGQRGAATEGCAEANELSAP
                     STSAMTAGEALRSSSVQGLGDVQSTSAVKQSASAWEASQLTPTQSRSSTATPSSNATV
                     AVTADDRPHSRGSTTRRQLQRQLQRQRSRSFPSRIRAPATFTAGKHPPPPRTAHWAVK
                     LIEDFVTQVAVQQESAATAPTIVPLYGAANALGRRATAGGRDATTTTTVADLTATFLS
                     SRYGALQQRPILHEFAACLHRYRLLSPTCAVFREYFIHVDAENLADFHLFCRLYAAGD
                     IQHCSTVETRRVALATATAASVHTIVSRRYIDEREVGDRLQRMLQSVVLMDCAPCIVV
                     GADGGAASRAAPGDVTMSRQPRVRVQYRYAREPPTHTKWVPQRRHLTVDEIRRVKKAV
                     LGWMEEAARKGTAECGCGAVGPYEAADTADDAWPEAAGGVDLQRVAFDREGGVDAYAL
                     LQATVEAVKLVCCSRHPAPERRDEDAGHVDGGVKRIEKASGRSQHLQQPYQPVKSTAR
                     SPQLPRELVSPPSQAYMYPLEEVSLSPPRPQHRSSVQRPTQPEGEDDGNAEARCMTQT
                     RQEPSSMPSRTSVSTGVSAARVLADSLLLSPSCNNVVSQRCGSRSSSGRSHSLHLRPS
                     AGQRTFSLSPCRRVAAKGRRSNSPASRVQQRGQNRGEREVEESRPPSSRGEPYTHHPY
                     VTQLHGNQLWAEAQREAAAASQRRDSCWRDHYPRIYPRVQRTPSPRKPTNSACAAHAA
                     FALSSSPVDATSDSIDAELRRRQARGRDGHLIEPRQMTASSVDLSSRACAAPEVLFLA
                     NTQEVRCGARPADGLQLPRSFSPVDPPASTVTYPSRIHPAAARSSSSAAPAARAIRAD
                     RSTTVSSSFPALSPRTMSSPTAAKVAVVSARPHVSHEEAAATASNAVLLTDEERAMLN
                     QLEIALNRLDTQHQRNRVAIASTAAAGATAASKAYA"
     gene            <336027..>336905
                     /locus_tag="LMJF_25_0870"
                     /db_xref="GeneID:5652497"
     mRNA            <336027..>336905
                     /locus_tag="LMJF_25_0870"
                     /product="putative protein kinase"
                     /transcript_id="XM_001683789.1"
                     /db_xref="GeneID:5652497"
     CDS             336027..336905
                     /locus_tag="LMJF_25_0870"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001683841.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652497"
                     /db_xref="GOA:Q4QA07"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR022495"
                     /db_xref="UniProtKB/TrEMBL:Q4QA07"
                     /translation="MSSSNAQAELGPGGSTHSIELGRLIFQGAESKVYCCSFYGALAL
                     CKHRFVKRYRDPSLDERLRTQRTRREARALERCVKKGIRAPRLLGADYINTFLVMSYE
                     AGPTVKEALDIEHAAYMQQVSKGKSTSAQQQQPQTTPSPSALGNAAPSPVTAALLQSI
                     GVVVARLHNANIVHGDLTTSNFICTCDGLEAAAPGADGADALASSSPVLPTAEDIVVL
                     DFGLISEKYSTEERAVDLYVLERAIASTHPYLSSFASDIILEGYRSAADPKKGEEALR
                     RLEAVRARGRKRTMIG"
     gene            <338363..>342370
                     /locus_tag="LMJF_25_0880"
                     /db_xref="GeneID:5652498"
     mRNA            <338363..>342370
                     /locus_tag="LMJF_25_0880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683790.1"
                     /db_xref="GeneID:5652498"
     CDS             338363..342370
                     /locus_tag="LMJF_25_0880"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683842.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652498"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR003591"
                     /db_xref="UniProtKB/TrEMBL:Q4QA06"
                     /translation="MLSLRFLSVHMNSIKELESGCLRTLRHLVELDLSANELREIPPG
                     CWDGLGHLERLNLSSNQLTRLGPAAFGSLASLQWLSLGFNSIIDLAGLRSVPASAPLA
                     YVDLCANRIATLDEVIDALTPHRTHLQELRLESPSSRSSMATAAAGSGAFSTPATMNT
                     SLNDSQDGAAAYWPIEENPCCLTTDRDTQDAGGGSVEVSGGAAGGQGNSRVHGAVGSS
                     PSAANYVERLLSCFPRLLVVNGVSYGVDPLHALRQQRRSQEPEVQEVGPSAADATVAV
                     ADVSPLASLCNADKSAWDRSLLRAGGAENPPAGVERLADGTPVSEAFARLLRRPLPHL
                     RWSSSSSRSPSSASSGGPKKQRRSRNRHRADSRHRTYSSSRHRSRPSSSSPSPPRESS
                     RHGHRAAAAPAAAARAEQDAGWLLPSFKSAAPATANPLPPQQGPQAAPHKTREVGDES
                     VVAAGAASTKEAPLRHGRRAAAAKPRRASLRRRSSSNASSLAASPLSGAASSPLAVSP
                     SAPQERYREREPKTVVSSSSRATPHARKLRCEVATLTSATEAFCTPSETPSTGPRMPS
                     ADKSSDLALPLMSPSPAGVTDTSDISPPAAAAHRQCEHRGSDGESYEKDDSLATTTGS
                     GAVMRVASKDRATLDPPPPLTGVGSAAALRWKPKQVSRGTCTEQGAQTLSTVSRDAEL
                     TAKVDQLQEQLALRTTTISDLRRHLDLTRTQYVEGQREAQQWQQQLRSQVSALKDELA
                     RRAEEATILQRKQQAQLNRAVDSVKVEWARRLEAAEQHSAEAYAEATAAWEVRLARAE
                     EQELHMQQTVAVKSAQLVTLERQTHAMEAEMQAIRGRLVTQRHHWAAQTGLLLAEADK
                     RRSLEAAAVASLAQLCRSFSDAVVHLHTESLREAERGRARAEDALREQQATWRAQVAA
                     YEDAIRHAASEVRHAVAGQHGAAYLSPLPPTCTLPTLPEAPPLSLAMIPSPTLAGVPA
                     PQHEPLALSDQISSNQVVSAQAGAIERDDRKERTPLAVERTAADGSALVSTSTTESLR
                     VAEGEDSDCDAGAECGAASKELKQVAGVNDSGTLIAYWRCACARVEARLHRVDAALHV
                     ATLTQQSTAAENTRLLSHVEALEAEKKEALAAHHSTSEAAVQERDNLLRTLHTLRADM
                     ERKEAALDALEEEAHAKLNEKRHRIAELEDAVEALTTQQARATEVNVSTRGQLEAAQA
                     TVARLQQELADAKEQCKAVTQQQVEQVPDLERKQRELSELLATRNAEAHQHQLEKKAL
                     VHALTIAREQLVRLYESHQLLSSAHASAREQITQLQAKLDTAQRQVHELQEATRAKQK
                     ATFEVLSHLMTNNAL"
     gene            <343151..>343909
                     /locus_tag="LMJF_25_0890"
                     /db_xref="GeneID:5652499"
     mRNA            <343151..>343909
                     /locus_tag="LMJF_25_0890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683791.1"
                     /db_xref="GeneID:5652499"
     CDS             343151..343909
                     /locus_tag="LMJF_25_0890"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683843.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652499"
                     /db_xref="GOA:Q4QA05"
                     /db_xref="InterPro:IPR012678"
                     /db_xref="UniProtKB/TrEMBL:Q4QA05"
                     /translation="MKRLSSHHAIVCGAASATAASTRFGDVVGGGSSCTATSPLFAAQ
                     RGRFYRPLVNQGINLWRSRMGRLHKGWTTWEYNRDVIPDPRPFPEPAVNNYFGRSRIW
                     NPIAGKIGLVNRKAEEWGWPHQRPPPTGLRRSPEYFPFFFSRYFPDVEVRLVLDSVLN
                     NETTRPIFHIPQDMSKQELVNYLKNIYNIDNVVRIRVRNMRGRRFKNEVGEIKSLPDY
                     KVAVVELDSPVSIVFKQIKGTEDTPDNKPAAQIT"
     gene            <344662..>345684
                     /locus_tag="LMJF_25_0900"
                     /db_xref="GeneID:5652500"
     mRNA            <344662..>345684
                     /locus_tag="LMJF_25_0900"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683792.1"
                     /db_xref="GeneID:5652500"
     CDS             344662..345684
                     /locus_tag="LMJF_25_0900"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683844.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652500"
                     /db_xref="UniProtKB/TrEMBL:Q4QA04"
                     /translation="MTGSKALCRACLTVYSAFMVILTAVYLWSKWGVHRRFVEVLEET
                     KRHSDSSADVNGVALVESGGAEYVLVALLHVTHLICFTLFLFGYKSGVKMALGCALLL
                     ASAVMYILVYGCVTLQGRLEQQAFFASPTAAAAHTRKQKESQPYQVEVNHTPGAIAVA
                     GAAASARNGKRRELSRAAAEKVSGKPGTCGIASARAGEPLSYAELGWMLLEALVDVLA
                     IIAVGPESPTGDGGVRLHPDGTPISSEAPLTGVRRLSLLMLNFAGFALSMWGVMLFDA
                     SPTSAPAPALSTSAAASGSIRGRGGRSNGAQAAARWASAPATLADPAAGAGQPSAAPV
                     EAKKYQ"
     gene            <346362..>346895
                     /gene="CYPA"
                     /locus_tag="LMJF_25_0910"
                     /db_xref="GeneID:5652501"
     mRNA            <346362..>346895
                     /gene="CYPA"
                     /locus_tag="LMJF_25_0910"
                     /product="cyclophilin a"
                     /transcript_id="XM_001683793.1"
                     /db_xref="GeneID:5652501"
     CDS             346362..346895
                     /gene="CYPA"
                     /locus_tag="LMJF_25_0910"
                     /EC_number="5.2.1.8"
                     /codon_start=1
                     /product="cyclophilin a"
                     /protein_id="XP_001683845.1"
                     /db_xref="GeneID:5652501"
                     /db_xref="GOA:O02614"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR020892"
                     /db_xref="InterPro:IPR024936"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:O02614"
                     /translation="MPYTPHYPVVESNPKVWMDIDIGGKPAGRVTMELFKDAVPQTAE
                     NFRALCTGEKGFGYANSPFHRVIPDFMCQGGDFTNGNGTGGKSIYGSKFADESFLGKA
                     GKHFGPGTLSMANAGPNTNGSQFFLCTAPTSWLDGKHVVFGQVLEGYEVVKAMEAVGS
                     RSGTTSKPVRVSACGQL"
     gene            <349361..>351976
                     /locus_tag="LMJF_25_0920"
                     /db_xref="GeneID:5652502"
     mRNA            <349361..>351976
                     /locus_tag="LMJF_25_0920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683794.1"
                     /db_xref="GeneID:5652502"
     CDS             349361..351976
                     /locus_tag="LMJF_25_0920"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683846.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652502"
                     /db_xref="GOA:Q4QA02"
                     /db_xref="InterPro:IPR026502"
                     /db_xref="InterPro:IPR029344"
                     /db_xref="UniProtKB/TrEMBL:Q4QA02"
                     /translation="MQKQQQSFTMLQRAPRDGGSDSHVEACVGQTPESCGVLLKGSRS
                     LSPAPCFPSDSISPSARQQSQQDHHLAGTPLKDRRPPSSQPREPSHAPQRRHLHKQQQ
                     QLSPGYSPRSHRGDGERGASGSGAPHNWWQRTVPSNGKASPFGGHTRPRKLSPSGNSP
                     DEDRRRSQREKQIQFGYVTDGYTNMKRLIAHDPLLRSGGILPLSPPDVVKGSKRLWDI
                     QLRKWRRALHMFDYVFIDGEDHPETRTKVVEEQRRQWVSEAFNEMPREARLKIDLDTL
                     RGVQRSSAVPSRIPIEEDLRCILRSDDCYESVRSVVPQSASSLTKGTDISPLEAGIKI
                     HIAPSAAVLQRQQAQLEMQQRLSSLHQQQQQQQALATEVAPEGMETGLHVPSAPPVLG
                     ATVECAAAERPIELSPSPRRPPLPLPSSPSSSHVSCPSLPQTACETTPHRQLCCSPLP
                     RKTAAPASTAFGSAETAPGISASQPRAVSLSGSLAPAQGVSLGLPGMSATAAVLAPPP
                     PFAGPTPCTVPNMWVPGAAVSPTSAAAGGATTAATAQPLMSWCSHCGHCIDLPAPAIT
                     GAPYGGMCAGTTGSRRGVLAPAQVPLQHVNPVAIGGTSGTVMPPSMQLPGAMPYMSHS
                     TDSMAAAAAAVVTSPLYWQMLAPPVFERIGGGGTFTAHHGSSHSQYRQSEKRQDTFAT
                     MPRSAATVAGRSCPRDGRRHSSRAVATGSGAATPQTVPRFVARLSTSPNEVRLGERQS
                     AERLHSAEVASGDVSAATKPLAADTRAAAAAPAPLRPPFSAFDAAADAARLEKSQSAL
                     AVTPERTLFGTGIIAEVTTEPRPVVVGALQQDETPQGTPSGKPRPTREVEDAPVVPLG
                     FDGDEEEEEEAVDCV"
     gene            <353768..>354556
                     /locus_tag="LMJF_25_0930"
                     /db_xref="GeneID:5652503"
     mRNA            <353768..>354556
                     /locus_tag="LMJF_25_0930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683795.1"
                     /db_xref="GeneID:5652503"
     CDS             353768..354556
                     /locus_tag="LMJF_25_0930"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683847.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652503"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q4QA01"
                     /translation="MSLAPSLQLTGLTQAVIQGDLSALMENVTPSNVNYTDPRYRLSL
                     VMWAVALGRLPTTQLLLSRGASLAQVDRQGFTILHRAVWSADVSVIHMILFTTPMSAL
                     ASSAGARARATGAHTPTSSSPSASPLLLTWRPGAQRLVNAAHSATGRTPLMMAALSGQ
                     VDVVRYLLVTCAADPYQRDSYGLTAVDLAALCGHLQIVQQLLNLAVAPNGAGDSAADV
                     FPTTQCSAEDYIEIAKTIPQRERLCAVNKLLNEKLAEASRVAAI"
     gene            <354974..>356911
                     /locus_tag="LMJF_25_0940"
                     /db_xref="GeneID:5652504"
     mRNA            <354974..>356911
                     /locus_tag="LMJF_25_0940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683796.1"
                     /db_xref="GeneID:5652504"
     CDS             354974..356911
                     /locus_tag="LMJF_25_0940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683848.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652504"
                     /db_xref="UniProtKB/TrEMBL:Q4QA00"
                     /translation="MLPSLPQTACTYSIFDLLVCSPPTLLSLVNHFILPRSLPSPLIP
                     ADHSRCGAWQARMENDAVSNERSFDKVDRGSIASSLPFLNVTMPEQQTATAAPIDAPD
                     DIDSLAEESENATRSPNATTTASTPATGPKVKGSARSKKKRCATAPRETAGRKVRSEP
                     AEESTLVAAMPAHFAEHGTTGTHSSSQDESDLLTKRRDETRRGSEGPERNLPTAEGVL
                     TRRAMMEKAEDAAALQQEKPRPDGASDTAASKLEGSEELFDDARLHEVCGSRSRSHST
                     APHTPTVLNPASASSLSALGTKQEEEEVWEAAVQAAIDTQERQLRHTLLSVFPPELLR
                     GAEWERCLAKEGDLRGGTEAAGARNVQDARSQPVRTTPTPFLSSSLSHRLSPEPLLPL
                     LKALCEDKAYVHGAWCRYEDDLAVRRTQNSIQRKRQRYTFNKGGRKASSSWPTAAARR
                     PDGDGGDDSSAGEEKAADEDELQPPESHWVEAPPAFTGGPRPLPTSATHLAPDSAVIG
                     GFQWTPWRFYRAKRRRNSRRPTVGGASPASARSATAASAVQPDLFSAVSSNAPVSSGG
                     VPSLACSEVPSLPVLHVEAHVPESALAVVSPMTPEERKGYARYVMSSGKLRHDCRDPY
                     AFLVSRAKEMRIQWKRQHPMD"
     gene            <357417..>358901
                     /locus_tag="LMJF_25_0950"
                     /db_xref="GeneID:5652505"
     mRNA            <357417..>358901
                     /locus_tag="LMJF_25_0950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683797.1"
                     /db_xref="GeneID:5652505"
     CDS             357417..358901
                     /locus_tag="LMJF_25_0950"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683849.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652505"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9Z9"
                     /translation="MRALCVCVCVCVCMCVCWNEVVWPHLNSRRGRASGEAHLVNELV
                     ASCLAPLFSPLPAHKMSSAAVQAPATAEASAESVPLLITCLHASAFSAPLAEGRRAFD
                     IIGRLLSNRLQHPAEPRYASFSATSAAWVNGVAPLVYVLRLATWMGCTLTAEGTRYVF
                     FESLGETRAPEPSDGAEGPRQRHGQQQIADRLDELRCVASVWDTSVVESSADASRRYQ
                     DAYQQLLKLFQSAHGFTDREEVWARHINCLQLQRLLAYAADLERQQATASSQVTSDVL
                     RRECVATWTARAQRELDRFLSAPNSTPSTNAQGACMTRALSAPHTQHGRRGECEARAT
                     CLADDSLRWLLSHASLCECRRMCESVAAASASSSVGSRESRAAAVPLVPGFSAAVAAR
                     FRQRAQLEQHQRYLDTTGPAYRRLGQEERHRGESLIISIAALLEQISEVTETQGMVRH
                     DRHEARRLMDNFRQDGDLVKLYALEKKYTAELEEAKLLHGKPLV"
     gene            <359887..>361230
                     /locus_tag="LMJF_25_0960"
                     /db_xref="GeneID:5652506"
     mRNA            <359887..>361230
                     /locus_tag="LMJF_25_0960"
                     /product="gamma-tubulin"
                     /transcript_id="XM_001683798.1"
                     /db_xref="GeneID:5652506"
     CDS             359887..361230
                     /locus_tag="LMJF_25_0960"
                     /codon_start=1
                     /product="gamma-tubulin"
                     /protein_id="XP_001683850.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652506"
                     /db_xref="GOA:Q4Q9Z8"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002454"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9Z8"
                     /translation="MPREIITLQAGQCGNQVGSEFWRQLCLEHGIRLDGVVEPYAVGG
                     EDRKDVFFYQADDDHYVPRALLVDLEPRVINAVQRGSMQKLFNSENIFIHKEGGGAGN
                     NWSHGYELGDQVQETLFDMIEREAENSDSLEGFVLTHSIAGGTGSGMGSYLLENLNDK
                     FPKKLIQTYSVFPNQSRGGESDVIVQPYNSLLAVKRLTLHADCVVVLDNTALNRIVTD
                     NLHIASPTVEQMNGLVSTVMAASTATLRYPGYMNNDLMSMLASLIPTPRCHFVCTGYT
                     PTTLDTSNIQSSVRKTSVHDVMRRLLMPKNMMVSTSMKSGCYISLLNLIQGDVDPAQV
                     HRSLERIRERSPTFIPWGPASIQVILSKKSPYVDTRHRVSGLVMANHTSIHTLFHRTL
                     KQFDMLFGRGVFLDQYRKYGPTKDSLDEFSDARDVVESLVAEYKACESSDYIRNF"
     gene            <362453..>366157
                     /locus_tag="LMJF_25_0970"
                     /db_xref="GeneID:5652507"
     mRNA            <362453..>366157
                     /locus_tag="LMJF_25_0970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683799.1"
                     /db_xref="GeneID:5652507"
     CDS             362453..366157
                     /locus_tag="LMJF_25_0970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683851.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652507"
                     /db_xref="GOA:Q4Q9Z7"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9Z7"
                     /translation="MSVLPAGADGAAVQELERLFRTADPANTGLLSYSEFAYLILRSG
                     GTQEQADALIEKFAGPSRAQRVVYYGALLEQLYDSAEATADAHGDVENGSARHTSDPL
                     LRISSLDCTSSMPTLDTSNSSPLPTPPAPTGVGPSSRHASRSPTAGGGGAAAPAPRGV
                     MGAGQYVVPPAASSSSPLCRSVTHAGAGGRSTSTLASRESSTATYATYSTCNDRSLSH
                     LRGNISVTPPCRPPRSLSSPHSSRFVESALRTATAAAAGSHQQQRLDRAPSQGGTHVS
                     WSASRSRSRDDVRATPLTDSSVVGAQGGERARVYGATSAPQYAAGAGCYSYPPRACDS
                     APVGIGHCRRETSAERMVRAAAEVSIRGRPQSRFDAEGGAGAGETREGEGKLGSSVAR
                     VLPGALHSASSSSYAAAPHLVAANRASRAAAPQAENTSAFFTASRASDSYVRHVDDSG
                     HSTYHSDAAATSLLSLRDIFQRHLAPRSSRDGTVLLSELEEALATRGVGVHPLELEAV
                     ADSLELTAVPAAIEHHGRALQHHSFNTSLKNGFGASVATAGRMRRDSPHPWPSVNASG
                     MDSTDASATTVSRTTITGGADRALSLVDFCVLVSRLRPALIQRIRSSGVWECSASIDG
                     VEVLRSRQPPPVNDRLKSRGGVGVDDGDSIADVTVSPMTPEAAAPATPRSTVSSSSTR
                     PHSSAQRHLRRRRSLVPHRFADLHRPLSAAKVCGAAASALSSTAPPTARQLSADYQFA
                     VEHAQQEPRRSEREEDNDDSHHVSVRYAQPTAASEQRRNGLHVPSATTARLNHTKVPL
                     WHDDRRPSARRSHTNATRSPSSASPGSSRGLISPDERHHPQQPRPHRAHVALRSPTSD
                     FSARVVCEELGDGLARRGCGGMSEPLPTTTSAQLSPTSRALSSPQSATKRGSTSWMLA
                     PRVLETLQSAALPLLRRCAQLDNRHTGRMAPSAWLRVLRDACPALTGAERLRVQEWIR
                     ARGQRSACGADYAAVVEDILTEANVAPLTPVSGVKAGAVRRGDRTAVASPSRSSATRM
                     RSYPQRQDAAATRSSVPYTSTTKDTPPASSRSAVKPRAAVRCGPSGRVPVSSSSHTTV
                     NGQTADEDAKRLLAHELMTACGGDTEALLEYFRAFDEAGTGLLVEHVWRASLEELFRR
                     TEGREPPAWVVGGCVRLSRVPLERWDATPSLQRGTPPLVSPALSAACARVSRVPPAMR
                     RTLCDYRYVLEELGVHADGRGSRAASASQR"
     gene            <367262..>381319
                     /locus_tag="LMJF_25_0980"
                     /db_xref="GeneID:5652508"
     mRNA            <367262..>381319
                     /locus_tag="LMJF_25_0980"
                     /product="putative dynein heavy chain"
                     /transcript_id="XM_001683800.1"
                     /db_xref="GeneID:5652508"
     CDS             367262..381319
                     /locus_tag="LMJF_25_0980"
                     /codon_start=1
                     /product="putative dynein heavy chain"
                     /protein_id="XP_001683852.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652508"
                     /db_xref="GOA:Q4Q9Z6"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004273"
                     /db_xref="InterPro:IPR013594"
                     /db_xref="InterPro:IPR013602"
                     /db_xref="InterPro:IPR024317"
                     /db_xref="InterPro:IPR024743"
                     /db_xref="InterPro:IPR026983"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9Z6"
                     /translation="MEDPQVAAVAGRPGSASEMNRHIRSDLRHHYIFSRVKDFLSGGD
                     AAKADELARQLDRNFTDGSANFMVVHDLLQGTGANTLLFTYQPANGGGAGAATDTRAA
                     ATDGGSGEDVLQVLDPTKSTIEHITKRFVYVIRADTGKPINTKDLMQVVQEVSMGIMR
                     ANVLTSYEHLLTEVYTPLLNRMRNWGKNTVDEKNQFIVTLMHYADRVNELQQLQDDSA
                     TLNPVDQATWKHLRSGGVSKRGGMSDTTVITRLAQTVESWIQTVNEAVAQVPNYEAEL
                     QDERAGPKTEKELWKARLAKLRLLEEQLQRFSATQAVQYLREARSPLVAQWTEMDTNL
                     TEALAEAQENVKYLQSLDTYFDVLYSSNLQRIMTIMPTLITNIRMMYTIARYYPTREH
                     MTALFFKITNEIVLACKRAINPSGTRSRIWDMTHDAASLQDLIARLQASAKLNEVYIR
                     EYRKAQEYFLSHSSSSGGRLFDFDELRFLGHFNLFAKRVDKLITVFRKVEQFRLLKSF
                     HVDQMASLLPRFDEYLGHLRGKTTDILDVHDNNKFDVEFKIFESRLSELETSMQVAIN
                     SSFENITSTDNALLLLKKYQKILQSETFAADLESKYLVIFHSYGMELEKDQKTYERYK
                     EDPPMARHMTPVAGAISWSRQLLRHIKEPMDKFKTNRTIMANTKDSKKVIRTYNKVSI
                     ALLEFEAIWLDAWKRSIESSKAGMNATLLVRHEGRLYVNFDSEINQLIKETRSLMLLG
                     DVDVPAAAKSLLMQEQKLKVFYNELTFLVKEYERVVGRPGESMRCAIIGITRPLLQPA
                     IQRLDAIIRPGETTLTWTSMNVDTYLERVRNAIGNLDHLVSKVSETVVHRIQSNLKAV
                     SSTLLVNLFEQHVSLDQFVQLQERHIRQQCELMNIKNREVESAVDDVVELIVRYDTAN
                     AQQGVMKAGSAPASTELVPVTCANRSEMVAGAMDGATQEKVRVLKGHFHRLMFKAILT
                     CTTRSLNLLKKRVGTRNRVAFLFSETPLFDADVQLLSAEPYLFLNPSLDEVQLTINQC
                     ATAVLSCSKYMTRWHYFNEEGANFYEEIARNKEVAKVVLLLTGSVHGLKKQVMEYLCH
                     FRKYEAIWKEDKDETYEAFLRANPTLDSYEAKLGEYVALEEEVKGLAPCFNVGSLALQ
                     SKPLQLELLQRIRDWKEVYVNKLYAQAQRQLDALTFKMEEEAHQLQMPIPDQDKLEDL
                     RVLMNTLRDIRDRESVVDFQFLPVQEAYALLQRYTSIIPKEETDRVEDLRIKWRKLQK
                     AAQLRTDDINNMQHGFKKGLTHEVQKFGAEVVAFRNDYDSNGPMVEGLPPQEAMERLK
                     RFQRQFDDKYRKWMTYMAGEELFGLPVHKYPELVKTKKELELLDKLYTLYINVLQKVN
                     GYNDILWCDLDFDAVCEEVSVFVSQCKRLPKSLRDWDAYVELKTILDNFMELQPVIQE
                     LKSPAVVERHWQEIMKVSGRKWRTDPDVFKLQDLVDANLLAVVEEVVDIATSSAREAE
                     IEAKFRVQEGLWKDQELHFSEFKHRGPIILKGDDTAAIREALEESSLAVNSMLSSRYC
                     AFMRENIQGFLQKLVKVSETISLWTEVQFTWQYLEAVFAGGDIMKQLPQEAKRFAMID
                     KQWQKIMNKANETPNVIVFCYENELLQSLPTLKEQLDECQRKLSLYLEQKRNLFPRFY
                     FVSDTVLLEILSQASDPQSIQPHLASIFDGLSAVTFERVKPKAAGAQPYYQVVEMISG
                     EGQVLAMHEPTPCVGNVEDWLTRLCTGMTDTVREVVKASVTELPTLLNNTAYLGTIID
                     RYPAQVALLMLQLFWTADVTDCIHRGAMRARGKEAVAARSKCDAVKNYLVNITTSAEL
                     EKKPLRMRTNIETLITIQVHQQEVFMELQKTSIKDITHFDWLKQARFYYRPERDATII
                     SIADSDTEYCNEYLGVKERLVITPLTDRCYITLSQALAMYMGGAPAGPAGTGKTETTK
                     DLARTYGKFCVVFNCSDQLDRHAMGKIIRGLSQANAWGCFDEFNRIDLPVLSVVAQQV
                     SCVLQALKQHKDKFIFIDGQVTDLMPGVGFFITMNPGYAGRQELPENLKILFRGVTMM
                     VPDRQTIMKVKLASQGYSQDELLSKKFFILYKLCEEQLSKQRHYDFGLRNILSVLRTA
                     GAVLRRNPGKDEEDLFMRTLRDMNLSKLVFEDIDLFDSLLRDMFPGRQFVKGTHPEIE
                     TVMKKVVEEKGLIYWMPWISKVLQLYETKLVRHGIMVVGPAMCGKTQCYDVMTETLSR
                     TTVPHQQLRMNPKAITAPQMFGRVDVAGDWHDGVFSSLWRQAVRNAKKKNIWIVCDGP
                     VDAIWIENLNTVLDDNKLLTLANGDRIQMSDTMKCCFEVENLANASPATVSRAGIVYI
                     SDVVLGWMPVLESRLRATMNADGQMLPRDVVKRCHPPLAEKLLDIFLPINPETNTVPE
                     NCITNKIAEFYSRECTVVMRTSVAHLVENAFHLAVALGDEIDDGTAVSQQLTEKIFWF
                     SMSWSFGGTLELQDRSKFDQFVRSKFAALPAPAEGQIFDFSLNCKTGEWEPWSRYLEQ
                     WRYPGDDRLDFSSLFIPTADSVRLHYLAKCNFLQNRPTLFIGVSGTAKTVTVEQFLGG
                     IKAQDEQSNFRKVNFSSMTLPQNFYNTLEDMTEKKMGSNYGPKNCERLTVFIDDINMP
                     EINEWGDQITNEIVRQVVEMSQVYDLSKPGVRREFKGLVFMAAMSHPSGGKNDIPNRL
                     KRHFTVLNMPLPEEANIQQIFGTLFEGRFCNENYVQGVQDVARMLTKMSINFWEAIGK
                     RMLPTPDKFHYFFNLRDLSRITQGVMLAGMHSDPDRPEKRAQSKPWETITDAVTLLRV
                     WKHECARVFSDKLNSVTDKRWFDENIQNCIHDHLSSTPYKDLVDQVRDPVYMANFMRD
                     PVIDPETGEQVEPAPRIYEVVPSMESVLERLMNSMQAHNETPAGRVKKLNLVLFEAAL
                     KNVCRISRGLSLPRGNLLLVGVGGSGKQSLARLAAFVNGHDYATLTISKGFGVNQLFD
                     AIREQYISAATKKPVTMLFTDNDIKQEVFLEYINSFLSNGEIAGLFASDQRDSAINDI
                     RPIMKKDPYAKFEDMSESLWKYFIGRVRERLHFVLCFSPVGDRFRTRARKFPALISAC
                     IINWFFPWPKQALLDVSSRTIQNFEMATEDKHKKALVELMAEIHLLMLERSEEYLARY
                     RRSVYSTPKSYLSFIESYTTVYSKKFNELNDEAKKINNGLKKLHQAGEDVRVMRTQLQ
                     EKEVLLSDKRKETEALVKEIEVRTAEAEKKRAEVEIVKEAVAHDAAIVAHGEAEAKKD
                     LEAAEPALIEAIESLNSITSADFVTLKKLANPPALIKRIFDAVSILLHRPLLVPGSEL
                     VKGALWITDSWDFSGRQLASDTNTLDVLKNFGESKKDFINEETCELLLPYLWMDGFTA
                     DAARKACGNVAGLCTWVSSMYKYINIAKEVAPKKEALRIATIQLRAANKKKEEQEEEL
                     ARVTAEVQAYNTQLADENAKKQALEEDANRTKQRMDSANGLIDALSGERERWTQQSNE
                     FKTLIDRLVGDVALSCAFISYCGPFNSEFRNQLLYDYFYPKCKQLNIPVTPDLNIVKF
                     LVDETTIADWQLEGLPADSHSVQNAIMITTSSKYPLMIDPQGQALNWVRKRTEQQQNR
                     VVQMNDRTFSNSLQEQLDQGRPLIIENMPEEVDMMLDPVLERQVVRSGKTLLMKISGE
                     DMIYNENFSLYMTTKLPNPSFTPELFAKCLIIDFTVTMEGLEQQLLSQVVSREKAELN
                     EESAKLSEDINSNEKRRKNLEDRLLKQLSESKGNLIDDVELISTLQETKDASAEIAEK
                     LATAMETKKRIAGAREEYRPVACRGAVLYFLVVQMSLVNHMYQTSLVQFNGIFDNSIL
                     KSDHHPVTAKRIQCIIDHFTLAVFKYVIRMLFSKHKLLFVLLLACKIEVKAGRLDPVA
                     FEVLLKGGGSVQVDRAKPFNWLKDKAWANLMAIAQQVPRVFKQLPDLIMRSEQQWRSY
                     IESDSMETLPVPDINEKMDPFERLLLVRALREDRTMLAAAQYISVSLGKIFAEPQQLE
                     MADVVEETTGLTPIVFLLSQGSDPTTLIEASAKKLKKKIYPISMGQGQEEAAMNIVTS
                     AWQNGDWALLQNCHLGLPFLLQLEERLRVQMMPAQPGEKKAEIHEEARIWVTSEPHNS
                     VPIGLLQMSIKLTNEPPQGIKAGLIRTYSWMSQDYLEMFRRPEWRPMLFAQCFLHSVV
                     VERRKFGPIGFSVPYEFNQGDWTASVQFLINHMTTIGEQLRNPVNRDTVCYMVADIQY
                     GGRITDNNDRALFKAITEFLYDMHITNPDKCKDGKEMTEFYSGYGIPLFDDINKHREF
                     IRETYPDVDTPEVFQMHPNQDITYRTRQAQEVLATILDVQPRGASTTGGVTREEKVIS
                     MADSYLKLLPSDWTVDRKAHLGDRQPLSIFAGQEIDRLSVTMRTVRRTCQDLKLAVAG
                     TIILTPALQDALNSLYDARVPAAWVAVGWPSPNISLWIAELVRRYEQLQSWASNGRPP
                     VYWLPGFFNPQGFLTSVRQEITRSHANEAVPWALDKVEARTEVRSSEYRPGQEAKAED
                     LRTEKGEVVIYGLFLEGAMWDRVNKRLKDPLPGDLYRELPMLLISAYNKDAPQQATVQ
                     PVKPGGVKEKKTKQEYYRCPVYKYPTRSDTNWIFDVRLPVAEDDAYWRMRGVALLGTT
                     D"
     gene            <384698..>385186
                     /locus_tag="LMJF_25_0990"
                     /db_xref="GeneID:5652509"
     mRNA            <384698..>385186
                     /locus_tag="LMJF_25_0990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683801.1"
                     /db_xref="GeneID:5652509"
     CDS             384698..385186
                     /locus_tag="LMJF_25_0990"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683853.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.0990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.0990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652509"
                     /db_xref="InterPro:IPR008011"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9Z5"
                     /translation="MLRSSAPLCALGGSIVHSKALVPPVSEVVIRDAGTNLPGIPHAN
                     RVCRSYRQWLKLAVLCPPSALCDLNEHAQMNERFVIILRQKFREGAELRDPDQIAVAV
                     QSCERSLAMFRFLAADGAKRQFPEAKPRLNLHKMGFLEMGKLNYKQMVKEYWNTYVLR
                     KW"
     gene            <386368..>388722
                     /locus_tag="LMJF_25_1000"
                     /db_xref="GeneID:5652510"
     mRNA            <386368..>388722
                     /locus_tag="LMJF_25_1000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683802.2"
                     /db_xref="GeneID:5652510"
     CDS             386368..388722
                     /locus_tag="LMJF_25_1000"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683854.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652510"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9Z4"
                     /translation="MFSLHSSPGADELAEKLRQQLATLQSSSDHIQQSLTVLRQQPKP
                     PASVSTPDARSEQLPDKPQHPVPQSEEAVRPPVQEQSEHDEAGDYPVESADAKPQPAQ
                     ATPASSTAARGLEETVQQGHEPSQSAESPECHAEDSTQIPNTHETPTPTTLHGVTERN
                     ADDTNPLAYNVPSAALIQELPSCHLLTSAHTPDASLHRINFSASQHSSYGTNSDCFSP
                     VRDTHASADEPIPYRQDSTNTSAAYAIDPTTAREAGEHAEQSEEAVRPPVQEQSEHDE
                     AEDYPVESADAKPQPAQATPASSTAARGLEETVQQGHEPSQSAESPECHAEDSTQIPN
                     THETPTPTTLHGVTERNADDTNPLAYNVPSAALIQELPSCHLLTSAHTPDASLHRINF
                     SASQHSSYGTNSDCFSPVRDTHASADEPIPYRQDSTNTSAAYAIDPTTAREAGEHADP
                     RRSDNEAGDAHLNGEREDVVCRTAASQTIVAEGVGGLPLSASLPRVLDRPGVSGVQRR
                     LSDCGAVKRRMSGMPEVRWPLRGGENHARVSALVPCTRSPLPQQPRCLYLYPSKKIEG
                     GNAKEPERTLVEPASGVDGELAVFVSSSLLPVSRRLLQEVRPVTPREQGPNGTCATPA
                     MSVATAASASSVAASNRAGDEAGALTSTAPVRFELLSAANGDVVELDILAGRPYWDAE
                     NPKTMSYTKPSALLEAKEKRECTLFRRYSRRYKKLVEDSAVHVGGEAGASILRSHEAF
                     KVACEAADQKPIHKRSFYEGPSVNWKKVLLEQAAAMSSVSNRDA"
     gene            <391290..>392585
                     /locus_tag="LMJF_25_1010"
                     /db_xref="GeneID:5652511"
     mRNA            <391290..>392585
                     /locus_tag="LMJF_25_1010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683803.1"
                     /db_xref="GeneID:5652511"
     CDS             391290..392585
                     /locus_tag="LMJF_25_1010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683855.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652511"
                     /db_xref="GOA:Q4Q9Z3"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR027443"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9Z3"
                     /translation="MLRATILARGTLVKIGRGPNNVTESASNALLESLQDHGYCYIQH
                     PFIQKTILDQLHRDCRIFFEQYVLHLHDAAAQGSLKRNNLHNYNCTQLSPYELESIKS
                     PSGFRGYYRYVGASGIDDAIECFSVGRDDVADPAVLRRDYYKQAGWEESEYLSMISRR
                     NPWDILLNHVNSIPASGSGIVPGMDRNDNFMSDFKDMMMAYYDLCYTVSMDVMRHISC
                     GLGIRPSIPQGGSDPTMDFELEYFTSFHQKRDCDLQAKYYPQLGAGARLKNGVDIQNQ
                     RSAHNPDGVKVLRRKGAKTQPLVRTASTEDGDGEKDVTVRLDTHKDLSTITLLSQDSL
                     GGLEVWDEEKASYMAVPVLEDALLVNAGLFLEKWTGGLIEATPHRVRNAKGGSSRCSI
                     VFFALPDHDARIEPLLQQEDNPAVDAQDSFLAGDMMPAP"
     gene            <393784..>393993
                     /locus_tag="LMJF_25_1015"
                     /db_xref="GeneID:5652512"
     mRNA            <393784..>393993
                     /locus_tag="LMJF_25_1015"
                     /product="putative protein transport protein Sec61 gamma
                     subunit"
                     /transcript_id="XM_001683804.1"
                     /db_xref="GeneID:5652512"
     CDS             393784..393993
                     /locus_tag="LMJF_25_1015"
                     /codon_start=1
                     /product="putative protein transport protein Sec61 gamma
                     subunit"
                     /protein_id="XP_001683856.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1015"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1015"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652512"
                     /db_xref="GOA:Q4Q9Z2"
                     /db_xref="InterPro:IPR001901"
                     /db_xref="InterPro:IPR008158"
                     /db_xref="InterPro:IPR022943"
                     /db_xref="InterPro:IPR023391"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9Z2"
                     /translation="MDFLDDILFHPIVAFTKNSRMLVRKCQKPNYNEFTTAAIAALIG
                     FFMMGFLGFFVKLVFIPINNVILGA"
     gene            <395600..>396895
                     /locus_tag="LMJF_25_1020"
                     /db_xref="GeneID:5652513"
     mRNA            <395600..>396895
                     /locus_tag="LMJF_25_1020"
                     /product="dehydrogenase-like protein"
                     /transcript_id="XM_001683805.1"
                     /db_xref="GeneID:5652513"
     CDS             395600..396895
                     /locus_tag="LMJF_25_1020"
                     /codon_start=1
                     /product="dehydrogenase-like protein"
                     /protein_id="XP_001683857.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652513"
                     /db_xref="GOA:Q4Q9Z1"
                     /db_xref="InterPro:IPR006115"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR029154"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9Z1"
                     /translation="MSAIKRSLNVGVVGMGNMGIPITRNLAFKARSAMYLQIHSRTLS
                     KARQVCDDMSADGATCAMRIHDRYSTMTKWCDVILLTLAHRAASRKVLLEDSEALVTN
                     ARPGQIIVDHTTVDMELSRECAHEAERRGAVFLDAPMSGSPKQAFNNQLVLMVGGPAE
                     QVQRVSPIFRMYADHIHHMGANGSGTAAKLLSQALVASHNAAAAEAMTIANRLGIEDY
                     QKLIQVLDASWGSSTMLRRNAPTMQDLVRNPDKLAPSSGASIDNLLEDLALLDASLPK
                     IEKGDNGNGGREVEEERFPVLDASLRMLGAAVESGMGDRDMAAVIHYIPAAAAMEKEE
                     GVRVQPRGLTSGAFLDRNATGKVNSGPAAAAGAAVAASSPPTPAEIEMDPGSLADSLS
                     AAESSSNGKGSTTQAASIAEPLTTASSQQPPAFTPEDFY"
     gene            <399440..>401716
                     /locus_tag="LMJF_25_1030"
                     /db_xref="GeneID:5652514"
     mRNA            <399440..>401716
                     /locus_tag="LMJF_25_1030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683806.1"
                     /db_xref="GeneID:5652514"
     CDS             399440..401716
                     /locus_tag="LMJF_25_1030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683858.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652514"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9Z0"
                     /translation="MHLDQVLAAATVAKAHAHINKHQCALAVRRLRLIALTLRQMPRP
                     APSQLLLTAIQSLCLLLRQCAHDGGLVASTAESATALQILYGPDGDPLGPAQCWPVLL
                     YQHFTSRLLFQSAYRRLWAAWSMYSHVDLEREDSVAESLDCAEDGQVMMELLFPMGVS
                     GREADRSALEEVGSVSHHLRDLQAYHQRRKMSPWRILYQDLQPTDQLVPGVGRPQSAS
                     ASAPPTATVAVEHHADGEEDVRFRVVPHVYRYNGVPVVVKALCGAAGTGDAETQEVAM
                     QHATEFLLDAGCRSTWCHPHIVTCLGGYTERFVDDAESSKASEERLASAAMANFPWQR
                     PVSTVTGKPIMALGYVLELQSARLLSTTADSAQASYVTLHDLLFTPSSSAASSSASLP
                     VLGRHHFTLHEALDICAQIADALQYIMSDSHEVSEAVQTAWLTVDPANVFVVRVVGLN
                     GKEEPVRQQKRQQQSVVSGDQHARDTSLPLSVNSESAVWAASVTPFAEGGSREEPPVV
                     GGADLQSGPVKASEDGGGRVDWSLPNKADTVQARSEWETEVYVCRGSKEDHGSAEDTL
                     RPRSKHFVVRYSPPCRWMPHQVAGSRWRPHARATAPASYAVVQLLLALLTGQVPYAYI
                     KTDREVEKRVFAGSTDQLGNTSGAASCLSGAESLAPVRLSSSSQGYRIPPSLPPMVAN
                     WCRRALSLDHSQPPMELEALRNTLATIQASLPDNIRHAYLRAGEDATERDRGAGGGGG
                     SANQEMQSCMRGEPLDVL"
     gene            <403994..>406195
                     /locus_tag="LMJF_25_1040"
                     /db_xref="GeneID:5652515"
     mRNA            <403994..>406195
                     /locus_tag="LMJF_25_1040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683807.1"
                     /db_xref="GeneID:5652515"
     CDS             403994..406195
                     /locus_tag="LMJF_25_1040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683859.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652515"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9Y9"
                     /translation="MPLLPVPLDTASASSSTSQQAATRATAAGPAADVPAASQTSTTT
                     HWQLSSPESHRHRSDGHVAQRGAVFEYASEAVTTLEQQYGDALQRLNTMHRLYDRLDA
                     HNRTLASELKRVRQVSDALHNGVAFHLYSSVRQVKHEMKLLKQYVELLSSNFSNQLHV
                     LQQVVGEELPHSAEGRLQPMETRVSIGAASGGARSLERVTKAPSPVLGRHVTRAGGGV
                     GAGTQFYSQDYWWNVMSPHPIRPPSSAHTQTAPADMDAGGWADVVNGCDRGTTEGERD
                     LSPPGQLPLSIEDSRENNLLIQSSGEALVSRRAYREVQEALADAQRRVVELEQTSSNQ
                     QADYENRIAQLKAAHRAKEATLKEELALQRRRAELAQDGEPQKTALSTGLPGQAAGLV
                     SPADVNQLVQLLLEHQYQQPTAKQRPGAPSKTSSPASTVQPPRQARHKAVRSPLRKWE
                     EADETTGQKDSLHGSEDTSATTNDSDRDCRRRAAHPCATESAPASNTDDGNGDLRPSF
                     VRPKRRVLRAIASNGSGRNRTGADGDLHMPDRYSPAAAARRVERAGEMLGCEARDGES
                     QQQGQRAHSSSSSGNRRQREKVVATEAAGATASVRRSLAYERLMDHSRAASTSAEGYA
                     SHSGRSAARTRPRTVSDADAPSVPKRRSSRRGQSAGGAARDPRHGGGAGPELLRSLLS
                     RVEAVGVQGGSRCAVPAPKRVRPVQSQPDTKVDRVAQGIWAQELLKERRCL"
     gene            <407234..>407803
                     /locus_tag="LMJF_25_1050"
                     /db_xref="GeneID:5652516"
     mRNA            <407234..>407803
                     /locus_tag="LMJF_25_1050"
                     /product="frataxin-like protein"
                     /transcript_id="XM_001683808.1"
                     /db_xref="GeneID:5652516"
     CDS             407234..407803
                     /locus_tag="LMJF_25_1050"
                     /codon_start=1
                     /product="frataxin-like protein"
                     /protein_id="XP_001683860.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652516"
                     /db_xref="GOA:Q4Q9Y8"
                     /db_xref="InterPro:IPR002908"
                     /db_xref="InterPro:IPR017789"
                     /db_xref="InterPro:IPR020895"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9Y8"
                     /translation="MNCARLHQRIPLRAMALATTGYPALASSHSFANASTSVMTASAM
                     AVVRRAATTTGASAATTTPQVVHYSKLGMDGFTDIKFNTAADELLELVETKVDALDSA
                     AVEDVSCNGGVLTLETTDRGTFILNKQAPNVQLWLSSPISGPHHYDMITVTQGGHEKV
                     SWKSDHDGHDLVKKLEEELTEVLGTDFKV"
     gene            <409285..>411552
                     /locus_tag="LMJF_25_1060"
                     /db_xref="GeneID:5652517"
     mRNA            <409285..>411552
                     /locus_tag="LMJF_25_1060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683809.1"
                     /db_xref="GeneID:5652517"
     CDS             409285..411552
                     /locus_tag="LMJF_25_1060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683861.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652517"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9Y7"
                     /translation="MPLSAPSSIAFREEEPSEGHRDGKVVDSFATISMQEEPSESHRD
                     GKVVDSFATISMQEEPSEGRRDGKVVDSFTTISMQEEPSEGHRDDKVVDSLATISMQE
                     EPSEGHRDGKVVDSLATISMQEEPSEGHRDDKVVDSLATISMQEEPAEEPEELHYENS
                     IGTAPNTSTHKDDIELHVVDNIASKSEKSLPYQVEVSSTNLDRLTSTQQEEGAAALRE
                     SHPSDAAAAPMSDIYLLNPPPSRLSQRAAKAAQTPRSHTSAPITPRTRSATSTYRPPA
                     QQQQTNEENQDAEVQSLVSGAESAPTPETAANDLSRAGAEPTPAGAAPMPTPGATSAG
                     IPDVVVTVHKRHFPGDKWESVVPSSLDVVKRTVRNETADAIGVESQYVQVLNVEATAT
                     GITCDISVDHAPGMTANEVDEKLSRYPYETTITLPDILTAGGEHPQDDLGGALAPSEG
                     TQAAASAHEQQVEEEGEGEAQAGVPEEAPKKMKRAHTQLENGSAASDAQKATVPPSAR
                     VLLKKLVLKGLPELLVTPRIYHYRSPRPGAERSMDKGSILYLEGPREGTGGLSSRYST
                     SAATPHRGTNGVTGINGSRSPSAPTYRSVSIRNSVHIPPQRVERGVVSLALRKHPIIQ
                     AAAPPQQQQRATAAPADNASAHRYMNGVDHTANTHSVSRRTRSRSPQQLALAPGTDSA
                     SDAASEEAAVTAVPMAASGSAADQDDYILMTQGVEEAADAEGLLQKKQKAVAEYDTAD
                     DEDDPVPAPAPNPFV"
     gene            <415312..>417888
                     /locus_tag="LMJF_25_1070"
                     /db_xref="GeneID:5652518"
     mRNA            <415312..>417888
                     /locus_tag="LMJF_25_1070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683810.1"
                     /db_xref="GeneID:5652518"
     CDS             415312..417888
                     /locus_tag="LMJF_25_1070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683862.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652518"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9Y6"
                     /translation="MTGSVLATAPLTETPSFVSQGTSPPASAAKMNRGLSQRSSHPSI
                     HTDKEPPEQRSRRAEDVEAAAQAHQQQGGAGIYEAPPVPVTRGPGHTPRGRAREGSQP
                     PRRLPSRTSFRHGTPRGGGDDVSTTLIPKPHNPRVNLVTQASIAPSDASVHFLVDDEQ
                     TDAQSILFQAEPTTNNFNATEESLNFRAITESSDIHFVVEQSRLPSQVVAVKQGGAST
                     TRSSLCFEVESTNDPMRNSTISHFSIQRNDPEQKPPVPTPHLRVEHKDNSAEKVAPAK
                     VENAREPEIEFGGETEEQQSSKKAEEERCKQVLKERSLYMSIRPWSTNEPHRRARRTS
                     SESAAHGLKQQLHEKMEDVEKRRRAMYARPWRTGSASPNTSRSASRTNPKRRFTPLSG
                     RSGDGVAMSEQPATESEKMQAGNKRAPAALAAYSYSSSPSSEERLSPTAPTFDCVEAA
                     NFVTPAPVLKAPLEIICEEFEDWVHTANQRCNLKAIADMMRARERTIVQLSTKLEDQS
                     RVMKRLNKELYDARDKCMRHLGNDVTGLALHAPRSWATSRPPGRIITSRTPSVVRLYV
                     EQRHRAKDYYSMKMQQLGPRPVSVLSDDELSDSEKEVYAQELQSWRVERAALREEKAR
                     LVHCRRDLAFQMRRGSNIKDIACTQPTSGRGPLERAATGTETAVDVKGYDRLMDLRIQ
                     AQRAVVETANAKKVYEATLCMAATMKKQHDPSSAELMNAKESRRKARELYAASLQRLQ
                     QSAEEARSLLERVKALKVCREKAAEWLDESAQEDQVDYGDAVLAVCLQADRVQALAEA
                     AADDEDRTLRSPSTVRLGVSRAGTPRSSVNGSMRLGTPAHTRGASTSNGDDVFARLTA
                     RK"
     gene            <420007..>421374
                     /locus_tag="LMJF_25_1080"
                     /db_xref="GeneID:5652519"
     mRNA            <420007..>421374
                     /locus_tag="LMJF_25_1080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683811.1"
                     /db_xref="GeneID:5652519"
     CDS             420007..421374
                     /locus_tag="LMJF_25_1080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683863.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652519"
                     /db_xref="GOA:Q4Q9Y5"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9Y5"
                     /translation="MPAKQKKGRGKTVNLFEFNEDYIPEEALDWAEDDWMTAEQVGVA
                     KLSEKIAKQRQEYSRVANNTLDQQESFRTAAVSEQKKHFTIDDLQPPFVAHFGNLRNG
