GenomeNet

Database: RefSeq
Entry: NC_007268
LinkDB: NC_007268
Original site: NC_007268 
LOCUS       NC_007268            1130424 bp    DNA     linear   CON 18-JUN-2017
DEFINITION  Leishmania major strain Friedlin complete genome, chromosome 27.
ACCESSION   NC_007268 CP000079
VERSION     NC_007268.2
DBLINK      BioProject: PRJNA15564
            BioSample: SAMEA3138173
            Assembly: GCF_000002725.2
KEYWORDS    RefSeq; complete genome.
SOURCE      Leishmania major strain Friedlin
  ORGANISM  Leishmania major strain Friedlin
            Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae;
            Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Rogers,M.B., Hilley,J.D., Dickens,N.J., Wilkes,J., Bates,P.A.,
            Depledge,D.P., Harris,D., Her,Y., Herzyk,P., Imamura,H., Otto,T.D.,
            Sanders,M., Seeger,K., Dujardin,J.C., Berriman,M., Smith,D.F.,
            Hertz-Fowler,C. and Mottram,J.C.
  TITLE     Chromosome and gene copy number variation allow major structural
            change between species and strains of Leishmania
  JOURNAL   Genome Res. 21 (12), 2129-2142 (2011)
   PUBMED   22038252
REFERENCE   2
  AUTHORS   Ivens,A.C., Peacock,C.S., Worthey,E.A., Murphy,L., Aggarwal,G.,
            Berriman,M., Sisk,E., Rajandream,M.A., Adlem,E., Aert,R.,
            Anupama,A., Apostolou,Z., Attipoe,P., Bason,N., Bauser,C., Beck,A.,
            Beverley,S.M., Bianchettin,G., Borzym,K., Bothe,G., Bruschi,C.V.,
            Collins,M., Cadag,E., Ciarloni,L., Clayton,C., Coulson,R.M.,
            Cronin,A., Cruz,A.K., Davies,R.M., De Gaudenzi,J., Dobson,D.E.,
            Duesterhoeft,A., Fazelina,G., Fosker,N., Frasch,A.C., Fraser,A.,
            Fuchs,M., Gabel,C., Goble,A., Goffeau,A., Harris,D.,
            Hertz-Fowler,C., Hilbert,H., Horn,D., Huang,Y., Klages,S.,
            Knights,A., Kube,M., Larke,N., Litvin,L., Lord,A., Louie,T.,
            Marra,M., Masuy,D., Matthews,K., Michaeli,S., Mottram,J.C.,
            Muller-Auer,S., Munden,H., Nelson,S., Norbertczak,H., Oliver,K.,
            O'neil,S., Pentony,M., Pohl,T.M., Price,C., Purnelle,B.,
            Quail,M.A., Rabbinowitsch,E., Reinhardt,R., Rieger,M., Rinta,J.,
            Robben,J., Robertson,L., Ruiz,J.C., Rutter,S., Saunders,D.,
            Schafer,M., Schein,J., Schwartz,D.C., Seeger,K., Seyler,A.,
            Sharp,S., Shin,H., Sivam,D., Squares,R., Squares,S., Tosato,V.,
            Vogt,C., Volckaert,G., Wambutt,R., Warren,T., Wedler,H.,
            Woodward,J., Zhou,S., Zimmermann,W., Smith,D.F., Blackwell,J.M.,
            Stuart,K.D., Barrell,B. and Myler,P.J.
  TITLE     The genome of the kinetoplastid parasite, Leishmania major
  JOURNAL   Science 309 (5733), 436-442 (2005)
   PUBMED   16020728
REFERENCE   3  (bases 1 to 1130424)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 1130424)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR796423.
            On Jun 1, 2012 this sequence version replaced NC_007268.1.