                     TTEEDFLSLFNRDAIATHRLINQDGKSFAFVEFVSAQALTVALSLDQTFQRGRRMYVD
                     LATQKQVERLLNRNTNERPGMSRDLAGQQQPGGLAAMGLSRDVFGGQQPEDQPGMPSM
                     GSRSNFGSRVDLHNLGDLSRDMLGSAVQLASPTSCSPICGAGSPMSFGNWRSDAPEQQ
                     PEFPIPRENCRSEDSFDRRAGNLRRSSGPASPDPPVLPPEPKPNPFSGESGNWRDAPR
                     AEAPKMEELSAVTAESDTTAPSEHKTEEHNAGGANSSGAASSPSSNGRGRGTGGIGRG
                     GSRGGRGGAGSCERNSFGGERSGFGGERSGFGGERSGFGGERSAPPKPSGPVNTDKWA
                     DLRRS"
     gene            complement(<423906..>425147)
                     /gene="MGT2"
                     /locus_tag="LMJF_25_1090"
                     /db_xref="GeneID:5652520"
     mRNA            complement(<423906..>425147)
                     /gene="MGT2"
                     /locus_tag="LMJF_25_1090"
                     /product="MGT2 magnesium transporter"
                     /transcript_id="XM_001683812.1"
                     /db_xref="GeneID:5652520"
     CDS             complement(423906..425147)
                     /gene="MGT2"
                     /locus_tag="LMJF_25_1090"
                     /codon_start=1
                     /product="MGT2 magnesium transporter"
                     /protein_id="XP_001683864.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652520"
                     /db_xref="GOA:Q4Q9Y4"
                     /db_xref="InterPro:IPR002523"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9Y4"
                     /translation="MMHSKLDGVTPGVAEAHQLSPLVARQRYLTVNRSGGSSWFVRKD
                     VMLKNLQVSQDSTLWLDVEGETPEERRAILNDLPWRVNIPSAVLDAVARPTESDVVEL
                     QPSLAQYAHGVLSCAINPLYDTTDETATVDEDNFSGEAFDAARGFVWCSVLITDTLIV
                     TMHDKRFLGLEEVVRALEMRMNPMDTTSLGNSVLTPSIVFATLVAYSSEMMLPDPTTL
                     LSEVDCIDEMVLLIAPGVRDQPDLLRRIALLRRRISSFRGLLYMKEKLLRELVTPSMR
                     GSFVACDMVHVVPIYKEALDKNTKMADRLDDARDILNQANLNFVTGVSMRMSQSSANM
                     DFKMQILSQVAVICLPLNLLASIFGMNCEVAWQADSHPNLKAFWGIVALMVAWVLVCS
                     IPTIRHVLHGNAAKAIVPTDS"
     gene            complement(<427169..>428356)
                     /locus_tag="LMJF_25_1100"
                     /db_xref="GeneID:5652521"
     mRNA            complement(<427169..>428356)
                     /locus_tag="LMJF_25_1100"
                     /product="DNAj-like protein"
                     /transcript_id="XM_001683813.1"
                     /db_xref="GeneID:5652521"
     CDS             complement(427169..428356)
                     /locus_tag="LMJF_25_1100"
                     /codon_start=1
                     /product="DNAj-like protein"
                     /protein_id="XP_001683865.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652521"
                     /db_xref="GOA:Q4Q9Y3"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9Y3"
                     /translation="MRGRRTTRVVAALLVLVWVAALVAEVPVHMAGAADPRDEDAKAV
                     NAVLRLPEDDFYAVLGLGEAREDATERDIKNAFRRLSKKYHPDVATGDQDSYRLVYQR
                     VQRAYEVLGDRRKRKIYDILGIDGVTRLEKPQQQQQMNPFFAFFGVGQQADAERGKDM
                     VLLMVVPLEDIYRGAAHTSRFAKRKICRACKGTGARSGEDVVKCPHCQGRGRLAQRVQ
                     IAPGFVQQVEQVCPHCQGKGTHVAHMCPVCRGKMVLPGEAVLSVDIEEGLPEGHVLTY
                     ELEADQAPGQVPGDVLLTVISAPHPVFHRSGNDLYANVSITLKEALLGFKKTLAHLDG
                     HNVELHWDGVMQNTQQVRIAGEGMPRHHVPSERGDLYITYNVLLPEALTAEQRALFQE
                     HFA"
     gene            complement(<429674..>449296)
                     /locus_tag="LMJF_25_1110"
                     /db_xref="GeneID:5652522"
     mRNA            complement(<429674..>449296)
                     /locus_tag="LMJF_25_1110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683814.1"
                     /db_xref="GeneID:5652522"
     CDS             complement(429674..449296)
                     /locus_tag="LMJF_25_1110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683866.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652522"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9Y2"
                     /translation="MEAKAGRGGEPQLQPHTSMNESATPPIVNSFSKASTASVNTATS
                     LLQSSDGEDDNRAPNSAALSTDSAVPSSSIASSSFSMFSQSTTTRRGEEGRKEEGGGR
                     GSAASLVPTLTKRSRALSSSPAATRTSIPAEFTAPFVSPAPTRPEGPLPLLFTAALVD
                     VAAVPASTAGPLGSAIGTNAPMHGHPLSPSPTAPPSSTPFLVAPAEVPIPSVGDAAEE
                     GSAPPAAPATLPANAAAAVDEKVVDAGAAKCVTEDDESEGSGASASRSLRGDNGVPMD
                     GRAETPPNVEQPPALLSECLPATSMEPPPPPSHASADSGAKHSEGHSSAPDGPPQAPP
                     SAPAPFLRESPEEPPSLLRIAPEEQLRHSGRLSGTHDSGSDTIEEAATSGDEGGGWGI
                     RRRPRRSSAHRSGAAAERGEAQSNAHESSGRCGQLRSSGRRRRTRELDTEASHTSPLH
                     ASESRSHQEGTPVCGAFPSSTAALDACLTSMVGAAANDVPQQPAAHQHSSSSFSAFTH
                     AHAANMQASTAGPSLFAADVLASTHTTAVSPTQSSLLPAQRRRSPSDLLSSGWPDAVF
                     QVGEDEGDGVAAPEGEALQSSTQAQGQQGQEERACTEDDMAGKATVVAIAAGEMSAPP
                     SLSPATHVREAAAVAVAPLLLLPKEHQGDTRAEALASASASTSLSTPVVAMARGAMSL
                     NGGLSTTAAPALSTAVLPAPAHPSPFGSSPSAPAASHPPPRSTTHHQPPPPSSPAVAA
                     LAPSSATEKEAEASRGVHDVGRAVATSASAASIEPAAVRTALHPVPISPALPVPAATA
                     TAAAGFIGEPHREAYPASLLCINRPISLGGAVGDSGSVETAGSFATLKSTVAGHNRLS
                     LGSVRSNAMVGQRLLSMAQFADRWTWSEEGSRHGSDADNCSNRRSGKEQESTGSWPSH
                     TAANPRHEDDSSGSWYSYSYGSAYSTEDITGSTTRGLCSSVTVSAPCLQDEREGAVTG
                     GTAAASGTEMVNLVEYEEVTPIVRGQGGLLGWLCCGRQKATGGVRRSRMEVHRVCFTA
                     EDTRRDHSIGLSALHAEQHKDLPRREGSTASPVATAGAVRANITTRSEDKAERQAAFG
                     GMRSGGAVGSEGSGPPRGLGSATETPHSSEKDTAESVDEGVDEAAAYAGCRGSTSSYA
                     DGEAPLISRANTLAPPHDGAEEMNEGDSGLRSHGEEAETAPAAAAAADQKRTPPPGVV
                     GQAACSSSVSAPFAKLDVAVSVNTKLSSSAHCYAEADGTHYPGGVGVLGSDGSVPGGD
                     ASAPSAATDAVEAPDHHNRAVGCTGRGGGVEEREEGAATTASTAPHPLWALLVSTEEL
                     PRLRAWDAEPPVAASTCRLHQEREAARLEAKYNEEAIAAAEEAQQAFHQAVQELMVRP
                     PRQCVFVSVHGLRHWCSALHCLRQAPRAGLANGAAAALAGVWRDAWGGNAQAGAPIIE
                     DPKWMDVRLAIYMHNSAGERLLAAGSVFSLPSNLEALRRCLGCGDGGGGDGIVEHPST
                     GGYGRDSWSDLLVFQLPESASEGSAEGMQQAEVRDHDCIVSITSECTTGHCSDRGDGG
                     GAAPSHRASECGLPGCGNLGSLGGCGILYVKLEERDERWVSLGDACAGAAATRAGEAA
                     SCGIRAHSPVKDARPATAAATTIGGGAEGLVTSSQQDEENTPQLSVGRRTEPSSPSSS
                     LPLAGEAAPPSSSASETKAGRDCARHAIGATADMDSVHVRASDDGGADERAQATGTRL
                     EECWRPLAVSPPLLPADLCQLQSDQPPLHTALGTTEEAAASAVACPGQLLPQLSCRLR
                     WAQEPQPRFRAAPEPAPRVPPVEQGLSAWASLGTAIKEYERVCRCASTDAVSAVTAEN
                     HKPFRPLTVLWNTIPSHLAAENDKLREVRKASVAAAPLERWCGGELAPRGHAMEALMV
                     CSVVMRCAAAILFAHELADVPESRYCPPTSISVTGGCDGVVVEGAAAVGADDAHGTPV
                     AHRAPVMQYNITFHTVLTRDPASSLLFTVHGAASPADVFGFAVWTPFDAASAAHVQSR
                     HRHGEDAGVGGVADVWLPLFAPASADATPLASVPAQQRKVASSGVSSATLSSTNKGHK
                     RSTTGLLLVGWLHCDVEAVFLPSLAETAVQQLWNGSQRSFSSLAAAAGGESGHDGCCM
                     GHGISVEDDTLVDFSVMEGAGLRPLATPFGMPLSPTPLRWDDSATWGNNGTCAHVYCE
                     VLALRRQQGTSHQVPRWPPHAAGVFALASSSSAARAAVYRPHSSGYRLRAAARADFDA
                     MSFASESDGHGQVARRVPLSDSGEEVEVRSAYDTRTWTSVTGAVPNAVLPVTDSVAHT
                     NHPRWEHTFRCGLALLSSLHLRVFDVCQHRRGGDGSETKSQAEERGSVRARLSGASGG
                     RARLLGTATVSSWLLRRLLCRPSGEGCAWLPLLWSPGAAAESMTASVTANGKGSFQQH
                     FFPAVCNGFVLVEWRRVPQATAVARLPCTRGASSWCASVTRRLLDSEGRHTTASAARR
                     RLFLGTFKKLHDFPQRWYHPMPSPGTEPNSVTAVPTAYSRQLGWITPEVVPWLRIHEV
                     RLQWPWLQHLLCMHGGQAQLSLRYRAAQGETRLLAQCLLVPLCELAGPSTSTVCGGRP
                     SRVHSRETRDVAAVYGMVLSAAPSDDTAPSPNAAAAAEATLCLPATPFIEVQVWWYPR
                     HGTGSAADCGLDVPPRFIGRGEWRFPAHEAAAEVRGVVAGTDQGAFEEALNARPTTAD
                     AADIACLSDGEEESEAARGPAPLPTALRSFFTPHEADLRVAPVHSTGVPQHVEGGVLT
                     WRLMSVPRLLCNGWGEVPPAMPRPLPESSSCVAGPCGDVRRPLRPSPAAVPASTWVWP
                     DVGTPAVVHVQVCDMICFDDTDGPGIDTARATAAVQIAVSGTTCVGSSTQTPPDESAA
                     ITGARCWMYPGDAPPPDAPRVAYALSPVYNTAANATDTGSNMGGYQQQHQLPPSQASW
                     ALKTPLRPPQATAVAGSGEKSAARSAMPGVGASRSPTVEVQWPPRRFGWVDDAPPSLS
                     VWVMAPPSLSGGAGAAGDTAAAAAKERVWGAVRLPGLAAFTSTSGVLWLPLFQSYATP
                     ALAAEVSRCAAAAEDVALSSSSSSGSSGSGACTGTGEHCGAVSPPPPPSTVERVHGGI
                     AVTALPQSTLASGDTPDSLVMVAAPRAAIVVRHVGFVAVRYAHNMQRRAADAVTTGGT
                     EPSAAGPRVLLVRAGSLHRRFPVAVAARHPLSYPSSPPPSESCTPVSEAPLTPPSDAA
                     LTHCNAAWSALPAADNAADTAAATGALLGNASGGADVLLGFEAHQLSVRTSDADTGRD
                     DSREASSLSGIAIFPLPQRDAGDGGSLQLRVQSRVGASAAMATNTMYFDPGGDEATPE
                     SAQWVPLVVRRRLHDAYGAGYDGEGESVVAELLVQWRVVDLSAATAPPRSTFLPTSLQ
                     CLVRECCGGGGASCSYTVLPALSAAAQVHQNPLVQSCAGVQRRAGFLELPGRERRGQD
                     TITAEQASRVLSRVLRTIQPRRRRCVYLTLDQLLVQCSVRQRRMWAALQRGTTASPQE
                     MLADGGYDDAASAPIRFRLEVQLRWPVEWSAVWRGIASLSPRRMPRETEIGAAASLPP
                     AAAASATSTADTVFLNVWVDSGEGVFAESSSPAAPGAAVADEAAAYASEECLLSCASL
                     PPLCLVLPSAEDIDHLLGDLGLAARFCLTFALFAVPQWRGDRDAREREASDVCVGTGR
                     TPMTFSPSMQFGLTSLLPSISSRSGGGPPCADAAGAGAKGGVATVPPLLRWRARVTES
                     LPVPSPASSILCISPKVRDLAVASGTAMGDDGARCGEQMPSWSRSSSPVSSSAEKDEV
                     IEGDGHTRAAGATAASLLPRTPALAHVAVTRIELCGVDVSLARGAAQRHRRALPPATV
                     TVMTTDVTDAAAAPTDRRGGAANAVSTVLQLLPCLLSPRPTAASPPIHATSTPSLPMT
                     RLDQTQSVPPPPQRYMWSTDVCIAAPVSQLIFYVSVPVAALRSARVEEAWLPPRSHSS
                     EAEQQDAAAQSVDAHWRSRHGDEVNVVGKAAYALDLLAQVEGARRPCDDSRRVSAAQT
                     ADCARDVVLEVESLVHGRCLGRLWVQVDIAAADLLMRDAASVFFISRMTLSVQRCSGF
                     AVGDVPLTYRAEETYVRLRERAALLCERRGRLPRRLRQQLNEIRQIRRQLRQGQIQQR
                     DGVLASHAAPSTAGVVRLTSAWGEQDTGASSTYTSKPFALPTATELVRRRCRATTSSS
                     STCAPLLCLSHDTKTAQTTNDATATVQLELCQASSGVTVAAGQMVLPLRSARTLWRDG
                     AWQPPVSTVTSPLSVRVDLQPCTVSEVHTPRIRPVAPPGGEAEVTATWAVHPARGDTW
                     LTCICLKPTVGGDGAATPPRQLLLRWVYCFEATAYPETEHAVDMPLHLRSSSTANDHG
                     GKRAQTPHACHRLRNGAPVYWSGAAMQLPRIGAVGATIKRVELLEVTSVSCAHLLVGG
                     EACEVTQASPLRSNLPTRDACMTVRLAVHVWTVADELCFEARRRQAQDSGEDALVWLT
                     CGGASAAGSRRCRPGYEVLLGLYTSNSLAKCAAQLLEQRGLRATGAEMPIAPLALAMQ
                     PPRLPPHTGVTTSVACNAAGPIKADESSSPPTAPHVRCHASTSPAKGVVVPGAVGSGG
                     GVAMRALTFRCGAAALATLELGQVDTISCCVLAARRRCDRGAALHVHQPPLAENGSGA
                     VDRPEASTVVLDAGRATSLLQERCSAEDLPQAATGSSPPLASPQLTATWLPTLELSHS
                     TMVAPCAAAAPPRADAHHGTQKARLQEVRGALLRVMLPLVQPDPVVAAAGDGKADDDA
                     GSDSGDEVATLKEEQFRIEVTVRGRRCGAGVDEAATTAYYVSDPLCASDIFRSARSYA
                     ERNGIGSSADTTAAAAGGDSPLCMSPSQWMSTLAMRLVPAPASAGTTDSAACESSEKE
                     QETGPLSPRMDSTATMEVTWALDVLGVLRTSACAAGVVLASAKCARRRADRDAGDGAH
                     RTEAVFDSLARMADDTDEDDNAGGGGVGMWELEAYAAWTDFLAAQDSVERMRAAQADL
                     RHWRCTIVGVEVSGVELPSWCSTGVNTGADTEDEVHDTAQCTSLLAQLVLPMGAARSV
                     AGADAEGQPTQDSAGTGHHHRRRLRSKGGLVMGVARTTVTRMDRDARLDTEAAPTSCD
                     RATVKGGACSARSVAPVSSSSRPRSHRYTGTFTPLSWSMAVSDMIGQAAATAHREGKG
                     TAATVGGDPAAGITVWRLLACAPPSSSSARNSIDNSRSTTQNTTQLVYNLGATQLTDL
                     LHECALYLVQVLARWLGDVYTTEEREALLEAAALYPTQWMPLAPVTPIMDGTQGSARV
                     RFKCAYSYHGPVLLLPKSLSTVVPSRITAPRVLADAVCCAQLDHMQLVYTSLDGAEVS
                     AATAGPHRRNGTSAAAAWPSRLSLVMRVLVTTERAVNGAVVQSRNVAHWHTQLTPGPC
                     GSAPLITEAVRESGTVAPFAPAASSPSSSPSAATPQPTPAPTAPVATPVPVTVLPSAG
                     GAAESIQNRGGEVRQRIVTAASAAPSSVTEVVPLLPTTSFFCWQPPSLEEAMEGCSAA
                     HTSVAVPAAHATETTTATLVEIVLMLADEKTEEGDSAAANSQDRLPGGGSGVVEGTVV
                     GRGQLRLGCSSLKEVVWDAAEGRVESGWRLYMPLSVRLPVTAGAALPRGGCDASTSAI
                     APGEGAKGEPQPSLTFSLDLLIFTAPSMAQVAALQASRAAQAEQRRRSLFLLQRTEEV
                     LAASATTDYHLHEQGSELNKRACAIAAGEPRATLRQFSQMWVSRKPYQLLRVPPIVIC
                     VDTFAVLDGIPSTTARRVAALSAGGNKKDGPTRLSQTLWTTLRRRMVRRVSTHDGTDA
                     VPCPSQRCSGGGLSGGTSDAAVSVEVQVWLVDEQTGEVRVPVWTLLSDGPPLLRSSGG
                     AATCNPSHAPSLASHLHAGRAILRNAQRLRLDWCSEDEGARPQSMSLPASLAGLLGGA
                     SVSYMATNGSACTWVSGGLRRRCAQHTRHGTCHALRVQGNAGGGNSGRGAVEPVPPLL
                     RSAAHHTSPGRRRRQPLVPPPAARVDAQPSPPPAPPGLDSCTPSCQFDYALYGSHFLS
                     CAAAAQDGQATTPVWRCEAHACVTRSFPAASPSATAVSRLFHSATLVGGRIWLLGGWI
                     SPAGATTLPSMLAALVGTSRLVERRRREVRQAVTHGSDNAATGDLLSLAPLAECSFRC
                     ASASTRNARCRADNAPPSASLCWCEVVQSVQCLNDGFPAPPVDAPSPSSQAENSKDAA
                     GATRRLLAAPPRLACHVAVACGDRYVAVFGGLMAPTGTDDRAPVATSAVHIYDTVQGT
                     WSAQYEPDTGDVQGEWPVARYGHCVTPVPGTGGARQPRSYFVFGGATTTPSCRTVLVP
                     PGQLLWIWTPVPGVLQHGRSCAVEDVSVHSAWRRVQLPVELTTPLAGRFLSQLHAYAA
                     VEVAAAVCGAEEPLDDGAAVPSDPGLTSMLLCVAGGMTAPALHTAPAATHDQSPFATK
                     ASASDAYRAFCECVEPWFAHPASDVASVLVACVCEHQQQLPSLPAYSAPFSQTRTRTP
                     "
     gene            complement(<452597..>454096)
                     /gene="ALDH2"
                     /locus_tag="LMJF_25_1120"
                     /db_xref="GeneID:5652523"
     mRNA            complement(<452597..>454096)
                     /gene="ALDH2"
                     /locus_tag="LMJF_25_1120"
                     /product="aldehyde dehydrogenase, mitochondrial precursor"
                     /transcript_id="XM_001683815.1"
                     /db_xref="GeneID:5652523"
     CDS             complement(452597..454096)
                     /gene="ALDH2"
                     /locus_tag="LMJF_25_1120"
                     /EC_number="1.2.1.3"
                     /codon_start=1
                     /product="aldehyde dehydrogenase, mitochondrial precursor"
                     /protein_id="XP_001683867.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652523"
                     /db_xref="GOA:Q4Q9Y1"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR015657"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9Y1"
                     /translation="MLRATLTRLEMAPKVIHIQDKLLINGKFVPAVSGKTFEVVNPAN
                     EEVIANVAEAETADVNLAVNAARHAFESFRMTDGHWRRNLMLRLADILEKNSKEMAAL
                     ESLDNGKPYEVALNVDVALSVECFRYCAGLADKVNGTVPPRSGNFLGIVKREPIGVCG
                     QIIPWNFPLLMAAFKLSPALALGNTVVLKPAEQTPLSVLCLGEMAMEAGYPNGVLNIL
                     PGFGATAGADIARHMDVDKVAFTGSTAVGHQVMQMAAETNLKKVSLELGGKSALIVCQ
                     DADLEEAAQVATTGFCFNTGQVCTASSRIYAHESVYDEFVSRLRKNVEAQRVGPGNDT
                     ANNMGPLVSQKQYERVLMYIEDGVKAGATVVTGGKKVGGKGYFVQPTIFSDVKEDMRI
                     CNEEIFGPVTCVMKFKDMDEVVKRANKSIYGLAAGICTRSMDTALRYSTYLHAGTVWV
                     NTWNNFCVSMPFGGFKRSGIGRELGNEVIDMYTETKAIHFALKGPIVKP"
     gene            complement(<456296..>456793)
                     /locus_tag="LMJF_25_1130"
                     /db_xref="GeneID:5652524"
     mRNA            complement(<456296..>456793)
                     /locus_tag="LMJF_25_1130"
                     /product="putative cytochrome c oxidase VII"
                     /transcript_id="XM_001683816.1"
                     /db_xref="GeneID:5652524"
     CDS             complement(456296..456793)
                     /locus_tag="LMJF_25_1130"
                     /EC_number="1.9.3.1"
                     /codon_start=1
                     /product="putative cytochrome c oxidase VII"
                     /protein_id="XP_001683868.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652524"
                     /db_xref="GOA:Q4Q9Y0"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9Y0"
                     /translation="MPRPFGVWAPATTLAEYRARIPNPFAYSFKWVYAMKKEVFYPPE
                     ALAHFKDPQQFKDAVDTVIAMRVSDKIFGEGQKLPRHPVILMLMVLATHGFIIFSGLK
                     YYYGTYMPANNPTWRKTVNKEWEEAINNSPWDHMSHVWQYSDEYAAALGDTAAPGQRK
                     FYIPA"
     gene            complement(<458326..>459957)
                     /locus_tag="LMJF_25_1140"
                     /db_xref="GeneID:5652525"
     mRNA            complement(<458326..>459957)
                     /locus_tag="LMJF_25_1140"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683817.1"
                     /db_xref="GeneID:5652525"
     CDS             complement(458326..459957)
                     /locus_tag="LMJF_25_1140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683869.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652525"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9X9"
                     /translation="MPKGPRTAEVSRRLVDAYVTTLRQHLPTYCIRQLDKLPRAEEHQ
                     LTRLRQSYPGTPAELLYLLQRVNGTCWETLQAPPGSVPPSAAAAQPRAPLASATVTAT
                     AGKSGSAASTTSTATTTTAGSADAGALPTAPTYKTAAKSAAKATAAAAMASEAAVFIK
                     SQIAKKVNTMAGPRQRRPLPHFVALPILGSTCTSCPYYLKSVEQMLVAEQQFPPPPAT
                     LPDEGEGWAPPKAAAATQSSSPPLPSTPKPSLPASTATAGGGLRDAACVTAQFSGEGG
                     AAGDSPPSATSCVTPNAHSIASVYSGYKIVYGAPPPLPPPSSLSAGSASNAAASYGAP
                     TGDAKTSFATTPTPTPLSEEPRVVYVDPRIDIHASFHQWLVFADSVQPHVRGSAPITP
                     DADPAKMTAAAATRNAADSSRFSPARASPHAHTPSSPPKHFAASRLYIDFKPVELHGG
                     VYGQVIQFVHGNPDSFSVVASDFGEYLKYIMTEECSFTEELEDDDDDEGVRVLEENCN
                     TSSLTGTPPPPIITSADGRPLTSPTSSLIDVQKKR"
     gene            complement(<463407..>464147)
                     /locus_tag="LMJF_25_1150"
                     /db_xref="GeneID:5652526"
     mRNA            complement(<463407..>464147)
                     /locus_tag="LMJF_25_1150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683818.1"
                     /db_xref="GeneID:5652526"
     CDS             complement(463407..464147)
                     /locus_tag="LMJF_25_1150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683870.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652526"
                     /db_xref="GOA:Q4Q9X8"
                     /db_xref="InterPro:IPR007965"
                     /db_xref="InterPro:IPR016181"
                     /translation="MRRRPPQLTKTKLADEEVPELTLVPDGVSRWTGSDLDALLNAAR
                     RGGAEAAQQDLERKLCRTIDILGARSQQAQEINAVLTSVARLRENSTFRLYLLTQNHR
                     GVGILKVGVKKLFVTHPVTCGLVEVDPLCVLDFYVDESCQRQGYGKMLYSHMLKAEHV
                     SRPEVLAIDRPSNKLLGFLRKHYGLAAYTPQVNNFVVFHSFFDHTTVSERGKLLRAPS
                     PARASPFPSSANATVAIGGAKAKNWTPG"
     gene            complement(<465364..>466806)
                     /locus_tag="LMJF_25_1160"
                     /db_xref="GeneID:5652527"
     mRNA            complement(<465364..>466806)
                     /locus_tag="LMJF_25_1160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683819.1"
                     /db_xref="GeneID:5652527"
     CDS             complement(465364..466806)
                     /locus_tag="LMJF_25_1160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683871.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652527"
                     /db_xref="GOA:Q4Q9X7"
                     /db_xref="InterPro:IPR006876"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9X7"
                     /translation="MLNWWLIVLIVVVALVCVGLTIYTLIYFQSEEDSKWDYVPKAVA
                     GLGLILAMGSILLVPYDVANSPNPTVAHKYVQTLNTQLMWEIVLWMMAVMAVVVCPFF
                     MFFYEAYDPDKPSVGTQVSHGVISTVIIAFLFALIVGLCYHFQGVADITFQAYKGNPQ
                     MALPESSTISYVSDSIKSTITVSVSIYTYCIGMLCFFGWIFFFFYGGAGIVAYPMSLI
                     QNFKSRPKAIGASKFAEEMAIILAKADAMLELCMRLQQESRGSISRSTKNKINIVRNE
                     VYFLEAQQAQLIWAYTKAGGSPFIVYGKLALGVVCIVTAIMWCLQIFVYNTFDADPFL
                     NTLLLRLNDAFALCGVCAYGVLAFYLTWSTFQGQIALGLRLVFFQIHPMKKHDTLVNA
                     FLFNVSLLLITSYAVIYFVVHSFQDYATMTAINGLMNVFVTRLRGIGAFIRWAQFCFL
                     GMSLLTLIWMAVCPKRKSRDATKLRLDDLS"
     gene            complement(<468887..>470464)
                     /locus_tag="LMJF_25_1170"
                     /db_xref="GeneID:5652528"
     mRNA            complement(<468887..>470464)
                     /locus_tag="LMJF_25_1170"
                     /product="putative ATPase beta subunit"
                     /transcript_id="XM_001683820.1"
                     /db_xref="GeneID:5652528"
     CDS             complement(468887..470464)
                     /locus_tag="LMJF_25_1170"
                     /codon_start=1
                     /product="putative ATPase beta subunit"
                     /protein_id="XP_001683872.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652528"
                     /db_xref="GOA:Q4Q9X6"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR000793"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004100"
                     /db_xref="InterPro:IPR005722"
                     /db_xref="InterPro:IPR024034"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9X6"
                     /translation="MLSRVQSAMIRRAAGVRAASSAVAAAAAKPAEHKGRVGYVSQVI
                     GAVVDVHFSEGVPPVLTALDVTEDLGRDEPLTLEIVQHLDANTGRCIAMQTTDLLKLK
                     SKVVSTGGNISVPVGRETLGRIFNVLGDAIDQRGPVGEKMRMAIHAEAPKLADQAAED
                     TILTTGIKVIDLILPYCKGGKIGLFGGAGVGKTVIIMELINNVAKGHGGFSVFAGVGE
                     RTREGTDLYLEMMQSKVIDLKGESKCVLVYGQMNEPPGARARVAQSALTMAEYFRDVE
                     GQNVLLFIDNIFRFTQANSEVSALLGRIPAAVGYQPTLAEDLGMLQERITSTTKGSIT
                     SVQAVYVPADDITDPAPATTFSHLDATTVLDRAVAESGIYPAVNPLECASRIMDPDVI
                     DVDHYNVAQDIVQMLTKYKELQDIIAVLGIDELSEEDKVVVDRARKVTRFLSQPFQVA
                     EVFTGMTGHYVQLVDTVESFSGLLMGSYDQIPEMAFYMVGGIKSVLEKAKAMAEEAAA
                     MEKQRRARQAANASDSQ"
     gene            complement(<472239..>473816)
                     /locus_tag="LMJF_25_1180"
                     /db_xref="GeneID:5652529"
     mRNA            complement(<472239..>473816)
                     /locus_tag="LMJF_25_1180"
                     /product="putative ATPase beta subunit"
                     /transcript_id="XM_001683821.1"
                     /db_xref="GeneID:5652529"
     CDS             complement(472239..473816)
                     /locus_tag="LMJF_25_1180"
                     /codon_start=1
                     /product="putative ATPase beta subunit"
                     /protein_id="XP_001683873.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652529"
                     /db_xref="GOA:Q4Q9X5"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR000793"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004100"
                     /db_xref="InterPro:IPR005722"
                     /db_xref="InterPro:IPR024034"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9X5"
                     /translation="MLSRAQSAMIRRAAGVRAASSAVAAAAAKPAEHKGRVGYVSQVI
                     GAVVDVHFSEGVPPVLTALDVTEDLGRDEPLTLEIVQHLDANTGRCIAMQTTDLLKLK
                     SKVVSTGGNISVPVGRETLGRIFNVLGDAIDQRGPVGEKMRMAIHAEAPKLADQAAED
                     TILTTGIKVIDLILPYCKGGKIGLFGGAGVGKTVIIMELINNVAKGHGGFSVFAGVGE
                     RTREGTDLYLEMMQSKVIDLKGESKCVLVYGQMNEPPGARARVAQSALTMAEYFRDVE
                     GQNVLLFIDNIFRFTQANSEVSALLGRIPAAVGYQPTLAEDLGMLQERITSTTKGSIT
                     SVQAVYVPADDITDPAPATTFSHLDATTVLDRAVAESGIYPAVNPLECASRIMDPDVI
                     DVDHYNVAQDIVQMLTKYKELQDIIAVLGIDELSEEDKVVVDRARKVTRFLSQPFQVA
                     EVFTGMTGHYVQLVDTVESFSGLLMGSYDQIPEMAFYMVGGIKSVLEKAKAMAEEAAA
                     MEKQRRARQAANASDSQ"
     gene            complement(<474703..>475065)
                     /locus_tag="LMJF_25_1190"
                     /db_xref="GeneID:5652530"
     mRNA            complement(<474703..>475065)
                     /locus_tag="LMJF_25_1190"
                     /product="ribosomal protein S25"
                     /transcript_id="XM_001683822.1"
                     /db_xref="GeneID:5652530"
     CDS             complement(474703..475065)
                     /locus_tag="LMJF_25_1190"
                     /codon_start=1
                     /product="ribosomal protein S25"
                     /protein_id="XP_001683874.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652530"
                     /db_xref="GOA:Q4Q9X4"
                     /db_xref="InterPro:IPR004977"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9X4"
                     /translation="MPPKAGQTKKAKMEAANKGAKKTTKKWSKGQSREALQNAVMFDK
                     ETYDKLRSEVPKYKLITPSIISDRLKIAVSIAAAGLKQLCREKLIRLVSCSSKTRVYT
                     RIVQAAPAEAAAAAPAAE"
     gene            complement(<475755..>478277)
                     /locus_tag="LMJF_25_1200"
                     /db_xref="GeneID:5652531"
     mRNA            complement(<475755..>478277)
                     /locus_tag="LMJF_25_1200"
                     /product="modification methylase-like protein"
                     /transcript_id="XM_001683823.1"
                     /db_xref="GeneID:5652531"
     CDS             complement(475755..478277)
                     /locus_tag="LMJF_25_1200"
                     /EC_number="2.1.1.37"
                     /codon_start=1
                     /product="modification methylase-like protein"
                     /protein_id="XP_001683875.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652531"
                     /db_xref="GOA:Q4Q9X3"
                     /db_xref="InterPro:IPR001525"
                     /db_xref="InterPro:IPR018117"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9X3"
                     /translation="MTSARSYPPLYPAGVFVVRSKQELAPLVARLRAARRLKPGRNVT
                     VFDGEHFAEVADALEIRLSASAPEGRGGGASEDAACSLRETLVHLRETTEAEAAELVM
                     ATQTGGRTGLSGNDGIIALLPTSLSTSEAHSTNARASAPAVMYERCALITARDSVEGE
                     EFLSLLRVPCAERAGTRWPLYMAAHVVGEFAETELRTLFSSDGSSGGPSTESDGADGH
                     EPMKSSTPVAYIRGVRRFHRVCCPVLAEMPSALAAMRRTALLQRHHRLVQRGEAAADS
                     PCAPPSSETGAPSLSAATLQRSSAPPGGLSRDANTACSPFFTFSELFGGIGMFRSGLE
                     RVGGRAAFAVEFAPPAQIVYALNHRCLHDCPAALQLPNAKREDPGENTRGLLTQRGGG
                     RLRSGTAMSAAASAAAEDYAATEGGFPDATARSVPFLVGDITEIPSAFFPTHDVLTGG
                     FPCQSFAKAGDAAGLHADKGWLFYEVVRVLAATRPTAFLLENVEHLVEVETGAQLAVI
                     LARLHRPASALSTPTAEDVALEYEVQHVVVDGGALTPQTRKRVYFFGFRAASALVPAR
                     AASLDYALCQFALPRADDGEASAAAARVVADALQRIKVASLESPYRIVRELLVAPSTV
                     DASYSTPQGRSMQDEPTSTSRGEKSAAHSSAHGDLQLTPAQWEAVRRSRTYRQNPLWR
                     LCDVQGRARTLLGSYRTSYQLYSEFVPFSSERTQHEVVAMLLEKTPLKPGDDADDVRA
                     GGSENPAIPAPPPPPLRFFALRECARLQGIEDTFLLPHDTTQLSSSADGATPPGATVI
                     PAAVLRQVPSGAVYKLIGNAVNPRVVTCLGGAIASYLQERRR"
     gene            complement(<479597..>482788)
                     /locus_tag="LMJF_25_1210"
                     /db_xref="GeneID:5652532"
     mRNA            complement(<479597..>482788)
                     /locus_tag="LMJF_25_1210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683824.1"
                     /db_xref="GeneID:5652532"
     CDS             complement(479597..482788)
                     /locus_tag="LMJF_25_1210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683876.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652532"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9X2"
                     /translation="MLPLKTKRSAAIAAPPPAAERTPTKRAPASSAKPPTSRSPQPQS
                     VTTPVKRSSVAGTARSAPSSSSTPQRQQQQQVSQPQLSTPEAQRSQSTVKQARESSFA
                     SSPQVIPPAPANSPAPASSRAPQRRSSASPNHQSPSKKAARVKANSPAAAAAAPTTSA
                     SPVSPPSPARHERTTPLRPPQLASPAKRGASGVTNSSTYASATPASTGPARKAGSVAA
                     ADTANVNAGVSAAAEGAVKSSKSARSRSVRRSRARAALSTSTSATSSPEAHFVERFIR
                     ESKVIAPDVSGILCLAVHPSEQELIVARENGSLVRYDVAFFQGIPQFVQRRHTGGQTH
                     RTISGLAYVTVPASVSSLSSVSKSGAGSAAHHVLLASMMSGQIVVYDAELLVPIALHQ
                     RSGGAIWALHAVSAACIYAAMADGSWQQLSLTCKRDGAAPQLELVRVVPGISGADRAL
                     SVTTSLSLRIAVGSDDAGNVHAWRLPAGVSSPGSSVGAGAAEEDDEAAAPSRARGLAE
                     HESLWTTKLAKGIALSCAVVGGTQRPCVVVGTSMGDVVLLDAAHGHVFQTFSQHKGPV
                     STLAVQGDAVVYASGWHESLRSYRCNEQGDWYPAEVKRRTHYHEASQLALLPHRRLIL
                     SASRDGTIMYAPTAQLFTSPAMYVVVTTQQFAYAVDREVLLQSRFDTIEAFHIDSAAR
                     HWVPFFGHRLDGRFHLSGLWCDRQLNYIVFSTEERIGLLKVAWRAHAAMSVSRLEAVL
                     ELPARSGVVDVCWSGTAAAAGSAEEASAGAGEETAADASALLPTSQRLYILYDDGVTC
                     VTLADGYPVVHTPVQVRGKGLPDNSLRPYRVLCRPIAAASLTRSRSSGPASDATEDEE
                     LVIYGHRGSCRMRLMADGTPDADSLVADLDDVYALAQELPLLQDALSTKVNDNSHGGA
                     ERTLKRARVEASASSAPAKATSCEALVGLSTLRQRYFVGSMLHSSSAAITPLSATLPH
                     DVRWIARIATFSPSSSTKTTAPAVAASYKYLGYFSRGLLVATGNSWHMVRRMCVEAAF
                     LIKGGTEVLVLERNLEKTLEALPLCWKVRRFGN"
     gene            complement(<483357..>485180)
                     /locus_tag="LMJF_25_1220"
                     /db_xref="GeneID:5652533"
     mRNA            complement(<483357..>485180)
                     /locus_tag="LMJF_25_1220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683825.1"
                     /db_xref="GeneID:5652533"
     CDS             complement(483357..485180)
                     /locus_tag="LMJF_25_1220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683877.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652533"
                     /db_xref="GOA:Q4Q9X1"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9X1"
                     /translation="MRTFVFISDIPAFLLEPIIKGDKDSSGAAAVAASKFDLRYERLR
                     RLLVEHSSGVMLVMHLESKGYALALYASEGEALAACKADITPEQPGRKYPPLRLRIIE
                     KEKPCPPEPVYKPFLMVENEEVRKEELADTRGLELVYRGRAVAKWCARTLAGEDCFFG
                     VSCLKLHKAAVQRTVRKRPRIEDDEAGARLTCEQEAVVRHLLSSAEAARAALTPASMA
                     MKDCTYVPVSAEEMGLLSQLACEALSSAPLPAFETLEAHPTYQAVLQRIDDALQAQRA
                     AAVAGESMTFFPRLSCPGGAPWDWSVESEDGRRLLRQRCPLPANGAPTPLERDVYTQR
                     LWYHMNQLNRCHSARDVLRMLCGSHRAREALRRHSEAIDGGDARTHASSSSLPSSSPA
                     TKAAGLTICLQPWLYLPTVGCEVTAYLERGGRRVRGVVQRYGQVRLMTSATLLASASA
                     VVGDAAHVDALLARYAVLESATDAAAEEDLTGELRALQRSFASAVGDVAHHLQTHPDS
                     IGGDGAAWCVHLAAVLTPSVAPAAGPPPPVTLLSASPYQRALEECSMYSSLAPPIRGD
                     DMAASAATAPAKVDVTWNTQRHPYISLFSRSVLEKLRADAA"
     gene            complement(486161..490998)
                     /locus_tag="LMJF_25_1230"
                     /pseudo
                     /db_xref="GeneID:12981312"
     CDS             complement(join(486161..487777,487780..490998))
                     /locus_tag="LMJF_25_1230"
                     /pseudo
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /db_xref="GeneID:12981312"
     gene            complement(<493009..>498927)
                     /locus_tag="LMJF_25_1250"
                     /db_xref="GeneID:5652536"
     mRNA            complement(<493009..>498927)
                     /locus_tag="LMJF_25_1250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683828.1"
                     /db_xref="GeneID:5652536"
     CDS             complement(493009..498927)
                     /locus_tag="LMJF_25_1250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683880.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652536"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9W8"
                     /translation="MDRFLHALAPACHVLPLCIIYPQHTRLDLCIDKGGGRRGDSITA
                     PLPLLSPALPPPLPPEAAHSHRRLHLFLSRFLPLLCISPCVRSSSAPPTSSPLPPSLY
                     PLSMKHFSCQPDSHNAFGSLTNGVLTYFTVDCARYRRVAANGICDAEELHTPATGGDA
                     TVEGSAPLQWTGQRPFTASSSSTSHSAGHGVTQHDVHFTTETRMHIQRTLTLPSPFQG
                     TQCFFSMANRTVFGTDMAFIGAANGLLALAVLQEDLLLYVRGKDPQSLREHAESSTIP
                     RRCSASDSGVIVRQPSSPSATSLTLPSPSKGGAGGGGLLSFPSLIGGAAAAARTSRSS
                     SSFQGRDPSSNAAASTPLLPHRGGGVVRGLYRRDAPSTITWMRNKPLVLVGYTSGWVE
                     WYEVSISAAYRKELLDPAKEMPYGASVTSSAFAYRALNRDSLTSHVARVAVGGQIAGL
                     RTELVASCVLAEAGALVSSDYFAANGTVAVGSERGIIFLFDADQLEAPLCEVQLSTPS
                     AAFLYCHPFLPIVGVLSQSVWTGAEEQTISTAAAAARRRENSPTLHLTGSHNSGLVRP
                     SAGHADGAMGAGVGGPQRGVTSGKRGPTTFPLVLLQGTRGDPGSGPQQLSSPSEATPS
                     AAAQGTSKPDRHVGWHDASPAALMSGGSVAEAFSSGISATSPFGPYSSGSTVPEVGAA
                     SALHSGCLLTFVEYRKDPPPRLLSRAWTGAQPPTPSHRLTQVLQHRMEGAVARYGTYY
                     TFSWKFSFDLELAVGNLEEGALHIVRAARIMDKDADSDAGDAADEEDREGTAADGERG
                     VPAPAVSTASAAHPSSYQVVQDYNVRLPLHSLVNVEYVSAATSSLSSLDNAVAVTEAE
                     LIAGSNGTGSTTAEQSLFQRDAERCQRQTALLGAAVDPRCRLGFSSVSPSQASAVAGV
                     LCRPANPLWAGLAVVSMPRGGRQHERGHSGDAHRYVGQLDLFGAGRGHGGAFGVLYSP
                     ASMRAGDGAAGVIGGARASGCAADGGGPLLKENALAAAMRQPFRGDAGAIGGTRHHRR
                     HTGDMGNGSGTDATSSRWFYSSAIPTVSPQQSHQQRRREQQRLRRDPRAPAITVPSYA
                     AMCTKNEIASAALIAADQGVDLHDALRIGPGNVSCVAVMNAAGEVASVPIEVRAVSAW
                     HEAGSVFVGLGPTLYAADLVSIQGIEQLMRRRYAAGFGLSSVANLAAVKEVGGFGSED
                     VAMLFSYVVTLEAVSLVALSGPVPSLMELLHSCPATGRGALQREAAARVRTRLGPAWR
                     AKMEACVCHGDLCCFLVLQVLRWLPSSLTEEAGQPWRGIAQPAPLADTTPVLGENSTN
                     VDIERAVAVEVTHMRYTEAAGLLLRFASRSPSYGAMATLLRRPEEAQSMACNSDPRVC
                     AAFRASLTPWLLVVFHCLCGPCDGAPRYQSHGVAADKSGLHDDAASVRTVLPPHLYRH
                     SALPFWDRVALAVVMEAGTTAAFTHVMQDILLRECNPIQALLLQYGIHLRTYAAMQEI
                     VDCTGDFQLGACLFARVGVLTTAAALAFPFLLDAEVSAAASTAAATEQTAVTLPAARS
                     HDLSAVSAGYPPYSYRADGGFGGYGDGNHEGQGRDSVYGCSPFSYLRSSHRRCSSGQL
                     PSSSAGDEEGSLEDGVTHTARLVLNSALPPPARAPREAINGARILPHSADAARVSSSR
                     PPGHGLRYAVSPNDAVAGNGHGDGDGVGNAADADVPWVWWAAAYRSFLDDEQAFVRRT
                     TFDVECRQLRGGAFLARDATAAMTVCGADAASSSAAAVVSAAGDAGVGRYGSGCHSLH
                     RTPPRDTEAVGLRCPSRSPSPADLVSRSVEQCVTHHVAGAGGGSTSGGGGIGVGRGLS
                     AAASWSSPSAPSAFAGPSGGGAAHVTSVTPPYASAVMRSPEPKPCVCGEQHTGTQLIR
                     SLLSICSTTTTRCCVCLETVRLGSKDVDTAFAWCTSCDHGGHAYHLQSWFRTHRRCPV
                     NGCDCHCDEDSNLY"
     gene            complement(<499573..>506697)
                     /locus_tag="LMJF_25_1260"
                     /db_xref="GeneID:5652537"
     mRNA            complement(<499573..>506697)
                     /locus_tag="LMJF_25_1260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683829.1"
                     /db_xref="GeneID:5652537"
     CDS             complement(499573..506697)
                     /locus_tag="LMJF_25_1260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683881.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652537"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9W7"
                     /translation="MCVRLLSPSLHRYTPPLPSLPHLSCSLYYLHCAVGCPFETASRA
                     RWSAAVCLPRSSISSSLLPIHPLALPSDMLLSKQPGDTGIYATATSSQVRLYYVLDRV
                     FPVASSRAVAAEGSDVLGNAACDGFDDIRASATTQSLKPVPPDLMPYFAGAPACVPRE
                     YLRMLCRLSAVGRGTGSVAAATTSGVDVRAGGYDDYGLPAPLATSAARVRFPPPPRTG
                     VGYASATSAASDDWLQKEQQRHDLSSAYHWGAPLVPFHTVSCGGGVGAGEGRLLSSHG
                     GASASLQEWATPTLAAAGATSTFTEECGPGQASSHVSGNSAAWYSGYYTGGSQTLAGR
                     AGGGGGGGRACASSTASAAAVSTAPTALSLSCATDCVLFFVANAEGLSWIGRSDATAL
                     SPLRVSTSLPMRRRGTGGYGGPSGGGGGGTVVSSASHPPQPFSEGCGAPVNATFSASN
                     FSSSEQTATPPNMAGGRSLQNAPVMVSDEDRGEGSDDDKAGEAVAAGTGGGGVADNRR
                     RPSLAGAAAPSFTDGLDVYGGVVPAAMAGLPMRRAVSRHDRVVTASGWDPRNSAILAL
                     GRQSGAVQLLDVEYVVGSVEGRCCSPTTTSRSTSNDDTNELLFVPAGASALGGSSVCG
                     TRLVPYAGADHLSYSVVQQKQMLGPVTALDWMPQSHLTVVAARRLDGLGFYAELLDLR
                     ASHDGVTYLGAPPEVFGVPVCARTTDNAAPCVLCSAEQVACHPSQRYVATVGASQMQD
                     IVQLWDVRMATRPVSCQVHLRAGYTSLCWSAAEAGVVLGTTRDGGLRAHAFKELAPSR
                     AAPGGPVVVTSHHYGSAANSHLSPSGFGSGGAGGGFGTGRSRRRRAPSGGLPHHRSPS
                     GGELEADGWGVSNSNPVNSGCSGTEAEADAEEDFTDDSCSIRSGFSGDGTGAAMPSIT
                     DGSNALVHVSVKAQSALKCRLPSRVPAAAVGWVCHPLSESMKTITAGSIPGLASVHRR
                     TSSGMSAAGPHHSERLHTSHGATSGLRPTDDCDGEVDDNAMARGCRTDLPQLLLLNAK
                     NGELYTQVYNPGGSTVTSLDSSTALVGAGPNAFLTHASTAYKTASYVYEEAVLDRLEC
                     QAAAAAAAAAAATAAASAAAGMAVPSRPTPIPSGSASKAGMGLLCGRAGAAGAATVTS
                     THRPHISGDSTADGAQLLSNDSSATDSGRACTAAAAAAARGGGDGVATAEARLKGRPV
                     DLIGLGLLDEVEDENDDEEGERDTLRVSAAAAATGDYEHCVLAGANTNGQQLGFGAAS
                     STPHSLSSIGAAGTAGVGGDDGSASAGSPRAGLTREAASSSVCTGGAAAPKAPKGVRC
                     SGISGALQEEEGLLGRRASLREPVAASPHSQSTSAELMQQPYIVTTSAGGRGAAQSAT
                     AAAAAFIPQEMSFCEFHRLDRTRHLWRRLRSGFSYDPVRNLTVLLREGLDREAYATFL
                     YGCCAAQLLFPAAVMVAPKSRSTDPATGPAASAPSLVVGLKRAVPGLLELLVSERELR
                     QQLRLSDTRFSSQFPLSQHHHQLASANATAAGEAAMAAGFAPPSGYAIVGPIGALGLQ
                     TPLLAGLSSAMERHKGPPGLSLHPFSAVAAGIRAGRPPPPAHLTGPAINAGVSHTASS
                     VLRGSAGSPGAAGGAAGDSAAYLPMYPVAIGMLRQLVLQSMGWTTPPAVCLVDPPAEH
                     TTEREGTSASAAAARAGGVQATRSPPPRGDHRPQHPAERFFVQGDGIGQRNLQEALER
                     RVAVLVLLDRLEEAAELLALYGTRNAQYPSIALTLSAARGRQTTVMSLAADDCPGVTF
                     WIHLMLTYMELVMHQQSCGAAAAEDRTLPADAGSSGSGSDDATSSTTTSTAAATEPVS
                     RFDDLFTLPQQKAVVLRLLERYPRLVLSDKVALATALLLPSRYHSGHVANLLEVLQAL
                     VQQQYRDYSSTATASTAAQQAVADSTYGSPSSASLTLGIRARQQRRVDSKRTSLSGLP
                     RSPAQNSSVDAAVSPAALGSRFPSPLGVPPVHGSVDSHYSDPSDTFVLAAAASAASAD
                     RFAPIHRCSLLLVTVVEGVSTDCGALQRYVDESGDVQTALSYAAAFSNVLSPTVHTWR
                     DAYRRLLNDQGLAMWRSLHDLHIVKLLKAREEADKHGGGSATSGSSNPHSAGAGGGVA
                     GVPGGPVIGGGGGSSAGMAGAGTTRSGGVVEATTGASPGSLAGAFSGAGVPRPNGFPG
                     ALGSLGSDLGTGPGAASAAAMMSTQTAMMMERTLNRFAQTTATATTDRDRSLREAAAT
                     AGGASQGANEALHRSVELRCNCGQAMHATAPSKSTISSMTSTNMTRKQLIPCGNPECR
                     QWQSPMCTVCGERMEHRATELPPERFFAWCSVCLHGGHWCHLREWFSKHTKCPVENCP
                     CRCCDNVHLS"
     gene            complement(<509024..>510556)
                     /locus_tag="LMJF_25_1270"
                     /db_xref="GeneID:5652538"
     mRNA            complement(<509024..>510556)
                     /locus_tag="LMJF_25_1270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683830.1"
                     /db_xref="GeneID:5652538"
     CDS             complement(509024..510556)
                     /locus_tag="LMJF_25_1270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683882.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652538"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9W6"
                     /translation="MWSMLSQDFSDFAEAFKSESAGFMGYVEHIASNVVGRGDVYAGD
                     EALGKAVAEMPLSNALLRRLQDAEATYTLPIQPEEKAAFAAWIKGSPLSSVNALRRQQ
                     YMAAGGKITTKSEGDSPAGTSGRLPPPGTTPNRRTVEYPDEPIEETRWRLLDYNEVVL
                     KRYMSLVGDAVSPRSSISSSPDARRWQTDPSFAARRGEGEGGSPVPVAATGERPQVSS
                     PSSAMTPARGRISEDEFFDRYLFRLTQLRVSESQRRGAAPHQKASASTSAAASPASPS
                     APPTPSSSPQVNDRSRQSTDDDDFAVVPLFAKRVMTAASGFVMGIDNALNSVVTGEAS
                     RCSGAEGEGTDELSEDGGNVDPKNLVHYGSTRQQIAGLESMVQELQEALRQERRRVVQ
                     LASALKAQGIEVPAELVTPAPSSAPITPAEKTEVSLATALAAARDSDPAPATPTGAAA
                     AASSAGSGASATPLAPAAAAPPLDNQKGSEATSSTHSTSGDMISAVTEEDTWVCMSTS
                     AE"
     gene            complement(<511710..>515225)
                     /locus_tag="LMJF_25_1280"
                     /db_xref="GeneID:5652539"
     mRNA            complement(<511710..>515225)
                     /locus_tag="LMJF_25_1280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683831.1"
                     /db_xref="GeneID:5652539"
     CDS             complement(511710..515225)
                     /locus_tag="LMJF_25_1280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683883.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652539"
                     /db_xref="GOA:Q4Q9W5"
                     /db_xref="InterPro:IPR001373"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="InterPro:IPR016159"
                     /db_xref="InterPro:IPR019559"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9W5"
                     /translation="MRCVCARLALLRISCLPSWTSPALMWLYRMSACVHVRVSLSVYP
                     SPPPLPFRGISLRLPSFRFSLPLCVSGHVRRSEHLDTRSRAHVWWASPRTSGSRLRSS
                     AALAALYPLTGIKMTMFPRPPLPSFQVTLLPELPPGKAHSASSPPSLSCSSRASVQMH
                     DEAAAKAMLHAVLDMAYDCTTPQRRFCSYSPEAVLRSVRALVDSDLCAPLVEALQAAT
                     RAYAQRCVEVLLGQQQQLPPGAGTPQGMANGDTESDEEATALSANATLGVVQILAQLV
                     TYWERLQQGLAELSSVWVYADQWCAMQVGSAMPRSLIAAATQEVREVFSGYPELCDTA
                     LAGYVAVLKAELTADTAALLSASRSARMSYAAALPDKRAAASPAGSEQPVASTPPLPR
                     PDATPLAALACPPSLASLDKPLRQRLLRLFTQLTLATQQYTTRVEPTVVRVVQGHYEE
                     VAHRLWAENVSARVFFRFCDGVLRHLGPMSASLLHPGTSLMLEEAIQGSLISRVGSEV
                     LKRDFVALMEWQDYRSLRLAWRLLSVSARVRSSPLVADLFHEYLMDCGQRIMEELVPS
                     STKGTPAAALVPPCERPFLAVRHLLGLLEQGSRTVAKCFAECERDFKVALHEDLQTIL
                     EAYPQAFSEQLAAYQDAIMREVEVGHVPVGSSKPTAPVALEKNGDDDNDDEEDVLSSP
                     LRRPRPEGTLPSSRPPVAAPSPGFTRAEEDEGVSSGREESAEVEDAAEGDAVMGAAAL
                     HHAAPLPTEVREATSVLRRIAHIYSYHPKKDLFEAAYWRDFARRCLHAHRKLNSAPEN
                     TFIGFLRDICGLSFTSKFEGMLTDLTSSTELTTQYNTWVQEQEQQQQQQPSGEAGVDT
                     AAVGRLVSEAKGLDAHLFILTQSYWPECPSMPGNFYVPPALRAVTQLVEKFYTGRFPN
                     RHLSWQHPLSHATLLVRLTPQSSVLTLTGTYTQCVLLMQLDALYDRGVTTITAKALCD
                     AVGMDMTNTELLWSLQGLCHPRFRLVLRAEAASSPPSGGGAQRKSAELDNEDDESAAR
                     VEESAASCTSPQSVSPGAAAGASAGCTLAATDLLQLNLSFTSATSKVRIPFQTRMRTT
                     ASAGLDGPSRGGRTADNGGHLVEVAIVSCLKSQRTMTRTDLASAVAARVPFPVTTTVL
                     KKAIDKLIERGFMIRGKGSTYVYSA"
     gene            complement(<515808..>517691)
                     /locus_tag="LMJF_25_1290"
                     /db_xref="GeneID:5652540"
     mRNA            complement(<515808..>517691)
                     /locus_tag="LMJF_25_1290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683832.1"
                     /db_xref="GeneID:5652540"
     CDS             complement(515808..517691)
                     /locus_tag="LMJF_25_1290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683884.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652540"
                     /db_xref="InterPro:IPR007717"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9W4"
                     /translation="MLPRSLPFRCWHLFSCFCPAPIPSPIPLLRTRTHAPCNPFSLVL
                     LCSLTLFHSPCKKCSSSVRARAGQAIEPWTKRRNRVKKPSFIAIHTGAPSRRFGREEA
                     LARPRSQSPACPRAVRPSCSHCCCSCCVPCPRFGCHPTLAGVRSSIFSLRFSPVEAGR
                     SESLLIKSHTHLYTHTYTHTHIHTHTHTHTQIRTCVWGGNMSANDSLGLLREEQRRRF
                     EAAKREGNTPEVRKCDACQQPTYSTNVCPVSGLFHDLGKKKLIGGSVVTSNVISSSQL
                     MAAIDQTRVKWVPSRTQLVKVDAQSINIFQSFVAQMDWRLQRYAILYGLYDDATHTIE
                     VHAVYEPEQHGSTYTFEPLPDAHLDKVERIAKALGLRRVGVACTHPMRDPEHILLNFR
                     ELLLCAKEQSRYGDECALLTVAPAAMPSTKSGGATSAPGELPTGSAAASSGATLEPTI
                     VVSCQAWQTSPQCVHLYRLGVLQESPSGEAALQDVEQARQVHCTMPLEVAQTDTDPSG
                     HQRFVTKAPSTEIDTRWFTSYIAVQQFESPIVRGAFMRLSRPGMPPPVLQNLRNYISD
                     PKRKSMSFAETIADFHVLVYLLTQIFTSDDELYTLCSVARTKKMTEEAANYQAILLGM
                     MSA"
     gene            complement(<518128..>520107)
                     /locus_tag="LMJF_25_1300"
                     /db_xref="GeneID:5652541"
     mRNA            complement(<518128..>520107)
                     /locus_tag="LMJF_25_1300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683833.1"
                     /db_xref="GeneID:5652541"
     CDS             complement(518128..520107)
                     /locus_tag="LMJF_25_1300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683885.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652541"
                     /db_xref="InterPro:IPR005037"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9W3"
                     /translation="MEPHVFCGPEFILEVPPQSVSHVLESAQEAAVAVVAPAPVEPSA
                     PPTSAESDRPDNTTSHASSGTGGAASHGWAVRPSALLRIQNELYGVCTAEVRRHVHAN
                     RELAACMKADVRRGMEMVSRRMAHFGRIVLPASYGGTSGSGVPPPPAELAFVQVKPTT
                     TLGPEEVASMQQSVRVAGASSSSATAAASAAAGPSSPSAPSTSSANTYLLLCVTDSRV
                     AAQLHMLCLRNAYIALPHACRLLNYFVSTGRAAAIVPSQVLQKRELLRSHLNFDAELW
                     GVLESRLTDELVEQVRSAGAAPNGGRLLTAFEQHEQNVKAVLRYCEQNVRYAGVFDDS
                     EEASPFLLAMGLCWRLGLTMDDVCRHFARHPRRVVRALALYLARYTLAPEDYVYFFTP
                     SLCDEVIIACTEDAQVTFSMKDLSRQLLTKKDVVDAWLPILSKRWQEDVVLPAMAFME
                     TCWKLQAQGGRGEADTAAASQDATTGASQLFKEADGIARGGPERVHGEGRGIAATFGF
                     RSITEIADHAAQHARVLVPQSIATILKRRRGLEEEVFGGGGGGRGGDNDDAVDVLGDD
                     YDNDDFLIHVDVRGGDETGDAEGSGTMEVQRNGGSNRLAFPFTKRARTDEGKDRSGVV
                     LDPHRRIMREGLKLTLSLLGRRTLFRKDDEHYIEF"
     gene            complement(<521635..>522402)
                     /locus_tag="LMJF_25_1310"
                     /db_xref="GeneID:5652542"
     mRNA            complement(<521635..>522402)
                     /locus_tag="LMJF_25_1310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683834.1"
                     /db_xref="GeneID:5652542"
     CDS             complement(521635..522402)
                     /locus_tag="LMJF_25_1310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683886.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652542"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9W2"
                     /translation="MGPRKSNAFASGKDDGAAAGKVRKVGGNGVGGSSATNSGSHKHG
                     GAAAATMADIYTNEERAFLESQLALFTSGGGGSGGTDFARMTKEQWFAGLPTLVSATE
                     KLLQAAADRYQQTCRERAAAAASVNGAQNAGSLPSADSSGVGKHGTTASSSHANSCTA
                     EGIAPSGVAGSSDHRSTPAGGTPAQFAEENAYIIAQAQQLQWYPFTYQRWVELLLEPG
                     KYHTACNDGGLRGDAIQTSLRRCILVTYPAVEGGDVI"
     gene            complement(<523535..>523789)
                     /locus_tag="LMJF_25_1315"
                     /db_xref="GeneID:12981313"
     mRNA            complement(<523535..>523789)
                     /locus_tag="LMJF_25_1315"
                     /product="DNA-directed RNA polymerase ii"
                     /transcript_id="XM_003721754.1"
                     /db_xref="GeneID:12981313"
     CDS             complement(523535..523789)
                     /locus_tag="LMJF_25_1315"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase ii"
                     /protein_id="XP_003721802.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1315"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1315"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981313"
                     /db_xref="GOA:E9ACT0"
                     /db_xref="InterPro:IPR000268"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR023580"
                     /db_xref="UniProtKB/TrEMBL:E9ACT0"
                     /translation="MIIPVRCYSCGKVVGNLYEQYQRLLDQDYTEAEALDALHLDRYC
                     CRRMILSHIDLIDDLIPYSVPVTGTMQMIGPLQMPTPHRR"
     gene            complement(<524965..>525918)
                     /locus_tag="LMJF_25_1320"
                     /db_xref="GeneID:5652543"
     mRNA            complement(<524965..>525918)
                     /locus_tag="LMJF_25_1320"
                     /product="putative serine/threonine protein phosphatase"
                     /transcript_id="XM_001683835.1"
                     /db_xref="GeneID:5652543"
     CDS             complement(524965..525918)
                     /locus_tag="LMJF_25_1320"
                     /EC_number="3.1.3.16"
                     /codon_start=1
                     /product="putative serine/threonine protein phosphatase"
                     /protein_id="XP_001683887.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652543"
                     /db_xref="GOA:Q4Q9W1"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9W1"
                     /translation="MTTAGGGSAVGSSSALDLDEMINYVIQCKPLSEQQVARLCEKVK
                     EVLEKENNVHAVRAPVTVCGDVHGQFHDLLELFKIGGLPPDTNYLFMGDYVDRGYYSV
                     ETVTLLLLYKLRYPQRLHLLRGNHESRQITQVYGFYDECIRKYGSANVWTIFTDLFDY
                     LPLTALVENDIFCLHGGLSPTVDTFSHIRNLDRVQEVPHEGPMCDLLWSDPDDRDGWG
                     ISPRGAGFTFGQGVTEGFCHNNKIKTIARAHQLVMDGYSWTHQDQLVTIFSAPNYCYR
                     CGNLAGLLELDEHMNKCFFQFDPAPRRGEAQVSKKTPDYFL"
     gene            complement(<528184..>530298)
                     /locus_tag="LMJF_25_1330"
                     /db_xref="GeneID:5652544"
     mRNA            complement(<528184..>530298)
                     /locus_tag="LMJF_25_1330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683836.1"
                     /db_xref="GeneID:5652544"
     CDS             complement(528184..530298)
                     /locus_tag="LMJF_25_1330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683888.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652544"
                     /db_xref="GOA:Q4Q9W0"
                     /db_xref="InterPro:IPR000305"
                     /db_xref="InterPro:IPR027520"
                     /translation="MDTRFHCVYLLTSLDPQCEGDFYIGYSVNPLRRLRQHNGELVNG
                     ARRTGRRGRPWTIVCCVSGFPDDRTALKFEWCWQHPTASARLRHTIDILTGLRRLPYA
                     VATLHLLVRASLFCQLDLTLHIFESAFLQEAAARAEVFLARRRGAFAVGGGLQAESPR
                     VGTQQHSQRSSSLQGQADGVVTPPLPALDSQGELQGASTAAALATTTAASHLLPPLTP
                     SLLLHVENTTREAFEDAYLSHDRCLLLPSAGMGVVVGEAGKEDSHMSASAGTSCPYDV
                     SLLSQAARAEWSNASFASDSDDEDTRRLAPYCPSAGSSTPSPQRVRTAASPALLGYRS
                     EERAGDGVWEASPGSSVGCGAALRSFSSPPPPRESSPRSASRPPVCTGINASASLAVD
                     APHGDVTAACPSSPAAAPAPQPRIPLRFADYGEVDFARAHAEEQHRLHHGLLPCSLCA
                     LPLQPSCLVYCSRAPFCTLRCHLSCLAMWMLYAEAEAAATIDGTDKSPALLSHAPPAP
                     ISPLRRLIPSQPCPCPLCGVLLHWGSLVKELKKRVVVERRLHAVQRRIRMEQRWQARL
                     AHIEPTKRSTGAAMRRRQRARVGAAAALAKGAGKVPGAASTVPAPTMHAGPARRDAPR
                     VSSPISFGEPTLTSFAAAASCPSPSASLAALSPTSASPISRHNGHSNTVTATHTAAAA
                     AAASDASLLSLTDFCEEDWLLP"
     gene            complement(<531465..>534533)
                     /locus_tag="LMJF_25_1340"
                     /db_xref="GeneID:5652545"
     mRNA            complement(<531465..>534533)
                     /locus_tag="LMJF_25_1340"
                     /product="putative protein transport protein Sec24C"
                     /transcript_id="XM_001683837.1"
                     /db_xref="GeneID:5652545"
     CDS             complement(531465..534533)
                     /locus_tag="LMJF_25_1340"
                     /codon_start=1
                     /product="putative protein transport protein Sec24C"
                     /protein_id="XP_001683889.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652545"
                     /db_xref="GOA:Q4Q9V9"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR006895"
                     /db_xref="InterPro:IPR006896"
                     /db_xref="InterPro:IPR006900"
                     /db_xref="InterPro:IPR012990"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9V9"
                     /translation="MYNLQGHSSNPYGDGYGSYGAYGSAAASGGAPAARSYYDPNQGH
                     GAQTNYYGGATQQAAAPPPQAAPAAPSSYSYGSYGYTAGAAPSAAAAPASAYPYGGSY
                     GSAAMGAQASSANAPSTSSSASPSSAPAPSVAGYNSYGYQAASAAPAPSRQPAPSAPA
                     SAYPPPRSTSSAAAAASDPYPAPSSSRREPVAQQLPPEPTQPYSDTLLGSGARGNNRP
                     LRALARQPPTRIVNVRSVPNPERSIPRNSGAPIEYLTCTNEPPYATVDFLGLDNGNAN
                     SKFFRPSMLCAPGEERLVKDSHIPFGAILSPLCQPLHNKEVVPLVKQPKPPVRCHRCR
                     GYKSCHARLLEMGRKWECPLCEVTNDVVGDDLDAVDGMGCRVNVADHPEMGFGSVEFD
                     VDDFPEYALRTEDNVVLPSRPLHHLFLIDISRDAGQRFLSDYTEAIRAALQRMAELTP
                     ECKVSFITFASQLHFYDFRHPDMPQMCVPDVENPFVPLPFTSLCWMEVGAELERLEAF
                     LSRLPHMAANVNESDCVLGAAVKAATLVLAGQHGGRVIMCASRHPQRGIGQIVLREQH
                     KLYGTDREKELLRPIEGFWTATATAAARQQISFDLFLFATGYCELVTLSNVCHVTNGR
                     VFLFSNYDPMVDNTKVSASMQQLLTEEAGYAGILRVRCSAGLHVQRYRGHYLSQTVQD
                     MDLASITGGSTFFVEFAHEDHLPKDNYAHFQTALLYTTRSGHRRVRVQSCRLRVASSL
                     TVLFRNMDMEAILFGFIQDIMVEAVNKGPQQARQGMTDRLIKAFSCYRQYCASDKSGG
                     EYEDVKTAARDKKNTLLMPPRLKLLPVYLLCLMKSNALTEGTIVHIDHRVASIFDLVA
                     MPAYKLLSYLYPSLYCLDDLESDPTIGTLDVTTGNCILPHHRQLLFDSIARDGTYVLC
                     DEQARLVYMWIGENVPPKIANTLFGTPDAASVCVAGGPGEECFSERLRNVLYALMLRE
                     DGMRRLIVIHHGERSEDAFFKELKEEMGTSKMGYDEYLTHLHRTIQTHVS"
     gene            complement(<535301..>543085)
                     /locus_tag="LMJF_25_1350"
                     /db_xref="GeneID:5652546"
     mRNA            complement(<535301..>543085)
                     /locus_tag="LMJF_25_1350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683838.1"
                     /db_xref="GeneID:5652546"
     CDS             complement(535301..543085)
                     /locus_tag="LMJF_25_1350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683890.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652546"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9V8"
                     /translation="MNIEEDLTIVSSWAQKAYQCFARELEELQELHQRHEQLEAQSQQ
                     ELEARCKEEVDAQLLKEHPDVFPHLASAVSLSRSANAKLLPIPPPSSPPSARPNTKRP
                     RSKHAHQQRQSEVALFNAKREALLQQNIQAAMAAQQRRPARQLAVQYADHLSSTQRQV
                     ELYLEREAHELRRFTSKPAGAYALREVLEVPTLAAAPAVPAPVAVAPRGGSVPHPAPY
                     STPKRRKASSALSEGTTTTTLRDASERSGAVLSSLGLTRQKARRDGRLGRPDSATAAR
                     ARIADKSGAAVSAKARRSRQEAEDASALAVPPPFLIDAHRFAVEYNEMLKKEYGYRPA
                     MTNTFAADVHRESCDAADVVAALNDQLRTHAPGMTSKRPAATASSSLLPPLLETEARG
                     AGAGTEPRLLPPHTSDAESSGSRESKHRPAHSSRKQKQPQTQPGTRKRVTTGGSSSNP
                     RQKGRALPALSSVRDGASALSTASPLDGVQCTIAGGCLSLSSCVGVPSRQVVQFVNNN
                     AYRTRLRLKPASHPWLTYRSVCIAPSAAAAATVAPESPLNCGGYVEVEVVFCPTSFEA
                     STATVDTVLEMGVTRELNDRTGEGAQWRFISVPLQARVVLPHFDWWRSPTAAVTRSTE
                     GTEMLVPGPAPVVRAEEETSNGANAMDARESAAAEAQPLITHDALASRAVRLDVSGSS
                     AAVVAFGEVLLLAEVKQTLYLENTGSTAVVHVLSSSPEFTVSVPAVVSTTLPPSHAMP
                     LHVSFCPLSEGPCEASLTVAVRASDAADSPVLAEHTLALFGVGVAPRVRITSLGPQLV
                     QECAVPQWQQCKSEVPLHILLRGTIPGVPTEVPVTVSNDCAVPLPYYWRGCEPPFTEE
                     SGSDAEKDQRGTDERDQACAPRLQLTTTTSTEDTAMDVGASRTSHITPSFGVLPPMST
                     TTFILTVMPRTLQPLQTLYNLFLDKMPDPTAPRNAARLPFVDAEVLELYRRNRPIPCG
                     LHGSAQDSGSPLADDAVRAAALPNGLQMTYLDPIAVFAQFQTAQDEHDGHASADAVFA
                     TGFLTYQQPVLPTLSIDPAVLEERVECLIQSRTRRTVSLHNSSPIEMHFVLDPTAAEF
                     AASLQEHEHLAQHTSTNFTYERWRASFAASDGISVQCQPRKGLIPPHSTVTITVHFTL
                     EAIGPHYAVVPCWVPEVELLCARLAAVSTACTGRLSKCMSLSLLGNPRGAASAGAASQ
                     RTLLTSLPQERTTLRVGKRPLTANSASGGAGKLSKPASTPGTGGGPLPVTVTAVEDVH
                     QQQHAEDWGYYALHVMATGVGPTVMTSAELLDFGLIELGQEAAASFTVSNPNSIPVVF
                     DLCDPLMRHPPRFVFIPESCRLGAGNTVEVTVYRKVVSTEDAQTFFELTVRDGGASVA
                     IETRATIQQPLLVIEDPVVQFGVVPEGVWQSGAFHVSNRSALDTVFTVIPATLAPSYM
                     ELDYKAEHVLRAGEQLTVPVRCRFEVCPLALVNRGDQRDTSASLVSSQGHTATEARTK
                     DCYSTLLGVVSKRSRQALFVEVRCDTVQPLAVSVDVAPEASPNDREVASSPVRMSTEA
                     YVRALLWNALEAALCARATAALDGSVMRDAQATTLVARPYCAGLSLVDYIPDDVPISR
                     RSLTVILENYTGCEANYDVRAKHFEPLPMEVPGAQGILDKRRKRAEKGASRSVSSSTQ
                     ASRAGASGSSRKATQMQLQKQQEQPLSPFSALASRKVAGSNSNGSKGGATLPAFWITS
                     VQSGVAVQQQQQQRQIVETAQKVLGDGRGCATLLGSLTGSLGPYSQVRLPVRLLCSLP
                     GRYAEQLCVRADATLPWLQIPVDYGVYGKPILLDTTTSGLVKEGGRDGKEVLLMPPVI
                     APLGTSRRSIRLINRVSRDMDVTVEVFPCPLGLAVHAVDPNAPADQVELKLCSMNAED
                     REKEWHRVGRVTAMPFQLRIPAHSRRDVLLEFTPAAKLTEGSDAGDYDEDRGGSSGHA
                     ASNSGKGHGSAGTKSPLTARAADDSEDEEDGEEAMLPPSEHWWEGSVCVRAVLAHSEL
                     NDIFLIDDFYARYADRYPSQRVARSISGATSAADPAAAAGSSAGPSLSVAQLTVMRPL
                     RTRPGGRVVRSGRVVWPLETAPQPSSRAAVTGDALVAKVAATTTAAAAAAQPADSGAD
                     SDSDNSEDDASSGRLTVSSQRRGSVLSLEVLQREAEERQALLAFMESRRCALQEESRR
                     YFTSIELRLRARCGRPHLTVEPSQRRVRFPAVQHMEGRAAAAAAPAASLCMKTIRLTN
                     RNSSSLRFSLSLPAAPTSGAANVFSIVRCALWRSGHDVSTELFASALATAVAGAEEHE
                     YTLHSMDALDVQVQAHTGSSAWRQACEAVCSALPRPSLSDKAPAVEGLLRVQFLPTSE
                     SAETACASPDDRVQAPCQLLSLCVPLTRPSLECSPGVVWFRPGQQRHDGRQQVAYMQK
                     FTLLNRSAVPVAYQICPVTDTDEETLRTFRLQQRQGTSYGEAAVFSPAVSQCLLVANT
                     TTTQFGVSATQRQCDSITRKVKAAVEMPAVAPPAEGRPDLVYVDEPARFSLSPLEGVV
                     PAASLGGESGRLEVSVTFAEFSDVRYESLFKVIVLGAGAQPPTYVVLRGDSRDAEV"
     gene            complement(<543890..>546787)
                     /locus_tag="LMJF_25_1360"
                     /db_xref="GeneID:5652547"
     mRNA            complement(<543890..>546787)
                     /locus_tag="LMJF_25_1360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683839.1"
                     /db_xref="GeneID:5652547"
     CDS             complement(543890..546787)
                     /locus_tag="LMJF_25_1360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683891.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652547"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9V7"
                     /translation="MKTTLGRWTTSSRARPRFRASWMSPGLTSHQQLDAGIAARQHAG
                     RKALKKSKRPFANYFKTEYRLSPLARLPITRTSGVISSFDAVRMMTDPTRSWGTPWDR
                     AGSRVRTRRKRQDVLEPTLTQFGDDSMDRVVERLLEIRFAWDREDGILCTSLVPESLF
                     STTKHCRPYLTEVAPSPQSSSTSLSPRESTVGGGRGRHSCDLNTSTEDGEIVMITGTP
                     VRVKRRTPLVRRKSGQPKRPHTRSTLGFSGVDTVPSLVLDVSHGPFLTSPSAPLMTLR
                     WKGEHRDAASAQSALQLLRRARAVPTVGLSPRLSLLLLKALATVEVEEPALAVSLAIA
                     MGENYNGYSDTECLELLRCLRRLALVRELPGVAAPDIDTSALSSASAAAGRSPPTLYT
                     EAALADALLSHYLDDAAPFLVAKVWSRLPEQSHRLLNRGYFLDWFDLMSLAIAASGPQ
                     RLPERLPNAVSEAPYAAKYLFFRYTLGLKEDVLRALADHLRGFTTSTDSTLQQPRNSP
                     ADYPHTLPTASSTSSSGHAAPLHFVDEVKEEVYKPLLLWLCAALLVRIVAESLGDVVR
                     HVGNSLHQHAALAAEQAEAQCTQHENSLVCQQHRLGDPDSGSDPASAPLGLHQPYPRF
                     SNGAYQQMGCRRPKRVRVRLLPFEAFPRVSQCFSCPFAAVTEKAEAQERRRRRRHGES
                     QGFFTSYDGGATARGNDAHTVTLSSTSDASSSAGERKPLKEVESTFASVLADSPFMAK
                     HIERACAALVWSTMVLRSCHALVRDLPLVHPHPLTVSMPSDNTDGAAAASSRGSAAPL
                     HHEDSGDEWAHESAAMEVRQALCYRFVRSSVQQHIDALFAFIPWAEMESAWEPVLTTD
                     VKPAEETSVRDAAGAAVADNATSLTAAALEAVLMEDSVGSAQASASTEPAATLSEAEQ
                     RARATMEGLRERLEEFQVAVAELLEAHETSFPDAVFPASSSSSRAGGGDDL"
     gene            complement(<548510..>549931)
                     /locus_tag="LMJF_25_1370"
                     /db_xref="GeneID:5652548"
     mRNA            complement(<548510..>549931)
                     /locus_tag="LMJF_25_1370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683840.1"
                     /db_xref="GeneID:5652548"
     CDS             complement(548510..549931)
                     /locus_tag="LMJF_25_1370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683892.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652548"
                     /db_xref="GOA:Q4Q9V6"
                     /db_xref="InterPro:IPR007304"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9V6"
                     /translation="MSNNTDAARDFVTVKGHFNSLCDTYIAEVVNASLASTDATLNAQ
                     IRSLVAGFELFWRHLSAVGAFSPNDEIDDYSTTSLEMLWTPYILADLFQRIQGPMKRA
                     QDSRAGNDGGSSNGTAQQQAGSADERMWGEDVLRRSEQDSGAQQMETVAHSAANLTSL
                     SLREEELRSLSRQEALARSHAWLKVFFEWMENIELVDKKTLDTHAVYRADQRSQRVEL
                     SRTIASLRAALKAEDDKVGYLRAKRRRMRELMAEEGEAAEETGGEEEETLRARALARL
                     KWSIYEGCHQLQISSRELSMLEALNPEQRAAISKQYQDTMDSVRRGELSLGRHTYTIL
                     PGGMMVAGTADHPQQVHTSDIVQSGGVTAPAATATAAASSSLAVCGSSNAQLYRQQIR
                     NELMIDRNAPTMTLQEFAELEMAEIQRQVDEAQARRQQQAEEDARLGQDGVEERQRQK
                     DSAWDDWKDEHPAYGLTNKGNYS"
     gene            complement(<551038..>551748)
                     /locus_tag="LMJF_25_1380"
                     /db_xref="GeneID:5652549"
     mRNA            complement(<551038..>551748)
                     /locus_tag="LMJF_25_1380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683841.1"
                     /db_xref="GeneID:5652549"
     CDS             complement(551038..551748)
                     /locus_tag="LMJF_25_1380"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683893.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652549"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9V5"
                     /translation="MRATRWWCYAGVLGGLCARTLPSLQHFTALNSLNESVAELRRKL
                     QSQLHQKMPRMQTVETESRLIAQLSRSALAEERAEALEMAEAMWAELNDAGSSIPFGS
                     RTAMKITLCSSLRRCALVSKNRELAEAWTARFAERAATLSPASFKEQSSAAGKVPGWR
                     EARTQARPGTGIDADDLEADAREEAEAAAKEGDAGERGRKKEPSPFEQYRQEKMLEHP
                     TVELAFRRRAGPGPRYTG"
     gene            complement(<552704..>553504)
                     /locus_tag="LMJF_25_1390"
                     /db_xref="GeneID:5652550"
     mRNA            complement(<552704..>553504)
                     /locus_tag="LMJF_25_1390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683842.1"
                     /db_xref="GeneID:5652550"
     CDS             complement(552704..553504)
                     /locus_tag="LMJF_25_1390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683894.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652550"
                     /db_xref="GOA:Q4Q9V4"
                     /db_xref="InterPro:IPR004130"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9V4"
                     /translation="MGKYAAVIIGPAGSGKSTLCGVLAEHYATMGRSTHIANMDPAAD
                     LLPYEPSMDIRDLISLEDAMEGKGLGPNGGLVFCMEYLVTAGATWVSQQLGDYADDFI
                     IVDMPGQVEVLSNQPAVPAFVRLLQQEGYYTTVLYLLDALATTADSGKFISGCMFSLS
                     SMVCFDCPFINVLTKCDLLSKDFKENGMLEHFCMCDFDYMDLSRLPPRFRAMSRQIGA
                     LLTDFNLVTFRPVDIEDVGYVSNLCSVLDETLQVADEAEVQDHDLGDN"
     gene            complement(<555006..>556193)
                     /locus_tag="LMJF_25_1400"
                     /db_xref="GeneID:5652551"
     mRNA            complement(<555006..>556193)
                     /locus_tag="LMJF_25_1400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683843.1"
                     /db_xref="GeneID:5652551"
     CDS             complement(555006..556193)
                     /locus_tag="LMJF_25_1400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683895.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652551"
                     /db_xref="GOA:Q4Q9V3"
                     /db_xref="InterPro:IPR000061"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9V3"
                     /translation="MENEEALPTIVTPGPELREKVDAFAARLSALDRRKADEMVAKLL
                     ASSKRNQFLFVDTSHIFYPYFLSKLTEFRQHPELRPQKPGEHKDRDGAAGRDKGAATM
                     TKAGTITRTMGGTAGAKSDPQREELLRQTEAEARRYLEDPFPNHYSLDRKAGTVDVTA
                     LLMDVLSTTAQYTAKYGDKFLAAVQSKQRHNPMFHFLHEDDVRHDMFRKLVESYRRIL
                     AFDEEETETRLENLKSQSYLLDTVCEMKKRYAKAALARRRAALLTDEELRGRLQWTLF
                     SVVTTFRLSDLQLDGPVPETAASKQRAAQAANVNFISPALTSTSKPRATGAEAPSSVP
                     PAAAASGGLTTARANTLPHPLGAASPSFAPVYMSSTLVKGTGSNGKRPRERGGQREAQ
                     GQS"
     gene            complement(<557495..>559273)
                     /locus_tag="LMJF_25_1410"
                     /db_xref="GeneID:5652552"
     mRNA            complement(<557495..>559273)
                     /locus_tag="LMJF_25_1410"
                     /product="putative DNA polymerase delta subunit 2"
                     /transcript_id="XM_001683844.1"
                     /db_xref="GeneID:5652552"
     CDS             complement(557495..559273)
                     /locus_tag="LMJF_25_1410"
                     /EC_number="2.7.7.7"
                     /codon_start=1
                     /product="putative DNA polymerase delta subunit 2"
                     /protein_id="XP_001683896.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652552"
                     /db_xref="GOA:Q4Q9V2"
                     /db_xref="InterPro:IPR007185"
                     /db_xref="InterPro:IPR024826"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9V2"
                     /translation="MSHSGSAAAAVETRSACPITRTHQRFLLRSLEFTQQYAPMYRCR
                     MGAQYTSALQAIQRLVRADPMYGPEAGAMKPRRVLELQPGVPAVCVGIVYKNMKLLPR
                     FLDEYQSELVRIDAGDDDNDEESGVVEAAPLDRSEEAAAAAMHRGNDAEEDVSNDGQT
                     LAAADEHYNVCNSADELMLEDSSGRVLLQGLDAERFCTGVVLGVYGTLLSNGSIKVLR
                     YAFSGDLSFMVVPRPLIRAASPCYIAFVSGLNINIPRGSSKEEQAAAARARASLELLV
                     EFLCGNTGNASLRAKAKCVSRLVIGGDSIAPTDELKLKKKVKLDPSDHVRLNDDKAQA
                     STVTSAALMRQLDTLLERVVRTVEVELMPGANDMSDAFQPQQPLHPLLLPKAGKHSTL
                     RLVSNPFCFTAQPPAAASAESEVRGEERVESEAKKHKVEVADGVNFFVTSGQNINDVA
                     RESRFPTRLDTMCMVVVSGCACPTAPNTLFSYPFCNHDPFLFQHTPHCVVACDQPQFE
                     TRYATLEELHEETHHSFTGPASLSARSKEKLSAASTKDEENKAARAEAGVRLICVPSF
                     ARSGALVLVDVNSPTLETSVVIFSVP"
     gene            complement(<561385..>562035)
                     /locus_tag="LMJF_25_1420"
                     /db_xref="GeneID:5652553"
     mRNA            complement(<561385..>562035)
                     /locus_tag="LMJF_25_1420"
                     /product="putative GTP-binding protein"
                     /transcript_id="XM_001683845.1"
                     /db_xref="GeneID:5652553"
     CDS             complement(561385..562035)
                     /locus_tag="LMJF_25_1420"
                     /codon_start=1
                     /product="putative GTP-binding protein"
                     /protein_id="XP_001683897.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652553"
                     /db_xref="GOA:Q4Q9V1"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR002041"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9V1"
                     /translation="MQQAPSDCVASFKLILVGDGGTGKTTFVKRHLTGEFEKRYVATV
                     GVDVHPLTFHTNRGKICFNCWDTAGQEKFGGLRDGYYVEGQCAIIMFDVTSRNTYKNV
                     PNWYRDITRVCDNIPIVLVGNKVDCADRQVKAKMITFHRKKGLQYYDISAKSNYNFEK
                     PFVWLAKKLANDPELMLVEVPMLDTDVVALTAEQVAALEAEQQAMANAPLPMGDDE"
     gene            complement(<563585..>565048)
                     /locus_tag="LMJF_25_1430"
                     /db_xref="GeneID:5652554"
     mRNA            complement(<563585..>565048)
                     /locus_tag="LMJF_25_1430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683846.1"
                     /db_xref="GeneID:5652554"
     CDS             complement(563585..565048)
                     /locus_tag="LMJF_25_1430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683898.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652554"
                     /db_xref="InterPro:IPR019366"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9V0"
                     /translation="MSFRELRSFSETMRLLGYPQLISMESFREPNVELVADCIHWLIT
                     RYEPSAEVTFNIEREHNRVTFFKQVCEVALAKGRIKLNVKKLYQADGHAVQEMLKLAN
                     VLKKAMKATDTEEPDFTALQQMAAQKNVSDAKAVQQLCSELTADGSSLFFLVEGELNS
                     RGDRQRILSRATEVGEFERRLRELLTNVTQEVDQYQQSIVNLSADESNLEQKIENKKA
                     HLERAQKQYKSAMATNPAFLKEYENHEKKLHTQFVNYLEQYRNLEFLEHQIAKYNAKE
                     DALLEEQETRLKVMRERLRKEELKNIRADSMARRPSGRRGGGGGSLTPAMSDDEDNGY
                     ENAPRVNGGVRIRNAAEEDSSGDESTSGDERSDTDNSRPRQQRGQRQQQRQRPQNAIG
                     YSRGPLVRDGAVNSDVDNRDEEDESLVNQMRRPRVATGARPPAAGGERSRLLANNPAE
                     SASSSEPDSSELSTSTSSGEFSSDDSSDYSGSDDSDI"
     gene            complement(<565850..>567379)
                     /locus_tag="LMJF_25_1440"
                     /db_xref="GeneID:5652555"
     mRNA            complement(<565850..>567379)
                     /locus_tag="LMJF_25_1440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683847.1"
                     /db_xref="GeneID:5652555"
     CDS             complement(565850..567379)
                     /locus_tag="LMJF_25_1440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683899.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652555"
                     /db_xref="GOA:Q4Q9U9"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9U9"
                     /translation="MLRRSYATLRRKASVVLKGQLNPLEALTQIQLGMTPSLPIQRGF
                     LLEHCERQLESLGITEGKLLAMDGRLCTQLTKRIVYELYLSVPFRVFTFDMEFTGPPV
                     FTADGPTEDITELGLYSPLLDETFSCLVRPVCGRKQGPGVEELTHITDMMLEREGIPF
                     VEAWQQFLKFVQTPQPDEISGSEERILLLSHGGKLADVSLIKWTLEKFHMELPPSFVF
                     GDTIHLIRDAHRRRPVTIDKHPPSWKLADLVQWLHIPPTLPAHRAGNDARMTWDALYH
                     TLLRYGDDGMTPREQLVPRFFDAEAKQLLREHTARQAQERAALSLDGTFLLADAKQST
                     SAGHADSSSIGYSVYRSASDGSGKPGKSGAATDLLDLDFDDIFSEQNKVSASAPIEEF
                     KLDDDDDLHSISAGATSFTASRTLSSTTTSRTADLSVDPAEDDNAVSDVNAASTSTVS
                     PARAAKTATSGGRKGKASGSSRSKEAVEKRNKRRVSAGDDDGGETSDPPAAATRAVFL
                     V"
     gene            complement(<573207..>573995)
                     /locus_tag="LMJF_25_1443"
                     /db_xref="GeneID:5652556"
     mRNA            complement(<573207..>573995)
                     /locus_tag="LMJF_25_1443"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683848.1"
                     /db_xref="GeneID:5652556"
     CDS             complement(573207..573995)
                     /locus_tag="LMJF_25_1443"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683900.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1443"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1443"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652556"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9U8"
                     /translation="MTAIPPFLSLVDMYGYLPNFDADCDLQVGDWVVVQPQRRAALLG
                     PLISAWETAPQDHALSAASSFVPQYTLSQLLPEPLTLRRRSLAWNRVGLDSFSTRLPR
                     LAPLSMARAHYCQRKRLHVSDDSPTNTRESSVCEDDASSGNGNLYLHVRLGLLTPSRP
                     YVFGGLDIVEVLGWPYDDACAEDTAAPVPPRSATQKPAVLYLNLLTGETLTREEAVRR
                     TSKLMPSFTSSTTTWSSAIEEAAEKEWQQWVLRGTCITQQQPCR"
     gene            complement(<578314..>579087)
                     /locus_tag="LMJF_25_1445"
                     /db_xref="GeneID:5652557"
     mRNA            complement(<578314..>579087)
                     /locus_tag="LMJF_25_1445"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683849.1"
                     /db_xref="GeneID:5652557"
     CDS             complement(578314..579087)
                     /locus_tag="LMJF_25_1445"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683901.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1445"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1445"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652557"
                     /db_xref="GOA:Q4Q9U7"
                     /db_xref="InterPro:IPR001104"
                     /db_xref="InterPro:IPR010721"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9U7"
                     /translation="MSAQDRARPQSGTAVEEEPNKQAPESLFQRCVRKWMGFSDYLST
                     SLLGGPRCIKLAHVINFQKCTTLFVCSAMMWRSGNFSATATTYTALHGSYGLCWYLKH
                     LVFPDPRWDQNITIGSAIAAFAAVLGPYWMIAYNSIMQGAERSNVALCAATVVYAVGL
                     AIMMGADGQKYFVLRERKGLITNGFFARTRNPNYLGEVMIYGSFAFVSGRTSSWVILL
                     TIWTGLFLPSMLAKDIRMSRHAGWKAYVQRTGLLFPRIK"
     gene            complement(<579676..>580995)
                     /locus_tag="LMJF_25_1450"
                     /db_xref="GeneID:5652558"
     mRNA            complement(<579676..>580995)
                     /locus_tag="LMJF_25_1450"
                     /product="peptide chain release factor-like protein"
                     /transcript_id="XM_001683850.1"
                     /db_xref="GeneID:5652558"
     CDS             complement(579676..580995)
                     /locus_tag="LMJF_25_1450"
                     /codon_start=1
                     /product="peptide chain release factor-like protein"
                     /protein_id="XP_001683902.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652558"
                     /db_xref="GOA:Q4Q9U6"
                     /db_xref="InterPro:IPR000352"
                     /db_xref="InterPro:IPR005139"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9U6"
                     /translation="MLWWTARLLFGAGGTQGGVKKLSAVKAEYCDWALKENTRALIGS
                     IHHPLVTEYLIRLHEKRIALEKWQEDSVSDTKVNALVNCVDSSPFDYVRWNTKYRDEL
                     DIAAKVCAVLRQLDENATLHDQLQSKSLRNREDEEILDMVKEDIATLMNQLRLLEGEV
                     NAVMERRIGSDDLVGSVTNVWNINVEGKAGGEEASLFAAELAEMYRMYATEFRNWKVR
                     PVVKDDGSEAANSNEFQVCGEGVYRNMRHEIGVHKVQRVPVTDAAGKMQTSTAVFTMM
                     PVLDPVSVDVHENDCKIDFVRGSGPGGQGMQSSSNCVVLTHKPSGISVKCHQSRSALG
                     NKELALQMVAQQILAQRVKEQNSSLHKAWQNQWSSGERSDKMRTYNHPQNRVTDHRLG
                     KDYALSSFMERGSGLKGLHDELNDINDREQVTNVLLKHIKGGFGSVV"
     gene            complement(<581581..>583902)
                     /locus_tag="LMJF_25_1460"
                     /db_xref="GeneID:5652559"
     mRNA            complement(<581581..>583902)
                     /locus_tag="LMJF_25_1460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683851.1"
                     /db_xref="GeneID:5652559"
     CDS             complement(581581..583902)
                     /locus_tag="LMJF_25_1460"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683903.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652559"
                     /db_xref="GOA:Q4Q9U5"
                     /db_xref="InterPro:IPR006602"
                     /db_xref="InterPro:IPR010554"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9U5"
                     /translation="MKNSAARTQLEKHFAYAPQSENLPLAIGADFHDDPINRSTLRKS
                     HNLLLERKTDHAPHTKYCYNGQPFEMSRTAAEAAAAEDKAAVWNGWFSEDFTKADLDD
                     FVVRMLGYFIEDVSESSAEKERVRKVRISFFVKDDSLSITEIGQRNSGLGESKILSRR
                     QVPKDMRNPTDLLLLSDFQIGDSVNIYGQMFYIVDMDKRSRRYFREVLEKDVPDAQSI
                     PQDSFSRAAAASAERSTKRVVSSDDMDRKRAIEQELTGIYTKHSTEDIAITKEFLKNK
                     INEHLTYLALWDDRGNLSGDLHYCVIRVFLENNTIEIAERRPENSGRWGGPILIHRQR
                     IPHPSADLTQSRYQQHTYGKLMKNDYLCPEDIQVGETYMIYGKPFYVYDSDSFTRNYV
                     RERYQVIIRDAVDITPFETPKKQTSVFYPPPPNGFGSERETRSNWLSLVGKPARVDDE
                     MAQRESGRVMKFSAKLTKPIGAGDESREFVVSFHCETKELEIFEKPKRNSGMLGGRFL
                     AKGVHRKDMPNGTTVPFTPDDFQVGRVIEIYRRPFLLTGLDAGTQRILDGTDKVVTED
                     RIKCLVVLLKQQLNLKFSRANEAFLALAPQGTLGYAQVKEFLRACSCSITDEEALLVV
                     QNLSPGTNGVINYDDFLRIVDVSSESMDEASLTTRSIRSVNMTKNDQLKLAATASEEK
                     QRRKQLRDVLQFKLIQRKGSVQEQFRLLSDHSANSRLNRNTFRISLNTVLYFNMNKKD
                     EDTLVSLLFDSVEDENGDITYKQFQEFVDSVDN"
     gene            complement(<585118..>586047)
                     /gene="CYCA"
                     /locus_tag="LMJF_25_1470"
                     /db_xref="GeneID:5652560"
     mRNA            complement(<585118..>586047)
                     /gene="CYCA"
                     /locus_tag="LMJF_25_1470"
                     /product="cyclin"
                     /transcript_id="XM_001683852.1"
                     /db_xref="GeneID:5652560"
     CDS             complement(585118..586047)
                     /gene="CYCA"
                     /locus_tag="LMJF_25_1470"
                     /codon_start=1
                     /product="cyclin"
                     /protein_id="XP_001683904.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652560"
                     /db_xref="GOA:Q4Q9U4"
                     /db_xref="InterPro:IPR004367"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR014400"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9U4"
                     /translation="MAVPLRMRIPFSNQTNLVREPYHKPAAQPPTPLTNESRFVSEYG
                     SEILTYFLEVERVVYSERMYIDRQSEVTDRMRKILIDWLVDVVTEFKLHPETFFLAVD
                     IIDRFLFFYSIPRTKLQLVGVTAILVAAKHEEIWPPTVNDCVAVTANTYTSREVIDME
                     FDVVTTLRFKFTVPTTYPITCRLLESCHMAPAVCHATFLFLESAAHCYPLLQFLPSRI
                     AAGAVLLGAFLIRYNRSKGAISLQGLWEIEVSPFAQGIGFDELQPVTEQLLPFTQRLC
                     SGSSRLQAVRRKYSSSEYDCVASLEFPFISTSA"
     gene            complement(<592410..>594527)
                     /locus_tag="LMJF_25_1480"
                     /db_xref="GeneID:5652561"
     mRNA            complement(<592410..>594527)
                     /locus_tag="LMJF_25_1480"
                     /product="calpain family cysteine protease-like protein"
                     /transcript_id="XM_001683853.1"
                     /db_xref="GeneID:5652561"
     CDS             complement(592410..594527)
                     /locus_tag="LMJF_25_1480"
                     /EC_number="3.4.22.-"
                     /EC_number="3.4.22.33"
                     /codon_start=1
                     /product="calpain family cysteine protease-like protein"
                     /protein_id="XP_001683905.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652561"
                     /db_xref="GOA:Q4Q9U3"
                     /db_xref="InterPro:IPR000169"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR015232"
                     /db_xref="InterPro:IPR022684"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9U3"
                     /translation="MGNGCCGCCDAKPDYKLGRPLVSGKTTPCFNDGRLFKIVKGDIW
                     YFYNDTQDYQMKVTADFGNGSNIVAMSDTELVRKNDSGACTATVSVFPLETKAMVQTK
                     EVNGFNVKYSGIAFTDADRQKLRQKAAAQVSADLAEMRKLRERNPKVNNQNRLLKVAR
                     GKGKMYVDTSFPPTSQSLIRSGIDSDPDACLKRPETIAWRRPEDFLPKKWHPKIRLFG
                     NISPKDISQGQLGDCYYLCALAALAEHDAAIKGIFKNHHGCCIRSQERKHGAWRVNLN
                     ISGWWRTIIIDSYLPTVQLLPVFARNRNHPNELWVSFAEKAYAKVFGSYQAIVAGYPW
                     QALEDLTGFPAYNFGNMWRTAQTDTETRKKLFDSLHRWNKKYLICIATPSNGALKMAG
                     KQLSANQWEALFEKAGLRIGHAYSVLDVRHFPLHRLCMLKIRNPWGSHVEWSGDWGDD
                     SPLWNRYPFIKLACRPEKKADGIFWMEWRDVSKFFDSGSVCFRRGHWFRSWYDYRVLG
                     SFEDLVCDTALLIIVNKTSQFPAYISLHQKDCRGLATSDPDSKYACVMISISEGDING
                     SQQKVVANSSENPEEPSTEYLFQESRSVSLYYKFTKGHKYLVIPRRMKSSTGNNVPKK
                     KYVIALRTQTKVSSEDVVVNIVRLDKNNAVFKNVASFDAGTPTSLNTLYQIKDGNNVF
                     RTYRSDNLRKGKKQHNAEFELVM"
     gene            complement(<595667..>599437)
                     /locus_tag="LMJF_25_1490"
                     /db_xref="GeneID:5652562"
     mRNA            complement(<595667..>599437)
                     /locus_tag="LMJF_25_1490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683854.1"
                     /db_xref="GeneID:5652562"
     CDS             complement(595667..599437)
                     /locus_tag="LMJF_25_1490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683906.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652562"
                     /db_xref="GOA:Q4Q9U2"
                     /db_xref="InterPro:IPR026147"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9U2"
                     /translation="METMHTRSESPPEAPSEEIPLLIEDFSCANSFEECVKVIEQYLA
                     ALFDGEPLLQSFLVAPVSAAAGTDAPADRKSGADIENGAVASSSSPASPTTTSSSPAS
                     LSVNGEAASLSTASKVYGRTISLYAADPISLDKDLSIAVEVHVRDATHPIMQQYCTPL
                     FFLIKKAVVSASYRESETSYLLSLLSTAVRQMLLQQQKNRVKGGVLRLCPASRRAAAP
                     GCAPPSHHQQAMAASLLPSPFFYPDGCAPCFVPAGDSYKQTFVGVAPPLPTCAALPPL
                     PAPPPSPSPTISAAEWLLLHQRSFTTRFLADAFGCVPEHCQSLSDYIDLFQLHVGQHS
                     RIRSDDFDGICVSLWKKYVLPTPWKFQPYGLSADSKPNSGGNHADDAHAADGDGIPLS
                     AASSSLTWESVLRRENEYARLLCGAFTHDFGTAAPPLKNVRFHFQWNQLQDIEAHEAV
                     GRISHLDPFQYALTTTAPGTAPPSALAFSSASAAQAVQRKCSITAQAVVRDDKDIQHG
                     VSEHLAKVLLGGYLESFTNATAARRTISAHDANEGGGGRGAVTDQVQQPGDDEGAGTA
                     REGPGDKDESGADERSGGRCSEAQLRDLAACIVEWAGAKVALQESLLQRFAAPLASDD
                     DDDARGGDDTNVYGDADPGSPRPPGAALAALSDKRSEAVVARHLRSLWGEWEAHQQCC
                     SGEASAPHRQQRKGGAGHEKDLRRSYFPDSFFARFAFVCATQVPHPTDVQALWRLCLD
                     ALHRLLLDAPHEQKKKSWQRLLDCLAMPPEDPPVDLGRPLLTQKLQLLRYAQEALLRS
                     LEENGSPTTATPAASARAEEDVAATSLTTSPVRHLITNGEVLCVPPPLPQPPTTADEV
                     VKRAVELNSLDAAAVESASVEWLQTDVLYNDMCFFLYVNKAHEGRIVRFPDFVQWHSP
                     RDFVASAGAGSTTSPSVEAPSRPLSDNDYLSERMRRQQKKGGASGGKGSAHVWWSLWR
                     RATPRSRDDIVQGLFRPLEQATKILAWLAAMPTAELLLEVSNASIANALHHMLCHRCV
                     LGDDGADRPSGRGRPSHTADWSSRMPLSTAEAAHHTIPATPRIRALHRYVRGKCAALT
                     KDVEAASALFLTSRGAFGEGAAAQQSAAESGAMVTEMLHGFFANALHQLGEIEVSVCT
                     AVALQYLLGFSNPEVAATVHALSSPAAMSQQHQATSLQMRTVTVSMATWSTAFAKQFA
                     QAETREVQESMVRLTCMAERPLDTCACFQQLVVHQDASRSLRLALALTKEVL"
     gene            complement(<600167..>602293)
                     /locus_tag="LMJF_25_1500"
                     /db_xref="GeneID:5652563"
     mRNA            complement(<600167..>602293)
                     /locus_tag="LMJF_25_1500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683855.1"
                     /db_xref="GeneID:5652563"
     CDS             complement(600167..602293)
                     /locus_tag="LMJF_25_1500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683907.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652563"
                     /db_xref="GOA:Q4Q9U1"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR002478"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR023267"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9U1"
                     /translation="MISLDAYVRYVYQYSSPTTTEHLRQTVWGPLGLCSGASASPKPI