            Data release policy www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1130424
                     /organism="Leishmania major strain Friedlin"
                     /mol_type="genomic DNA"
                     /strain="Friedlin"
                     /db_xref="taxon:347515"
                     /chromosome="27"
     gene            complement(<4279..>5403)
                     /locus_tag="LMJF_27_0010"
                     /db_xref="GeneID:12982853"
     mRNA            complement(<4279..>5403)
                     /locus_tag="LMJF_27_0010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721759.1"
                     /db_xref="GeneID:12982853"
     CDS             complement(4279..5403)
                     /locus_tag="LMJF_27_0010"
                     /note="previous protein_id=AAZ09747.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721807.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982853"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:E9ACX8"
                     /translation="MESKVPLFLYFMVTNHPEVKQYTELLCHQVDQANRRLKDENFGD
                     VYQEFGKDAGLAIKLGMVDCLQEPGLMAKFHIDPHMFPLIYFVRNKVFCDKMVGVVTE
                     SHVKEAVEAFIDYAKLESKSESEGASLFQKVRRQDDDDENAMTLIAAAHGKMQAGDPA
                     KGKQLFEKALRMSMEDMEVVKKRYGVPNKKMTPELWAKLKREPCYNSAPEALCGLAMC
                     AMASKQRDEAFRLAARVREEFPFAPQDMRGVAEAVVRIELIQVVDYDPDTDNYMRLLK
                     FDELVSEPAQFYKHHLKRAVAFYVEGVAGQAIEECLRLIRAEPKLLSALKEGGIVPND
                     LRLGPTAVTPARQVIRAIFEALGPTNEHVEKGRKLLQLYL"
     gene            complement(<6488..>9577)
                     /locus_tag="LMJF_27_0020"
                     /db_xref="GeneID:12982039"
     mRNA            complement(<6488..>9577)
                     /locus_tag="LMJF_27_0020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721760.1"
                     /db_xref="GeneID:12982039"
     CDS             complement(6488..9577)
                     /locus_tag="LMJF_27_0020"
                     /note="previous protein_id=AAZ09748.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721808.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982039"
                     /db_xref="GOA:E9ACX9"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR019170"
                     /db_xref="UniProtKB/TrEMBL:E9ACX9"
                     /translation="MSQLRSSPCRGGGWRIGTLLVMIVCSVGAASQLNTDCDTLGFIL
                     DVADRSCQACPEHARRVQGTCVCDVGYALHVDASTGTQSCVDCAAQKMMVSDAGAVNA
                     SAYCLPCGGDRQLTCLVDATYNEATRTCVCAPGSVLAKQVGTLLLTAAMCAPCARSAC
                     VTCSFPYALDASSGACRCSAGFTMLYDGSCVPTEAYESMAAAASGTSTALSPPNIDNS
                     GAAGPLTRVFPAQTYSLGAALLCSRGNSTACNLLANLCVVMDYQVTAMPCALYQHIKQ
                     SKPCDDPWCETIDGLPWLYYTRSNADVLSNVTTEYRLSARQKLQLVVSVFDLYGNWLG
                     YQSVVSQVNPCFLKNTELQTFFAAGDTRATSCHVNWHWFLRANRTLFYEVYLRHPFNA
                     SRLMPVPLLIDYSNYGFEPATFHDPWLYRGRAVASNGAMSEGGFRRRFYAYDNVGGSS
                     DALLRSLPSYVTALRSASLVLGADHRDDRYVATPLLVLQYASKMVSTIADAAPTDDLE
                     EERQTPLNTSGQPDYTLHCQMRSYYLSSTDSVSQGLKVAVIVLCALCFFSAWVRTYGW
                     MRRRQYLVLDSFAVLRFFVYLCNHISNMFFLAVAVASWYMFIAYKGQSSLSRAMRLGD
                     AYVNAMLYVAVTGKGVTVLYRLAEQCNADYFVIDWERSKGQLLRENKVVPVSMWRSTF
                     VANALNELQALRYWCPLLTMTIVLLFLLGLDYQNMSASVPRGSRQVDGMTVSFDTLRI
                     AIDTFFWVAVALVMYLFEYQIYYRFVVVHPLQAFVDLCSVSNISIIILLEQQWGFYIH