                     SGAQPCWRDASVSHEVLYAVPPITTNVRCVGSRIDAHLTDLLEALPLSSPTVPPTTPA
                     AATLASRFARPSRLATIGLPFCLCVKPQTEHLTPWSLLCTSSSSPTDASNPEMNRKQP
                     SRPLVLVVDTGAAEAVLRGSDLYAPGIVTASRPFHAGERAVVAFYVERVAGTGDEAQN
                     GSAEAPCRLVCALPTGATLSAEQFEPLDMDVDYQDKHQQVDMLAGRSTFLVCIGSGVT
                     CMEWKTVMSRSVHGTALRMEWTPQGQPSRATLRALLGITKGTEDSNARSSTPLPQPPS
                     SGVEEGEERAADVFFLQNYSSMVPVALLVQHLSPAALRRAWTHSDDADQGRSPVPCTI
                     LDACAAPGGKTSLLLSLLQERAEQERTAMAEAAIPLPSATVATEPFRVVCCERSRPRQ
                     EQLMSLLHRHFASHLAAPSASPSLNSTPAVDVPYVTRVLESRCVDTNKFLKRKLTEAA
                     GSSDGSAASHTASFDAVLLDPPCTGMGLRPKLMPHVQSIASIQRSADYQRKLFDSCIR
                     HIRGSPTSPGVIVYSTCTTTLEENEANVLHFLCTYPSVRLARARTAAQRALCGLSTVR
                     SYGAQHDTDGSHGSTCLCSCLLRNEITEVQLAKERAAAAEGLSSTDPLLLLRFMPRPL
                     DIYDDISEDGVGFFVAVFLCSGYTDA"
     gene            complement(<602961..>604613)
                     /locus_tag="LMJF_25_1510"
                     /db_xref="GeneID:5652564"
     mRNA            complement(<602961..>604613)
                     /locus_tag="LMJF_25_1510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683856.1"
                     /db_xref="GeneID:5652564"
     CDS             complement(602961..604613)
                     /locus_tag="LMJF_25_1510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683908.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652564"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9U0"
                     /translation="MEIVSLSLKSFIEPLIDLIHGDLVLEDICCQRVAHAFVEHHEAA
                     LRRVVTSHTLPSGLEKAIESYCVRSYVLNAPKLLTESHEVAQMLQRLADTLIEAARAP
                     KGEQQNGRHDINNVCIEDAGARSPLAGVAEVKAGSAAYLLATSAEMIKEDVAALQARP
                     ETQRCARLIDSLGEVVLGHIMYAAQQCAQQAQEYLGGASWHCTRVAHASYHAALHQFV
                     KSAVEHREARKRERDAAQEAEVQALLFGSDHAIVEPAARNEGRYEVVEGDLVAVREPA
                     QHDAPPAPPESPDTDFATHVQAAMESMPSSPQPPPQPLLKHSIPQTTSTSGGRVLHSV
                     NDSIAEQCEALVHMTPPATLQVQQQQQQSTPVQSSAPHSSVLAAAEGRTSAPVEPALS
                     PEIVVDPFSLAAASSSLVTSSERDAPQENDDTARPPHRKLRKADTIFIGASETSVLRM
                     MEHTNADGSESCHLLSSPTSASASIPSSTLPIGAQRRHDSSGTTGGTVPSATSTNVAA
                     ADVTDAWEGVRRCLQRQDAEPRSYFLCGATHRFEPCVARGFF"
     gene            complement(<606816..>609650)
                     /locus_tag="LMJF_25_1520"
                     /db_xref="GeneID:5652565"
     mRNA            complement(<606816..>609650)
                     /locus_tag="LMJF_25_1520"
                     /product="putative protein kinase"
                     /transcript_id="XM_001683857.1"
                     /db_xref="GeneID:5652565"
     CDS             complement(606816..609650)
                     /locus_tag="LMJF_25_1520"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001683909.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652565"
                     /db_xref="GOA:Q4Q9T9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9T9"
                     /translation="MNPSSKRHAYEPLPQQQQQHPTNPPAAYQHRRVSTGTGRDSPAL
                     PQLSPNSMPAMTNIAEPSSSPALISTSAASSTLVPIFQGREGSVAASRGGGSGNSEAH
                     PCPAEESHSYPGASTTAAQSMALAVVPFTGTSSGGMSSDGVGVSAPQRCDPRVGGVVQ
                     EGKNTGVGGDDVGYYSGSSPYGKLAPLSLSTERVCPHCLRPYDVFDDREGVLDPATFF
                     RVDATTRSSSIQPSPSHPKLLPPPSQEGDEQQKQQPSKPPRLYTKSAGDGGSGTGQLL
                     CSRGSMTAGLDDSSSDGINRSGNYTPVHPPAAAFTSHYFRALPPPSFIIAAGARGASA
                     PLAIEDYRPSPLLDSPRGEKEEARQPFALAPASASDNGGGGGNSSGTLVCKVAPVPHY
                     SYVWPITCTGMRSQVRLLQQGDGSDKTAAEVEGRKEESPSCESGSPVCSPTAATPSPN
                     NGYYRHYFKELRQLGRGTYGGVYLCRHIMCGVNLGEFALKKIPVGDKVTYLQSVLREV
                     RILEEVRRHPNVVEYKHSWVEEAQLADFGPPVRCLFILMEYASAGSLDTYLERYGNNL
                     STLAVWYFFLSSVAGTAHLHEKHILHRDLKPQNLLLAATKDRPPRVLVSDFGTAALLD
                     DILYDRSGGTGTLEYMAPELLETTTSLRGTNERYVNHHTMASDVWSLGMVLHYLAFDG
                     ALPERHEDGSVNLDKARHSANARPPEMLRLLEAMLQLDPAKRPRCNDILGSPMVQSIM
                     RIFNKDDHSQWDLSIQRQQQLSATSPSAILPLERPPLPPVPAPAPRSTPLNVLEAHSI
                     DDSSSPRGARSRNAILAVSTSSQGHGARADRTNLEDKSNTLQSSRVELLSASTLVDLS
                     TAMALVGSSSSSNGSPFAVKLPPPRPPSTVISQHGRQQQQRAHAVVGLPQTLASFNTS
                     QLSDSPSPRRVNVGVQTNPVVIVEKQQRDT"
     gene            complement(<610467..>612239)
                     /locus_tag="LMJF_25_1530"
                     /db_xref="GeneID:5652566"
     mRNA            complement(<610467..>612239)
                     /locus_tag="LMJF_25_1530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683858.1"
                     /db_xref="GeneID:5652566"
     CDS             complement(610467..612239)
                     /locus_tag="LMJF_25_1530"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683910.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652566"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9T8"
                     /translation="MSHSDMNPLERDDVFHLFDATSPVASASVAVDGGSDAGAAPITE
                     IQYTALLYMMAAQLGISHAEAEHLFPSYKHAPLSVQASAASVDTKSSQLPPLCAHLLR
                     EGAAAYCWAKADAHTIPDVRCCDAREVHKQEVFPALDHGPHVHCLRCFQQSIERAPPP
                     GPGVSPPVVVDYRDAGSLRAHLEEHRTRYATCLRILEDSSSSDCGAAHDMLSENLAVC
                     EVAAEEASRHVCFMASLGTVACPLVVFCAECDSFAPLVHFHGVSGAGPNVADAWVSTE
                     GTDTVLSRLLLGCHVLYMFDETRFGRQRRSARRVGRNSATHATRSTQHLLYMFKPLLF
                     SMATEDRLIEEFESGAECTYAAVVLPNASVAGDPPQLLLREDTEGEGSDAAPAQPCFS
                     PVVIGFAKEWATAELLEKKVAMVFEHSSRASAVDSQEGGEPSSCSSDPSSPTPPAFRV
                     TTRMVYIVDTGEWAVAHVLYHRLLPANTELPLSYVDKADDGIRVQDVYEVDVPMPAWT
                     NDSISESEASAAVESSGEGGEEAEEGSDDAVAMAALAMDGCPYSMESCTIDFFTRMTV
                     LAKAMHELRTWRLTIDENKNLSLL"
     gene            complement(<613157..>615409)
                     /locus_tag="LMJF_25_1540"
                     /db_xref="GeneID:5652567"
     mRNA            complement(<613157..>615409)
                     /locus_tag="LMJF_25_1540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683859.1"
                     /db_xref="GeneID:5652567"
     CDS             complement(613157..615409)
                     /locus_tag="LMJF_25_1540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683911.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652567"
                     /db_xref="InterPro:IPR019195"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9T7"
                     /translation="MSSYYRGGSTRGRGHYRGGGEGGFRRGRGSYADAVSDGNMNRNE
                     EQQRGERYRSQSSGDDESERGSGGFGGNPQCHAGPPLPLVALESFLRDVDGSNYSQLK
                     QLTGRTYSLTRQMKPDPASVSIRFVRIQPDPFAPGSQVCVSVPAPFATHALLHSAHST
                     PPGVTAAALGNLLSPEDVACRRVAAEDFILRCVKGGFAAGRNTSGAVQTIHQSQHVIA
                     RSAVRLLDASEAHDSDGTSDGWIHVYFRVKLPGHGRRIDGRRIQQILFSEVLPVFQEN
                     VLRCDHHALWAHVTCVHDQEWLRAQLREWGFAAFIADGAILPRATGNSDKPLSGPSVV
                     AFSPPDTLRHTFQLPYSGRAISGAGLPHGLTLIAGGGFHGKSTLLRALELGVYNHVPD
                     DGRTFVVVDPTAVKIRAEDRRAVHGTDISPFITNLPYRDNTTAFVTADASGSTSQAAN
                     IMEALELGSTTLLLDEDTSATNFMYRDPLMEQLVPRTQEPITCFVHRVRDLMYHHGVS
                     VIMVVGGSGQYFPMADVVLLLNAYKVTDATAQAKAIAAQSVGRGGVGLVESAAPPATS
                     AFRLPPRRSFVYADTFGRLGSQSQQQQYHHHHGYGYGGSGRGIKISGSGIEHIRIADE
                     DINVTLLEQLVEEGQLNAIAQCLAMLYDSGSAAAAEWQREEAPRSRYPPSLSKALSVD
                     AAAAAGAPASSLSDFGRLVYNCEGRLRQARLELQTASCYLPVGFTALPRVFEIGAALN
                     RLRTLVTSCK"
     gene            complement(616915..617004)
                     /locus_tag="LMJF_25_snoRNA0001"
                     /db_xref="GeneID:12981314"
     ncRNA           complement(616915..617004)
                     /ncRNA_class="snoRNA"
                     /locus_tag="LMJF_25_snoRNA0001"
                     /transcript_id="XR_002460466.1"
                     /db_xref="GeneID:12981314"
     gene            complement(617090..617203)
                     /gene="LM25Cs1C4.1"
                     /locus_tag="LMJF_25_snoRNA0002"
                     /old_locus_tag="LMJF_25_snoRNA0124"
                     /db_xref="GeneID:12981321"
     ncRNA           complement(617090..617203)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C4.1"
                     /locus_tag="LMJF_25_snoRNA0002"
                     /old_locus_tag="LMJF_25_snoRNA0124"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460467.1"
                     /db_xref="GeneID:12981321"
     ncRNA           complement(617091..617201)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C4.1"
                     /locus_tag="LMJF_25_snoRNA0002"
                     /old_locus_tag="LMJF_25_snoRNA0124"
                     /transcript_id="XR_002460468.1"
                     /db_xref="GeneID:12981321"
     gene            complement(617265..617343)
                     /gene="LM25Cs1C3.1"
                     /locus_tag="LMJF_25_snoRNA0003"
                     /old_locus_tag="LMJF_25_snoRNA0166"
                     /db_xref="GeneID:12981322"
     ncRNA           complement(617265..617343)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C3.1"
                     /locus_tag="LMJF_25_snoRNA0003"
                     /old_locus_tag="LMJF_25_snoRNA0166"
                     /transcript_id="XR_002460469.1"
                     /db_xref="GeneID:12981322"
     ncRNA           complement(617265..617342)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C3.1"
                     /locus_tag="LMJF_25_snoRNA0003"
                     /old_locus_tag="LMJF_25_snoRNA0166"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460470.1"
                     /db_xref="GeneID:12981322"
     gene            complement(617412..617494)
                     /gene="LM25Cs1C2.1"
                     /locus_tag="LMJF_25_snoRNA0004"
                     /old_locus_tag="LMJF_25_snoRNA0150"
                     /db_xref="GeneID:12981786"
     ncRNA           complement(617412..617494)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C2.1"
                     /locus_tag="LMJF_25_snoRNA0004"
                     /old_locus_tag="LMJF_25_snoRNA0150"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460471.1"
                     /db_xref="GeneID:12981786"
     ncRNA           complement(617412..617492)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C2.1"
                     /locus_tag="LMJF_25_snoRNA0004"
                     /old_locus_tag="LMJF_25_snoRNA0150"
                     /transcript_id="XR_002460472.1"
                     /db_xref="GeneID:12981786"
     gene            complement(617589..617680)
                     /gene="LM25Cs1C1.1"
                     /locus_tag="LMJF_25_snoRNA0005"
                     /old_locus_tag="LMJF_25_snoRNA0139"
                     /db_xref="GeneID:12981324"
     ncRNA           complement(617589..617680)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C1.1"
                     /locus_tag="LMJF_25_snoRNA0005"
                     /old_locus_tag="LMJF_25_snoRNA0139"
                     /transcript_id="XR_002460473.1"
                     /db_xref="GeneID:12981324"
     ncRNA           complement(617590..617680)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C1.1"
                     /locus_tag="LMJF_25_snoRNA0005"
                     /old_locus_tag="LMJF_25_snoRNA0139"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460474.1"
                     /db_xref="GeneID:12981324"
     gene            complement(617766..617879)
                     /gene="LM25Cs1C4.2"
                     /locus_tag="LMJF_25_snoRNA0006"
                     /old_locus_tag="LMJF_25_snoRNA0125"
                     /db_xref="GeneID:12981759"
     ncRNA           complement(617766..617879)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C4.2"
                     /locus_tag="LMJF_25_snoRNA0006"
                     /old_locus_tag="LMJF_25_snoRNA0125"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460475.1"
                     /db_xref="GeneID:12981759"
     ncRNA           complement(617767..617877)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C4.2"
                     /locus_tag="LMJF_25_snoRNA0006"
                     /old_locus_tag="LMJF_25_snoRNA0125"
                     /transcript_id="XR_002460476.1"
                     /db_xref="GeneID:12981759"
     gene            complement(617941..618019)
                     /gene="LM25Cs1C3.2"
                     /locus_tag="LMJF_25_snoRNA0007"
                     /old_locus_tag="LMJF_25_snoRNA0167"
                     /db_xref="GeneID:12981326"
     ncRNA           complement(617941..618019)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C3.2"
                     /locus_tag="LMJF_25_snoRNA0007"
                     /old_locus_tag="LMJF_25_snoRNA0167"
                     /transcript_id="XR_002460477.1"
                     /db_xref="GeneID:12981326"
     ncRNA           complement(617941..618018)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C3.2"
                     /locus_tag="LMJF_25_snoRNA0007"
                     /old_locus_tag="LMJF_25_snoRNA0167"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460478.1"
                     /db_xref="GeneID:12981326"
     gene            complement(618088..618170)
                     /gene="LM25Cs1C2.2"
                     /locus_tag="LMJF_25_snoRNA0008"
                     /old_locus_tag="LMJF_25_snoRNA0151"
                     /db_xref="GeneID:12981793"
     ncRNA           complement(618088..618170)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C2.2"
                     /locus_tag="LMJF_25_snoRNA0008"
                     /old_locus_tag="LMJF_25_snoRNA0151"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460479.1"
                     /db_xref="GeneID:12981793"
     ncRNA           complement(618088..618168)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C2.2"
                     /locus_tag="LMJF_25_snoRNA0008"
                     /old_locus_tag="LMJF_25_snoRNA0151"
                     /transcript_id="XR_002460480.1"
                     /db_xref="GeneID:12981793"
     gene            complement(618265..618356)
                     /gene="LM25Cs1C1.2"
                     /locus_tag="LMJF_25_snoRNA0009"
                     /old_locus_tag="LMJF_25_snoRNA0140"
                     /db_xref="GeneID:12981328"
     ncRNA           complement(618265..618356)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C1.2"
                     /locus_tag="LMJF_25_snoRNA0009"
                     /old_locus_tag="LMJF_25_snoRNA0140"
                     /transcript_id="XR_002460481.1"
                     /db_xref="GeneID:12981328"
     ncRNA           complement(618266..618356)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C1.2"
                     /locus_tag="LMJF_25_snoRNA0009"
                     /old_locus_tag="LMJF_25_snoRNA0140"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460482.1"
                     /db_xref="GeneID:12981328"
     gene            complement(618442..618555)
                     /gene="LM25Cs1C4.3"
                     /locus_tag="LMJF_25_snoRNA0010"
                     /old_locus_tag="LMJF_25_snoRNA0126"
                     /db_xref="GeneID:12981762"
     ncRNA           complement(618442..618555)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C4.3"
                     /locus_tag="LMJF_25_snoRNA0010"
                     /old_locus_tag="LMJF_25_snoRNA0126"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460483.1"
                     /db_xref="GeneID:12981762"
     ncRNA           complement(618443..618553)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C4.3"
                     /locus_tag="LMJF_25_snoRNA0010"
                     /old_locus_tag="LMJF_25_snoRNA0126"
                     /transcript_id="XR_002460484.1"
                     /db_xref="GeneID:12981762"
     gene            complement(618617..618695)
                     /gene="LM25Cs1C3.3"
                     /locus_tag="LMJF_25_snoRNA0011"
                     /old_locus_tag="LMJF_25_snoRNA0168"
                     /db_xref="GeneID:12981330"
     ncRNA           complement(618617..618695)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C3.3"
                     /locus_tag="LMJF_25_snoRNA0011"
                     /old_locus_tag="LMJF_25_snoRNA0168"
                     /transcript_id="XR_002460485.1"
                     /db_xref="GeneID:12981330"
     ncRNA           complement(618617..618694)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C3.3"
                     /locus_tag="LMJF_25_snoRNA0011"
                     /old_locus_tag="LMJF_25_snoRNA0168"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460486.1"
                     /db_xref="GeneID:12981330"
     gene            complement(618764..618846)
                     /gene="LM25Cs1C2.3"
                     /locus_tag="LMJF_25_snoRNA0012"
                     /old_locus_tag="LMJF_25_snoRNA0152"
                     /db_xref="GeneID:12981794"
     ncRNA           complement(618764..618846)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C2.3"
                     /locus_tag="LMJF_25_snoRNA0012"
                     /old_locus_tag="LMJF_25_snoRNA0152"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460487.1"
                     /db_xref="GeneID:12981794"
     ncRNA           complement(618764..618844)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C2.3"
                     /locus_tag="LMJF_25_snoRNA0012"
                     /old_locus_tag="LMJF_25_snoRNA0152"
                     /transcript_id="XR_002460488.1"
                     /db_xref="GeneID:12981794"
     gene            complement(618941..619032)
                     /gene="LM25Cs1C1.3"
                     /locus_tag="LMJF_25_snoRNA0013"
                     /old_locus_tag="LMJF_25_snoRNA0141"
                     /db_xref="GeneID:12981332"
     ncRNA           complement(618941..619032)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C1.3"
                     /locus_tag="LMJF_25_snoRNA0013"
                     /old_locus_tag="LMJF_25_snoRNA0141"
                     /transcript_id="XR_002460489.1"
                     /db_xref="GeneID:12981332"
     ncRNA           complement(618942..619032)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C1.3"
                     /locus_tag="LMJF_25_snoRNA0013"
                     /old_locus_tag="LMJF_25_snoRNA0141"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460490.1"
                     /db_xref="GeneID:12981332"
     gene            complement(619118..619231)
                     /gene="LM25Cs1C4.4"
                     /locus_tag="LMJF_25_snoRNA0014"
                     /old_locus_tag="LMJF_25_snoRNA0127"
                     /db_xref="GeneID:12981763"
     ncRNA           complement(619118..619231)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C4.4"
                     /locus_tag="LMJF_25_snoRNA0014"
                     /old_locus_tag="LMJF_25_snoRNA0127"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460491.1"
                     /db_xref="GeneID:12981763"
     ncRNA           complement(619119..619229)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C4.4"
                     /locus_tag="LMJF_25_snoRNA0014"
                     /old_locus_tag="LMJF_25_snoRNA0127"
                     /transcript_id="XR_002460492.1"
                     /db_xref="GeneID:12981763"
     gene            complement(619293..619371)
                     /gene="LM25Cs1C3.4"
                     /locus_tag="LMJF_25_snoRNA0015"
                     /old_locus_tag="LMJF_25_snoRNA0169"
                     /db_xref="GeneID:12981334"
     ncRNA           complement(619293..619371)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C3.4"
                     /locus_tag="LMJF_25_snoRNA0015"
                     /old_locus_tag="LMJF_25_snoRNA0169"
                     /transcript_id="XR_002460493.1"
                     /db_xref="GeneID:12981334"
     ncRNA           complement(619293..619370)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C3.4"
                     /locus_tag="LMJF_25_snoRNA0015"
                     /old_locus_tag="LMJF_25_snoRNA0169"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460494.1"
                     /db_xref="GeneID:12981334"
     gene            complement(619440..619522)
                     /gene="LM25Cs1C2.4"
                     /locus_tag="LMJF_25_snoRNA0016"
                     /old_locus_tag="LMJF_25_snoRNA0153"
                     /db_xref="GeneID:12981795"
     ncRNA           complement(619440..619522)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C2.4"
                     /locus_tag="LMJF_25_snoRNA0016"
                     /old_locus_tag="LMJF_25_snoRNA0153"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460495.1"
                     /db_xref="GeneID:12981795"
     ncRNA           complement(619440..619520)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C2.4"
                     /locus_tag="LMJF_25_snoRNA0016"
                     /old_locus_tag="LMJF_25_snoRNA0153"
                     /transcript_id="XR_002460496.1"
                     /db_xref="GeneID:12981795"
     gene            complement(619617..619706)
                     /locus_tag="LMJF_25_snoRNA0017"
                     /db_xref="GeneID:12981336"
     ncRNA           complement(619617..619706)
                     /ncRNA_class="snoRNA"
                     /locus_tag="LMJF_25_snoRNA0017"
                     /transcript_id="XR_002460497.1"
                     /db_xref="GeneID:12981336"
     gene            complement(619792..619905)
                     /gene="LM25Cs1C4.5"
                     /locus_tag="LMJF_25_snoRNA0018"
                     /old_locus_tag="LMJF_25_snoRNA0128"
                     /db_xref="GeneID:12981337"
     ncRNA           complement(619792..619905)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C4.5"
                     /locus_tag="LMJF_25_snoRNA0018"
                     /old_locus_tag="LMJF_25_snoRNA0128"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460498.1"
                     /db_xref="GeneID:12981337"
     ncRNA           complement(619793..619903)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C4.5"
                     /locus_tag="LMJF_25_snoRNA0018"
                     /old_locus_tag="LMJF_25_snoRNA0128"
                     /transcript_id="XR_002460499.1"
                     /db_xref="GeneID:12981337"
     gene            complement(619967..620032)
                     /locus_tag="LMJF_25_snoRNA0019"
                     /db_xref="GeneID:12981338"
     ncRNA           complement(619967..620032)
                     /ncRNA_class="snoRNA"
                     /locus_tag="LMJF_25_snoRNA0019"
                     /transcript_id="XR_002460500.1"
                     /db_xref="GeneID:12981338"
     gene            complement(620144..620226)
                     /gene="LM25Cs1C2.5"
                     /locus_tag="LMJF_25_snoRNA0020"
                     /old_locus_tag="LMJF_25_snoRNA0154"
                     /db_xref="GeneID:12981339"
     ncRNA           complement(620144..620226)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C2.5"
                     /locus_tag="LMJF_25_snoRNA0020"
                     /old_locus_tag="LMJF_25_snoRNA0154"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460501.1"
                     /db_xref="GeneID:12981339"
     ncRNA           complement(620144..620224)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C2.5"
                     /locus_tag="LMJF_25_snoRNA0020"
                     /old_locus_tag="LMJF_25_snoRNA0154"
                     /transcript_id="XR_002460502.1"
                     /db_xref="GeneID:12981339"
     gene            complement(620321..620410)
                     /locus_tag="LMJF_25_snoRNA0021"
                     /db_xref="GeneID:12981340"
     ncRNA           complement(620321..620410)
                     /ncRNA_class="snoRNA"
                     /locus_tag="LMJF_25_snoRNA0021"
                     /transcript_id="XR_002460503.1"
                     /db_xref="GeneID:12981340"
     gene            complement(620497..620609)
                     /gene="LM25Cs1C4.15"
                     /locus_tag="LMJF_25_snoRNA0022"
                     /old_locus_tag="LMJF_25_snoRNA0138"
                     /db_xref="GeneID:12981341"
     ncRNA           complement(620497..620609)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C4.15"
                     /locus_tag="LMJF_25_snoRNA0022"
                     /old_locus_tag="LMJF_25_snoRNA0138"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460504.1"
                     /db_xref="GeneID:12981341"
     ncRNA           complement(620497..620607)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C4.15"
                     /locus_tag="LMJF_25_snoRNA0022"
                     /old_locus_tag="LMJF_25_snoRNA0138"
                     /transcript_id="XR_002460505.1"
                     /db_xref="GeneID:12981341"
     gene            complement(620671..620749)
                     /gene="LM25Cs1C3.5"
                     /locus_tag="LMJF_25_snoRNA0023"
                     /old_locus_tag="LMJF_25_snoRNA0170"
                     /db_xref="GeneID:12981342"
     ncRNA           complement(620671..620749)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C3.5"
                     /locus_tag="LMJF_25_snoRNA0023"
                     /old_locus_tag="LMJF_25_snoRNA0170"
                     /transcript_id="XR_002460506.1"
                     /db_xref="GeneID:12981342"
     ncRNA           complement(620671..620748)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C3.5"
                     /locus_tag="LMJF_25_snoRNA0023"
                     /old_locus_tag="LMJF_25_snoRNA0170"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460507.1"
                     /db_xref="GeneID:12981342"
     gene            complement(620818..620900)
                     /gene="LM25Cs1C2.6"
                     /locus_tag="LMJF_25_snoRNA0024"
                     /old_locus_tag="LMJF_25_snoRNA0155"
                     /db_xref="GeneID:12981796"
     ncRNA           complement(620818..620900)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C2.6"
                     /locus_tag="LMJF_25_snoRNA0024"
                     /old_locus_tag="LMJF_25_snoRNA0155"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460508.1"
                     /db_xref="GeneID:12981796"
     ncRNA           complement(620818..620898)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C2.6"
                     /locus_tag="LMJF_25_snoRNA0024"
                     /old_locus_tag="LMJF_25_snoRNA0155"
                     /transcript_id="XR_002460509.1"
                     /db_xref="GeneID:12981796"
     gene            complement(620995..621086)
                     /gene="LM25Cs1C1.4"
                     /locus_tag="LMJF_25_snoRNA0025"
                     /old_locus_tag="LMJF_25_snoRNA0142"
                     /db_xref="GeneID:12981344"
     ncRNA           complement(620995..621086)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C1.4"
                     /locus_tag="LMJF_25_snoRNA0025"
                     /old_locus_tag="LMJF_25_snoRNA0142"
                     /transcript_id="XR_002460510.1"
                     /db_xref="GeneID:12981344"
     ncRNA           complement(620996..621086)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C1.4"
                     /locus_tag="LMJF_25_snoRNA0025"
                     /old_locus_tag="LMJF_25_snoRNA0142"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460511.1"
                     /db_xref="GeneID:12981344"
     gene            complement(621172..621285)
                     /gene="LM25Cs1C4.6"
                     /locus_tag="LMJF_25_snoRNA0026"
                     /old_locus_tag="LMJF_25_snoRNA0129"
                     /db_xref="GeneID:12981764"
     ncRNA           complement(621172..621285)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C4.6"
                     /locus_tag="LMJF_25_snoRNA0026"
                     /old_locus_tag="LMJF_25_snoRNA0129"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460512.1"
                     /db_xref="GeneID:12981764"
     ncRNA           complement(621173..621283)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C4.6"
                     /locus_tag="LMJF_25_snoRNA0026"
                     /old_locus_tag="LMJF_25_snoRNA0129"
                     /transcript_id="XR_002460513.1"
                     /db_xref="GeneID:12981764"
     gene            complement(621347..621425)
                     /gene="LM25Cs1C3.6"
                     /locus_tag="LMJF_25_snoRNA0027"
                     /old_locus_tag="LMJF_25_snoRNA0171"
                     /db_xref="GeneID:12981346"
     ncRNA           complement(621347..621425)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C3.6"
                     /locus_tag="LMJF_25_snoRNA0027"
                     /old_locus_tag="LMJF_25_snoRNA0171"
                     /transcript_id="XR_002460514.1"
                     /db_xref="GeneID:12981346"
     ncRNA           complement(621347..621424)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C3.6"
                     /locus_tag="LMJF_25_snoRNA0027"
                     /old_locus_tag="LMJF_25_snoRNA0171"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460515.1"
                     /db_xref="GeneID:12981346"
     gene            complement(621494..621576)
                     /gene="LM25Cs1C2.7"
                     /locus_tag="LMJF_25_snoRNA0028"
                     /old_locus_tag="LMJF_25_snoRNA0156"
                     /db_xref="GeneID:12981797"
     ncRNA           complement(621494..621576)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C2.7"
                     /locus_tag="LMJF_25_snoRNA0028"
                     /old_locus_tag="LMJF_25_snoRNA0156"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460516.1"
                     /db_xref="GeneID:12981797"
     ncRNA           complement(621494..621574)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C2.7"
                     /locus_tag="LMJF_25_snoRNA0028"
                     /old_locus_tag="LMJF_25_snoRNA0156"
                     /transcript_id="XR_002460517.1"
                     /db_xref="GeneID:12981797"
     gene            complement(621671..621760)
                     /locus_tag="LMJF_25_snoRNA0029"
                     /db_xref="GeneID:12981348"
     ncRNA           complement(621671..621760)
                     /ncRNA_class="snoRNA"
                     /locus_tag="LMJF_25_snoRNA0029"
                     /transcript_id="XR_002460518.1"
                     /db_xref="GeneID:12981348"
     gene            complement(621846..621959)
                     /gene="LM25Cs1C4.7"
                     /locus_tag="LMJF_25_snoRNA0030"
                     /old_locus_tag="LMJF_25_snoRNA0130"
                     /db_xref="GeneID:12981349"
     ncRNA           complement(621846..621959)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C4.7"
                     /locus_tag="LMJF_25_snoRNA0030"
                     /old_locus_tag="LMJF_25_snoRNA0130"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460519.1"
                     /db_xref="GeneID:12981349"
     ncRNA           complement(621847..621957)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C4.7"
                     /locus_tag="LMJF_25_snoRNA0030"
                     /old_locus_tag="LMJF_25_snoRNA0130"
                     /transcript_id="XR_002460520.1"
                     /db_xref="GeneID:12981349"
     gene            complement(622021..622099)
                     /gene="LM25Cs1C3.7"
                     /locus_tag="LMJF_25_snoRNA0031"
                     /old_locus_tag="LMJF_25_snoRNA0172"
                     /db_xref="GeneID:12981350"
     ncRNA           complement(622021..622099)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C3.7"
                     /locus_tag="LMJF_25_snoRNA0031"
                     /old_locus_tag="LMJF_25_snoRNA0172"
                     /transcript_id="XR_002460521.1"
                     /db_xref="GeneID:12981350"
     ncRNA           complement(622021..622098)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C3.7"
                     /locus_tag="LMJF_25_snoRNA0031"
                     /old_locus_tag="LMJF_25_snoRNA0172"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460522.1"
                     /db_xref="GeneID:12981350"
     gene            complement(622168..622250)
                     /gene="LM25Cs1C2.8"
                     /locus_tag="LMJF_25_snoRNA0032"
                     /old_locus_tag="LMJF_25_snoRNA0157"
                     /db_xref="GeneID:12981798"
     ncRNA           complement(622168..622250)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C2.8"
                     /locus_tag="LMJF_25_snoRNA0032"
                     /old_locus_tag="LMJF_25_snoRNA0157"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460523.1"
                     /db_xref="GeneID:12981798"
     ncRNA           complement(622168..622248)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C2.8"
                     /locus_tag="LMJF_25_snoRNA0032"
                     /old_locus_tag="LMJF_25_snoRNA0157"
                     /transcript_id="XR_002460524.1"
                     /db_xref="GeneID:12981798"
     gene            complement(622345..622436)
                     /gene="LM25Cs1C1.5"
                     /locus_tag="LMJF_25_snoRNA0033"
                     /old_locus_tag="LMJF_25_snoRNA0143"
                     /db_xref="GeneID:12981352"
     ncRNA           complement(622345..622436)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C1.5"
                     /locus_tag="LMJF_25_snoRNA0033"
                     /old_locus_tag="LMJF_25_snoRNA0143"
                     /transcript_id="XR_002460525.1"
                     /db_xref="GeneID:12981352"
     ncRNA           complement(622346..622436)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C1.5"
                     /locus_tag="LMJF_25_snoRNA0033"
                     /old_locus_tag="LMJF_25_snoRNA0143"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460526.1"
                     /db_xref="GeneID:12981352"
     gene            complement(622523..622632)
                     /locus_tag="LMJF_25_snoRNA0034"
                     /db_xref="GeneID:12981765"
     ncRNA           complement(622523..622632)
                     /ncRNA_class="snoRNA"
                     /locus_tag="LMJF_25_snoRNA0034"
                     /transcript_id="XR_002460527.1"
                     /db_xref="GeneID:12981765"
     gene            complement(622697..622775)
                     /gene="LM25Cs1C3.8"
                     /locus_tag="LMJF_25_snoRNA0035"
                     /old_locus_tag="LMJF_25_snoRNA0173"
                     /db_xref="GeneID:12981354"
     ncRNA           complement(622697..622775)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C3.8"
                     /locus_tag="LMJF_25_snoRNA0035"
                     /old_locus_tag="LMJF_25_snoRNA0173"
                     /transcript_id="XR_002460528.1"
                     /db_xref="GeneID:12981354"
     ncRNA           complement(622697..622774)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C3.8"
                     /locus_tag="LMJF_25_snoRNA0035"
                     /old_locus_tag="LMJF_25_snoRNA0173"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460529.1"
                     /db_xref="GeneID:12981354"
     gene            complement(622844..622926)
                     /gene="LM25Cs1C2.9"
                     /locus_tag="LMJF_25_snoRNA0036"
                     /old_locus_tag="LMJF_25_snoRNA0158"
                     /db_xref="GeneID:12981799"
     ncRNA           complement(622844..622926)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C2.9"
                     /locus_tag="LMJF_25_snoRNA0036"
                     /old_locus_tag="LMJF_25_snoRNA0158"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460530.1"
                     /db_xref="GeneID:12981799"
     ncRNA           complement(622844..622924)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C2.9"
                     /locus_tag="LMJF_25_snoRNA0036"
                     /old_locus_tag="LMJF_25_snoRNA0158"
                     /transcript_id="XR_002460531.1"
                     /db_xref="GeneID:12981799"
     gene            complement(623021..623110)
                     /locus_tag="LMJF_25_snoRNA0037"
                     /db_xref="GeneID:12981356"
     ncRNA           complement(623021..623110)
                     /ncRNA_class="snoRNA"
                     /locus_tag="LMJF_25_snoRNA0037"
                     /transcript_id="XR_002460532.1"
                     /db_xref="GeneID:12981356"
     gene            complement(623196..623309)
                     /gene="LM25Cs1C4.8"
                     /locus_tag="LMJF_25_snoRNA0038"
                     /old_locus_tag="LMJF_25_snoRNA0131"
                     /db_xref="GeneID:12981730"
     ncRNA           complement(623196..623309)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C4.8"
                     /locus_tag="LMJF_25_snoRNA0038"
                     /old_locus_tag="LMJF_25_snoRNA0131"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460533.1"
                     /db_xref="GeneID:12981730"
     ncRNA           complement(623197..623307)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C4.8"
                     /locus_tag="LMJF_25_snoRNA0038"
                     /old_locus_tag="LMJF_25_snoRNA0131"
                     /transcript_id="XR_002460534.1"
                     /db_xref="GeneID:12981730"
     gene            complement(623371..623449)
                     /gene="LM25Cs1C3.9"
                     /locus_tag="LMJF_25_snoRNA0039"
                     /old_locus_tag="LMJF_25_snoRNA0174"
                     /db_xref="GeneID:12981731"
     ncRNA           complement(623371..623449)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C3.9"
                     /locus_tag="LMJF_25_snoRNA0039"
                     /old_locus_tag="LMJF_25_snoRNA0174"
                     /transcript_id="XR_002460535.1"
                     /db_xref="GeneID:12981731"
     ncRNA           complement(623371..623448)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C3.9"
                     /locus_tag="LMJF_25_snoRNA0039"
                     /old_locus_tag="LMJF_25_snoRNA0174"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460536.1"
                     /db_xref="GeneID:12981731"
     gene            complement(623518..623600)
                     /gene="LM25Cs1C2.10"
                     /locus_tag="LMJF_25_snoRNA0040"
                     /old_locus_tag="LMJF_25_snoRNA0159"
                     /db_xref="GeneID:12981800"
     ncRNA           complement(623518..623600)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C2.10"
                     /locus_tag="LMJF_25_snoRNA0040"
                     /old_locus_tag="LMJF_25_snoRNA0159"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460537.1"
                     /db_xref="GeneID:12981800"
     ncRNA           complement(623518..623598)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C2.10"
                     /locus_tag="LMJF_25_snoRNA0040"
                     /old_locus_tag="LMJF_25_snoRNA0159"
                     /transcript_id="XR_002460538.1"
                     /db_xref="GeneID:12981800"
     gene            complement(623695..623786)
                     /gene="LM25Cs1C1.6"
                     /locus_tag="LMJF_25_snoRNA0041"
                     /old_locus_tag="LMJF_25_snoRNA0144"
                     /db_xref="GeneID:12981733"
     ncRNA           complement(623695..623786)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C1.6"
                     /locus_tag="LMJF_25_snoRNA0041"
                     /old_locus_tag="LMJF_25_snoRNA0144"
                     /transcript_id="XR_002460539.1"
                     /db_xref="GeneID:12981733"
     ncRNA           complement(623696..623786)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C1.6"
                     /locus_tag="LMJF_25_snoRNA0041"
                     /old_locus_tag="LMJF_25_snoRNA0144"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460540.1"
                     /db_xref="GeneID:12981733"
     gene            complement(623872..623985)
                     /gene="LM25Cs1C4.9"
                     /locus_tag="LMJF_25_snoRNA0042"
                     /old_locus_tag="LMJF_25_snoRNA0132"
                     /db_xref="GeneID:12981766"
     ncRNA           complement(623872..623985)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C4.9"
                     /locus_tag="LMJF_25_snoRNA0042"
                     /old_locus_tag="LMJF_25_snoRNA0132"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460541.1"
                     /db_xref="GeneID:12981766"
     ncRNA           complement(623873..623983)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C4.9"
                     /locus_tag="LMJF_25_snoRNA0042"
                     /old_locus_tag="LMJF_25_snoRNA0132"
                     /transcript_id="XR_002460542.1"
                     /db_xref="GeneID:12981766"
     gene            complement(624047..624125)
                     /gene="LM25Cs1C3.10"
                     /locus_tag="LMJF_25_snoRNA0043"
                     /old_locus_tag="LMJF_25_snoRNA0175"
                     /db_xref="GeneID:12981735"
     ncRNA           complement(624047..624125)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C3.10"
                     /locus_tag="LMJF_25_snoRNA0043"
                     /old_locus_tag="LMJF_25_snoRNA0175"
                     /transcript_id="XR_002460543.1"
                     /db_xref="GeneID:12981735"
     ncRNA           complement(624047..624124)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C3.10"
                     /locus_tag="LMJF_25_snoRNA0043"
                     /old_locus_tag="LMJF_25_snoRNA0175"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460544.1"
                     /db_xref="GeneID:12981735"
     gene            complement(624194..624276)
                     /gene="LM25Cs1C2.11"
                     /locus_tag="LMJF_25_snoRNA0044"
                     /old_locus_tag="LMJF_25_snoRNA0160"
                     /db_xref="GeneID:12981787"
     ncRNA           complement(624194..624276)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C2.11"
                     /locus_tag="LMJF_25_snoRNA0044"
                     /old_locus_tag="LMJF_25_snoRNA0160"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460545.1"
                     /db_xref="GeneID:12981787"
     ncRNA           complement(624194..624274)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C2.11"
                     /locus_tag="LMJF_25_snoRNA0044"
                     /old_locus_tag="LMJF_25_snoRNA0160"
                     /transcript_id="XR_002460546.1"
                     /db_xref="GeneID:12981787"
     gene            complement(624371..624462)
                     /gene="LM25Cs1C1.7"
                     /locus_tag="LMJF_25_snoRNA0045"
                     /old_locus_tag="LMJF_25_snoRNA0145"
                     /db_xref="GeneID:12981737"
     ncRNA           complement(624371..624462)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C1.7"
                     /locus_tag="LMJF_25_snoRNA0045"
                     /old_locus_tag="LMJF_25_snoRNA0145"
                     /transcript_id="XR_002460547.1"
                     /db_xref="GeneID:12981737"
     ncRNA           complement(624372..624462)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C1.7"
                     /locus_tag="LMJF_25_snoRNA0045"
                     /old_locus_tag="LMJF_25_snoRNA0145"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460548.1"
                     /db_xref="GeneID:12981737"
     gene            complement(624549..624658)
                     /locus_tag="LMJF_25_snoRNA0046"
                     /db_xref="GeneID:12981767"
     ncRNA           complement(624549..624658)
                     /ncRNA_class="snoRNA"
                     /locus_tag="LMJF_25_snoRNA0046"
                     /transcript_id="XR_002460549.1"
                     /db_xref="GeneID:12981767"
     gene            complement(624722..624800)
                     /gene="LM25Cs1C3.11"
                     /locus_tag="LMJF_25_snoRNA0047"
                     /old_locus_tag="LMJF_25_snoRNA0176"
                     /db_xref="GeneID:12981739"
     ncRNA           complement(624722..624800)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C3.11"
                     /locus_tag="LMJF_25_snoRNA0047"
                     /old_locus_tag="LMJF_25_snoRNA0176"
                     /transcript_id="XR_002460550.1"
                     /db_xref="GeneID:12981739"
     ncRNA           complement(624722..624799)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C3.11"
                     /locus_tag="LMJF_25_snoRNA0047"
                     /old_locus_tag="LMJF_25_snoRNA0176"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460551.1"
                     /db_xref="GeneID:12981739"
     gene            complement(624869..624951)
                     /gene="LM25Cs1C2.12"
                     /locus_tag="LMJF_25_snoRNA0048"
                     /old_locus_tag="LMJF_25_snoRNA0161"
                     /db_xref="GeneID:12981788"
     ncRNA           complement(624869..624951)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C2.12"
                     /locus_tag="LMJF_25_snoRNA0048"
                     /old_locus_tag="LMJF_25_snoRNA0161"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460552.1"
                     /db_xref="GeneID:12981788"
     ncRNA           complement(624869..624949)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C2.12"
                     /locus_tag="LMJF_25_snoRNA0048"
                     /old_locus_tag="LMJF_25_snoRNA0161"
                     /transcript_id="XR_002460553.1"
                     /db_xref="GeneID:12981788"
     gene            complement(625046..625137)
                     /gene="LM25Cs1C1.8"
                     /locus_tag="LMJF_25_snoRNA0049"
                     /old_locus_tag="LMJF_25_snoRNA0146"
                     /db_xref="GeneID:12981741"
     ncRNA           complement(625046..625137)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C1.8"
                     /locus_tag="LMJF_25_snoRNA0049"
                     /old_locus_tag="LMJF_25_snoRNA0146"
                     /transcript_id="XR_002460554.1"
                     /db_xref="GeneID:12981741"
     ncRNA           complement(625047..625137)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C1.8"
                     /locus_tag="LMJF_25_snoRNA0049"
                     /old_locus_tag="LMJF_25_snoRNA0146"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460555.1"
                     /db_xref="GeneID:12981741"
     gene            complement(625223..625336)
                     /gene="LM25Cs1C4.10"
                     /locus_tag="LMJF_25_snoRNA0050"
                     /old_locus_tag="LMJF_25_snoRNA0133"
                     /db_xref="GeneID:12981768"
     ncRNA           complement(625223..625336)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C4.10"
                     /locus_tag="LMJF_25_snoRNA0050"
                     /old_locus_tag="LMJF_25_snoRNA0133"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460556.1"
                     /db_xref="GeneID:12981768"
     ncRNA           complement(625224..625334)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C4.10"
                     /locus_tag="LMJF_25_snoRNA0050"
                     /old_locus_tag="LMJF_25_snoRNA0133"
                     /transcript_id="XR_002460557.1"
                     /db_xref="GeneID:12981768"
     gene            complement(625398..625476)
                     /gene="LM25Cs1C3.12"
                     /locus_tag="LMJF_25_snoRNA0051"
                     /old_locus_tag="LMJF_25_snoRNA0177"
                     /db_xref="GeneID:12981743"
     ncRNA           complement(625398..625476)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C3.12"
                     /locus_tag="LMJF_25_snoRNA0051"
                     /old_locus_tag="LMJF_25_snoRNA0177"
                     /transcript_id="XR_002460558.1"
                     /db_xref="GeneID:12981743"
     ncRNA           complement(625398..625475)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C3.12"
                     /locus_tag="LMJF_25_snoRNA0051"
                     /old_locus_tag="LMJF_25_snoRNA0177"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460559.1"
                     /db_xref="GeneID:12981743"
     gene            complement(625545..625627)
                     /gene="LM25Cs1C2.13"
                     /locus_tag="LMJF_25_snoRNA0052"
                     /old_locus_tag="LMJF_25_snoRNA0162"
                     /db_xref="GeneID:12981789"
     ncRNA           complement(625545..625627)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C2.13"
                     /locus_tag="LMJF_25_snoRNA0052"
                     /old_locus_tag="LMJF_25_snoRNA0162"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460560.1"
                     /db_xref="GeneID:12981789"
     ncRNA           complement(625545..625625)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C2.13"
                     /locus_tag="LMJF_25_snoRNA0052"
                     /old_locus_tag="LMJF_25_snoRNA0162"
                     /transcript_id="XR_002460561.1"
                     /db_xref="GeneID:12981789"
     gene            complement(625721..625810)
                     /locus_tag="LMJF_25_snoRNA0053"
                     /db_xref="GeneID:12981745"
     ncRNA           complement(625721..625810)
                     /ncRNA_class="snoRNA"
                     /locus_tag="LMJF_25_snoRNA0053"
                     /transcript_id="XR_002460562.1"
                     /db_xref="GeneID:12981745"
     gene            complement(625896..626009)
                     /gene="LM25Cs1C4.11"
                     /locus_tag="LMJF_25_snoRNA0054"
                     /old_locus_tag="LMJF_25_snoRNA0134"
                     /db_xref="GeneID:12981746"
     ncRNA           complement(625896..626009)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C4.11"
                     /locus_tag="LMJF_25_snoRNA0054"
                     /old_locus_tag="LMJF_25_snoRNA0134"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460563.1"
                     /db_xref="GeneID:12981746"
     ncRNA           complement(625897..626007)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C4.11"
                     /locus_tag="LMJF_25_snoRNA0054"
                     /old_locus_tag="LMJF_25_snoRNA0134"
                     /transcript_id="XR_002460564.1"
                     /db_xref="GeneID:12981746"
     gene            complement(626071..626149)
                     /gene="LM25Cs1C3.13"
                     /locus_tag="LMJF_25_snoRNA0055"
                     /old_locus_tag="LMJF_25_snoRNA0178"
                     /db_xref="GeneID:12981747"
     ncRNA           complement(626071..626149)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C3.13"
                     /locus_tag="LMJF_25_snoRNA0055"
                     /old_locus_tag="LMJF_25_snoRNA0178"
                     /transcript_id="XR_002460565.1"
                     /db_xref="GeneID:12981747"
     ncRNA           complement(626071..626148)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C3.13"
                     /locus_tag="LMJF_25_snoRNA0055"
                     /old_locus_tag="LMJF_25_snoRNA0178"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460566.1"
                     /db_xref="GeneID:12981747"
     gene            complement(626218..626300)
                     /gene="LM25Cs1C2.14"
                     /locus_tag="LMJF_25_snoRNA0056"
                     /old_locus_tag="LMJF_25_snoRNA0163"
                     /db_xref="GeneID:12981790"
     ncRNA           complement(626218..626300)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C2.14"
                     /locus_tag="LMJF_25_snoRNA0056"
                     /old_locus_tag="LMJF_25_snoRNA0163"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460567.1"
                     /db_xref="GeneID:12981790"
     ncRNA           complement(626218..626298)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C2.14"
                     /locus_tag="LMJF_25_snoRNA0056"
                     /old_locus_tag="LMJF_25_snoRNA0163"
                     /transcript_id="XR_002460568.1"
                     /db_xref="GeneID:12981790"
     gene            complement(626395..626486)
                     /gene="LM25Cs1C1.9"
                     /locus_tag="LMJF_25_snoRNA0057"
                     /old_locus_tag="LMJF_25_snoRNA0147"
                     /db_xref="GeneID:12981749"
     ncRNA           complement(626395..626486)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C1.9"
                     /locus_tag="LMJF_25_snoRNA0057"
                     /old_locus_tag="LMJF_25_snoRNA0147"
                     /transcript_id="XR_002460569.1"
                     /db_xref="GeneID:12981749"
     ncRNA           complement(626396..626486)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C1.9"
                     /locus_tag="LMJF_25_snoRNA0057"
                     /old_locus_tag="LMJF_25_snoRNA0147"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460570.1"
                     /db_xref="GeneID:12981749"
     gene            complement(626572..626685)
                     /gene="LM25Cs1C4.12"
                     /locus_tag="LMJF_25_snoRNA0058"
                     /old_locus_tag="LMJF_25_snoRNA0135"
                     /db_xref="GeneID:12981769"
     ncRNA           complement(626572..626685)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C4.12"
                     /locus_tag="LMJF_25_snoRNA0058"
                     /old_locus_tag="LMJF_25_snoRNA0135"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460571.1"
                     /db_xref="GeneID:12981769"
     ncRNA           complement(626573..626683)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C4.12"
                     /locus_tag="LMJF_25_snoRNA0058"
                     /old_locus_tag="LMJF_25_snoRNA0135"
                     /transcript_id="XR_002460572.1"
                     /db_xref="GeneID:12981769"
     gene            complement(626747..626825)
                     /gene="LM25Cs1C3.14"
                     /locus_tag="LMJF_25_snoRNA0059"
                     /old_locus_tag="LMJF_25_snoRNA0179"
                     /db_xref="GeneID:12981751"
     ncRNA           complement(626747..626825)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C3.14"
                     /locus_tag="LMJF_25_snoRNA0059"
                     /old_locus_tag="LMJF_25_snoRNA0179"
                     /transcript_id="XR_002460573.1"
                     /db_xref="GeneID:12981751"
     ncRNA           complement(626747..626824)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C3.14"
                     /locus_tag="LMJF_25_snoRNA0059"
                     /old_locus_tag="LMJF_25_snoRNA0179"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460574.1"
                     /db_xref="GeneID:12981751"
     gene            complement(626894..626976)
                     /gene="LM25Cs1C2.15"
                     /locus_tag="LMJF_25_snoRNA0060"
                     /old_locus_tag="LMJF_25_snoRNA0164"
                     /db_xref="GeneID:12981791"
     ncRNA           complement(626894..626976)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C2.15"
                     /locus_tag="LMJF_25_snoRNA0060"
                     /old_locus_tag="LMJF_25_snoRNA0164"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460575.1"
                     /db_xref="GeneID:12981791"
     ncRNA           complement(626894..626974)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C2.15"
                     /locus_tag="LMJF_25_snoRNA0060"
                     /old_locus_tag="LMJF_25_snoRNA0164"
                     /transcript_id="XR_002460576.1"
                     /db_xref="GeneID:12981791"
     gene            complement(627071..627162)
                     /gene="LM25Cs1C1.10"
                     /locus_tag="LMJF_25_snoRNA0061"
                     /old_locus_tag="LMJF_25_snoRNA0148"
                     /db_xref="GeneID:12981753"
     ncRNA           complement(627071..627162)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C1.10"
                     /locus_tag="LMJF_25_snoRNA0061"
                     /old_locus_tag="LMJF_25_snoRNA0148"
                     /transcript_id="XR_002460577.1"
                     /db_xref="GeneID:12981753"
     ncRNA           complement(627072..627162)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C1.10"
                     /locus_tag="LMJF_25_snoRNA0061"
                     /old_locus_tag="LMJF_25_snoRNA0148"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460578.1"
                     /db_xref="GeneID:12981753"
     gene            complement(627248..627361)
                     /gene="LM25Cs1C4.13"
                     /locus_tag="LMJF_25_snoRNA0062"
                     /old_locus_tag="LMJF_25_snoRNA0136"
                     /db_xref="GeneID:12981760"
     ncRNA           complement(627248..627361)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C4.13"
                     /locus_tag="LMJF_25_snoRNA0062"
                     /old_locus_tag="LMJF_25_snoRNA0136"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460579.1"
                     /db_xref="GeneID:12981760"
     ncRNA           complement(627249..627359)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C4.13"
                     /locus_tag="LMJF_25_snoRNA0062"
                     /old_locus_tag="LMJF_25_snoRNA0136"
                     /transcript_id="XR_002460580.1"
                     /db_xref="GeneID:12981760"
     gene            complement(627423..627501)
                     /gene="LM25Cs1C3.15"
                     /locus_tag="LMJF_25_snoRNA0063"
                     /old_locus_tag="LMJF_25_snoRNA0180"
                     /db_xref="GeneID:12981755"
     ncRNA           complement(627423..627501)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C3.15"
                     /locus_tag="LMJF_25_snoRNA0063"
                     /old_locus_tag="LMJF_25_snoRNA0180"
                     /transcript_id="XR_002460581.1"
                     /db_xref="GeneID:12981755"
     ncRNA           complement(627423..627500)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C3.15"
                     /locus_tag="LMJF_25_snoRNA0063"
                     /old_locus_tag="LMJF_25_snoRNA0180"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460582.1"
                     /db_xref="GeneID:12981755"
     gene            complement(627570..627652)
                     /gene="LM25Cs1C2.16"
                     /locus_tag="LMJF_25_snoRNA0064"
                     /old_locus_tag="LMJF_25_snoRNA0165"
                     /db_xref="GeneID:12981792"
     ncRNA           complement(627570..627652)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C2.16"
                     /locus_tag="LMJF_25_snoRNA0064"
                     /old_locus_tag="LMJF_25_snoRNA0165"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460583.1"
                     /db_xref="GeneID:12981792"
     ncRNA           complement(627570..627650)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C2.16"
                     /locus_tag="LMJF_25_snoRNA0064"
                     /old_locus_tag="LMJF_25_snoRNA0165"
                     /transcript_id="XR_002460584.1"
                     /db_xref="GeneID:12981792"
     gene            complement(627747..627838)
                     /gene="LM25Cs1C1.11"
                     /locus_tag="LMJF_25_snoRNA0065"
                     /old_locus_tag="LMJF_25_snoRNA0149"
                     /db_xref="GeneID:12981757"
     ncRNA           complement(627747..627838)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C1.11"
                     /locus_tag="LMJF_25_snoRNA0065"
                     /old_locus_tag="LMJF_25_snoRNA0149"
                     /transcript_id="XR_002460585.1"
                     /db_xref="GeneID:12981757"
     ncRNA           complement(627748..627838)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C1.11"
                     /locus_tag="LMJF_25_snoRNA0065"
                     /old_locus_tag="LMJF_25_snoRNA0149"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460586.1"
                     /db_xref="GeneID:12981757"
     gene            complement(627924..628037)
                     /gene="LM25Cs1C4.14"
                     /locus_tag="LMJF_25_snoRNA0066"
                     /old_locus_tag="LMJF_25_snoRNA0137"
                     /db_xref="GeneID:12981761"
     ncRNA           complement(627924..628037)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C4.14"
                     /locus_tag="LMJF_25_snoRNA0066"
                     /old_locus_tag="LMJF_25_snoRNA0137"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460587.1"
                     /db_xref="GeneID:12981761"
     ncRNA           complement(627925..628035)
                     /ncRNA_class="snoRNA"
                     /gene="LM25Cs1C4.14"
                     /locus_tag="LMJF_25_snoRNA0066"
                     /old_locus_tag="LMJF_25_snoRNA0137"
                     /transcript_id="XR_002460588.1"
                     /db_xref="GeneID:12981761"
     gene            complement(<628953..>629261)
                     /locus_tag="LMJF_25_1550"
                     /db_xref="GeneID:5652634"
     mRNA            complement(<628953..>629261)
                     /locus_tag="LMJF_25_1550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683860.1"
                     /db_xref="GeneID:5652634"
     CDS             complement(628953..629261)
                     /locus_tag="LMJF_25_1550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683912.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652634"
                     /db_xref="GOA:Q4Q9T6"
                     /db_xref="InterPro:IPR004217"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9T6"
                     /translation="MQPVQSNPSLMGLTQSEAVILSEKLYHISNEGFMYCTKKCITHY
                     GDDAIPYHPGEKACLDRCISKVRNGMYMAIDHKKEFEQKLRSGDLPYQWMKDAAAGKM
                     "
     gene            complement(<631014..>633443)
                     /locus_tag="LMJF_25_1560"
                     /db_xref="GeneID:5652635"
     mRNA            complement(<631014..>633443)
                     /locus_tag="LMJF_25_1560"
                     /product="putative protein kinase"
                     /transcript_id="XM_001683861.1"
                     /db_xref="GeneID:5652635"
     CDS             complement(631014..633443)
                     /locus_tag="LMJF_25_1560"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001683913.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652635"
                     /db_xref="GOA:Q4Q9T5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9T5"
                     /translation="MVQTLYVDPALSSAAVTNHSSYYATPVSQGGGNDDEGQAHRLCD
                     RADGPAPHTSAHSVALTQSSSCTCPSRASSHSNWPTPPPPLPHAAPSLSSSASSSYSD
                     EDVEDETNEKDPRNYAEDVTKKYPIFTEAYAEKFRRDATPFMRVVEAASAVSRISSPT
                     GGVSGPLQREKQFVLYDTYLYERTLGKGTFSKVVLGIAPPSSPALATQISGDVPARVA
                     LKVFRDKEEYIEACWDEFTILNSICVDPPSVAPEEVAAAAAAGHRQGTTTSSPYISVR
                     SVVMFTASTCGIKQQYFADQGRFLVPMGYVAHPVHPAIVFPVMGPTLLNVLNTIRQKS
                     KEVARASRHKRLRTEAQPGKNTCSDGAFSTMPRQFSAMAASVDMGASGEAQQPLPLPP
                     QEQLQQQQQQQRRHVYYRGLPLPLLKAVLYQVLTFLQFIHCRGVVHTDLKPENVLFES
                     SKVLSVDVGIYYTHYLRRNSDTVAKRMPSATETKKWSNDDCKLHSSSLEQRAHRHEQM
                     AFTLSSPPLSSNRSVTGAAAEGEGLKSSLMEAARAAGEGAASMSSTGLSTVPVDVTPS
                     QKGDLTLAHYVRVPMPVMNSVRVVDLGAAQFLSTFRDHSLIPGYAHVPVSYNPIQTSH
                     YRSPEVLLGFGWNTSADIFSLGCMIPELLTGECLFMPNHTMEHLAMMQHVIGTFHDKD
                     GIRSGTATNLRSVFACDMRTFRHYFTLQPNNRDFDLKWPVSKSMVHEQEKQQRFASAE
                     SGKTEDDGLEPLEETLPGDIDYVTRMPTLDDILAPLPDLLDLTRRMLCYHPFKRITAE
                     EAMQHPFFRKI"
     gene            complement(<635613..>642407)
                     /locus_tag="LMJF_25_1570"
                     /db_xref="GeneID:5652636"
     mRNA            complement(<635613..>642407)
                     /locus_tag="LMJF_25_1570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683862.1"
                     /db_xref="GeneID:5652636"
     CDS             complement(635613..642407)
                     /locus_tag="LMJF_25_1570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683914.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652636"
                     /db_xref="InterPro:IPR024420"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9T4"
                     /translation="MSLEDWVEQRYARPVVVVESSAAADAICARNGMDLIHLLRLHSV
                     YAGGPLYARIGDRSEPVVCNKFGVRLMRTECVRDVSLSQVARHTRHLLRNAAAFDLAY
                     GEQLDAALRAIVEKNRSRHDGSLPRPVRAAQPSTESPSPPAPFEVIGGPAAVSTLLER
                     ACPTWHRAFIRDLHSLVRCSPFDTIDYPIGALFAVATTEAGGVEGMLQVFRLQARRIQ
                     ELRASLPGMDTELHQYYLILHDNTSPLSPSLSTARQVLTSVQQLYGANYCALIKVNSV
                     VDPRTVKNLDPSMWIAASPMAMDVPSAQALHQAAAQAAAAAAAPASTVTASQSPSAST
                     ASPSSGAASPSGTAADRAPALSFRAVHRTCGTWPNSNTAIITGCYMSPEDVTDVHNVM
                     AHYLSQSLFKFVERRLRMLDVSVQDRRTTTLSKMAAWFKGKDEGRPRTADVVNTPNGF
                     DSSAFPRYVAHSLEMQMRHCGDLSLALHDLKGAISYYRMCIEELLETLALRSYNRALI
                     AACQEGIGVAQLLQGKLVPQSLTPWYTSVTSATQRVSSQTNRWEVAWNDYLAAGMPTH
                     AVRVAFLLYESSRVRTPPMLDRCHAILTHLQRSGILQRQNLLSGVVNDMLAGIAAFTN
                     PPFPAGLEVPPSIPRDYPVYMSLRRFAQRMQRAGALYRAGNSLEQALRCYLRVLELLR
                     TIDPQESWKTLAEHLYLTAGQLYMQLGQDVRGIAMTSVAVAQGTPLYRHPATAQQAFE
                     GFWAQQKRMLSSMGYALCPHMPMPRILRDSFRVDRNYYSTDTLTDDAARKMGEAAAET
                     EWHSMEKHLKKNYTETVLRAHPSCRFPAFHGGGKYGCGGTAHGRRSQGGHGGCHNTAN
                     NGYRYSTAADGRSGASSPAVSQHPGARQDDHVFPMAGAASGSAAQPQRHYTIAKAEPL
                     VLNFVMENIIGCSIEATNLTLLYLDYVSPEQLWKSSMTQTVRLEAGASRRVSLSFDPV
                     SEGEYAIIGLCWSLLGQEGYYYFATRENRPGCPESLYEYAIENPMPALDAPENIHVSV
                     TPSKACVTATFQPPIPEHLYDGEYFYTNLVVCNTSAQQDAAHVVLQRSPAASHLMYIE
                     EFGRLQNLKREAPLVLAEHLKAQETRTFAVTIRAQHRRSDAALQNTPNYFFLLLGYLS
                     GPLPEPEKLPPCLFASAAELDPANATPPTESSLTSTIALPTSPPHRQLHSPTTPVAGH
                     KAAGGPAVMVRLHRLLRRCEVQPVLAMHSTVLPPANASLQTAVVLTVKNISPAAARAP
                     VTATAVTAITTTSGEPASITPASTPDAVQAVPVSSSGSAALSCHTHARGHSYAPVRVA
                     RVLVVHSPRWGVEHKGTEELFADRAVHCLLSHGDSLALPLLVKRQSHAAEGADTTVRR
                     VSLSDDAAAASVEAQCPYRDTMCIALAKALPSSARAKAVEEHLGTSVSQSERNLFFLQ
                     TSCVGPGHVGARPFADEAGGGLAFYADKAGQQKEAAKTAKQRRCDEADEERRLCGGPI
                     EQYTPLAIAVAWVREEGGGAENQEKHSGVGGDLSQREGQVFLFVDPIEHVYQTVAQQQ
                     KRQAEQESVTSLQPALSAVRAGVSAEQTQQELCEAMLVRYASLKRWQGALVSHVQAPS
                     VVRVTQGRSSDKTVAAPVPVTLRCLSLAPVPLLVTAEALPPSVPHHSLSSLKHAREGG
                     ARGDWAASPATPPPSPPAAMTASGPDVPVLFVGKTVHTFLLMPSEEYEVQFTALALRP
                     GLVDCQRISLSAAPICYLHSTTEKDDDGADEIRGTEGAQPLMCTGMTLPSLIRAVLTH
                     KTPSAAPRTAPRVLLSDRQLSGRQQPNDDADMRSGAERCERRRALQGYLAAAAHSSVM
                     TLVERYGTRAAELVRQLAPLGPAGGATVSQVMPCTAPALTRVIMLDDHAATSTAVGEG
                     AGVAMRKATPAAAPVATVSAPSTAAAAATRSHDAARKFFRQLEIFETELQRARLGSVS
                     DPHGLQYVYRPTVKMAGGGTSRVGHCTADNSFATTPMSAAAPPPLTEEAVTIGNGGVA
                     APDSFGGSWVADLVSATSRKMDSLARPAVVTVFGAQGTLSSVRSPAQQPCDDAEELGS
                     PLHLPAVAFESHAVEAAFALDISETSSPLQGSHSGPHPLSGADEMGSVECIAELAVCE
                     DSDSLCVTDTKTQIDLVSPMRQLRSSGVNVAGATDVCDGTEVLMTAADAKDTETWTSP
                     AARHAPALPRHSQETGNSALAHDPLSPSSASSNAAASPTGFTADVAAGIPPPSPSSSP
                     LPPSGAAAVDVTTPPT"
     gene            complement(<644987..>646504)
                     /locus_tag="LMJF_25_1580"
                     /db_xref="GeneID:5652637"
     mRNA            complement(<644987..>646504)
                     /locus_tag="LMJF_25_1580"
                     /product="putative casein kinase I"
                     /transcript_id="XM_001683863.1"
                     /db_xref="GeneID:5652637"
     CDS             complement(644987..646504)
                     /locus_tag="LMJF_25_1580"
                     /codon_start=1
                     /product="putative casein kinase I"
                     /protein_id="XP_001683915.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652637"
                     /db_xref="GOA:Q4Q9T3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9T3"
                     /translation="MTTVSEKYQPTGKEVPFGGGRFLLSHRLGNGSFGDIFEGYDKKS
                     HRIVAVKLERKKARYPQLSYESKVYRVLHQPPVGQNEVNPKQLFAEGGSNNTSSNLPQ
                     SVSAIAQQQRKSLEASIVVGIPQIYYFDSEGDYNIMVMEMCGPSLEDVFNYCHRRFSL
                     KTVLMLADQLLQRIQYFHEKGFVHRDIKPENFVFGCRSKAHILYIIDYGLSKLYWEVK
                     KNSHIPFAEGRPLTGTARYCSTNVHRGFEQSRRDDLESIGFLLIYFLRGNLPWQGIQA
                     KDQQIKSIKIGETKMATPLEELCKGMPKEFLNYCQYCRSLSFTQKPDYDSLRRLFRDL
                     GKRLGLTLPARDLPSANFCATNRTGAKPSNPLAVPAMLSTDITSQTDSRLLSVMSEST
                     VNSRRSHPLQTPSTVAAQVLPTLEDIDPMRGPYDWCFDWFCKRQMEVKRGMEEQSRQQ
                     RLETQMSAIASRHSELRLEDVSDVMNGSMQRDKSSAFGSKRPTFRSPLQPDHLRM"
     gene            complement(<647816..>651316)
                     /locus_tag="LMJF_25_1590"
                     /db_xref="GeneID:5652638"
     mRNA            complement(<647816..>651316)
                     /locus_tag="LMJF_25_1590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683864.1"
                     /db_xref="GeneID:5652638"
     CDS             complement(647816..651316)
                     /locus_tag="LMJF_25_1590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683916.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652638"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9T2"
                     /translation="MKRNGDGGRASARDVLRTARFHVQQLGATLALSEAAADLVVFHR
                     GSASFLEAAHVKFKTVVCPDYLAACVAADQRVSIAPYVVSATAATCTTPARQSTGTSS
                     SAVPASHTSAASPGSARRAATAASDIPHSTGWGAKSSRSTRRGAAAVPSRATRSPPKC
                     GAKTSAPAEGPTNPPLLHRLLLLDDDEDGGKADHQQQQQRGLATLARVVTASKEGAAA
                     ITAASPSCTPSAPRAAPSTPTNSGATKPHHLIADIQNSETSAIRCAPGQLQSDGAGGQ
                     QRRRAARAKRGVHQESTVAFELDEDITQQPSTDTASTPRLTPSSRYEVGGCRNQGVST
                     MTLPSSSSGNERVAAAVERWDADTGEEEAIRHAVLRSTATAAVTRRRGRPHREAGATP
                     HAAYSASLPAGGAAGGGGGAMGKRSRDPFLNSDGSSRQLRPRAAPAPSPRELRGVSAA
                     VTEPLAASSRTASIAAAQPQTPSAASVAPTRTTAKRPRSSSSSSSVADSCAEGSIHHT
                     RATPSDTPQGSRQRRRKQEDAGHGAAHDEASKSLKREQQQQRQLCARRRRRISGRGRA
                     EVLSDLECAPAAELPLSMTFTDLAFLRRLASEDEKVGVTAAGLCVLVLLDGLADADAA
                     AATLSSFLRDVVEQLGATCVVLGGDDDDSGGCSCWFGRHKRAHAERVRRAAKKPTHLV
                     VSPHAVLTPDILFCKALGIPIVTPQWLYDAVALGAFPAVLPHVHAHPVYGDRQVADAA
                     VAVAAPVTAAGVPRRHELLGVEEDDGDAVEAKAVRAGEKAGTRCPPRCGGSSTLRQLR
                     KEVAEEYVPAGEQAMRPFYVPIFQDRMFYLHVPPADLANANAAGGGAGPPRSSRASRN
                     GRSGNYLGDATAALAQVKELLRVLGGTVTRNVGSTYLDLVIDLTGFYDNMVKLGLTAR
                     EQQSQQQQQQARALRESLSCAFQDALQRVSLQPVSMDAGAASTASPTAPPVVGIAWLI
                     HSILTRQWTATDPFALTGHPLTVQIATVHPRAQIDGTEAASATVPCEYATGSGAVAAP
                     AAEDALVAAGAPAAMGAPYTHTPSALPSHEEAAESLSGAVWSAVVAAAAAPRLKHTRG
                     PQAALKHASHQLGTQEIAAMLSDAQLQSVGVSDAATPSIPEPAHPPHQSVTTPFCMEE
                     EDSLAFARIQYSDGDFDGVV"
     gene            complement(<652756..>656271)
                     /locus_tag="LMJF_25_1600"
                     /db_xref="GeneID:5652639"
     mRNA            complement(<652756..>656271)
                     /locus_tag="LMJF_25_1600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683865.1"
                     /db_xref="GeneID:5652639"
     CDS             complement(652756..656271)
                     /locus_tag="LMJF_25_1600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683917.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652639"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9T1"
                     /translation="MRSPYIRFPSPSLAEEALRLEWVFGLNSDYKAGIHNLSIGGGGV
                     SGRGENQQQLAQQQRRVFYTVAHMGVLYDAIQNAQKHLLGHRYSIISSSCCSHNHRFI
                     VTADEGDVKVRRRIQQQVVLTQSATGHAGESQKDVEEEELWEEAAMCVDPSVAKRDDE
                     EDGSAMIVWDATTALPVKMIATGKYGGVLSVAMSPDGQYLATLNRRDPQEIMIWAWTQ
                     SNPASVGGMPGSIGGTHNAAHLLADADMAPVFVRRIAARDEQTFISFSQDNPELLCTN
                     GLRRVIFWSWVEGMLKYYSPPILQRRLKASVGNFTQTVYLPGTMMACSGTVDGDVVLW
                     SLQPQDRVIKEQDKSLLKMVRVHTGGVTFITTVQGYIVTGGMDGVVKLLDAKLRLVAW
                     FDDLNGGPIVSISFDQVLPVMTVEEARAMAPEQVDGHLLTEGTAAASLFTAPDFMVST
                     AHSMIIDVPAKAFHTPGTAAHAGPNTAARGRLIVQGQDRAIQSLAAHPHLPRLAIGGY
                     SGNLHLWDYCEKRVVLLSLFRNLLIRCLTFDPSGKWLVVGFTNGVIKVLDGETLEEEQ
                     TIRPIANTTAVGTVAGDGATAAAAQPSSPGNGKQRVAEQQQQQQATVSKAAASVEEIR
                     FSPDSLLMATAKDDGSVGLYEYVKASGSTKKAEWQLVGHHKTHNAPICGLHFGAHTSG
                     LEEGLRLLSVGADKRLIEYELVDSSPETGLLLRTAHKIAQESTPTGFAWLPDGCSLLD
                     AASQPRDFFDACGESSDDGTGDGSAAHERGDNDNAASTATATGDGGSGTDVLDMLLIA
                     TREYKFQVYLSNWSRQCVKTVLAPTFGGPVTRMAVVPVAKPPAAPASSSSPPPSHCLV
                     YATKEKVIGLTQLPLRGDPCGSIGILAHPGSITSMVTSHDGAIVFTAGGPDQAVMQWR
                     VRGECIMSPSEWAAVVHCREKGGVPLPHLVGAVEGGADGELMKEVVDYFYYAQIRAQG
                     EETTAKRVLLGAIPFSQMPNLLRSLCYYPSEKEIGHLTYEVANMYGPRDEPLAEVNVD
                     AILLDFSQFMRLYINYRPVFGITRQDIEAAFRALGADRVTGEINRDHLFHLLSTEGES
                     LKSSEVAAALTSLLGDGIRLEMLEDVITARTFAKNLLGFEDYDEDLGPDGKDQRGNGV
                     DSEDDYDSSSGMYTAGDEVDVNTLA"
     gene            complement(<657413..>658393)
                     /locus_tag="LMJF_25_1610"
                     /db_xref="GeneID:5652640"
     mRNA            complement(<657413..>658393)
                     /locus_tag="LMJF_25_1610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683866.1"
                     /db_xref="GeneID:5652640"
     CDS             complement(657413..658393)
                     /locus_tag="LMJF_25_1610"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683918.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652640"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9T0"
                     /translation="MSSEVAIQLTPYPAAFIIEHAKRKKYAAGYILGTVRAEEIVITD
                     FIPHTHKDTEVPNTKAHRAELTRRRAAKRRYTTQDLIGWYSAGQPGADLTEEDYQLWC
                     NAPSVIFQGRHCLHLHCEMPHEDGTTPKVTWTASVVFEDPADRTLKHIDHRVTLAPMN
                     NLASDVMLSHITSLVLYNGGRPFPRSKLQNLDEVAYVASIDHKSSTDAVDEEQRRLER
                     AVAAAQEIVTGGSGGGKEEHEMMTAVENFRAIRDEALKRQRDQTGRMDFNSQQFKDAL
                     MIKCAATILRREIDQIEHLSTVYGEDAARRGNATGGENNEKQQQPEKQQQ"
     gene            complement(<659649..>660086)
                     /locus_tag="LMJF_25_1620"
                     /db_xref="GeneID:5652641"
     mRNA            complement(<659649..>660086)
                     /locus_tag="LMJF_25_1620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683867.1"
                     /db_xref="GeneID:5652641"
     CDS             complement(659649..660086)
                     /locus_tag="LMJF_25_1620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683919.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652641"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9S9"
                     /translation="MVFFSTYRSKRIVAPGFLKGPVMASRAFCDYYFQRAWSGCVQWA
                     IPGEVRFWACGVPVIYFIHRYHNDHSLEPDFVEKAMIQRWGGSLEEVRKLSPQDQLRI
                     RVFTDIEKLYSAYGPKEIIIQPPGDLLPGKDYYHKSGAAGAHH"
     gene            complement(<661872..>663707)
                     /locus_tag="LMJF_25_1630"
                     /db_xref="GeneID:5652642"
     mRNA            complement(<661872..>663707)
                     /locus_tag="LMJF_25_1630"
                     /product="putative diacylglycerol acyltransferase"
                     /transcript_id="XM_001683868.1"
                     /db_xref="GeneID:5652642"
     CDS             complement(661872..663707)
                     /locus_tag="LMJF_25_1630"
                     /EC_number="2.3.1.20"
                     /codon_start=1
                     /product="putative diacylglycerol acyltransferase"
                     /protein_id="XP_001683920.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652642"
                     /db_xref="GOA:Q4Q9S8"
                     /db_xref="InterPro:IPR007130"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9S8"
                     /translation="MDGAQQQRLQQQQRQSQVRAPTPLRLKSPPAPSLPAQDAAVITA
                     TAKDMVDTRRRSLITQFTSTISSSFHFLANEASARSCGTQRTGGHSTNRRAGEEGIHA
                     DEPLLTHARPPASREEVEEGLDKVLYAIDHLQKLQQRGRYIASTEVANLRRAFLFAVG
                     EEQRYRDAVAAHGSVSGWSSALTMPSLPAQRTPFKETPSVTGPTDTAVASWCVPRPPL
                     ADDPTGKAAEDAVEISRPTEGKREYSPKAAAADRLLAALERYVHEDLSSTSFGAHGAH
                     FSWCSVIHTPGQRRLQSLLVSIFTFFTGIPICIAITGLLLLSRYTAPFMVMYLIWTLT
                     FGRPSHPLSKYQTFTRCFVWRYYCDYFPIRLVIPKPVRRRFDKERNYFFVYHPHGIHS
                     FGAIVNFGLDQNDASEMLHGITIHLQTLKVNLYVPLWRQLAIWAGCGDASASCIRKTL
                     RSGPGQSVMLVVGGAEESLMAKPNCNDLLLFKRKGFIKIALQEGTPLVPVYGFGENNV
                     YNVPELANEPWMRYLMVLWKQYVGFAIPLVRGRGFFNFNYGLLPHRRPIVVVVGEPLE
                     VPHIPNPTKEDLEVWQGKYIECLRKLYNEHRGIYDLESTGLRIMQ"
     gene            complement(<665045..>666475)
                     /locus_tag="LMJF_25_1640"
                     /db_xref="GeneID:5652643"
     mRNA            complement(<665045..>666475)
                     /locus_tag="LMJF_25_1640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683869.1"
                     /db_xref="GeneID:5652643"
     CDS             complement(665045..666475)
                     /locus_tag="LMJF_25_1640"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683921.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652643"
                     /db_xref="GOA:Q4Q9S7"
                     /db_xref="InterPro:IPR003256"
                     /db_xref="InterPro:IPR005825"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9S7"
                     /translation="MGCVRVRTGCRIRCVRASFTYTQAQMYARYRTRSRFYKRPEKML
                     KAYNVSPNLLRLPKVKPGLLKGIYTDEKIDLRDRERLELVESIRHPKERDFYQDHTYH
                     NQWIARDLESHQKIQIAGRYPYFSPDYEIKPWIWYPGDTVEVVSGEGAGQRGAIIAVV
                     KYKNEILVQNVNVQDVVIPASETRPEQVVQREHPISVLRVRHVDPSTNQLCHLEIVKV
                     RNKETGELEERRISLESGALLPIPAPEETVEAGDPLKDTAIQDADEETYDREKEMPLL
                     VVRRLQAMENYFVDSLQKSHEYHKALQMRNAQDMQTFQKDVLVRATEKLAAAAAVAGH
                     GAMAEAGSQAASVATESSQAGDAEEDAVKGTITVETVVAEVLKSEQRFRSDAAAPGVP
                     GWWQNMIDAYVSVLEEEEATIEAEAAAQAQAAEADRRAEQLMADATAEAGQSMEEDGT
                     MEGGDEDLDEQDGDLDEDASRSDRSK"
     gene            complement(<666815..>667198)
                     /locus_tag="LMJF_25_1645"
                     /db_xref="GeneID:5652644"
     mRNA            complement(<666815..>667198)
                     /locus_tag="LMJF_25_1645"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683870.1"
                     /db_xref="GeneID:5652644"
     CDS             complement(666815..667198)
                     /locus_tag="LMJF_25_1645"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683922.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1645"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1645"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652644"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9S6"
                     /translation="MRHDSLLLLSPPPPPPPPPLSLCVTREATSTTTTTTAVTLAMTQ
                     SLPPASEKAITRLPQYFPTLCKQCATQTDTFFRCFETHAIMADDHDVTTAKTSLQHCQ
                     TELREYMTCMEKYLAEKNKPWWKVW"
     gene            complement(<667901..>668602)
                     /locus_tag="LMJF_25_1650"
                     /db_xref="GeneID:5652645"
     mRNA            complement(<667901..>668602)
                     /locus_tag="LMJF_25_1650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683871.1"
                     /db_xref="GeneID:5652645"
     CDS             complement(667901..668602)
                     /locus_tag="LMJF_25_1650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683923.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652645"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR013185"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9S5"
                     /translation="MWRCWKRSLPITARVAGPSARLPVAASSSLLTQHRGVFADKVRA
                     GMVLRVDKKVYRVVANTRSQKGQNAASFNIKLTEVGTSRKKEVTAGQGHDFTEVRAER
                     VRLLFSGFDDDDFACFVFPAHSPDAGKEVNIPGDSLPEVQQKFLACAMPVDILHIIPD
                     DDAPEKEMWTEITMPSSYVYTVEKIALKGLYKMATFVECDGTVSVNDQIQLGDKIKVV
                     IKPDGTVSFGGRANA"
     gene            complement(<669668..>672550)
                     /locus_tag="LMJF_25_1660"
                     /db_xref="GeneID:5652646"
     mRNA            complement(<669668..>672550)
                     /locus_tag="LMJF_25_1660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683872.1"
                     /db_xref="GeneID:5652646"
     CDS             complement(669668..672550)
                     /locus_tag="LMJF_25_1660"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683924.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652646"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9S4"
                     /translation="MPPKAAGGQKGSTKKAKPVFDAFERLCQYTSVSLQNAPGSHCAA
                     LKAATQPTNTVSASPAGIVVDGEAGADGSQAAEFTSSAITIKPPLPRTEVSLLVQFRV
                     SVALVEGDIIYIHLPKFRGPVAQQFALQRVFSGTGAAAGDLAAGNLVERVDDIDTSSH
                     FRAYWSGDSAKVITPVRQLTFKRGKNGGAPPKQVLLLQCIKAVNANTHLVFGVPRALG
                     LVSPDKLPANSPKIKIEGPLIREASGLRILKQVMFSSEIKKRTVVEELEVYDQCIAHV
                     AQEGRLQTADRHLGEQLSLEEVDQLWKAAQHRRRYPLPMPWFIAEELSISYDAAGGFV
                     KRIIQNAIKGIKDFDPLAIHREVARNWGVKVAAVVVLDDFLTTQWGGLYPGLPRASLF
                     AICLLVMEPEDVGRTFPRLLTLPERSIAEDLVSAFRMRTTLIDNTASAPSAAAAKEDD
                     AGIDVGSLPDRCGAFLQKWAALLTALLPASFVVEESGDNAARAAAKMMAAAAQSHESS
                     EAVVNVNEGGVADAQVMGADGSPRVGFQLPARDEVGDNAQDEDGVAFLHSRRRHSSGA
                     NASGYRMGAIATLQPPPTLYIGYRDVPFDVQRSLREIERGDWFVLPCFVVARQSLPYA
                     ATTTATLEGSVTLNGGDDSASQVNSATEGDERSEVASDGAIVAIPDNAVVVELRNVVE
                     ALELADLSFSPHNRAWLLPLVTSCRVVAVEEDQHDVLHVILDMQGSLLGHVNDPYLPQ
                     SDRSVATMVLSKYLLKTELSEMYISALSFLALLCARRNERRRLHPPTLIRAQYLSHCN
                     AALRAAIAKQHVEETESVEWQVHTHEAQLLDEGVVKPAVWEPIPKKFMLTVEQFFLGH
                     SRTLTKLEEGSLSVDLETYTIDYGGKGPRALRRVVQKVYVTHEPTLTETFAILHEREE
                     QYTKQISMLDTKLGINTSTASGATGNGAGVSASVTANGNGRKGSRK"
     gene            complement(<673431..>674036)
                     /locus_tag="LMJF_25_1670"
                     /db_xref="GeneID:5652647"
     mRNA            complement(<673431..>674036)
                     /locus_tag="LMJF_25_1670"
                     /product="putative mitotic spindle checkpoint component"
                     /transcript_id="XM_001683873.1"
                     /db_xref="GeneID:5652647"
     CDS             complement(673431..674036)
                     /locus_tag="LMJF_25_1670"
                     /codon_start=1
                     /product="putative mitotic spindle checkpoint component"
                     /protein_id="XP_001683925.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652647"
                     /db_xref="GOA:Q4Q9S3"
                     /db_xref="InterPro:IPR003511"
                     /db_xref="InterPro:IPR027097"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9S3"
                     /translation="MTQTTHAISLTGSVATVTEYLGFAINNILYQRGVYPPDNFQQVK
                     KFGLSLMISADADLNAYLAELLQQISSWIAHGTCRRLVMLITDVPSVQTLERWEINIE
                     TEPAASSSRLHGSGRKSEEDVRMEIQAVMRQITACVSFLPVITQPCAFDLLVYTSADA
                     QVPSTAWEPSDPQVLERGTEVKLRSFTTSFHYVDTSVVYRE"
     gene            complement(<675446..>681190)
                     /locus_tag="LMJF_25_1680"
                     /db_xref="GeneID:5652648"
     mRNA            complement(<675446..>681190)
                     /locus_tag="LMJF_25_1680"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683874.1"
                     /db_xref="GeneID:5652648"
     CDS             complement(675446..681190)
                     /locus_tag="LMJF_25_1680"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683926.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652648"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9S2"
                     /translation="MPKGDSAVRGPTMTSPSKLASRAPPARSASRYRRPNARPRKQQQ
                     ATFPAVPSLGHMAPHSPAVSRPAAAAPPWLSSASMRGTPAAQRMPSTHYAARNFSDAA
                     RVPRPPKAETWMTRQTHVRALQSSPAALAAAPTATEAPAYYVVGGAVVNPQLMVSPAV
                     QEEIREVRSLSVVPDALLRPGIGPQLNDTHGAAAAAASAGGETQRKSGSPDRTRAYGG
                     GTWGAASGGTSRRLRGRAAPPTCAASSSVERDTGDVVVTVEAIRTGRPRAENVPLLQQ
                     TLENTATASSLGLLRRLYGTTGEDVIEVARTNPRSGALEPPRLQYHLAQELLPELTGA
                     EAQLKTLASARRRIDWDVSIPTADTLPPPAIAFTTASNGAPVATLNSVRFRVDTSTLV
                     MQRDYATDAATAVGGGTPVAGAAVASVGGRPRTAKSALMHEEENVGLDITREDRIGSS
                     GLYCIHHLVGLRPGLGEQVGLERVLEYKVVASVRNLFIAPPYINSSTGDLFMELNTSL
                     QGTAKLAITGVDCGSVDPDAGVVLKSSNTLTCYLVLQHSTSTAATKAERDQTVASTLG
                     GGSTHYAHVPSAAARFARAITAGTAASAATMAQRSARDSSGAEAQGTDGFSLSLAHFN
                     QEAAGSIPAAVSGTSPSGLSRTPSPAKDGVAAGAPNPVAQQGKQAPLGQPRRNSLDVQ
                     SMAARNAAEAVAVAISAAYAPAAAGEAAHDLRGGSGTVGKKADSRHSAHHYLFPATNP
                     HELRYACYTEATRLRRLQQRKMQQAGKAEQGAAAEERCHQQPRCASATSSSGSPPQAR
                     TTLSNDEGDKDLSATLAADSGSRSQLTTSSVSKERMRRKSKVEVLELEPQVDTNGPVS
                     APAMTLWEPQWSKSASNSGGQASLAHRHGDGSEATPGKSGGVRDADAAANRELRGPPL
                     PTTFFFMDSLQSPLDYMRLTGWQDRLITLFREEDKDLLRSEPRTRFKREALQELSNGA
                     LAGMIANLYLWNGGIGNSSVSGSGRRASLHARRGSSTAASRNLSGGADSIFYHSSTNI
                     NNPFAILANRGSVTVNGCSTGGGVQLKASVEVTTERTFAMLRRLILCLAVEEERASTQ
                     LYNDTVQLCNQFCHSALLKTTSLTRGTREGLQQAAAAILSAGSPASPRRMCTSGGGFD
                     GNAGLSGKDIEVLRSLEDALELSMTTMLIVGAYGEAVEYALQRVHTLCLLEGDTDALV
                     NAAQRDLAEAYFFYGDYVAAATIAEDVVMLTRQLCDDVPDAYEVIEAELLCTVACVAA
                     GKRDRLPHYIDNLELNILPVDYGSDNVARAAQPLQQAQLRLVLVFAKTYLMRSGPVGA
                     TAGALAATGAATTVNDDMQQKRSAAGSALPVSTGDMATLLQEAVQLLRGRGDLQEIEQ
                     SFFTVFPSQVRPSITGDGGDIGTSTMLRICGRGRSAFTTGRASAKPVRVFGNPSALSG
                     GEGEDAEDVAAKMEAAQKRLRWNLLCFAGAQLLQNDHEQEGMEVIESAVKELVLGKHR
                     HVERNQRATLAAALWVGLMLAKSRMQPGQVTDIMPILKEMADRVVRTRGPLHPLAARA
                     NLLYAYVAHYVTNSRHSASLATRSLAALERGVGPQSYDRLMAHYVVGLMAEAQQRWQP
                     AIEHLSAAYAIAQTNRLAEEDLILMDTQFLGAVLLCPPTAVLDLDTATLCARFEERLQ
                     RLRERVGPHSEKLVMPLWNTAELFYLRKNTDSAIECLQQTTRLLDHRGVLLVSTDVLK
                     PKDVLMLEQQEAMGGSAGNEGWGGRAIRSCAAQAAEARERGEHLVAQRNALVQTSFDT
                     VSQALHLATTLFMWAAMLESQGCTTEAREKYGQSLALYEASHLGDNSLAAVRIMEALS
                     KLLYTVGECGDALIWARKAVDLLHIHYPKEWSLEHAAARKLVEATEHRLLVVEGTYVV
                     QSGLPIHSEFVELL"
     gene            complement(<682235..>683071)
                     /locus_tag="LMJF_25_1690"
                     /db_xref="GeneID:5652649"
     mRNA            complement(<682235..>683071)
                     /locus_tag="LMJF_25_1690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683875.1"
                     /db_xref="GeneID:5652649"
     CDS             complement(682235..683071)
                     /locus_tag="LMJF_25_1690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683927.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652649"
                     /db_xref="GOA:Q4Q9S1"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR004640"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9S1"
                     /translation="MLAQCSLFVQPRVFKGLVMRSHAPVACWAASLPWMTQQQRRRSS
                     FASATPAAPSTDAGKGNYFHFFRIAKHPDLDVAALQKKYHNLQRLVHPDQQQVQAQQQ
                     QAEAADVAPATSSSPLPFACTSNEAKSSTDVSTYANAAYETLRAPYSRCRYLSRLVKA
                     EEVKGNPLSAAEEEELLVEDDQRTMKAREVRPDAPMSDDFLMEMLAMNELIFAGDSSD
                     EGVRQQWSVLRFDLEDRAVGYFKDAIKSWNDGDMGAFHHIVHEWTYVATALNNLKERM
                     LE"
     gene            complement(<684706..>688146)
                     /locus_tag="LMJF_25_1700"
                     /db_xref="GeneID:5652650"
     mRNA            complement(<684706..>688146)
                     /locus_tag="LMJF_25_1700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683876.1"
                     /db_xref="GeneID:5652650"
     CDS             complement(684706..688146)
                     /locus_tag="LMJF_25_1700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683928.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652650"
                     /db_xref="InterPro:IPR003603"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9S0"
                     /translation="MRAGDQRRYHDILRREARPQTSKLCRGSAPVAAQLSGASLVCDP
                     LAELNIPSTAVPEVVEYVCDRRGFTSLHPNFLRFEHLRCIVLEHNALETLHNLLLPPS
                     TLGASSPASTVTAADGLPPLPPPPPLYRGCRQLTHLHAAYNRISDIAGDTDIPRLFLL
                     EHLSLAHNQLTGLSKVLDALKRLRNLRFLDLRGNPVTGEPRYRERCIAALPQVEVLDR
                     QSVTPKERKEAAAPVRWNGRTHESRLCSTATSTATAVSGSRPRSSPSCTRGLRAAGDP
                     FSKSLTAKDLERAYAAYLRQQQQAQEAAAQSTVAAWRQQAEIWESFHAVWTLSQPGMP
                     LSADGWQRTQMAAAAAASESAEGTGERPETQSTFLVSAPGFRVPVFGSAGPSPPSSPL
                     HAGRKQIKTPSVSPAATTITAAPAPTHVSVGNGTAALNVTIDVLLDRPLFPSCAETAG
                     TPESATLQPAAASTRSGPLPSAATATPLLPSVHNSLYFRAVRGASATSCKGTPPLLPT
                     ETSPPAVSQLLPVEGLAPDRLTTLQRTLEASAQVVRVATARQGSLGALKKLSVVQERV
                     GSGRRNVAPSPPPPTVAAATSIPVEFSTLRTIQETKYAVIPPPWEDAKARAAVSGAKE
                     AVARSPRAVVASLGATGASETTPFRIGVVSPATTQQEALTEILVLLHDVYSLKELQAL
                     EGEYGGAELLRLLPLREWSALGSESGAGEVVSTAVAARQAMTVLSHPDSVGNAAGGGG
                     GNVRGPASQHDRKCFAASKGTAHRGNTRAGSAGSAAARGGGADAVGGVPTVAAALDAA
                     RAALHREPQLVWQLLTGPYMVAGATAGGNSGVVVALGKSSEDAGGSVSLIRKNSSSSA
                     ASTAPPTEAVISSSAGARANAAAASAPPVSLQDPEAVQHLVRPIGPYASHVLGPLLTL
                     LRAPVAEEGVESMCDALAAHHAVHERTIAAASMLKATAAELQPRSSSVGPRSKKESLL
                     VTEENGSAEAKSRKSSRGAAPAFLPDGGASTSLLPVSSAAGPQTRSSAKAAQLLVQQH
                     SRQWVATQLTLTAVLTALLFSPAFVRSRVAYLEEKLARATSATAAASVITTADHAGQK
                     GGGAAATLPLLFHRVQAVKMHAARVEAALTAAGPSATTSEALRLLDPAQVLVAYTGRR
                     "
     gene            complement(<688843..>689238)
                     /locus_tag="LMJF_25_1705"
                     /db_xref="GeneID:5652651"
     mRNA            complement(<688843..>689238)
                     /locus_tag="LMJF_25_1705"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683877.1"
                     /db_xref="GeneID:5652651"
     CDS             complement(688843..689238)
                     /locus_tag="LMJF_25_1705"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683929.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1705"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1705"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652651"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9R9"
                     /translation="MLSQYLRKRVSVVTVDGRNLVGVLHAADQLLNIVLTSCVERTGA
                     PYDFDDGAAEEDNGSVVDEGVSTAFSGGDTASGALPPLEEVHLGVMMLRGADVVSIAA
                     IDVYEEAGTNVKDWRGRDMPPATAVARSW"
     gene            complement(<692154..>693206)
                     /locus_tag="LMJF_25_1710"
                     /db_xref="GeneID:5652652"
     mRNA            complement(<692154..>693206)
                     /locus_tag="LMJF_25_1710"
                     /product="putative pyruvate dehydrogenase E1 beta subunit"
                     /transcript_id="XM_001683878.1"
                     /db_xref="GeneID:5652652"
     CDS             complement(692154..693206)
                     /locus_tag="LMJF_25_1710"
                     /EC_number="1.2.4.1"
                     /codon_start=1
                     /product="putative pyruvate dehydrogenase E1 beta subunit"
                     /protein_id="XP_001683930.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652652"
                     /db_xref="GOA:Q4Q9R8"
                     /db_xref="InterPro:IPR005475"
                     /db_xref="InterPro:IPR005476"
                     /db_xref="InterPro:IPR009014"
                     /db_xref="InterPro:IPR027110"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9R8"
                     /translation="MRRFASRALFSASAAMAARCATTNMTVRDAIHSALDEELAREEK
                     VFVIGEEVAQYQGAYKVTKGLMDKYGKDRIIDMPITEHGFAGMAVGAALSGLRPVCEF
                     MTFNFAMQAIDQLVNSAGKSLYMSGGQMKCPIVFRGPNGASAGVGAQHSQCFGPWYAS
                     VPGLKVIAPYNCEDARGMIKAAIRDDNAVVVLEHELLYSESFPVTDEAADKNFVIPFG
                     KAKIEREGKDITLIGFSRGVDLCLKAAEKLAAEGVQAEVINLRSLRPLDRHTILSSIK
                     KTHRAVTVDESFPVCNIGAEICACVMESDTFDYLDAPIERVSCADCPTPYSKDIEMAS
                     QPQVADVMAAAKRVLS"
     gene            complement(<694289..>699004)
                     /locus_tag="LMJF_25_1720"
                     /db_xref="GeneID:5652653"
     mRNA            complement(<694289..>699004)
                     /locus_tag="LMJF_25_1720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683879.1"
                     /db_xref="GeneID:5652653"
     CDS             complement(694289..699004)
                     /locus_tag="LMJF_25_1720"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683931.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652653"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9R7"
                     /translation="MEAGQASSSDVASWWWSHRSIVEEAEPLDATADDAAASCLCVIV
                     KQTANNVLAYKNDLLALIGEVHPARKGSADSVSQHNRDVGACGLYQHMKWDYVLLPLL
                     TQLRKCMARAWEERAAEQAEQAADDTTPASAAAVARSGAKVTPAAHIDAVQARRLRAL
                     QQQIYLAFFKAVLQGFTDGARGAAETGADTSNAVAGEEGCSVGVQGRGSSETANVTPA
                     ARALSLLLDSLLTHVLSFATAGAAAASSHVEEEEATKSRRGQHRRAVAATGTHTGDWL
                     TGMLPLYLRAAYQQQQRAHDDVAEQRGVALASTSASLIPSPVLCLVSYIGAFVQGAGL
                     QLVPSEQEEYLPCFTRKVHSEFSDQLRSFVQAAAAQSEYAAAGVASSDAVAAAAAHIR
                     YAGDVLKAIIDRQLYSDDNATEVGEGDCTMAYAAVPPLPALRAQPQKSETPIKVDYSV
                     APLLVLSSYKVCERLLRLMSRWWVACQHMARHARMSAAAAVPRMEEEGNVEGEKQQQQ
                     QQGADGPNSGNDTIRLEEVEEAWLGLRKQAMAFTLVLSTYGETTLLIAPYTAFLTTFF
                     FTPAPNGTAPSAEKQAPLSLEAWKGCVRELHRVTHATQDGGYALFTHTTCGARRQLRM
                     HHRHARDCTFAAACFSRVMECLSYPPTGAQVPGQAAAAGTDRQAHSVGSHSLLPLAFA
                     ALQQPLSTMQEHVFPLLLRVGSVALGVRVDAVVREKGGAGDPGATPDASNVNLSTHSP
                     NSDAATTSATRAQALTEEPLSAVQLVELYFPRYYCVFSCLDQAMQYVLDRFQELAGDN
                     AAVEETADGDVARMWASPRSLPATLASFFGAALDEACVTRMRNTGDEVATSELLMFFA
                     AVFRTLPSTVLPRLRAALEAFLGEGGCTIIEYLRHHIIHQQRHGLAAFFVPPLRAMAL
                     DYATAEDADVSLALTAKYPASCAMAYAWELPRLYFWRAEDTPVAESAWYAHRAAQRYL
                     CELVTAAPATISTSSVPFLAILQEAAAVANGRFAEPHESAKMASGLFWTRSLAIDVMT
                     SVFFGMCRWCALQMSVSSSSLSAEAAATVIQHLCCPRPTSVTLLSPHVVAHPLLLSLR
                     DRVKVQLGSNVMDAAESEGAVAGTENAEAVNSPGVAYPPPAQQQLRSSHRWLSWFWVC
                     TYEEVDSAARMQTAAKRLLREFSVQCGSHAPTKTLLGIRAMVEQLKTEGVPDMAVAVH
                     ELREAVRGDLRALLLQQQQREASENENATAVASTEGTKEATITATTATSSADAAGAVL
                     KPATLRDYLDQIHEALVQRARISPVDGAVSAATLGHLLHVLSDAHLPITMSVQERQRM
                     CQRFFFTLANSLAECTRTEALSSVCCLRCVLQDIVLPYKKSFLIESSAARVYHRCFSD
                     TETDAFRMVQHMCGDVIMAVQKIVLRNGILDEWKMVLVLQHLGDPLSLVRSTVEKLRS
                     TVERLKARRRGVVMDVIARQLAVVEKSAARTDRGVADDVHGLFTLHPRPSSSSSPAAR
                     AAEGLLTASSAAAAPVERSSSGRRTRGDRRERERRNEKDRKRSRDDCVGGDGDEKPWQ
                     KPRTKDSKRYRADFKRPRR"
     gene            complement(<700194..>701159)
                     /locus_tag="LMJF_25_1730"
                     /db_xref="GeneID:5652654"
     mRNA            complement(<700194..>701159)
                     /locus_tag="LMJF_25_1730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683880.1"
                     /db_xref="GeneID:5652654"
     CDS             complement(700194..701159)
                     /locus_tag="LMJF_25_1730"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683932.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652654"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9R6"
                     /translation="MKPMRLCCPLWRAVLAHPAPQHAAQPRRIFMATATFTFLRSSSA
                     SATTDSLYPSPLLHQRRAVGQSPTLPGTPLSLSEKSSTARSSSSPVARESSVSSRSAA
                     KEGPPSLEPVVVELGTLVTRMMPVGELFRALSPASRKILVAHRLPLEELLLHFPNHFL
                     VCRLGEKRASQSATLHVAPPSCVKNNMQVMRLPPGTKPLPALEQWLGPQKAMEVAMPN
                     LNIVGGSPCIGTGSGFVNNTTTLKERLEEVLTHIPNEWVAFSSLNISRDVKMRCMGYP
                     VVRPCAFLLKYPQFFDVRVQDRNGNSFLVRRALSLQQQLNRNRKP"
     gene            complement(<702157..>703080)
                     /locus_tag="LMJF_25_1740"
                     /db_xref="GeneID:5652655"
     mRNA            complement(<702157..>703080)
                     /locus_tag="LMJF_25_1740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683881.1"
                     /db_xref="GeneID:5652655"
     CDS             complement(702157..703080)
                     /locus_tag="LMJF_25_1740"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683933.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652655"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9R5"
                     /translation="MRSFSILSRGGFSSGGPAAAAMAVAAGAPASATIGYSACAMRWQ
                     SSRPYSRSSGGGRGSGSSFGPPVGSHGTGSFGNPRAPPGPVPAAVRNSTGDGELSAET
                     RAALRDDSIVMTEVLKHIPPKGAISIKSLFSAIDENIQEALSERHGGLRSFLEQRKQF
                     FVLHTNPEDGVLYVIGNPIVIQQYATRDAQRKTMRRMMGLDDADRRQQQRRPGGGVGS
                     NRGRGGRGGGDRRHQGFSSPSGPSRSPPPQYRNEGGSGSYGRGDGRRGPPPQRDDRHG
                     YGGNNGSRGGGDGAPRRGGPMGSRNQSFGTR"
     gene            complement(<704552..>704980)
                     /locus_tag="LMJF_25_1750"
                     /db_xref="GeneID:5652656"
     mRNA            complement(<704552..>704980)
                     /locus_tag="LMJF_25_1750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683882.1"
                     /db_xref="GeneID:5652656"
     CDS             complement(704552..704980)
                     /locus_tag="LMJF_25_1750"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683934.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652656"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR015232"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9R4"
                     /translation="MGCGYSTYSAQDDIVWKYGGPPEEPLKALKMFPKKQNGLLFRLL
                     YDDGERWAFYNDTLEYEFHIRYYFSRDSDIEALHNATLSELENGNKLVEIIVYPKETQ
                     DFLVGVAGSYTSTIEAIPLTERFQWEKTKEKYEHKQSRRK"
     gene            complement(<705675..>707180)
                     /locus_tag="LMJF_25_1760"
                     /db_xref="GeneID:5652657"
     mRNA            complement(<705675..>707180)
                     /locus_tag="LMJF_25_1760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683883.1"
                     /db_xref="GeneID:5652657"
     CDS             complement(705675..707180)
                     /locus_tag="LMJF_25_1760"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683935.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652657"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9R3"
                     /translation="MTAGTDEATVDYIRSHLDEDLEEVARRPGPPLIRPSLAPFLTPT
                     GLINLPAVAPSVRSQGSSRDLVHPDGTPLSSAAHTVTLVLQVMSVKDVSLSREQRSRV
                     LVHSLSSTRSSSGATPNAALNDADTDTAASLADATLQAMEEQQDEEAQNHIPLRPSGG
                     QWRCLRLELSDGFQRVLAVEDASARTRQRCGVLAKEGITIGAKLHVRLTAPVADTTAI
                     SVPCVQHGVLRLHAGNTEVMGGRVRALEVYWETQARQQLAASTGRPSKQQQQQQQYQP
                     TSLTDAPTMSTSAAPAQQHPQPSQQLVVASPVSSPAPPPQQPQSLAALPLQPLRCWPA
                     HAAQHPPDVPFCTVAFITEVVSDMVINEPSPGAAHNGHHVGAEPNPARDAFTYSLLVQ
                     LSSPNAVERDTQQQLSNSPSVGGEELGPVSEDDHLTVDLGHAWLHQLVGMPADAFRAL
                     SLSNAEADVELLTRTVESVGHALERFGKGRFTLVRRAGDGIVEVMHAEPKP"
     gene            complement(<710124..>711044)
                     /gene="EnCR"
                     /locus_tag="LMJF_25_1770"
                     /db_xref="GeneID:5652658"
     mRNA            complement(<710124..>711044)
                     /gene="EnCR"
                     /locus_tag="LMJF_25_1770"
                     /product="polyprenol reductase"
                     /transcript_id="XM_001683884.2"
                     /db_xref="GeneID:5652658"
     CDS             complement(710124..711044)
                     /gene="EnCR"
                     /locus_tag="LMJF_25_1770"
                     /EC_number="1.3.99.5"
                     /codon_start=1
                     /product="polyprenol reductase"
                     /protein_id="XP_001683936.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652658"
                     /db_xref="GOA:Q4Q9R2"
                     /db_xref="InterPro:IPR001104"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9R2"
                     /translation="MKVIVASGPDGARKHEVELAANATLADLKKAYQPGVDVHRKSFK
                     VPSAESPLPGADSGKLRPNLITLSDKVPLSQQGVKDGSVITYKDLGPQIGYRTVFYVE
                     YAGPIAFMLLYAMRPSLIYGSAPMPAYGYTQKLYIGLFLAHFLKRELESMFVHKFSHP
                     TMPMRNIFKNCIYYWSFAAFIGYVLCSPSFTPTSTMQSNFGAVVMVINELLNFAVHYQ
                     LSTMRKSDGDTTRNVPQGPLFAFVSCPNYFFEIMSWVSFSIGTNMLSSWFFTLAGFVQ
                     MADWAKKKHRGYVKADPANKKKAAILPFIM"
     gene            complement(<711851..>715207)
                     /locus_tag="LMJF_25_1780"
                     /db_xref="GeneID:5652659"
     mRNA            complement(<711851..>715207)
                     /locus_tag="LMJF_25_1780"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683885.1"
                     /db_xref="GeneID:5652659"
     CDS             complement(711851..715207)
                     /locus_tag="LMJF_25_1780"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683937.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652659"
                     /db_xref="GOA:Q4Q9R1"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR003616"
                     /db_xref="InterPro:IPR005905"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9R1"
                     /translation="MSFAVSPRRLALCGVCKCPSPGDGEASIDPHPTPTTTRAHKHSG
                     TPRPSSSSSNPTPPLLPPGPCRRALTRSVCACEHSRIAGRRCRPAPLPFPSLESLTGE
                     GSTLPIDGAFTSYSFCSLLALAFTLPSSCMDQLIPARTPTHPTPRHKHTHTQNNHRLD
                     HSRAQCQTCVHAHTRARAHVRVRLCTPIHTKHRQLAHHRKRISPIFKVKCPIAREREG
                     GRGTHARTHTHTHTHRHTDTHVNAGLRTPALAEESPSSYLSSSSFMIPRGGMGAARWA
                     AGALRCLHYSPNAAAILALTAPLSTCRVQLLHHWVGTAPRTALVVGTAFVYQQRLYAS
                     TAASGSNGASHGHDHRFSDGKNGAAGSSGFSSAHSSAGGGGGINGYGGGSGSRGNGAA
                     KRIRKVKASRRVLKTKRAGPKAKAASTPASSTSGGSAATASASAASGGASANQGSGAG
                     SSGSGSGGGIVASPSPGAAYAQSRTTAPRRKKKSSRVPPPPPGSSAAARGSRHPLTGK
                     RVSTGSLSGTGATPKKAVTVAHAASHGRSAVSAPSATAAVRAKAKKRKRIRICVLSSS
                     YDGTDSATASVDNYWCTPQHYIKKDRHKYSFADVSMKKIDSYRTVRKLVTSSKYDVFF
                     NLCDGGRDEKRAGVDVVEALEEQNAAFTGTDSRGFEPSKIDMKLMVGSSGVKVPNFVL
                     LSNAESLAKKCRHLKFPVIVKHLSGYASVGIQKDSRCDTLDQLRTKVRGFIKEYNHAL
                     VEEFIRGREGTVLACADPGSPFGVKVFKPLMFNFLQNNDDFAYFEKKWTMECGDQAYG
                     FLASSDPAYTAITEMARNAFKYIMNGVGYGRVDFRIDELTGEPYFLEINPNCGMWYAP
                     KDGGDFADVMVEGDPHWNHERFVANAVARALRDQAARKPWYFISHDRNGQFSTRASKT
                     VAAGKCLFGDAVHPIPVVAKSLYKLGEEEPTVGCVICRGDGIHQAVALRHSCEPNMGF
                     VHGRTLLFAAKRQINVGEELTVDYATLRDESMPHFVCSCGTENCRSVIFPMPAMPRTV
                     EAKTMKRLLREKKQVWMKEKANREAERILKKRSSRAPSSSASGSGSGGGGSSAGSSSS
                     TGHASSSASGGASSSSGSGSSSGISASERK"
     gene            complement(<715520..>716422)
                     /locus_tag="LMJF_25_1790"
                     /db_xref="GeneID:5652660"
     mRNA            complement(<715520..>716422)
                     /locus_tag="LMJF_25_1790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683886.1"
                     /db_xref="GeneID:5652660"
     CDS             complement(715520..716422)
                     /locus_tag="LMJF_25_1790"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683938.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652660"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9R0"
                     /translation="MNLVRVSLLCACTTLLCLSALYYYSMYDYEKHMNMVQRKYSVYD
                     PLTDCATPFGQLLGVADDVPAYSNCNTKFSSTYINYVNLMDPMDNGRRGDPSETRIVM
                     TAYRYTAFDYCMRWLVWNRGVMPRLVENTNQLWKTVDYFNPARPEQGWSAEYITNYEE
                     VTDVEERKFNAPRRGDAIVYRMDKNTIPAGHMAVVVKVEDDVEAAGGPEKLNELKKMR
                     LHPRRVYVAEQNWKNQPWGGHNYSRVLQFKWRAVSEKAHEGGYVDPDELDIIGVVRVG
                     KAMPLRAAPDPYEEALNMDNDGDL"
     gene            complement(<717213..>720308)
                     /locus_tag="LMJF_25_1800"
                     /db_xref="GeneID:5652661"
     mRNA            complement(<717213..>720308)
                     /locus_tag="LMJF_25_1800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683887.1"
                     /db_xref="GeneID:5652661"
     CDS             complement(717213..720308)
                     /locus_tag="LMJF_25_1800"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683939.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652661"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9Q9"
                     /translation="MLSQALLSAVERDLAVARQLAHFHVDLYASEGDSDENGDFIGPF
                     RHYPPLSSDLRSSQGTLTRGVHAYAVLSNPVQRPRQGTCAVLMELSRPLEWLSQRGRH
                     RCPGAGVGAAAGVGTAATTSSSTSSHVDNASAEGRLGVGGVSGQRGPTANSSCGKLAS
                     GPGALSGAHVASPASPSSAGMDAASPLHTAGVPLLIATAALEVVFPARYPSVPCQWQL
                     FEEVSFGGVGDHSTSSWAVTAGHHRGNTGGSSSGRSRPHHLHGSTSRCRTNSPAWCAR
                     SGAEDGACGTTGPPGSSSPFIDHDRADGTASRVADTATPTLTAFVVSDVGRRLLRWIA
                     EARAGTGDSFILSSPSLVSMMTSSATANVWGGQEHQYGGGINKTYPFLLDFAMLLRYW
                     SAVELDVHHLILPSRIAMAYGSGSTRVPPVMTSMHVSGGGGAAVAAAAAPAVGVSAPV
                     AGGSLPRSASAAAAASSKMVCTNVAASSSSAQSTAASTSASAAVGGGALYGGTTSSTA
                     SVPAPAPGAAGAAGGNVSSGVVATGAGAGVSVLYPFRRRPAKSFMAVLLPQGDVAVLG
                     TPLPARRARHGVSTTTANSNDNGPGATAPRPPFRRLPLCLRHIYEGPQDADGTEKMRA
                     GTVVSCTSQFELGKALPSYVLPAHVLGTVYKCGWDSVSLFSGKTANATLHANAKLAKA
                     LRLPDVSDLLQVLRRLAKNVGTPSTGVLYVGVVLWPALMETVRVLRNRRLPFWAGLAV
                     CSLLLPGVLQQVDSGRQADPGGGGRSGGCRVPVSILPADSDQPAVGGNSPSQLRRRHL
                     AELIEVVSFTEQVLAVAQKHTLLCEVRLVRFSLQRLLPLLQRGEVCGYHRASAADDRI
                     ATAAHTCLSHSDLSKCTAACAPAGLLPLAPLVASSAEMCRRVHAPISVCAVCGLSLLR
                     NTVTHAHVSGNGSAAAAAAPLTEMRHRSHATASVERDSDTLQRKKDGDDGRPVDSAAS
                     SESGPEATRATPRTLREEGCLVVQCARCGHGGHVEHISSWWNDPTVRCCPKGCDCRCI
                     Y"
     gene            complement(<721915..>722763)
                     /locus_tag="LMJF_25_1810"
                     /db_xref="GeneID:5652662"
     mRNA            complement(<721915..>722763)
                     /locus_tag="LMJF_25_1810"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683888.1"
                     /db_xref="GeneID:5652662"
     CDS             complement(721915..722763)
                     /locus_tag="LMJF_25_1810"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683940.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652662"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9Q8"
                     /translation="MRSSGDDIFRAPESGEKDLVDKIKNRRKKFELYQSDSHKMKSLM
                     MNSAGIRSDLVTSNGMALNPIWTTFPTRCVKPITSVEEMREKLNYFSKTDDVMVVRYH
                     QNNCTACNAVDKVFEVLCHQAATRTPGLKFYDVNRNDVPDLTKGLVRFPQIKGYSGGQ
                     WADIDFKPPTAFREELYAAIEKEVKRLKNEGKPVTALQAEEMYFSGAGPAMLEITEEQ
                     LMKFYCKAQVRLHNYWRQVSMRRTWFYRKFIEPEVEERVMDEWRARSVFGEKVVYGPQ
                     PSDEFS"
     gene            complement(<725258..>727753)
                     /locus_tag="LMJF_25_1820"
                     /db_xref="GeneID:5652663"
     mRNA            complement(<725258..>727753)
                     /locus_tag="LMJF_25_1820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683889.1"
                     /db_xref="GeneID:5652663"
     CDS             complement(725258..727753)
                     /locus_tag="LMJF_25_1820"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683941.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652663"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9Q7"
                     /translation="MSKTLPSIQVYRPASVEQSHSYSRSSARGARHEDHHRSYASSAR
                     VRSASPGATADSQFTGLSTLPRLPQVEFSLGPIQERVIPPYNDLEDPHLVPYWARKEM
                     LIHERADQRRRLRRQQEIEQQRKAAARRRFLQRRHQEREEMASRKGEQSRQREEEHQS
                     TTNNAFKNSRRVPTKPSSDRKSGAAAGGRSRQQAAAAASHRYYEASSELHAVDVEERA
                     AGGLPADHEYVTSSSSAATSRSASSHSDAASSHGSRRHDEGRYAEEDRAAVPAAPEAA
                     DEERTYLDEAGYPIEAAENADAVKKAAPRSISSRSSSASSSSPSSNRQCSDHDRAAEA
                     AREQAKAEARAEAHARAGEKSEDSYGDDDFENEVSPSRHHSSAAASSKSSSAAAYLLP
                     HKEDSDAEALPEQEEVRPLEETEQEAKEVYSDDEFEKSSASSDAAVDAAGEPADPLPQ
                     QPQYTEEEESGPPAADKANEAAKPDAYEEDRFDDDELSSKKTSPDASDADVPLAEEHE
                     DQSEAYPEDAQWAGAALMATEDAKPAEDEDEDKYSDDGFFKDDTADSAAAVEPQPYDS
                     LDAAAHDDDAVEAKSDVADDAYEEDDFENDLPSKKSSAASDADVPLAEEHEDQSEAYP
                     EDAQWAGAALMATEDAKPAEDEDEDKYSDDGFFKDDTADSAAAVEPQPYDSLDAAAHD
                     DDAVEAKSDVADDAYEEDDFENDLPSKKSSAASDAPRSSAAGSRKSDAPKEDVADEFE
                     EELSPRKAADAEHKREGSAMSSSAIAPLPVVQSAPSLPSSSISDSEVAPALASAVKPA
                     AEMSHSSSGAGMDAEELGSGANDAYADDFDEDM"
     gene            complement(<729746..>732736)
                     /locus_tag="LMJF_25_1830"
                     /db_xref="GeneID:5652664"
     mRNA            complement(<729746..>732736)
                     /locus_tag="LMJF_25_1830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683890.1"
                     /db_xref="GeneID:5652664"
     CDS             complement(729746..732736)
                     /locus_tag="LMJF_25_1830"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683942.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652664"
                     /db_xref="GOA:Q4Q9Q6"
                     /db_xref="InterPro:IPR026502"
                     /db_xref="InterPro:IPR029344"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9Q6"
                     /translation="MHVRMRGSNVSGSARRSTPSSSVEPPATAAAAAGRDSSVLVNRG
                     HGVVGDAARHIYCAAGMDRINATPLASAAAPPFPWSSKSFVTSHGAHADAAARDANAA
                     VSTGSILQDSDVVLGTTPDTHRRSRHMASPSQHPGDSSLVFAMSEDSELKVLASGVSP
                     STALPPATCTSSSNAIHPPLPHSSQCTVGHSRTARTQVPMAGNIGEGDCGVYAVNRRG
                     NQHNRHGIAGATLADYNAVADMGHLMPHTPSVRRQSDVDVVVPGGLHEAAIRKPFVQL
                     SHQQLGGSIRGAAATTAGVPSSAGSAAAPAYRTSPHEVRTPPALQVFTGVAPGVHKVR
                     GTTAATTAPAATAAPTPLHTGAGARWPQRQMPSVSLYSAGGGGAVFVHGASRTSSSTA
                     ALHATAGSDQLVQQQPAQLLQQQPPSAGVSNAADARSQHSGTPPPPASQPLDKNFTEA
                     QRLAVLEEVQQELYLNYTAVPVPANMINAGDTDERRRRLDQRRKQIVYGKETEGYLKY
                     TSMIPRPCDREYHNPLHAITPRPEYDCSKRQFDRVLNAWRRQLHQWDDYDVDNIDERF
                     FPLGKASLLDLGLCHPLANHTPTTAAAAAAAPGATAPPPGKPPQAPPAGVMHSIANVA
                     AMANSVHGDDGAMQCHSRSPVFTENSPTSGLYSSASLSMHISSGRAASMAAACTPSRP
                     QLSEGADGPKVDESFFFHMNSGNSRIASPFHPTYSGTGHMAHGGGNGRSSANSHYQQL
                     IMRNSAAYAHNSANSGTPGSSCTNYTGLTPAHRPASRGGMPHHITAIFGSEYELMTPS
                     GLASPAGMPHNPRNGSSPYPLGEPWMPNRRSPTCVVGTTHSFGCHHPSAAALSGVTAS
                     NGSGTAMMVGGGRGESPPHTTEMALIPSTSLSNGSGFAQSPYSYRVHSPIQPQGAPPQ
                     TTNTYVTPLTRQQSRPSLSGYTNAVSAAAGIHHQQHQSNSSSSARVGPPQQQQPRVAI
                     ATGTAAAAASRSARGSSVSGLPTS"
     gene            complement(<735294..>737219)
                     /locus_tag="LMJF_25_1840"
                     /db_xref="GeneID:5652665"
     mRNA            complement(<735294..>737219)
                     /locus_tag="LMJF_25_1840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683891.1"
                     /db_xref="GeneID:5652665"
     CDS             complement(735294..737219)
                     /locus_tag="LMJF_25_1840"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683943.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652665"
                     /db_xref="GOA:Q4Q9Q5"
                     /db_xref="InterPro:IPR007207"
                     /db_xref="InterPro:IPR007282"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9Q5"
                     /translation="MSNIKKVQTEADRLLKKVNEGLDAYDELHEKLANAPNASAKERL
                     EGDLKRELKKLQRHREAMKSFMQNDDYKEKMKMQVSRKKIEERMETFRAIEREMKTKA
                     FSNEGLASAALERADSATEQWLKDAIEEGRKKIELLEYEVQKANNGRVRRGKQQKSEY
                     QIRLENLQTHFFKWESLLRMVNNEELDTDEVDDLQEPIQKVLEDDVDLDVMEDMSIYD
                     SFDIPEPKAKPVVPFDVSDYEDKKVQSPKTTAKAKTPTSTVQAKPSPFITSPKETAAS
                     PPAAKAASSTPVPSSMQQPALAQAPQQQLLPPTANSPADDDIGEEEPVPEWMDDDMDT
                     ANDDTFGDAAMSGGFTIGSLAEMASATNKVTQDWEKSQKPVGSLEPKTVKVTDPVHGA
                     PEEKRKPTPPVAAPTPNAWERRAAEQQSRQKVQQQQQKQAPEAASPVAPLGPVAAAAE
                     ASAPEAVTTSLINPVAATSPSTPAGSANTDPIQPFPPIPGAAPGSKFTPKKIHELLDM
                     SLGNLPHTLDVQRQRPYEPPNAIDAIPYFPQEVLPVLSNKDVYHQMDLDTLFFIFYYH
                     QKSYQQYFAAKELKARSYRYHTKQQRWYQRLERPQTTTETEERGSYTFFDFEDKWDHD
                     RIDDFLFEYKYLENELH"
     gene            complement(<738256..>739821)
                     /locus_tag="LMJF_25_1850"
                     /db_xref="GeneID:5652666"
     mRNA            complement(<738256..>739821)
                     /locus_tag="LMJF_25_1850"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683892.1"
                     /db_xref="GeneID:5652666"
     CDS             complement(738256..739821)
                     /locus_tag="LMJF_25_1850"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683944.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652666"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9Q4"
                     /translation="MFPTDRPPTPADMARLQAFRAEGQAEAELARDVYLHSLMKRRSD
                     SVAGLLALYTSPEDARKAYPDPPSSLLQAADVAPLASTEKASEAATGTGGPSSGAMAQ
                     ALKRARRENAAAALGASSGAAAAATAAARPVPAVDGPPTAVFVDGVERVNYLGKSFLE
                     PPSSVLVHEQSTKQKACQPPRTMRGVFKVPEGYETASNTASAPASSSSLVDHGGSSGG
                     ERRFGKASGVQQLRWAPPAYGHLLFSGDIGGQCRLWNSSTRQLLATFAAHTQPIKSLE
                     VTTNAAIMSTGSVDGTVAMWDVEAGVCAHVLTNPDSLPVVQHLHHPSDEAHLLLAAVD
                     KKVVLYDVRVGCSKYQREYTGHMGTIFNLTLLSNGSKMLTTSEDRTLRTWDYRSPVQI
                     KQFADAAMHAITHVLHHPTQPEFLAAQSLNNKVIVFRDDGGGRLRLLHDREFTGHTIS
                     GTRCQLSFSHDGRYLSSGDIGGKLYVWDWAAKKLEKSFKAHAQMLVSHLWHPIEPTKV
                     VTAAWDGHIRSWA"
     gene            complement(<740570..>741877)
                     /locus_tag="LMJF_25_1860"
                     /db_xref="GeneID:5652667"
     mRNA            complement(<740570..>741877)
                     /locus_tag="LMJF_25_1860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683893.1"
                     /db_xref="GeneID:5652667"
     CDS             complement(740570..741877)
                     /locus_tag="LMJF_25_1860"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683945.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652667"
                     /db_xref="InterPro:IPR007621"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9Q3"
                     /translation="MWRRCSTVAAVRLPCAGISGGGNTTAVAASSSPSSPLFNSRRHA
                     GFDLLSPLSKLGQSRDLAADLKAGRQRNNREIVASFEKMQTMDEIHYRKTQRPWELVP
                     RYAKKRVTDLVGILSSEDRMEIEQAIDKMQSLCKTDMYVVLVPTVGYTTPKAFASSIF
                     FDWAIGEPNGNGLLLVIAQREATVQLISGLSIEEYFDNNFLAPAVREVFQPLVRDGKP
                     SQATVQLVYAIARQAQEMHMRWEKGLLTLPTRNKVRFVGKTVRYGVKQVPYLVAGVLF
                     FTACTAWLVSQLLDTVCPKCHHLMSRVRDDATLQKLMTRGQYLELINGCAYYRVWKCP
                     HCADGHSVVLCSRDMHQNTKCLQCMDCQYYTCSLEKEVIKLPSKREDGLKKLTYSCAN
                     CHIGREVLLPLYRPLTMDTGKQWYDFLVEGSQTHQKTSGNLNL"
     gene            complement(<742625..>744205)
                     /locus_tag="LMJF_25_1870"
                     /db_xref="GeneID:5652668"
     mRNA            complement(<742625..>744205)
                     /locus_tag="LMJF_25_1870"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683894.1"
                     /db_xref="GeneID:5652668"
     CDS             complement(742625..744205)
                     /locus_tag="LMJF_25_1870"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683946.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652668"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9Q2"
                     /translation="MTDATRTLLIASPSPEEAVVILADDNESSLTNAREMVGGGVAAI
                     ACQLRRVMLSPLPLPACRGRCRDARRKRYAWQASRARMTCAQCQRRCSLMAMHAFPSL
                     PLYPPLHTRTHSTMTLLVDLKLASRTRARAHTHTQIYSSCTRVDWMEACVSTAAAPSL
                     VLVDMGAPLQECLRRLHAQTARVAATLAARQQDKLFGGTAAPSAAALLSEYRAVASDT
                     LDSSDEGTAQLRRRIAQKLQRLRKERHIDLCSPTAFPDDVEDLAAALPTMPAGAKSRN
                     EALGNHAKAPTRASPPPPLSDDVWVVQGGGEDEDDIFGWVTQRPNESPHPASERAESV
                     VTPSRAAATAVAGTTRVTAGEAHDDEGAVDALLSRIACCLGDVVECKCRHAATVEGVY
                     QQLITLQRYAESLLNMREGSVGGTADSLGARLRRLLAYQPSHTVASEEEQQVWQRAWA
                     AMGCNAAPALRVGASVELIDVAVLARANAQRYEALLRRWLVVRQAYEAHVGQLNQRMA
                     LAALQLDKMEAVPKLAQH"
     gene            complement(<746150..>746569)
                     /locus_tag="LMJF_25_1880"
                     /db_xref="GeneID:5652669"
     mRNA            complement(<746150..>746569)
                     /locus_tag="LMJF_25_1880"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683895.1"
                     /db_xref="GeneID:5652669"
     CDS             complement(746150..746569)
                     /locus_tag="LMJF_25_1880"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683947.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652669"
                     /db_xref="InterPro:IPR007262"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9Q1"
                     /translation="MSSLRQLIISAFFLVMGFLFLILGCTVVKKRNAWPLMSLAFYCF
                     APVPFFLCGRGADSDDFNDFDDEPLDAFSTVGLFMGGVLLISGPGLAVVLYHTSVICG
                     LALFFTLLSGVCFITAGVSLTVADRGNGDDAADGYNF"
     gene            complement(<747534..>748196)
                     /locus_tag="LMJF_25_1890"
                     /db_xref="GeneID:5652670"
     mRNA            complement(<747534..>748196)
                     /locus_tag="LMJF_25_1890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683896.1"
                     /db_xref="GeneID:5652670"
     CDS             complement(747534..748196)
                     /locus_tag="LMJF_25_1890"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683948.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652670"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9Q0"
                     /translation="MMGSLFVEKCTPQLYTQGAPQQHTTARMSSSVRDPPQATTCSTA
                     TPEHPVVELQPALRQRTITFCFPGPSSLLSTGAAAAAEVADDGNDESIRVVLHLSVRC
                     FVDYVLLFVTEEQTCAPGVLLRYDAPAIGPGAFMYDDETPSLDFAVLLGLRDHPLTNL
                     LASAIAHRIRRYGETRPLLMGLSVVQTAKKLNSSHAKKLFLDSAASNLLELAGEVQSP
                     SK"
     gene            complement(<748902..>750080)
                     /locus_tag="LMJF_25_1900"
                     /db_xref="GeneID:5652671"
     mRNA            complement(<748902..>750080)
                     /locus_tag="LMJF_25_1900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683897.1"
                     /db_xref="GeneID:5652671"
     CDS             complement(748902..750080)
                     /locus_tag="LMJF_25_1900"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683949.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652671"
                     /db_xref="InterPro:IPR007085"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9P9"
                     /translation="MFSPRTHAHTHTHNCKIPSSSRSSLIAAHGSLPRSLPRTSAAKR
                     IIASAPVRRNGMINMQKNVDAFYAENMPSEAQAQLSAHKDTLLAFLEGVARSYPDCPG
                     ITFITSGGTTVPLEVNAVRFITNFSSGGRGAHLVEALAERGWACLLLHHRTAIMPFRR
                     VLGTLSTEQLFAAVASPSAPSAPGTGSASTAGAESTPAAASKAELQRVAELYYRTKGL
                     VHYVAYDTVVEYIFLLEVISRTLCGTAVPQVLQQRPCLFFAAAAVSDYYVPLPNMSRE
                     KISGGDGLTLHLSNVPKALLLLREEWLHRAAPDATQPLVVTFKLETCEETMKRKAISN
                     LHAYRCDAVVANVLQSYKEWVLVYTKNGDDSAPVLVRRGEGKTIEAALCDLLISLLRP
                     "
     gene            complement(<750427..>751458)
                     /locus_tag="LMJF_25_1910"
                     /db_xref="GeneID:5652672"
     mRNA            complement(<750427..>751458)
                     /locus_tag="LMJF_25_1910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683898.1"
                     /db_xref="GeneID:5652672"
     CDS             complement(750427..751458)
                     /locus_tag="LMJF_25_1910"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683950.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652672"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9P8"
                     /translation="MTATASNRAQAVSALKLQRDRSATYQQWTLLFHRAITGDITATE
                     LQRNIQGIILPAFQRISTQLRTLQKALTETEQRQNGHLSPHSPTEAPAGPADNRQQTS
                     SALSMWIDRLQDLEREHYTVTLSLANQLVDHCTPNVCLESESESSTAVEAGKEEGDTP
                     ENRAGEPADIKSLFKPDSSDDEQYELVERRPNHIAHSPPAPSTAAASAPAPAPAAPTL
                     RVHDVERCILLRLIPPRYRTHLYFVTCRGAMDDLGGSSDHSANGDDVDGTEGSTSRVE
                     EELVALPSKGARRDGAPTLAHYAPSAVACRCAGWSSAVASIIHHQESLRAAIEDLCEE
                     LQGEISDDA"
     gene            complement(<752277..>753761)
                     /locus_tag="LMJF_25_1920"
                     /db_xref="GeneID:5652673"
     mRNA            complement(<752277..>753761)
                     /locus_tag="LMJF_25_1920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683899.1"
                     /db_xref="GeneID:5652673"
     CDS             complement(752277..753761)
                     /locus_tag="LMJF_25_1920"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683951.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652673"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9P7"
                     /translation="MQSASSRVPRKPAAASNLGKPSSSGRFTKPNRPQPTSSFSKTAQ
                     PDMTGRYGTSTALVASTAASHFTAGARGQSTPFVGLADRTGQEGSVFGLRAPQNDATG
                     AAAHTKTRQAARTKVVDDASTPVVVVGPERDSVPFRLCCEALAEGCVQTYMHLFELAH
                     RDPVCVDTLSRKFFNVPDDRLAWVQQQLSAVEVLRRQSEFEQVFTHCEQLANYFEKEG
                     DYAEAAWYHEMVLHYMMESLDRTLEQRARHVYATFQERQGHLEEAAALYDAMYRLAVA
                     LRDEATLQDASCCLVRVHQALGETLKFSDPAAAARHYATAAEAAVRSKNVVDEGSAYS
                     ALGDVSEARGDLPLALKYQRSCRAVAQQNDLKPQECRATLRVADLEERLGLKLEASTT
                     LHEALQLAKELGAPRQLCIATMQLGEAYRSRNQEGEALQCFDESFAAAVEAGDQELID
                     TVRIAMGFARGDYYLTHAYGGKGYLHLVYTDIRAQLAWMSGGTL"
     gene            complement(<754490..>755194)
                     /locus_tag="LMJF_25_1930"
                     /db_xref="GeneID:5652674"
     mRNA            complement(<754490..>755194)
                     /locus_tag="LMJF_25_1930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683900.1"
                     /db_xref="GeneID:5652674"
     CDS             complement(754490..755194)
                     /locus_tag="LMJF_25_1930"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683952.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652674"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9P6"
                     /translation="MAARLLEPRHSSAAGLMPTVLIISGFPWHTSELAVHRYLTDVYP
                     AAEPVTTRLYTNPTNGASRGHCFVEYNLPPSSAVLCTSAVAAATANSSNGTDVRAIAG
                     GSTAQESSSGGGGAVDAVDALLPPVLREVKRCVEEHPYECVYLKVHAYVLTSQRWSRA
                     GRLPELPTDPPAALWRGRAGALVGYGDEGFSVRAGRELGLPNTVTADGKLQLERLRKR
                     LRTTSARRASGHLSAE"
     gene            complement(<755726..>757717)
                     /locus_tag="LMJF_25_1940"
                     /db_xref="GeneID:5652675"
     mRNA            complement(<755726..>757717)
                     /locus_tag="LMJF_25_1940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683901.1"
                     /db_xref="GeneID:5652675"
     CDS             complement(755726..757717)
                     /locus_tag="LMJF_25_1940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683953.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652675"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9P5"
                     /translation="MNLQPFRIVQPLSRVLHRTLHQLLCEPQQTLPPAATDALITYSL
                     YEQVPHAELLKTLLDGLKRAQCGDAVLSSENLFLPLKAVRRALAGVQQFPLTTAELTT
                     LKRDVEVGVVRDITRLSTDDLSSADVGLLWGCATQCSQWDCVEELLRHFPLSRALNLQ
                     SASEYRDLLIGVCTPQFVSQAHARSTNGEDEGAAAPAEKGTAAPTVSHAEAFIQRVLG
                     VEMVWQRCREALEASSLPLLVSGGSLADSAALEERDMHAIACVMYAATLEMQCDMPAD
                     SALAFPFSAAEWAQYVGGGDGCATGSSGTQCVRPSTIGGLSLPVWYRRMVALHQRSVP
                     DFVRASFAAAVANDLLRLYQRIDTESLETFFLSFLPLVIAAAPRMDCRTALRGYHNDV
                     MSKLFGTMPSASSATSGGGDRAAATGRRGKRAANDASALAAPAPETAAASLALSADMA
                     MRVMLAEVCIQEAGKPLPEAHVPAMELMLRTVVNHLRRHLRCELRSRVVPQCSVTPAE
                     PPASLWKAWNSHRTSLLAIVLSEVQERMAGSAGQESASTVMDLAGQGLQLLRPLISME
                     VIDERGTARMVTNLLSSGRGAALEIGGAAYEAELQSFALKHVQDGFARTDVAAVVHAM
                     ERHMGQGSGNGGAGGDEKSHSTLEGLKAAELTLPLRSWS"
     gene            complement(<758553..>761741)
                     /locus_tag="LMJF_25_1950"
                     /db_xref="GeneID:5652676"
     mRNA            complement(<758553..>761741)
                     /locus_tag="LMJF_25_1950"
                     /product="putative kinesin"
                     /transcript_id="XM_001683902.1"
                     /db_xref="GeneID:5652676"
     CDS             complement(758553..761741)
                     /locus_tag="LMJF_25_1950"
                     /EC_number="3.6.4.4"
                     /codon_start=1
                     /product="putative kinesin"
                     /protein_id="XP_001683954.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652676"
                     /db_xref="GOA:Q4Q9P4"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9P4"
                     /translation="MSSSSIKVAVRCRPLFGQERPAGGLDIQNRRILLDSKTYDPDFT
                     FSPTSTQEDVFQACRPILQCVKEGMNGTIMVYGQTGTGKTYTMLGSEDGEQGLVHKVV
                     ANMLEHVQRKIADGAQCALTLSMIEIYNEHLTDMLSPNGEEEVTLISGFPRFTHKATL
                     CRVNDAIETIQRGLSWRHTAATLMNERSSRSHVVFIFDMEEYNAFTEQTEVAHLFMID
                     LAGSESLKKSQASGVAAGEAGKINKSLLALKSVFLALSNTNEATRPSHVPYRDSKLTE
                     LLQDSIGGTARTLMIACISSVGRDIEETKSTLLYAVKARSIRNAANTEKEKLLVRLRS
                     MEVENQKLRNRLQERVNERGGYYVTKEEHEQTQEMAESYDQLKEAVEQLMQDRQSSDA
                     RQHIWESQVKVLNALLVDKEAELQNFKEVYHEALKRFEHQAAALQRVIRGGVAEAKDA
                     VKTSFTDNYARLQAWRTELLNSLEEPVPTTLPPLPLSPACCPQNDAAAATAVANEEEV
                     MRQKADDSAFRCPLDAVAATSPERRSCTPPPSQALLSGGTQSLSQTAGSRGVAGPTPN
                     GSPSRTAVAAAAVSQHPSRVMAAAAPYSARGSTTSSLQRGSVTSGAPSASVSPTRRAG
                     RPRCGGGGTAASSGPRRCPVGNSNSTGALRGSGAPPLSSPPLPPTPLPATAVTDVPTK
                     DDSKEYCGSTLVTSVMDASAPLLVSRTTSSSMAPPAWSAVMAEYDAQCLRTVHRLNES
                     VDALLSECLKLFTDYKEHAERAELKRRRGVEEVCQRLRTELDSNLKQLQRVEAVGERD
                     VQEVRERFSDRLRLRTKMPSLADAAPFQLAVRDACAEVIRHASHVFPHPSTPADAEAA
                     LDVIVRNVQRCSATFTLQSLDPLSSSAVSAHAASVVACGTTTSSSSAASSPIVGRAVG
                     AWGGGGGSSSPQLASLVPMPSLTAPVPRESPAAAPLCSLTGSPSKEEVRESGSVSGHP
                     LQGSRATMHVSSSQQQQQQSARPSSLRGSATLTTMPVNFNRGGDGRRGGGGSNVPRPH
                     KRARSAAASSTSSGGGAPPSSRRTTATRRSGH"
     gene            complement(<762861..>763394)
                     /locus_tag="LMJF_25_1960"
                     /db_xref="GeneID:5652677"
     mRNA            complement(<762861..>763394)
                     /locus_tag="LMJF_25_1960"
                     /product="putative acylphosphatase"
                     /transcript_id="XM_001683903.1"
                     /db_xref="GeneID:5652677"
     CDS             complement(762861..763394)
                     /locus_tag="LMJF_25_1960"
                     /EC_number="3.6.1.7"
                     /codon_start=1
                     /product="putative acylphosphatase"
                     /protein_id="XP_001683955.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652677"
                     /db_xref="GOA:Q4Q9P3"
                     /db_xref="InterPro:IPR001792"
                     /db_xref="InterPro:IPR017968"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9P3"
                     /translation="MPPPTHTDFFSFLDSPITERSIAKGKAALLAHAYTNTRKLENRL
                     TPLTALSISTKEDAAAAVVNPMEASCYIYTYRIFVSGRVQGVFYRKYTALKATELGVT
                     GFVRNLPDGRVEILAEGTKEQISALETWCYRGSPKSQVTAVDVENCTEVVPPSGGAEA
                     MAKPPVHRTMNGFVVSR"
     gene            complement(<763851..>767045)
                     /locus_tag="LMJF_25_1970"
                     /db_xref="GeneID:5652678"
     mRNA            complement(<763851..>767045)
                     /locus_tag="LMJF_25_1970"
                     /product="putative kinesin"
                     /transcript_id="XM_001683904.1"
                     /db_xref="GeneID:5652678"
     CDS             complement(763851..767045)
                     /locus_tag="LMJF_25_1970"
                     /EC_number="3.6.4.4"
                     /codon_start=1
                     /product="putative kinesin"
                     /protein_id="XP_001683956.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652678"
                     /db_xref="GOA:Q4Q9P2"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9P2"
                     /translation="MHSQRPCAGYNARCEHDRSVLPSLMSQQDEFFTGSSPRTASVHS
                     EARPHLQERFPFATAASSLPEHSDGANLYSGAGATNTRGNFKVAVRVRPPLHRELHGY
                     RPFVDVVQIVPEHPNSITLCDALDTEDGRGAVYSRQSYTFDRVYAADATQEDVYELSA
                     RPAVLSVLEGYNATLMAYGQTGTGKTYTMEGFTNEEERGIVPRAVEDVFACIQERRRT
                     SEDTKFLVRASYMQIYNEVISDLLEPPATAFVASSSSSSGGASRSSSLAVRHTPQRGV
                     YVDGLSEWIVRTPEDVYGLIAKGTALRATSATKLSELSSRSHAIFTIVVEAMEGNEAN
                     PLSYRFGKLNIVDLAGSEKIRLAGVTGQRLEETKNINKSLHELGNVISALAAKSGAHG
                     RRVQRHIPFRNSALTSALRDSLGGNCKTTLIACISPALESYAESLSTLMFANRAKNIQ
                     NHAVVNEGMSQATLLRAYEQELQRLRQQLQERTEMGGGGANGLMSSTDTHLLLSELEE
                     DRRRAEADRQAALAALEKSSVAHQEEMRVRQELESRIRELEAIMREGGMEGNPRTSQE
                     YAERLLELDRERQAVEEDKEQVERYKHLLLKQRDIMLSLTTRLNDRDETILLLQEEVD
                     AYDQHVQTLEEELELLARQGNAGRRATSPPPSSTAMMVVNPQLVGNASEAQAAEYIYQ
                     RRVQSPSSEAGARAGTSPRYRSFLQPSRTVTAEALAVELVMLQGRKDAAAVAASGKDR
                     SGSVEGSLVDAAELTRILQQRADSILHAHYNAQVAQLRSTVAALTLQLRNSEDRAHIA
                     DKEARLLAHRLSSGQNGATIDAVQRELRAEWDSRRKAYVSTMDAVRDAVRADTAERVR
                     LGREIDRIRVEVQHLLETATSSAIASPDTSRRSAVSRVWQRLQEVEEEVRLHGILTQL
                     PDVLLDAEAVPSGNSSATSAADAERKLRDAQAREAALQKRIEEQQCCITQLEREMEGR
                     ANGRESSEASAADTAEVAALRRKLMVHEKDRHAIRTILEHRMKSKINRICELLQVTHV
                     DTADGKDGASKLSSEALSLQGLIHAAIKAMDADV"
     gene            complement(<768768..>773216)
                     /locus_tag="LMJF_25_1980"
                     /db_xref="GeneID:5652679"
     mRNA            complement(<768768..>773216)
                     /locus_tag="LMJF_25_1980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683905.1"
                     /db_xref="GeneID:5652679"
     CDS             complement(768768..773216)
                     /locus_tag="LMJF_25_1980"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683957.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652679"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9P1"
                     /translation="MLRLSVRSLQWQSPSRVSGWVATAASARIATATPTAVSNNQHTI
                     TTSALQSQDTTEFTRRASAMKKRWRGRGQYGFARAEAQRFLDSEVPKGNLGAWMEEGS
                     NAIALSQLLSFFEIQPEASLASLILNKLIRTAEDESTPLISRLQAALSLICTRPDENY
                     ERVFHVIAQALQQLHRIALDGSGNGSSTTNGVGGGGTGRVDNGTSPVSPAQMLPFDAV
                     GVCAKALQRCGKRTPPMLNEQLTAFAMALLQKTPATNLPYVQATLLRLYAWMVRAERS
                     EANQLLYILIEQTGEFARHDFSTLMVSCVRHHQLMHLPVELIQRLARVAFQYRNSFNG
                     RDGAAILGTLAKLVVSLTAGANGVTAADVVRAQDYFNALLEEMQQRVLRLFDVNDKLF
                     WRNSEDMSSCAFAYELGGHVRYHRVFQAYAAYVQHSVEGFEPPQLALATGILRRAQLL
                     TPHLATRLSERIEVVLGELRLAELSHICATFAALPSPRPGWWDEARAVALRLLLPDVS
                     GLVSMNLAIAFPEQPGFAETIDYAQITSRQLVDLLPLTLESAQFGEAVVAMLCQRLAS
                     QGERFAPDDLRLLLACGERPQLVQAAQEHLREAFAQPVWSTDTLYSLPLVIDASHPER
                     NLQRFSVAKALAAAKTASVGPAQFVSLAELLLSSFGDTDQAVREYIQAGGDDLVKEKG
                     VYGGTIVRYLSVVRRFPSMVPPTQWLHDYADMLETQMPGMDPDNLEDVLLSLRTLYED
                     VAKTPALQMVLSSLVRRFYEELADSEQTARITVLVVYLQNGMTLPLLTASSPTLQRVT
                     SKESQYTPEVRRALAMMPIPKALPAEERRGRFVLKHLEPAHRSSEAAMPLLDLNLGDP
                     FLDSLSIAEPAAKPPTQPPVVAEAPSAPSSAPATETAASAPETETVAAPPPPSPREEK
                     PMSYYAKFFSSSVGQIFVGRGDRSHEEKKPATPSEPAVPPREEESPKPEAPPQPRRTR
                     LHPSAHTSVAAAAAVPAAPVAEGVPSQPQPTQQQPSSPAATPVAVPVTTFTTAWGSMA
                     PPPAGPGWGFAAAATSQSTLATAEKQHSSAFSSLFGMPPIPSLAAAAPASAPKTKPAP
                     VAAPAASRPVRMGGMGGNNIFFNPRNPSASRGRPVMSHKAVITRPGLHGAAATTTGAA
                     VGRTPPAATASETVFNSAAAEGMRRVSVDTARTSHVSPLANAPVGPPIARNAAAAPTA
                     DAAAAAANRHERGNGMEKISGYNIGEGSTRGVVAAAGGSSAAPFSAGGQESRPALDWM
                     DAARRVGRVTRLPRSKTKTRTQHNLSAWLNTPSARLDSPAKEETGEAASEPPAAGRGR
                     QATVAEVVKGRRSKRDASKSATEAAAHDDAGGSHAKRGGGGRGRGRGGKAGAAGGKAA
                     KATKAAGCAHHHGRAAPTATQAKKKGGKAAAAGAALASSSKKGTAAKSAKAAASSKSS
                     GSAGNNGLTKRAASTTVAVKPAKKAVKAAAKKVTAAAAKKPAKGKK"
     gene            complement(<774788..>776518)
                     /locus_tag="LMJF_25_1990"
                     /db_xref="GeneID:5652680"
     mRNA            complement(<774788..>776518)
                     /locus_tag="LMJF_25_1990"
                     /product="putative protein kinase"
                     /transcript_id="XM_001683906.1"
                     /db_xref="GeneID:5652680"
     CDS             complement(774788..776518)
                     /locus_tag="LMJF_25_1990"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001683958.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.1990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.1990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652680"
                     /db_xref="GOA:Q4Q9P0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9P0"
                     /translation="MEAVVKLNRKLGVGGRGVVYEGFDHARGHFVAIKELAYMEPSVP
                     DEDDTELAAILSELACMREAQHTNLVEYYGARRCAIGIQIIMEYVSGGSLDYVLTRCG
                     PLRENVARAYTRDVLEALHYLHKTMHMCHRDVKPANILITPDGRCKLADFGVAKQVEV
                     TTPTLPVHAERGGQSMGKEEEGNFPRHRNGGRQGYLQTAVGTPWYMAPEVINGGVEDD
                     DEDDEGVELGNAFAVTIGGDANSSSFSEDWTSSGLAHTAPDASASPPPLYSSSNYYNP
                     LKSIVKKGRLGARSVGYTTSADIWSVGVTVYEMVTGTKPFGADLTNPSAVLFRIANCA
                     ASPPQLPADVHVSAELHSFLDLCFVYDKDLRATAAELLGHPWLGPVRKGGSSGCGSAS
                     ADEKPRCQLFNGKGHSRSDMRADEGEQVQRHPQPAARRTVFDGVPLLDSIDLPAYPAT
                     TAVSSPASPAVAECGGSGEGAHPAPDTSPGRARHSAHRLSCSGTHRSGSSVTRRSPTT
                     ISPPLSSVSIAEQAEASSRYAAVRQRIGHTRATNSAHTAASAAPLAVQSSAGSLFSTR
                     GEFVDFMSHP"
     gene            complement(<778143..>782153)
                     /locus_tag="LMJF_25_2000"
                     /db_xref="GeneID:5652681"
     mRNA            complement(<778143..>782153)
                     /locus_tag="LMJF_25_2000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683907.1"
                     /db_xref="GeneID:5652681"
     CDS             complement(778143..782153)
                     /locus_tag="LMJF_25_2000"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683959.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652681"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9N9"
                     /translation="MSRAEVPCSGSPAWYSRSAEQTARLLLSNAFRHDTWECAAARKQ
                     VRFHGGAVHTLRLRFRELTKQRIAASDIEAVNLALFDPARKMFLGATYQLEARDITRP
                     LAVQVAPTQLLVLEAVVHDTRPSAPLEEYRVTSWGFCSVEEMMSGTISVRLRPGSAHL
                     LLVEKSSWPAVSLPTAPSDVALTCDVAVDQDAALAQLMGELVPPGIFVSEDFTRATPM
                     PGTSLFQLCVRNIELSGSTEESALNLADPDADWSVAAVAHNGFQQLGKGSEVSLILEA
                     PSDGGRHSSSSITSSSSTRRPPAAPAANTVLLCSDLPLEIDRLPVHSATSLVLAIRRR
                     APGSRTFAVLGFCVLPLCMMPMQDRDIRVENLPALRGPFSCEDARLLMVDSTSPYGRL
                     PIAVTLTVEYHNTGRPARALSAGPVAAPAAVAAQQKEEITKDEVSSSSLTSSASPVIS
                     GARPGQVLSTADVPGNSVAVGPPSYAALPPPADGGDSAGIFKLLCTIMEELHKVREAQ
                     DMILQQTSGDGSSLAALSPALQERLNKGLADGGVDLIDLAPRPLAVSWRARKLMQDGA
                     QPIRHPLHGTLLDDTAPVVDELTSSLYGFRLEGITMDSALHMPADVCLFFSFGPLPYQ
                     QVGPLHVTSVEQTPTNESYKVYDDRREAGFVWCEPKAALQSSAMRKYKSLSNAVVYVH
                     LYNALSMFYLATASLPLATFRRPISATCAMIPMDVVLQRDLSMTEQVVPPKVFPVMRH
                     AGQLHLTIFCVGIGAAAGDRKSCAAALATVRPPENVQSRVITAKKLRHADRLSPAGSI
                     TLPSGINEAAAADSGASASPTAAAPLTPESKRGRGGCAGGAGTLHWQRAQYFKTQLRE
                     HQQRVGTAPQLPGVPDAHVQAAQEAAELEYRLRQLELERAAVKSRRIAEALLSRLTVE
                     HEVLVISWRPEVVRTSFANPFYCAMEYFVEVDPRDTDVCTVIDAANFVLGPREKTELS
                     LAIRLSITQATGGGGGSGANRQQQQEQQNITVRVYSETRELVCCIRVRATVVPPVVDR
                     RYEIFGAPGTEVSKRILSRTFSSASFPVTTGSAALLQRMRELCAFVATSGEKTSVSTN
                     VVLDPITQAYITAWEEATVTTEIPKEVGRQRIEYVTLFHDAAMSRLYETWELCIFACE
                     SFMTRDIYWGQTTALGLPAERTRDLYCSDTAVTVERRGASYVLRLHPRDVGTQRMLLH
                     TLQDDTLKKTLVTVSTVHPTPTYSQVIELSLAEVKGPVLRRLTFVNRGDREEVFQVHH
                     NYKFNLRVSPSKFTLAPSDTQFVRLQLDLLTLPPGQQEGRWPVWIFINDSEDKTVESY
                     HLQIVLRAHPIVSVEP"
     gene            complement(<784287..>785126)
                     /locus_tag="LMJF_25_2010"
                     /db_xref="GeneID:5652682"
     mRNA            complement(<784287..>785126)
                     /locus_tag="LMJF_25_2010"
                     /product="putative 2,4-dihydroxyhept-2-ene-1,7-dioic acid
                     aldolase"
                     /transcript_id="XM_001683908.1"
                     /db_xref="GeneID:5652682"
     CDS             complement(784287..785126)
                     /locus_tag="LMJF_25_2010"
                     /EC_number="4.1.2.-"
                     /codon_start=1
                     /product="putative 2,4-dihydroxyhept-2-ene-1,7-dioic acid
                     aldolase"
                     /protein_id="XP_001683960.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652682"
                     /db_xref="GOA:Q4Q9N8"
                     /db_xref="InterPro:IPR005000"
                     /db_xref="InterPro:IPR015813"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9N8"
                     /translation="MSAGGAEFKAEMRAGKPKFGIFLNSASPLLAGQFSHSGYDWLLI
                     DAQHSPVDPLTMAHMIAAIRTGHSKVMVRVASTQDRAGIQCALDNGADGVLIPYVNNA
                     QELQEAVSCCYYPTTGTRSVYQPQQCMNAKGLLGYVPESNKNVVVAFQVETAACIENL
                     EEIMAVKGIDIAFLGQNDLCMSMGLYDGRYVFPQMYFSPELQAATDKLITTAKKHDVI
                     LGLFLFGTDRVGEFLEKGFTFISIGSELHHAMVQAGTWVKALKDISAEKGKPWANQPS
                     ALV"
     gene            complement(<786368..>787279)
                     /locus_tag="LMJF_25_2020"
                     /db_xref="GeneID:5652683"
     mRNA            complement(<786368..>787279)
                     /locus_tag="LMJF_25_2020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683909.1"
                     /db_xref="GeneID:5652683"
     CDS             complement(786368..787279)
                     /locus_tag="LMJF_25_2020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683961.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652683"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9N7"
                     /translation="MQKTILQILREQDDASSSCVLALLKGNASFQCLSKSEGEDILKR
                     DNEDAEKLSDGIRIAIRKGIVSGKPDVSPVNKLNVVGLSAQEVTDKIVAALPSKNGNV
                     IILQGLSGTGKGTTVSKLKDALPKCVTWSNGNIFRSYTYLCNEVLAAQGKEITEESLT
                     DELLSSVEKRVTFVKCEDGMFHTMLDGTRRVADVQNTLLKTPLISSKVPTVAQQTQGE
                     VIRFGAGAVKQLSADGYNVILEGRSQTLDYISSPLRFELIIPDVEVLGQRRAAQRVMA
                     KALEMLDDSASDEEVSKVLVKAVETLQ"
     gene            complement(<788434..>789528)
                     /locus_tag="LMJF_25_2030"
                     /db_xref="GeneID:5652684"
     mRNA            complement(<788434..>789528)
                     /locus_tag="LMJF_25_2030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683910.1"
                     /db_xref="GeneID:5652684"
     CDS             complement(788434..789528)
                     /locus_tag="LMJF_25_2030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683962.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652684"
                     /db_xref="GOA:Q4Q9N6"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR011948"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9N6"
                     /translation="MDGERETNVTPTSFFRGVSDKLESRQQQQPSSSGRLAAASSSSI
                     NAMPASPYRGGGAGGGATPPSSATTTPTSTVTPVSTLITQVSQHAPSSLQQQRSAGGH
                     TGGYGDSSGTDGSGNAHTGPRVAGGGTGGSTGFRQRVHATELVERARYIRNQPKNTSP
                     IDASAHPSLLPEPLPAVRNKKCLILDVDETLVHSSYQNTGRYDVHLPITLDRDTHVNV
                     YVAFRPHLQRFLEAVAPLFEVVIFTASLSTYCDPLMDSIDKQHILGGLRLFREHCSVV
                     GTTYVKDLSLLGRNLEQVAIIDNSPIAYLFQQRNAIPITSWFDDSRDEELLRLIPVLE
                     ALAEADTVYDVLDNYNALLQLQQLHENSGE"
     gene            complement(<791588..>792736)
                     /locus_tag="LMJF_25_2040"
                     /db_xref="GeneID:5652685"
     mRNA            complement(<791588..>792736)
                     /locus_tag="LMJF_25_2040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683911.1"
                     /db_xref="GeneID:5652685"
     CDS             complement(791588..792736)
                     /locus_tag="LMJF_25_2040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683963.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652685"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9N5"
                     /translation="MQSIILNVLSDIFTVQRDTFLGRLMPWFACGIVAFVAFPWVMMV
                     LYGLYFGIFLRPKEQAAMSLSPLLTFLYFLTDEATPGFDQRLMRLFHPSLLEEKDGGS
                     VQRGLIRAMSRCLIDKFGKVTNIARDTVVLKREGNDVNCMALVDFEKAKQVRCQLSWK
                     RRPGVVKRYREETGRYPARSEKESFVLNGIGIAFPYTFQVTSFHIDPKKGDEFNILKY
                     VRLVDFDDFGELFVRRLFEKPPRAAVSMMVQPLKEKYSSDEALATLQDSVQKVVDACG
                     GLASSLGSLTVEQTSYKAIYAPVPEEAAPLPGEPQTVNEDGRKAPAIDGVDMEYLVEG
                     TTRNLEAYLRLTFSGLKALVTRYELRLLPVELAQVVMDHDTGKSIIVG"
     gene            complement(<794078..>797209)
                     /locus_tag="LMJF_25_2050"
                     /db_xref="GeneID:5652686"
     mRNA            complement(<794078..>797209)
                     /locus_tag="LMJF_25_2050"
                     /product="putative helicase-like protein"
                     /transcript_id="XM_001683912.1"
                     /db_xref="GeneID:5652686"
     CDS             complement(794078..797209)
                     /locus_tag="LMJF_25_2050"
                     /codon_start=1
                     /product="putative helicase-like protein"
                     /protein_id="XP_001683964.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652686"
                     /db_xref="GOA:Q4Q9N4"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9N4"
                     /translation="MNLDNYFAKFLQKSSGRSAKGGESEKATLSSAAGAGVPVTPATA
                     TSSKQFSEGGGHKPSQGGGQSPGDAAEAQVQPSCGSPNAAFDQCYQRQQQWDADATEA
                     MTVTALPESTHQRAPSLKRSREAAMTTSSSPAPSHSAMDAPAATRLLTCRAASEDDDD
                     ELALLLGSQKAKQVREADAMLEGVARAQQAPSPPLSSSSPGHASNGVVGTSSACAVGI
                     LAWQTSSSATRETIARYFQRQLEWELHHSADLFAAFEPFFKDRALDRIAANDALRPVL
                     HAAPLSITSETVGALPGCALRSYQVEGVQFLLSHFHRGMSAILGDDMGLGKTAQVSAF
                     LHTLKQLHNIDGPHLIVAPLSTLTSWTRELARWAPQLRVVKYHGERRTRAAISSGRHN
                     RHAVFVTTPALLHLDKRFFRKRAWVTVVVDEAHVLKAHDTAITSASRKLTACYRVAVT
                     GTPVHNNVQEVWSLMSFLYPWLMATYDPRARDPVRQAEECAKVLQYIMLRRTKADVEL
                     GIPPRVDEPLTKLVPTDIQLQLLSLLTAHALQESSTGHQLHGHLSHQRAVCNHPLALR
                     LLADKGRTHGSQGSVEKRMRAAGVPMDAAHLIDPSAKMRYLDTLLPQLKEQGHRCLIF
                     SNFTTTLDLLEAMCHLRGHSYERLDGSCNRVERELSILRYNHPASSCFLFLVTTTAGG
                     VGVTLTGADTVILFDAHFNPQLDRQAADRAHRIGQARTVHVYRLCLQGTIEEHIRDIA
                     ARKAYLGDFIVEGGQRHGARGCGRSANDGADAPCITADDIREMLQQLDEKQHAKQQTD
                     GSSVSSPTLLRPSDGAEGSTSSGSQAAADAMVKDLLRVVEKGLQGAAATAGIHGAGRG
                     LASPPKQTHSCFCCGGIMHPMEPLLHCMVCPKAYHAACIGERPPRPGEAVKRFWSCPR
                     HECFSCGKQQAADGAIFMCDACPRSFCFDCLDPRYLEMNASGAQLLHIRDTYAGMEEE
                     EVEPRRSCYYVTCLRCCGLLSSSSSSASEDTDEVDSDEDDVSDCDMATAVDSDGLASV
                     DGHGGAGVENGDN"
     gene            complement(<798269..>799375)
                     /locus_tag="LMJF_25_2060"
                     /db_xref="GeneID:5652687"
     mRNA            complement(<798269..>799375)
                     /locus_tag="LMJF_25_2060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683913.1"
                     /db_xref="GeneID:5652687"
     CDS             complement(798269..799375)
                     /locus_tag="LMJF_25_2060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683965.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652687"
                     /db_xref="GOA:Q4Q9N3"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9N3"
                     /translation="MGARHSVPLRPNGQPSAQALAQANDNVNSWGTPPDEAPEDEKDP
                     TELVLQSWAFCKAKPTPQKMYRSDTDERKRRQSVSWRKRASFIELDCGEDSFFVANNY
                     KVIGVADGVGGWRAEGVDPSLFANALMENAKLFAETHRGERDPEKILDAAYTKVVKDG
                     IVKVGSSTACVATLRKDDDGSHKLDVANLGDSGVMVVRNRSMYFRAHEKVHGFNAPFQ
                     LAVLPQPMVGRAFSDRVQDCVRESVPVQEGDVIVMGTDGLFDNRFNSQLAADAGWIGK
                     VEESPIAKIPLVGFFLSGILDEKIDYVDPYRVAQRIITDAYKTSVNPDTNSPWASMLR
                     QFGQTDAKGGKPDDITVLLSRVSTREELSNSTSW"
     gene            complement(<800092..>801723)
                     /locus_tag="LMJF_25_2070"
                     /db_xref="GeneID:5652688"
     mRNA            complement(<800092..>801723)
                     /locus_tag="LMJF_25_2070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683914.1"
                     /db_xref="GeneID:5652688"
     CDS             complement(800092..801723)
                     /locus_tag="LMJF_25_2070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683966.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652688"
                     /db_xref="GOA:Q4Q9N2"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR017941"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9N2"
                     /translation="MSASSAPDRVYVGKRLHFTNGSRQLVRCGTRNIAVVCNRNELYA
                     IDNACYHHGGPLLLGDIEEMGGHPCIVCPWHSYKIALDTGEGLYLGVELSPAGGTPKQ
                     VVRSKGCKQRVHKVEVDEADDVYVLVDLSGPTLESDTYASMELANRERPMSLPVDGGG
                     RGLRVPGIHSHAGVELRSGQVFQHMGSLAEAGGNTGTRGANSLDHAQKTRPHEITSRG
                     SSCSSPTTRLMVSCVAITDVCPQVRQFDFVHHAGPLLRHAELGEYVELELPIKERRTA
                     NGGGGQAVDLLSSSSAPAATAGEPMRRRWTICDMNHNSTLFSIIVKAAGTDTQASGSA
                     WLHEHSLSVPLPITRVGGTFTFARHRDTIRRVGGRVLWLTAGVGMTPAYAFLNASLGN
                     SLYVASAEPLHVVHLHSNRTLETVPKLEQFGRWQREFPRSALDTAEKTSGGSGARKPG
                     KTYVMELFIALSTDAGQGQRTSPGSSPPDSCPVATITHRSRLQPANVSAAVQKYFGAD
                     MQLAYVCGPQKFVKDCTEALVSTGVPESHILTDDP"
     gene            complement(<803194..>805857)
                     /locus_tag="LMJF_25_2080"
                     /db_xref="GeneID:5652689"
     mRNA            complement(<803194..>805857)
                     /locus_tag="LMJF_25_2080"
                     /product="elongation factor 2-like protein"
                     /transcript_id="XM_001683915.1"
                     /db_xref="GeneID:5652689"
     CDS             complement(803194..805857)
                     /locus_tag="LMJF_25_2080"
                     /codon_start=1
                     /product="elongation factor 2-like protein"
                     /protein_id="XP_001683967.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652689"
                     /db_xref="GOA:Q4Q9N1"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR005517"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9N1"
                     /translation="MSVRMADAVQKLSEKPENIRNFCMVAHVDHGKTTLSDYLVASNG
                     ILSPQLAGEVRLLDSRPDEQERCITMKASSIALHHAYAGKTHVLNLVDSPGHIDFSCE
                     VSTAMRLCDGAVVIVDVVDGVTQQTSSILRQTYQEGLSMCLVLNKIDLLVTTQQYTAE
                     EAYLRLRSIIEICNAILASYANQMKIQELDQDMKREDPSDDVWFDPSKGNVLFCSCYD
                     GWAVSVDFFVRLYKDKVPLHNLAEALWGEHYLDPKTKTVTPKPKKAGQLPLAVQLMLE
                     PIWQLYDAFLGDSASEERQKQLSEKLKIAESKWNNPRRDPRGKLKALLSVWMPLAPCV
                     LDTVCSRLGSPVTLQRRRLPSLVPGFEADTPAELKEALMNCDQSPEAPCIVYICKLID
                     TQYLVGRVVGSVENHDGAFIGFGRVYSGRLRAGQPVYVHSDGVVVEATVGSVYLFRGA
                     GLEETSEVSAGFLCGVGGLTPCITKYATISSVPNMPPFKPLVLQSTSIVRLSVFPKDP
                     RSLQELERGLRLLYKVDPQVEVSMLPTGEHVIGTAGEVHAERCLKDLIDTFAQVEVVA
                     SEPLVSFRETIVSNLSAKPKPHTASLMDGAFHVTLQARPLPAEVLELIKDDGKNSGNN
                     PQLLRQAVAALAEHRRFSADVKNGVVSSGPSRLGFLGAVLLANFDGTADPVACWATLQ
                     DWKESVVAGFQAACESGPMAQEPLYGVAFVVTNIFVDADSDISGGMVLPSVREACRAA
                     MKLHPRRLVEPVYECTVYSSGFTQGKIYASLSRRRSEIVEEVPNEGSDLFYIRCWLPA
                     VEAFGLQDELRVQTQGASTAQLQMSHWEVIDADPYFVPTTKEEFEEHGAEVATKNIAE
                     QLLERIMRRKGLYRERVVENAEKQKFSLKGA"
     gene            complement(<807063..>807533)
                     /locus_tag="LMJF_25_2090"
                     /db_xref="GeneID:5652690"
     mRNA            complement(<807063..>807533)
                     /locus_tag="LMJF_25_2090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683916.1"
                     /db_xref="GeneID:5652690"
     CDS             complement(807063..807533)
                     /locus_tag="LMJF_25_2090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683968.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652690"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9N0"
                     /translation="MMRKTSVCAIAATRRALVGNGPTFHTGGDNNNISDIQNAFPMNE
                     RGIRSSSPFPEPNTAIYDSYMPWTYFQPIDVKVDKMPAPEAKYYQHHTKKPWDVSTTD
                     LIEIQSRKKYVQGVGYFVMLIYLYFLMPKEKSYSGETGSDGFFVMLPKNQPEKF"
     gene            complement(<808379..>809260)
                     /locus_tag="LMJF_25_2095"
                     /db_xref="GeneID:5652691"
     mRNA            complement(<808379..>809260)
                     /locus_tag="LMJF_25_2095"
                     /product="putative RNA triphosphatase"
                     /transcript_id="XM_001683917.1"
                     /db_xref="GeneID:5652691"
     CDS             complement(808379..809260)
                     /locus_tag="LMJF_25_2095"
                     /EC_number="3.6.1.15"
                     /codon_start=1
                     /product="putative RNA triphosphatase"
                     /protein_id="XP_001683969.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2095"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2095"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652691"
                     /db_xref="GOA:Q4Q9M9"
                     /db_xref="InterPro:IPR004206"
                     /db_xref="InterPro:IPR023577"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9M9"
                     /translation="MSAPRTPSPLEAANVPASATPTAPATAAEAASRSPGDGEASPDP
                     HPLLEVAASLLARLKPFLSESHIEVEARLCNLGQPQKRARESTQKAPVGATPTSIPSR
                     DAPRIVKDGHLRIQVGVSAEDFSRMKAHVAEEAEALPFQQSVTEDVITKTGRYTYAVA
                     EDGSESFVGCIAKRRLCNVEVLVPGCPYDIRVSISTEVPSAATSAPAVKPQGYVRRKR
                     RWTATSGSFEYAFTRVGADDQQCPNFEVEIEGVHANSQTGVTEAWLADLLCRLLALAR
                     LKGNTGLPQKRAHGEHQ"
     gene            complement(<809945..>811006)
                     /locus_tag="LMJF_25_2100"
                     /db_xref="GeneID:5652692"
     mRNA            complement(<809945..>811006)
                     /locus_tag="LMJF_25_2100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683918.1"
                     /db_xref="GeneID:5652692"
     CDS             complement(809945..811006)
                     /locus_tag="LMJF_25_2100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683970.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652692"
                     /db_xref="GOA:Q4Q9M8"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9M8"
                     /translation="MRRPPVSQWHRLVLEGCTCMSDEAEFKRAGALFSAGKYHEAISA
                     YSAIEALDGAAAEVRARALNNISACYAALKNYEMSSKVAREVIGLQPDNAKAHGRVAA
                     AEEGLKHYSEASLYYSAARRLDANSSTYVEGARRCHALVQAGRGVASAEAKDAYYYEK
                     SLERAMEAMQKTSYLEAIRHFGKALDLFPSTGTSREKATLLSNRSAAYFRAERIEESA
                     DDALEAIKADDTYARGFYRLGAAKAKLKKVGDAYDALTKCVKLDPKHVDAARLLAEVL
                     PAALESRKTAEERARDHTRQVTHMTERLSEMQATASSNAVPRATAHGSAYSYCNFCNE
                     TGHSRSECSLLRRKRSRPL"
     gene            complement(<812200..>814005)
                     /locus_tag="LMJF_25_2110"
                     /db_xref="GeneID:5652693"
     mRNA            complement(<812200..>814005)
                     /locus_tag="LMJF_25_2110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683919.1"
                     /db_xref="GeneID:5652693"
     CDS             complement(812200..814005)
                     /locus_tag="LMJF_25_2110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683971.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652693"
                     /db_xref="InterPro:IPR022083"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9M7"
                     /translation="MDELNFHAAFEAIKILSASEGPASNIFEPKFEARHQAEQLRDTI
                     VNVYRDEPSSRALEQLCRCLVFIGTTMMEVEEEEEGYTEICRAYQVMQWCVTAALPST
                     DAVRNVQAVEQDAILNTTSAVCTVAASSGYAGCVGYMAVHNALGFYFSKADLGKAKTV
                     LDRAEALYNEWAAWWEGQPVHCDIAEVPVSEDGTLRTDEISADRVAPILLRFYMDSSY
                     TATLFFMAQLHTAQQNAATASQYCHRTLHFQLLNKQEFNRKSWATNALQLSGFYSSHF
                     AYDKAFHCLVAGQKLMPVSEEPEEAKGLVAWAFGRFYLHRLHHYGQLLTGREPDSEND
                     DMLAQLQKSWRDFPGMPPLQPQPPITTFDEARECFKEGIKWLQAAQACRPFESFCTER
                     IDVARDMVQLYAALQLFEPNRARRIAMMQRQTRLLEEFPDQLSFNAYPVVVRQLLYDL
                     GSLYEDQMRLRAQQRKQPQPDEKPLTDNAFNAVVRKTLGYYERFCETWRHPTTHVIPD
                     VLEEDSRLPFFRALMRRAQVQLSYAYCTPKEEYDGIGASCKAYSRAIDFYAKNPLSKE
                     LDAEVSKEVELAHEMLKLLPVKQRDLWTAYQRNSA"
     gene            complement(<815258..>815893)
                     /locus_tag="LMJF_25_2120"
                     /db_xref="GeneID:5652694"
     mRNA            complement(<815258..>815893)
                     /locus_tag="LMJF_25_2120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683920.1"
                     /db_xref="GeneID:5652694"
     CDS             complement(815258..815893)
                     /locus_tag="LMJF_25_2120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683972.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652694"
                     /db_xref="GOA:Q4Q9M6"
                     /db_xref="InterPro:IPR013906"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9M6"
                     /translation="MDDYHDDDVHSNYGYEDDEYDDAADDWEAEAAEEEQRAVAEEAA
                     RQARLEKKLATRAPVKKEEEEEAVPEDVERAMADMRQVANDIASGSALLSGGDSEELI
                     GNHKLASDADVERVGTMIADRLTSFSDSGHYDKLIVEVFQRLTNHLTSTHLLNEEADR
                     VHRLREELKRAAKAKLKPVEKAPVTQSGLDLDNFEDRGGAAVADNEDETGW"
     gene            complement(<816850..>817749)
                     /locus_tag="LMJF_25_2130"
                     /db_xref="GeneID:5652695"
     mRNA            complement(<816850..>817749)
                     /locus_tag="LMJF_25_2130"
                     /product="putative succinyl-CoA synthetase alpha subunit"
                     /transcript_id="XM_001683921.1"
                     /db_xref="GeneID:5652695"
     CDS             complement(816850..817749)
                     /locus_tag="LMJF_25_2130"
                     /EC_number="6.2.1.4"
                     /codon_start=1
                     /product="putative succinyl-CoA synthetase alpha subunit"
                     /protein_id="XP_001683973.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2130"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652695"
                     /db_xref="GOA:Q4Q9M4"
                     /db_xref="InterPro:IPR003781"
                     /db_xref="InterPro:IPR005810"
                     /db_xref="InterPro:IPR005811"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR016102"
                     /db_xref="InterPro:IPR017440"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9M4"
                     /translation="MFARSAIRRWVNKDTKVIVQGMTGKAGTFHTKEAMAYGTKVVGG
                     VSPKKAGTTALGVPVFATAAEAVKATGATASVLYVPAPLCAASIEEALDAELPLVVVI
                     TEGIPQWDMLRVKSMLLSQNKTRLIGPNCPGIIKPAECKIGIMPGHIHQKGKIGIVSR
                     SGTLTYEAVAQTTAEGLGQSLCVGIGGDPFNGTNMVDCLRLFLNDPETEGIILIGEIG
                     GTAEEEAADFIKNSPIKKPIVSFIGGATAPPGRRMGHAGAIVSGGMGTAKGKKDALRA
                     AGVTISDSPAHLGKHMAELFATK"
     gene            complement(<820490..>821389)
                     /locus_tag="LMJF_25_2140"
                     /db_xref="GeneID:5652696"
     mRNA            complement(<820490..>821389)
                     /locus_tag="LMJF_25_2140"
                     /product="putative succinyl-CoA synthetase alpha subunit"
                     /transcript_id="XM_001683922.1"
                     /db_xref="GeneID:5652696"
     CDS             complement(820490..821389)
                     /locus_tag="LMJF_25_2140"
                     /EC_number="6.2.1.4"
                     /codon_start=1
                     /product="putative succinyl-CoA synthetase alpha subunit"
                     /protein_id="XP_001683974.1"
                     /db_xref="GeneID:5652696"
                     /db_xref="GOA:Q4Q9M4"
                     /db_xref="InterPro:IPR003781"
                     /db_xref="InterPro:IPR005810"
                     /db_xref="InterPro:IPR005811"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR016102"
                     /db_xref="InterPro:IPR017440"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9M4"
                     /translation="MFARSAIRRWVNKDTKVIVQGMTGKAGTFHTKEAMAYGTKVVGG
                     VSPKKAGTTALGVPVFATAAEAVKATGATASVLYVPAPLCAASIEEALDAELPLVVVI
                     TEGIPQWDMLRVKSMLLSQNKTRLIGPNCPGIIKPAECKIGIMPGHIHQKGKIGIVSR
                     SGTLTYEAVAQTTAEGLGQSLCVGIGGDPFNGTNMVDCLRLFLNDPETEGIILIGEIG
                     GTAEEEAADFIKNSPIKKPIVSFIGGATAPPGRRMGHAGAIVSGGMGTAKGKKDALRA
                     AGVTISDSPAHLGKHMAELFATK"
     gene            complement(<822704..>823918)
                     /locus_tag="LMJF_25_2150"
                     /db_xref="GeneID:5652697"
     mRNA            complement(<822704..>823918)
                     /locus_tag="LMJF_25_2150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683923.1"
                     /db_xref="GeneID:5652697"
     CDS             complement(822704..823918)
                     /locus_tag="LMJF_25_2150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683975.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652697"
                     /db_xref="InterPro:IPR004328"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9M3"
                     /translation="MFNSDALKYALPIIPVRQTEKPGLNSQVEVDLPSAEMKDIGKKR
                     DACIDFFEDFRKHLSRKGNSVDDKLSTSAGCEKYVKDLVDRVDAYTVSLANTVSKAPK
                     FASVQYYHWSSSLTDKQEMAFDDYRYELLGVYYNVGAILMNIAQYLLCVRATVGTLSF
                     LEKDAYRVLIKASAYFHFCADIVDNMKRHEISVAQVSVPLDVDKEMAVFLESLALAQA
                     QEIGVSKAFNVDPKEITETTARLSHQLFLMYEAVCTNARTINTRNEIFAEISTLAVVK
                     RDIFYALAFQHAASHLFNKNPAAGITLLSQGVEHARIVEEYFIKSRNGKLKLPFNGTR
                     FVGLCNTTVRNNTERLNKINSLVHRAKPDATKASLPPPQPLAMRPDISLPFRLEESPS
                     VCTVALLSRSAQ"
     gene            complement(<824406..>825161)
                     /locus_tag="LMJF_25_2155"
                     /db_xref="GeneID:5652698"
     mRNA            complement(<824406..>825161)
                     /locus_tag="LMJF_25_2155"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683924.1"
                     /db_xref="GeneID:5652698"
     CDS             complement(824406..825161)
                     /locus_tag="LMJF_25_2155"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683976.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2155"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2155"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652698"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9M2"
                     /translation="MDVDQHIVATISEIDRTLRSIGIRDDYASTLTQPSIINSPPPLL
                     TTAVVRANGAVQTSRSTCVNAGVQKSLSTVSQGVQNSPQQRATSSQTEKGADAQECFD
                     RVTCSVLCTNAMLEEGLQALENSSDKMEALFSKLTRLEGSVNTAAKSLRLLRNRWAIQ
                     IIEKEEASARSALLSYESSAHTEFMSLRCGELMSLVAASRKERVLSKASDGLKRLAPT
                     RVIANGSVVEETPSSSLNDLTELLDECWRVLDE"
     gene            complement(<825651..>826361)
                     /locus_tag="LMJF_25_2160"
                     /db_xref="GeneID:5652699"
     mRNA            complement(<825651..>826361)
                     /locus_tag="LMJF_25_2160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683925.1"
                     /db_xref="GeneID:5652699"
     CDS             complement(825651..826361)
                     /locus_tag="LMJF_25_2160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683977.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652699"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9M1"
                     /translation="MRRSLALCLHSTGACLLSAGKLSQYEQEAYESHRRFTESQTYPG
                     PIRAATPGDTRFYMGSAETILQENERHYWRAVVDDPHVQHLVPLRVRFKTFIWVTSGW
                     EQRVQVVQVMAQRDSTIAELMQQVRIENQSPYLCTSSFKLCIDGKDLDELKTLADYGI
                     HEYSRIDAIEENDHLLHTEAERLKDWNVAEMPEDVLLRSPYKEMAMQPQPNLAPRYEA
                     KPKGYYGKNDYSGMKQSS"
     gene            <827724..>829061
                     /locus_tag="LMJF_25_2170"
                     /db_xref="GeneID:5652700"
     mRNA            <827724..>829061
                     /locus_tag="LMJF_25_2170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683926.1"
                     /db_xref="GeneID:5652700"
     CDS             827724..829061
                     /locus_tag="LMJF_25_2170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683978.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652700"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9M0"
                     /translation="MINFIQPGGGSSTKSISVTIPSDGELIITVPSNEPKCSASIKLE
                     PSTGATDSRVDVAGSPLVTDISYYLLPGVTLNVFAWTTSVVRIEGSEQLLRGVIRSST
                     KSITRPLVEYHFILHTQRVAAEKTQCGGPVTLICGGQLTGKIMVARTLANYAARAGWK
                     PILVDLDPGVQQTVGLPGSIGAAILDYPLPLDEVMALSLVSTTYFVGTTEVESFSKLG
                     EAVVGAAYVHFSKLLLTCVRERLSTHANDLHGFSGAIIAVPEVHGSSGINFVSELIQQ
                     YDITNVLCLGDDDLFHTLYLRHDRGNTAQPDYVKIDRISHNFSIVPPANADSVMPSRY
                     SAYFLGSGVVDLHPSQWSKPFNSIDVLVLKEEQGQVVLSPVPKEELQGIVGCIGALYS
                     SKSGNALQLSPMAYARVQTIDPTGIYFLTSTHFTFPSEKLTLLVGTVRWITST"
     gene            <829454..>831247
                     /locus_tag="LMJF_25_2180"
                     /db_xref="GeneID:5652701"
     mRNA            <829454..>831247
                     /locus_tag="LMJF_25_2180"
                     /product="putative vacuolar protein sorting-associated
                     protein 33"
                     /transcript_id="XM_001683927.1"
                     /db_xref="GeneID:5652701"
     CDS             829454..831247
                     /locus_tag="LMJF_25_2180"
                     /codon_start=1
                     /product="putative vacuolar protein sorting-associated
                     protein 33"
                     /protein_id="XP_001683979.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652701"
                     /db_xref="GOA:Q4Q9L9"
                     /db_xref="InterPro:IPR001619"
                     /db_xref="InterPro:IPR027121"
                     /db_xref="InterPro:IPR027482"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9L9"
                     /translation="MTLPNDTSPLAEGLNQVPKQEFLSALSRVYEGHGTAIVFIEQHI
                     LSALSRLGIATRDFGRDKGVVGVFPFQNDINYVSADNVVYILNPDLSSMRSLVVHLLS
                     YTQRFASAKPTILYVPQKTLIAEQVMEDEFKLSHTFPSLRIASLDLDYVFLEEKFFTM
                     TLPLSFKSVFADGDLSNLTWIARLLLKLQTARFGAIRHIRGKGSNAAKVIQLLQRMQN
                     NISHDFITDIPSEVETLIIIDRSVDFVTPLMTQLTYEGLIDELYDIENCEVQFPFSLG
                     ESSGVGASEKVVLNSTDRMFAEIRDRSFTGVGSVLYQKSIWVKQNYDKRKEVQQLKEL
                     KEFMKGLPEMQEMHRLIGIHTNVATEISKTTQRTDFRKRIMFEHNIIQQTNEGDVLRY
                     IEDLVFRKEKFEVVLRLLALLSLVNSGLREKDLLGLKENMMLVYGIPHVITAFFMLER
                     CGLLCAQSGKGSSYSTIRKQLRTWNSSVPEGQPNDIAYAYGGYAPPFVRMVDTLLRNP
                     QAWDAEDDAPSLLPGEKKELMNDVEIAGTTKTAIVFVIGGITASEVSALRFVEERLSS
                     GGRPHRIFIGTTDIISGNRMIRSLLPFEPAR"
     gene            <831600..>832733
                     /locus_tag="LMJF_25_2190"
                     /db_xref="GeneID:5652702"
     mRNA            <831600..>832733
                     /locus_tag="LMJF_25_2190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683928.1"
                     /db_xref="GeneID:5652702"
     CDS             831600..832733
                     /locus_tag="LMJF_25_2190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683980.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652702"
                     /db_xref="GOA:Q4Q9L8"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="InterPro:IPR022755"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9L8"
                     /translation="MGEGRIRCYYEVLEVERKATYDEIRTAYKKKSLQYHPDKNYGNQ
                     EEAAMRFKEVQNAYSILSDADERAWYDSHREAILRGGDGTGDLDELNLYEYFTAGCFD
                     GFDDGESGFYTVYRKVFDILIEEESDYDSRAKLWPGFGTSTSDWADVQKFYGYWRNFS
                     TYKTFTWKDEYKVNEMEDRYSRRMAGRINSKARDGAKKEYVRTVQSLAQFVYRRDPRV
                     KAELERQEKEDQAKREERERQEIERLKRRREANERVWAEAAEREAREEAERAARGEAM
                     DGSILEMLYEKERQTKEMMRGSGGVGAHTAGFAMLGGDDDEAVTVFNCPACKKQFKSE
                     NQYKEHVRSNKHKTKLKQLAAKGTDVAALMGEKVEGGSGGTEE"
     gene            <833575..>834507
                     /locus_tag="LMJF_25_2200"
                     /db_xref="GeneID:5652703"
     mRNA            <833575..>834507
                     /locus_tag="LMJF_25_2200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683929.1"
                     /db_xref="GeneID:5652703"
     CDS             833575..834507
                     /locus_tag="LMJF_25_2200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683981.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652703"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR019399"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9L7"
                     /translation="MSSYEIQPIVKGTKRDPSLRKYNKAAGAGPFGAAPASLRTKKSA
                     LAQSAAAPPGEAVDANTAVNAVRFPYTGTKRGYGGASSSLRKGRPRDAPDAAFSEKGC
                     GKSAPPKAGAFKKRLIPPTEFRRAYDRGDLPISICHGSRPTVDWKVEVEKLDYHHYLP
                     IFFDGIRETEEPYMFLARQGCLDLLERGGPKILPTIPQLIIPIKTALNTRHPDIICAT
                     LRILQQLVVSDDLIGEALVPYYRQILPVLNLFKNVHKRRSRSDAMDYGQRSRDDVGDL
                     VNETLQLLEQHGGEDAYINIKYMVPSYESCIYNN"
     gene            <836154..>837467
                     /locus_tag="LMJF_25_2210"
                     /db_xref="GeneID:5652704"
     mRNA            <836154..>837467
                     /locus_tag="LMJF_25_2210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683930.1"
                     /db_xref="GeneID:5652704"
     CDS             836154..837467
                     /locus_tag="LMJF_25_2210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683982.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652704"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9L6"
                     /translation="MEDDYYYDDDGGYGDYYDNGTDEVVDVNPLELKYVDGKSFMQSN
                     MEESLRCLQEVVAEDSEHGRWTFKALKMLARACRVAKLYDAMADYYTQVVHFIHPDIG
                     AAAIAKAMLKFTEESQRVPAEWRGRTLHVTLEVATAQPESYRDVIVPTLLRRATLFLE
                     EAKYEEALVDLQAALQQCDESIATTAQINANSVYHIRTLQLTAYRKLNRYAELRRAYY
                     ELGRVNAALPSLRMIGSAMESAGHLFLHDADWAAAHRAFSSALRCHTESGDAQQYNVV
                     KYVVLATIMAGLPVDVFAQEETLANHPSVRPVRALWKASVTLDISTFLQVLHAPESAA
                     CFAKDAEFALYVEPMIFQLRTNYLISYSKSFGTLSLPELGARLQLEEQPCKELCTGAI
                     LLGLINARIDDARKLLLFQRASRAMPRSVAVLRDLSDLTSELCCK"
     gene            <838335..>840251
                     /locus_tag="LMJF_25_2220"
                     /db_xref="GeneID:5652705"
     mRNA            <838335..>840251
                     /locus_tag="LMJF_25_2220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683931.1"
                     /db_xref="GeneID:5652705"
     CDS             838335..840251
                     /locus_tag="LMJF_25_2220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683983.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652705"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9L5"
                     /translation="MPRQPTKNRINMHDIVEQPLSAIPDAVDAVLRRPEPLDELEVQS
                     IFFESSYILLRAEEALSAKDGNAFCALFKIFSEGFAHSESSFEKGIRTMVQNESLLQT
                     MQAIFKVVVEQEALPLHSAGTVELIQVLSSLCDGAALKDKCGAVFMRGFAKVLQRVYS
                     NTEEARRHFHVQRGTTTALINLVKGSKQNKQRLASWKFVADCCAASVDVFFQLQCVEL
                     LFRVSRQNKDVFSHLGGSLPPATIEELRALPNDGTLLSRMTLLIEHLNEGRAQVLRYP
                     LKEVVAAETTLTSSTNAYFTPNYVIVMVTAANADNITIPYRIIRSITLGRDGRVIVRL
                     EEFPVKLELLLSHTAGMDTVIFYMAQEELATFKQSPVRQWIVEALQVRKEEQRHHRPP
                     QAPRSPDSMAKPAEKTEPAAHESLSSTTPAASSHEVSDDMVAARKKARLEGGAASAAA
                     AVPYTNQPPIAAFLHVVDALVEQAATPNEAQAMLLQLRRLMEARKEMQRGKGMDDLSD
                     AMRHIQNRVDETRRTAEESRTAWHQTMWEELERVESVVVGAQDKAAAGVEQLNDHLKK
                     VKTSNQAINERIACMDIELQQTLEELREEELRWTNEIYTKCMREAERLEFEVDQHLVN
                     RSRPMTVLSDYMRQ"
     gene            <841269..>842261
                     /gene="PEX2"
                     /locus_tag="LMJF_25_2230"
                     /db_xref="GeneID:5652706"
     mRNA            <841269..>842261
                     /gene="PEX2"
                     /locus_tag="LMJF_25_2230"
                     /product="glycosome import protein"
                     /transcript_id="XM_001683932.1"
                     /db_xref="GeneID:5652706"
     CDS             841269..842261
                     /gene="PEX2"
                     /locus_tag="LMJF_25_2230"
                     /codon_start=1
                     /product="glycosome import protein"
                     /protein_id="XP_001683984.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652706"
                     /db_xref="GOA:Q4Q9L4"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR006845"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9L4"
                     /translation="MAWLGDAVDAQYTIDTVSKQQALLPSSTAFSIFPKDHVLRIFQL
                     DSVVLQHELAEILQTALFHVLDIPPLQHFRFAYQEELVLVLDALLYRLSVWRMGQSIG
                     DRLQNLVLRDEERARLLSLQNTKSILPSLAPSRRLLLVHAIMTLVVPYVTRKVQRKVL
                     EEGWEREPVPTARYRIAKALRYAVVTWSLLSLANTFNFLMTGRYRTLVERILSLRLVY
                     GSQRMMRFTNLLYMNQHVQWQTWMSLFSALSLGRYFRRLMKSFGSVASSSALLSMNEN
                     LCSACHELPTVCQRSNCGHRYCYYCIKSRLLDSQSTGSFRCIKCGQAVHSCTPA"
     gene            <842635..>843615
                     /locus_tag="LMJF_25_2235"
                     /db_xref="GeneID:5652707"
     mRNA            <842635..>843615
                     /locus_tag="LMJF_25_2235"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683933.1"
                     /db_xref="GeneID:5652707"
     CDS             842635..843615
                     /locus_tag="LMJF_25_2235"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683985.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2235"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2235"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652707"
                     /db_xref="GOA:Q4Q9L3"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9L3"
                     /translation="MWCGTPVEAAVLPGEVAHLYSRARQGGILFHLGEDVPTPPPQIS
                     SSSFLCLSTCVYACVWLSSKQVWPSELYPRLLRPRALSLLIPSPLLLLLISLPPFSAS
                     LLLRASVRAAASIWRRLLPLASHSRTRACTVHASMHVCTSVRCFGVLGRSAETRMDPA
                     LAVMSPFQNEARGIDGMLEDAVEEITRPSSMGATSSNNRTSGAADGVSVEPPALAALP
                     LTQCSFCAQSTTTRAVPKDGMYVCTNCLAEQGSRPRLFPLGTFKCCPTSTEAMDGDVV
                     RCAGCYRWYHVHCVGITDSVLRNYATLSTTSWYCPEPACCDRVLRRHLKK"
     gene            <844338..>845936
                     /locus_tag="LMJF_25_2240"
                     /db_xref="GeneID:5652708"
     mRNA            <844338..>845936
                     /locus_tag="LMJF_25_2240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683934.1"
                     /db_xref="GeneID:5652708"
     CDS             844338..845936
                     /locus_tag="LMJF_25_2240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683986.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652708"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9L2"
                     /translation="MDPTNIMCDFFHGDAASPRYQSSAKSTFMPLLQTWVMPERLENS
                     TATFLDALLYTDDSGTAVAQMWLQIDPDDSHGLGGAQLLSFLVAACRAPLACPSQADV
                     PIISGAAVLADDATSAVRQFHLVYPCVSGTNALLREVVHSWDGARLSVTRKRALLRVT
                     GATAPYTATAVVNDAATAGVFILESGAYHRADAFHVRTDAAARQGLVPPVTVLQMRAP
                     LPQRETYRSLQHGCLTESLVGFVVHETHRQRSIFSLAAVPSAGAQALYGAMDTVLEMS
                     TAALHDADAALVPCCGLAQRLVYTDCALTRTLLHASPLLEVTQVVLRAHVEGALSRPT
                     SLSSLSNVTWQLCGSQRYEATVIRLQRPLEERLSWVVEPLRAVSSDLRCVDSTLNRAG
                     AKATAARRSSDADPRSQMRCVTCVAETHFSSFSLHGGRFTGGVSRRCSLTLSADAVCS
                     VYPHHPRRTGGAHESRSCRRTSAAWWQPPPLWLSRTACFITHCSLFELSALYCLVLVV
                     CCFVLLRRRGRGRDGLARRDCIAW"
     gene            <846328..>847224
                     /locus_tag="LMJF_25_2250"
                     /db_xref="GeneID:5652709"
     mRNA            <846328..>847224
                     /locus_tag="LMJF_25_2250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683935.1"
                     /db_xref="GeneID:5652709"
     CDS             846328..847224
                     /locus_tag="LMJF_25_2250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683987.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652709"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9L1"
                     /translation="MVGHEVDPPPFPRPPSLHHAQSASVLEAFVVMVCLSHCSPVMPI
                     SLLLSFPSLRYLLAAFAPKRIHMPAITATTDFLPSSSEEWVHLCLLPSASPQLPSRPT
                     SCPRSLCAAAISAALTVLVRLFRRRFASRYSAPPLPPPVLSLLFSTYLISYPPHRPCW
                     HRQRYMENKAPGTAPRPEGYASASNAQGHENFFRPRQKLGTHNIQRAGLRSARRVGLW
                     FTSGVLVFILMPTYLGPAYVKYVAGSEWLERVSKSIWQRRNEKDFELYMTQRKNTWAE
                     WLGLKRYNISGEENDGGIQKYR"
     gene            <848541..>848912
                     /locus_tag="LMJF_25_2260"
                     /db_xref="GeneID:5652710"
     mRNA            <848541..>848912
                     /locus_tag="LMJF_25_2260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683936.1"
                     /db_xref="GeneID:5652710"
     CDS             848541..848912
                     /locus_tag="LMJF_25_2260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683988.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652710"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9L0"
                     /translation="MERERKLAEREVREVVADAESPLAQRHVRESLKKNKFAAVLYAV
                     ALFTPACVLMFFYTAKAREIRANFRDPYALPEGFDPKAGEFLSKGAQPKSVQELPIPR
                     SLFVGEEPGSYGGRARKCSIS"
     gene            <850055..>851416
                     /locus_tag="LMJF_25_2270"
                     /db_xref="GeneID:5652711"
     mRNA            <850055..>851416
                     /locus_tag="LMJF_25_2270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683937.1"
                     /db_xref="GeneID:5652711"
     CDS             850055..851416
                     /locus_tag="LMJF_25_2270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683989.1"
                     /db_xref="GeneID:5652711"
                     /db_xref="GOA:Q95ZC0"
                     /db_xref="UniProtKB/TrEMBL:Q95ZC0"
                     /translation="MSILLEIYRHSFPKRLRFDKASQVLYAQCYSINRRYKNKKYIPQ
                     KDIHDVLNSYAPMPGAPWLQLPIVRHFLLIRLINSIRGLKGGKLWLYNRNVEEEHRKI
                     VEWLSKEAKAFPARRRSVAARASTSARQGSAGAHAALEATVERERFEREVLRNFHVAT
                     MYQRMVRLGFMLVVALCCIVYASLHTDNLVYLYLRYWRRYNRRDIMEYFRGITLLHTV
                     AEVPPAYASLLPPPCVRYNDAAGDACYAVNMVEMVLPQHNVTVIAIPCPQAGEKSFFA
                     QVGSVAEVCDGIIMEGVTFDKIDKLVPAVFFPLKINTFPALGLHHRFLDILRNSSVEP
                     PMLYPAGADVGWGAAIMQALLPYELRCVYNPTELSATKGEARIGWGHVRQVLEEMMED
                     KAAQASGERRVLCLPWTLNQIVNIEASLVKYGFKVRNVYRLHWQREDHMGEHFCDYFS
                     IAE"
     gene            <853485..>854468
                     /locus_tag="LMJF_25_2280"
                     /db_xref="GeneID:5652712"
     mRNA            <853485..>854468
                     /locus_tag="LMJF_25_2280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683938.1"
                     /db_xref="GeneID:5652712"
     CDS             853485..854468
                     /locus_tag="LMJF_25_2280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683990.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652712"
                     /db_xref="GOA:Q4Q9K8"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9K8"
                     /translation="MPLTAPPRRHGNIKVFLNGRIFVGPDWRIMTLSVVLISVCSLVF
                     VFFTNEIVAARITVGVTALISVSVLLLCGLSDPGVKPRQPPPPPDAPPRESLWLEREY
                     LDENGCVHQARLEMKWCYSCNIYRPYRGVHCRYCDQCVARRDHHCPWTGTCIGAKNYR
                     SYFALVWVLSVMLFTALCGGIQSFVQRIVRHSKVTPVIEDGPSAFTSALFDTYGLELI
                     LILVSFIFGLLVWSLAVYHTYLISRNLTSGDAAKDLKENVFTHGSVLANLWAALSGWR
                     EEEMTCGDARTEVVIEVGGFDDVGDPPSPSTTTPAASSHATVCDGGDASHL"
     gene            <856567..>857457
                     /locus_tag="LMJF_25_2290"
                     /db_xref="GeneID:5652713"
     mRNA            <856567..>857457
                     /locus_tag="LMJF_25_2290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683939.1"
                     /db_xref="GeneID:5652713"
     CDS             856567..857457
                     /locus_tag="LMJF_25_2290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683991.1"
                     /db_xref="GeneID:5652713"
                     /db_xref="GOA:Q95ZB8"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR006845"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR025654"
                     /db_xref="UniProtKB/TrEMBL:Q95ZB8"
                     /translation="MQTATAPFILRSLYKDAYISDMQIARPITELMMNTIGAQLTNKY
                     DTHIPAIACSLYTLFSMSRVQTLGQEFCDLLPVVKAHPWQPVGPARVLLLAVLQLVEP
                     TAVFVVARKLFPDLSTADVEEVLRKAVLCALFLFERFGTLPHRIARVRFLSLKPSRTL
                     QDSDGAPGSYLVLGLVLLVELVVRLWRYSKERTSREAKRSTEAAVITSSDEDAEDARS
                     GKCMLCLSNRKCPTATNCGHIFCWRCIAEWIQSNPQEAVCPFCRQHITTQSLVPLYFY
                     VAKEPPRVGTATDAAAPPAA"
     gene            <858387..>860378
                     /locus_tag="LMJF_25_2300"
                     /db_xref="GeneID:5652714"
     mRNA            <858387..>860378
                     /locus_tag="LMJF_25_2300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683940.1"
                     /db_xref="GeneID:5652714"
     CDS             858387..860378
                     /locus_tag="LMJF_25_2300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683992.1"
                     /db_xref="GeneID:5652714"
                     /db_xref="GOA:Q95ZB7"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR025875"
                     /db_xref="UniProtKB/TrEMBL:Q95ZB7"
                     /translation="MSSFKVENIIRDRLDAAELSLSGMRLTSLDALVPFLAKMPRLRC
                     LNVSHNELRDLPMDLSSLTKLEALDLSSNPLGGVHRILDGLQSLPRLTSLSVTLPAPA
                     AEAEEQLIMRLPALTCLNGTALVDPREEVEESGAVNCDIAAAVEMAPADRAYWKPTDS
                     ASIESLFADVSRQDASTTQEFFDYMNRVVQHVTCLTAAEDDAFAQEGEVLKARRLLYE
                     FCFGDVIRHAFKDGHDVLGRQLQTLLRYESAMMDQYDMHWRHILRDRDSRLAHMKRDM
                     QDAMDDIRSLIECFQESGAQGPSIEGEDSRREREEAPHGAGSGVRASLGATPLTRTGH
                     TTHMDASRIGASPQPLPPAGLTRRSQQPSSEPKARRSSFTKVLSLRQLKEIIEDIYTS
                     KVKYDEKCKQNQLPRETLEQHMYTCLNQKYGLRDIILEWATAIVEAVRRYAPEDNDVA
                     VFGKILRNEIDEEFRFVQQHVRQTVKELLRKHIQAKRPLSGVVELSNALQQVLRGTVA
                     EGAWKEVVNYMYNAGDSALITDIIHEYLHCRSLPKLQRGNEEDARLSPTAGHSQLLCK
                     DFVRLLLDFQLDGHVRFLEPYVKIFRRHDKDQNGIVNRFEFASIVRELDPSKSEEAVR
                     FMAEQIDPHGSQLITFSESITFLNDELLKLSNAQNGTHE"
     gene            <861390..>863123
                     /locus_tag="LMJF_25_2310"
                     /db_xref="GeneID:5652715"
     mRNA            <861390..>863123
                     /locus_tag="LMJF_25_2310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683941.1"
                     /db_xref="GeneID:5652715"
     CDS             861390..863123
                     /locus_tag="LMJF_25_2310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683993.1"
                     /db_xref="GeneID:5652715"
                     /db_xref="UniProtKB/TrEMBL:Q95ZB6"
                     /translation="MSVPDDFNSLPPVVSVSTNVAVLTPPSARYALTAGELAGCFLSA
                     RRSSIHTQPPPSDAKAIQKAQQRLDTFHSSQINPFLYGYMYPDQDIPEPVLSSIRKLC
                     VNASGAWAARCQRLAFDVLTTELQAKASNVIPRTNHDDPIGLAQLRRVLPTLKYVPKM
                     SVTNPHSRFVGNCVDDIAENAQAFTATVTVQNNGSHPFTVAIAQTQTVIDGVRAEDKF
                     LEAKLEKAELHRGESMDVRLIMQRPPHAVLWEYEQVLVLSVNGILKYFVTFAVISPKQ
                     DLFKQRLPGCLPLTVLESPLGEYSAPLMLQVLKHAFIRQQGYTSPAVVHLFLGKSVNY
                     RTHNELVMSETMRLTKTLIDEMNMAATISSYWASVPDAKRAPLSRQYQPPVSSAQPAR
                     YAPGSDKLGSSNVATAEALFPNSATRLPEVLQRSPPAVIMGAILIWLAQMDIAVFDSS
                     FFNCDPVGYMQGMPPYLRGILLWILDLCCGLLANQEVNGVNERVLALTFAAVLMRRNP
                     PQYDVEETEAFSDAQAVFGSPSSDSGAGGSGSTATAVSFSTDVAFHQNAVTAILHWIS
                     IYRVKYANKIK"
     gene            <864140..>864577
                     /locus_tag="LMJF_25_2320"
                     /db_xref="GeneID:5652716"
     mRNA            <864140..>864577
                     /locus_tag="LMJF_25_2320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683942.1"
                     /db_xref="GeneID:5652716"
     CDS             864140..864577
                     /locus_tag="LMJF_25_2320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683994.1"
                     /db_xref="GeneID:5652716"
                     /db_xref="GOA:Q95ZB5"
                     /db_xref="InterPro:IPR009542"
                     /db_xref="UniProtKB/TrEMBL:Q95ZB5"
                     /translation="MEAAATPEANPAALALRKVHPAARWVAGLFSPMSLRDQGYCADM
                     FQCILWGSLAVSFPVAYWMGCVFVTVIGVCAATVVCLVLFVPNWYQHPDPALKYADDM
                     EVYDYYQQYEAAKKAAREASTSSKKTAATSPALPRAKPHVTIA"
     gene            <865541..>868054
                     /locus_tag="LMJF_25_2330"
                     /db_xref="GeneID:5652717"
     mRNA            <865541..>868054
                     /locus_tag="LMJF_25_2330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683943.1"
                     /db_xref="GeneID:5652717"
     CDS             865541..868054
                     /locus_tag="LMJF_25_2330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683995.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652717"
                     /db_xref="InterPro:IPR003123"
                     /db_xref="InterPro:IPR003409"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9K3"
                     /translation="MRTSPRDGSTAAAATSLASSISHHLSLELGDSYEGAVEVKRGVA
                     IPHGRGVWRSGDGRARYEGHFVQRWRDGYGRLCTPTFTLWARWRMDRPDLSSSTRVDY
                     PNGDRYCGFVELKVKQPPSAQARSKFSAWAASVEPSRHCWGELVTFSGDRYVGEWADN
                     EREGFGCYMWASGSRYIGRFRRGQFHDTGTLFVFPAEVEVCLSRLCSDGGWSCGSGDS
                     KPLAERHAPCGAARWPPASRPGWDGVVLDVVWRDGKFSGEGHVTLPSGVRISADWRNA
                     SSPVDGELVLPSLTPQARMDTEVYEWRESFQWESLLSNADAEARRIAYEKADISREGI
                     QQSNSTEYVRSCVLELLNTHKVAKTALHVFRRCFYCLYGTCGVDTEVGAGGHGNPLGW
                     CTLRNAYGGCIHPAEGRCISAADLDLALRDIASLARSMVRWVLDMVGPEQQSKVLDYG
                     GEALVGRWVADRVFQHCYPVLLNLYSQVYRAEETALAASVARLRDAVTLDDIGVAFAR
                     QSESQEKLFDPYTDAVHCVEKLNNEAQTLTQLLKVLVQWSREIDLSTRLTQACTDGRQ
                     KPARSTSGSADDLLPIHQYVLSQSRCRRLYAVTKLLSDFAAEPLFMESTSQEAFGVTT
                     LQACVLTLLRLHPWERDASNILVPFSVALDGVREVVQRRAALAEWVHEACSGVSFAAS
                     TDAPTLDVVERVMSRYVALWVPRMVGWMGEHANATSDPQPVDNGEFTQEELSLVFLGP
                     PIADGEEALCFCCWLYASALLDSVHMRLLLGPHTVPHRLSRAEDVAEACTQLRGWAAG
                     ASAAAPMQLQVKVAVSSPPAVPSRLLSLESHLTELLHEL"
     gene            <869984..>871150
                     /locus_tag="LMJF_25_2340"
                     /db_xref="GeneID:5652718"
     mRNA            <869984..>871150
                     /locus_tag="LMJF_25_2340"
                     /product="putative serine/threonine-protein kinase"
                     /transcript_id="XM_001683944.1"
                     /db_xref="GeneID:5652718"
     CDS             869984..871150
                     /locus_tag="LMJF_25_2340"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative serine/threonine-protein kinase"
                     /protein_id="XP_001683996.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652718"
                     /db_xref="GOA:Q4Q9K2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9K2"
                     /translation="MFMKLFKKKEKKDKEEDKKSESTPTLENKRVETPEAPEKLTKDD
                     FETLDVLGKGSFAYVVLCRRLSTNKYYAMKVINKQGLLDHKRVQDVFTERNVLTRLNH
                     PYLLKLYWTFQSEHKLFFVMDYMPGGDLDKYMNSVPKKQLDPATAQLYGAEILLAIMC
                     LHEHSVIYRDLKPENILLDGEGHCALADFGLSKDFHKDGQDVSDKELRANSFVGSPFY
                     VAPDVLRQREYTNAVDFWSFGILLYRMLCGRTPFNGRSMTEVFDNILYSDLSFPSGVA
                     VSPEAKDLISRLLMKDPNRRIKGPEVKQHPYWTGISFEEVAQRKIAPSRWTPLPSVEE
                     MLAARKNVSAGPSTSLKNPHHVVNTPAQSSQLNDGQQRLFGGFSCTADSHLNNS"
     gene            <873985..>875079
                     /locus_tag="LMJF_25_2350"
                     /db_xref="GeneID:5652719"
     mRNA            <873985..>875079
                     /locus_tag="LMJF_25_2350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683945.1"
                     /db_xref="GeneID:5652719"
     CDS             873985..875079
                     /locus_tag="LMJF_25_2350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683997.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652719"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9K1"
                     /translation="MTSNGDGQRHGFRYGAPAAVVDPLLSFLFDLRRMEDTVLSTLEH
                     IGVRRRDLPRPFGGGSSASPPQVPATADDDVAVFFDVPSLRMPASDPIGAYAHEIAAN
                     RSDARDVSVGGVIHQLLSWLDSQSSSSQSSPVSSKQLLTIFATATGAGADVFLRDAAT
                     LDDTHIERTFQRAKPDKSAASPTPDEETLAYGDDSTARLVGTLTAADIHAAVQEWRGY
                     ERLLKSSVAEMKATLAAVTAARPSSSYSCHAKWVERTRSGGKSTSVVPASAVLKRNYE
                     ELISLNDALATCQAAVHTAYVALEDNLDVLLEEAQTVDRQERLFQHHVSMARRECAAL
                     HALRSRIKQARRALQRCVYSQRRRTQVQPR"
     gene            <876385..>878106
                     /gene="PUF8"
                     /locus_tag="LMJF_25_2360"
                     /db_xref="GeneID:5652720"
     mRNA            <876385..>878106
                     /gene="PUF8"
                     /locus_tag="LMJF_25_2360"
                     /product="putative pumillio protein 8"
                     /transcript_id="XM_001683946.1"
                     /db_xref="GeneID:5652720"
     CDS             876385..878106
                     /gene="PUF8"
                     /locus_tag="LMJF_25_2360"
                     /codon_start=1
                     /product="putative pumillio protein 8"
                     /protein_id="XP_001683998.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652720"
                     /db_xref="GOA:Q4Q9K0"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9K0"
                     /translation="MGRTNAKKQEAREERLSKLPQSDRLTKIAIIKKKEGRVLDAAEK
                     HALKMSSEHGEILRLWEKLRTIEDRTEEQVAMPSSKKTAYAHKYPMVDKLMHLIEPKF
                     ANLVRTPSVSRVVQSMIKYGSAEQVNRLLKWVSKDFSTYATDAYAHFVVCALVRHVPH
                     EAYSKLMTHVIPSVPQLVAHKFGIEVLHSVYSSRWCSPADRSLLLLAVFKDNVAVMRR
                     WPGYPEVEAVLKKNPSLQRRLLSRLFDLSDKLVSQKEAIGYPFVQRLVGTYVRCGTRD
                     EVSELCDTLRPHITAISATREGAPLASLAFSLTEPKKRKEVLHSFNAQLGELCTSKYA
                     APVIARLFDLLYDAQMLRKYVASDLAEHIGQVVNSPYGYQILMHLLTPHEERKRRFLL
                     PNWQEHNLFSMENKEWNHHTWLTPAFVPETVEICSKPAVTSHLAALPMLVKAFLQYVT
                     DEAHSAKLNRHHAALIAREVLHVVQHEPLYKAAIQLSEDEEHALSKLAPAHGKRERED
                     AAGEVETYAAAPTKCPKRENGSQKAAALTPADKRKKTKVPTVISAAAPLEGRRVKTDA
                     KKRVKKS"
     gene            <879407..>880111
                     /locus_tag="LMJF_25_2370"
                     /db_xref="GeneID:5652721"
     mRNA            <879407..>880111
                     /locus_tag="LMJF_25_2370"
                     /product="putative adenylate kinase"
                     /transcript_id="XM_001683947.1"
                     /db_xref="GeneID:5652721"
     CDS             879407..880111
                     /locus_tag="LMJF_25_2370"
                     /EC_number="2.7.4.3"
                     /codon_start=1
                     /product="putative adenylate kinase"
                     /protein_id="XP_001683999.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652721"
                     /db_xref="GOA:Q4Q9J9"
                     /db_xref="InterPro:IPR000850"
                     /db_xref="InterPro:IPR006259"
                     /db_xref="InterPro:IPR007862"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9J9"
                     /translation="MPSKFLRLLFVGAPGVGKGTYSGLAAVSLACHAVSSGDLLRKEV
                     AEGTAIGKQVKGLIEKGVFVPDEIITKMVVQLIASLSADKERPNGYILDGYPRNISQA
                     TALWTSGDIKIDHVINLTQPRNVIIKKLSSRRSCPDCGFVYNLASIDEGGIKMDPLKP
                     KLDGLCDKCGCTKPLITRKDDDIDVVRKRQDEYDATATPLLRFYKEKGILHEFPVLGS
                     TKRYLPKLLELISTLD"
     gene            <882786..>882992
                     /locus_tag="LMJF_25_2375"
                     /db_xref="GeneID:12981319"
     mRNA            <882786..>882992
                     /locus_tag="LMJF_25_2375"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721755.1"
                     /db_xref="GeneID:12981319"
     CDS             882786..882992
                     /locus_tag="LMJF_25_2375"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721803.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2375"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2375"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981319"
                     /db_xref="UniProtKB/TrEMBL:E9ACT1"
                     /translation="MKAAQAKAVDNPKDDFWIEKCVGNAAVIYSKDTTNRLTDLAGAL
                     LVMCISVYFTVGGYLFYRELVLSE"
     gene            884961..887141
                     /gene="GSP"
                     /locus_tag="LMJF_25_2380"
                     /pseudo
                     /db_xref="GeneID:12981320"
     CDS             join(884961..886013,886015..886962,886965..887141)
                     /gene="GSP"
                     /locus_tag="LMJF_25_2380"
                     /EC_number="6.3.1.8"
                     /pseudo
                     /codon_start=1
                     /product="putative glutathionylspermidine synthase"
                     /db_xref="GeneID:12981320"
     gene            <890108..>890860
                     /locus_tag="LMJF_25_2400"
                     /db_xref="GeneID:5652723"
     mRNA            <890108..>890860
                     /locus_tag="LMJF_25_2400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683948.1"
                     /db_xref="GeneID:5652723"
     CDS             890108..890860
                     /locus_tag="LMJF_25_2400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684000.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652723"
                     /db_xref="InterPro:IPR007290"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9J8"
                     /translation="MPVCIECGHGVPRIIKPDTETVERCGMCGRICDICYEFGDVQIW
                     IDVVLLRHRAWAHVLFNQTDYYTKLVIFVLCCVVEAVVVHSLTVLKAIPFFTDDLENS
                     SLYTPERQVRSLQLVRIIQSSFLPLMNYPSAIFHIFVFTFTENALVASIATWLGRFFY
                     RSYGHRERLWFVEAALASYAKLSYALFLIWAIPPSMLPMVDVLYVLWLGCAFTVLGFD
                     RHWMYPVVTVLVCVCARGLFRYLTKWSPQVLY"
     gene            <891530..>894415
                     /locus_tag="LMJF_25_2410"
                     /db_xref="GeneID:5652724"
     mRNA            <891530..>894415
                     /locus_tag="LMJF_25_2410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683949.1"
                     /db_xref="GeneID:5652724"
     CDS             891530..894415
                     /locus_tag="LMJF_25_2410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684001.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652724"
                     /db_xref="GOA:Q4Q9J7"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9J7"
                     /translation="MSLEANIAVCLHDLKSPSDHPVALRSSPNGVAFTCPPSLKEASF
                     PGNDTNFAVEHVLERPNAAAIQKKMLSSAASNFVKNRQNLVMFSYGVRSTPKRQLMYG
                     QQSEEGYAVRVISDAVTTGQGIFALSCYIIGQDEHLVDLISAENELGVIVESVKEGPR
                     VRMVERSRVKTESDVRGVFSKIVQNYHKQFGSVLPEKQPTAELQALPPYQGDTIMLQL
                     LRYESEEKYSNYEDTNSMTFVALGDSERPVLCGLDSSQQEAFEKTNRILLSAMGIVSS
                     IKCSRLRIPFGKSKLSQLMRRCYNAEKGNPNGALNGPTNTVLLIHCWTNGEWAEESFH
                     NLSMIRRICNTLGSSGIGSMLRDLPVEKWRLDQDINELRDELVVARMVYDYKPCICES
                     TKPIANIKEEELKRINAIQQKRNEAHEKQLAMIQQKAMEEAKKIIKEQEASSGVTLAS
                     LEKMLAAKKRENESLQLERDNMTHEYEQTLEKIRRKKESEEDVVSRLREETNQLEEEL
                     GARQAAIANKQKQLDLAKLDKTKCREAILRERGNVEAMRKTLLTERRHQREQWIKQIK
                     EVNQQVLVQLRTMADERKQNGETVSAKEQASEKAVVEDIKTIEEYLPKLISLEDVPVN
                     PEETESIRRQFDEVFLQEKKTYLMKIDEEKARKEKLEKGLIAYRNRVLEVAHAKKKEN
                     MQDAAMKVQHLSSLVEQVLTYLRSGVKMMKVSSKNHVRCRFYFISDDGSRIHSCELDS
                     QGAPINRRKPPVTIWLRDIRKVVLGVYTESFVSFSSESQLAKARAEAITDNGTYRNDV
                     TQSITSANIGLNNYRAFALLLRGGKSLEVVCYTDTDCEAWMVGLRRLLGIKTATEKQM
                     ELHMESVRPQEPPVVEQPVEMKFGGLLDVHNMRGFLALSAEEASLCSESHIPPALFLR
                     VKQEMVDKSHTGTITTYDVRVSSGLDLVRSGCIYDFLVQHHVIPSPF"
     gene            <896193..>896978
                     /locus_tag="LMJF_25_2420"
                     /db_xref="GeneID:5652725"
     mRNA            <896193..>896978
                     /locus_tag="LMJF_25_2420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683950.1"
                     /db_xref="GeneID:5652725"
     CDS             896193..896978
                     /locus_tag="LMJF_25_2420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684002.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652725"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9J6"
                     /translation="MAELLSKKTWRLRDVLFNEGADQVVRVLKIDHPFRRQRITIVPT
                     PRYAREAYLTDWVYQPYVKEHIMYVSNDIYNPFYVFLCRSLLRKGKFPEYAYFHPMGL
                     PDCVDVNLSRRAFIKKEQPFKTPMSTILMTTNHFRDSHHPWVSRRTVNIVGEQYVVHP
                     KEDKQSMVFVLPPAYVPDVVNTLQGLGFAVTDTVTASIGNATTINKLNSWSNKCQLLV
                     LGYLWFLLALFIIGESRHIRQLFQDYKRELIEKAGKDPAKMGL"
     gene            <898219..>899814
                     /locus_tag="LMJF_25_2430"
                     /db_xref="GeneID:5652726"
     mRNA            <898219..>899814
                     /locus_tag="LMJF_25_2430"
                     /product="putative aminopeptidase P1"
                     /transcript_id="XM_001683951.1"
                     /db_xref="GeneID:5652726"
     CDS             898219..899814
                     /locus_tag="LMJF_25_2430"
                     /EC_number="3.4.11.9"
                     /codon_start=1
                     /product="putative aminopeptidase P1"
                     /protein_id="XP_001684003.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652726"
                     /db_xref="GOA:Q4Q9J5"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR001131"
                     /db_xref="InterPro:IPR028980"
                     /db_xref="InterPro:IPR029149"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9J5"
                     /translation="MKQSQPEVPSLEEWIAANLGSKAVVGMSPYVATVAEWERLSKKI
                     NLRPVANIVQDMMPPEKSVRKMYVRPAEFCGATCQERRAAILAELEKKDCDMIILSAL
                     DEIAWFTNLRGGDVDYNPVFYAYAVIDKHYENVRLYVNLDKVTDAVRQACEDHIDFYP
                     YEQFEADLKQLPRGRKALVDERQTSEAVFRILKDVGTVTVRVVCGPAQKLKAIKNEVE
                     LKGFRDCHVRDGAALTRYLAWLHDQVANKGVTDLNEYDAATKLEEFRAQGEHFVQLSF
                     GSISSIGPNGAMCHYSPAETGSAAIRRDQLYLIDSGAHYWDGTTDVTRTICFTAPSDE
                     QREAYTLVLKGHIALNSIIFPKGTSGIRLDTLARMALWGVGLDYAHGTGHGVGSFLNV
                     HEGPHGISTRPVATGANMELHSIVSDEPGYYKDGHYGIRIENLEEVVECRTKYSATGF
                     YTMSHLTMAPLCRDLIDVSLLTETERAWVDRYHAKVVASIMPHLQQAGDQNAVEYLKY
                     HTRPLFAVNEAYTLLSPDGKGAK"
     gene            <900682..>901665
                     /locus_tag="LMJF_25_2440"
                     /db_xref="GeneID:5652727"
     mRNA            <900682..>901665
                     /locus_tag="LMJF_25_2440"
                     /product="tagatose-6-phosphate kinase-like protein"
                     /transcript_id="XM_001683952.2"
                     /db_xref="GeneID:5652727"
     CDS             900682..901665
                     /locus_tag="LMJF_25_2440"
                     /EC_number="2.7.1.144"
                     /codon_start=1
                     /product="tagatose-6-phosphate kinase-like protein"
                     /protein_id="XP_001684004.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.25.2440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.25.2440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652727"
                     /db_xref="GOA:Q4Q9J4"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="InterPro:IPR017583"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9J4"
                     /translation="MGSPLIAVIGPNPAFQKTLAFDELRVDEVNRAATVHSYTGGKGT
                     NFCRASACCKESPHFCRTTLHTFVGGKTGERVIDLLHQEGIAVYPVTVPAETRTCITC
                     LDTQNSTMTELIEPSAAVPDDAAKDMDRALLKALEHAGGMAIMGSLPDGSSPDLYTRW
                     TEMAAAAQKPVLIDAVKGIEASLKVPGVHSILKVNMRELNKLTGQSTPESAFEYAMQM
                     WTVRVLAVTDGPRSAYIQERGQPLQVVHIPKVDGVVSPLGAGDTADAIFLAKYIHGTT
                     PVEAFRLALAAASANCLQKEAGVFAQHEMRRIADGITIGSSRPHSSSNTRA"
     gene            <902478..>902780
                     /locus_tag="LMJF_25_2450"
                     /db_xref="GeneID:5652728"
     mRNA            <902478..>902780
                     /locus_tag="LMJF_25_2450"
                     /product="histone H4"
                     /transcript_id="XM_001683953.1"
                     /db_xref="GeneID:5652728"
     CDS             902478..902780
                     /locus_tag="LMJF_25_2450"
                     /codon_start=1
                     /product="histone H4"
                     /protein_id="XP_001684005.1"
                     /db_xref="GeneID:5652728"
                     /db_xref="GOA:Q4Q277"
                     /db_xref="InterPro:IPR001951"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:Q4Q277"
                     /translation="MAKGKRSTDAKGSQRRQKKVLRDNIRGITRGCVRRMARRGGVKR
                     ISSEVYEEVRRVLKAYVEDIVRCSTAYTEYARKKTVTACDVVTALRKQGHILYGYA"
     gene            <904656..>907100
                     /gene="SCG6"
                     /locus_tag="LMJF_25_2460"
                     /db_xref="GeneID:5652729"
     mRNA            <904656..>907100
                     /gene="SCG6"
                     /locus_tag="LMJF_25_2460"
                     /product="phosphoglycan beta 1,3 galactosyltransferase 6"
                     /transcript_id="XM_001683954.1"
                     /db_xref="GeneID:5652729"
     CDS             904656..907100
                     /gene="SCG6"
                     /locus_tag="LMJF_25_2460"
                     /codon_start=1
                     /product="phosphoglycan beta 1,3 galactosyltransferase 6"
                     /protein_id="XP_001684006.1"
                     /db_xref="GeneID:5652729"
                     /db_xref="GOA:Q7YXU9"
                     /db_xref="InterPro:IPR002659"
                     /db_xref="UniProtKB/TrEMBL:Q7YXU9"
                     /translation="MREENNVPAEWAPRDTHRLDPLQLLPPSQRHCGQSSAAESGQGC
                     HSPSRGKPEVHSTRVSSGGKRSTGTLSRSDDCLNAAARTPLFNSCGHPRRSAAHCLCL
                     HTRQRRLVALDVLLALIVMVHWVIIEFTTNIDAQQKSSIELLNEANREYESSSPFSVL
                     VQHESAVERLTTAQRGLAASGAGSLARLDRDQLPSWTLRVIDEDCTMCLDNVTYASAV
                     AADAGRSTNKTGHHKQKGLSVFATTSAPLGLMGPMLFAMASVTDDVDVAAELPRWQWV
                     TWSYAQQRRFVHTSQSRSTGERPRHLIVLGIPSTDQPMRYPLRDAQRATWLTYREVAR
                     TENNFTGALLQLYVFAAAHRDSDYTAQYLGDTAQVAPTVIEYAAATEQHLAVEAGDVD
                     NAPPYLQRRVVLRDGWRDIPRSDDAVWRSPCAGVRTTVVTAASLVAGTSSLTALSAQL
                     SLPVTPAFTAAAQYVCHASAALWQEALHHRNSLWLDFLTDRKPTTKKKMGMSISWGIP
                     TEVGMSQKTVLWLNYAYTAFPDVPYIMKGDDDMYLKVPQYLSDLRHVRGGWQKPRNLT
                     ATLPHRGVIPPTLAIDDAEECLYRVWWIYSNKIAYGNGVGYILDRRLIQAALNPFDGS
                     NALLMKLLTNPYDYRLEKEYLSLNMQYEDMHIGKQIRDHHDAVERFCPKKRVCYMADG
                     RFRAHQILRPTPVKLTWISVMAHFGMSAIPYYVHYFHKNEFKVAEEAKRLIAQGIDVN
                     TIEENATQRMHEWVASQVPSTLVGLGASFHLNWVRGGPRTAYTVAEEDEVAVYDVRYK
                     LRRRNDVACVLESGKR"
CONTIG      join(FR796421.1:1..912845)
//
DBGET integrated database retrieval system