                     GESIHAHADVSMEEFQSNLFLEAQGNLPVRGLGGQSKCQSLEVYLGPYTRQYLYMCYI
                     EMHIENQRSLLKRERAINPAQWHYIRFLFCFSRQLCVYTQTALAIRDRINYAFQQSVR
                     RAESTVLVKFMLQKWLDFPPNVMYMNGPQRGDHCGKDLFFIDDVQSYGRAFLCGLDFD
                     LFVLYAALFAAIDAALHNFYVAMVLAFAVEVVVHFYRVREGLANLSQKTMIDDRFFL"
     gene            complement(<10467..>11477)
                     /locus_tag="LMJF_27_0030"
                     /db_xref="GeneID:12982040"
     mRNA            complement(<10467..>11477)
                     /locus_tag="LMJF_27_0030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721761.1"
                     /db_xref="GeneID:12982040"
     CDS             complement(10467..11477)
                     /locus_tag="LMJF_27_0030"
                     /note="previous protein_id=AAZ09749.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721809.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982040"
                     /db_xref="GOA:E9ACY0"
                     /db_xref="InterPro:IPR002616"
                     /db_xref="UniProtKB/TrEMBL:E9ACY0"
                     /translation="MDSQGPFLVIPTKRGAVPTLTPAQANAILEPSERILATSVFEAM
                     DFVKPCIEAGMQLSTYCGLSGYKTVLTLRSSFQGLHASASSSDTAVAGDNERGRAVIS
                     FEKWRDVVKATRPTFAVAVHESLPLCEPLNKRRRVAATRSETWLANTEEASDLGCTIL
                     PSISAGCTHDGGYIDAVPRGENSYEFFQTLQALQLSPKKCTMCVAPSISVLLAAMVSN
                     VSLLECPLPWTLAEKGVALLLPLEEATTTSPEPVVPLLDLNDNVYALDINPIAEGCDC
                     FTCKRHCRAYLHHLLTVQEMNSDILLVMHNLAQVVLLVRAYRCASAPTREALVSRVAS
                     AL"
     gene            complement(<12169..>13452)
                     /locus_tag="LMJF_27_0040"
                     /db_xref="GeneID:12982041"
     mRNA            complement(<12169..>13452)
                     /locus_tag="LMJF_27_0040"
                     /product="putative CAAX prenyl protease 1"
                     /transcript_id="XM_003721762.1"
                     /db_xref="GeneID:12982041"
     CDS             complement(12169..13452)
                     /locus_tag="LMJF_27_0040"
                     /EC_number="3.4.-.-"
                     /note="previous protein_id=AAZ09750.1"
                     /codon_start=1
                     /product="putative CAAX prenyl protease 1"
                     /protein_id="XP_003721810.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982041"
                     /db_xref="GOA:E9ACY1"
                     /db_xref="InterPro:IPR001915"
                     /db_xref="InterPro:IPR027057"
                     /db_xref="UniProtKB/TrEMBL:E9ACY1"
                     /translation="MSSSPNLFLRAAVVSLNVIGMWDAYLVLRQRRANQTKEMPSYFR
                     KDITDEEFAKAKEYESEKSTFSFLQHLKGLVLTNMGIFLRLPALLYYLVAQRASLSTG
                     SFSHNYAAAVAGELISVVLDIPFSYYENFHIEDRHGLNEMTKTEFVKDIVKTLLLRVT
                     LLYPMQIKLIQFVVQRFGERFPLYLFFGMSVMLVVFLLAMPTVIQPLFNKFTPLDAES
                     PLYKKIELLSKEMSFPLKKVFVVDGSRRSHHSNAYFYGFGSNKRIVLYDTILEQLKDD
                     DEPIIAVLCHELGHWKHNHIYVNLAMALGQLMLISYGARLVVFDKRVYEALGFREVDP
                     VVGLNIFAEMFYEPLSTFIGYGFCYVSRRHEFQADRFAVTHHHGEGMKKALLVISKEN
                     RASLTPDPLYSALHYTHPPVLERLQAIDAELKKRE"
     gene            complement(<14117..>16483)
                     /locus_tag="LMJF_27_0050"
                     /db_xref="GeneID:12982042"
     mRNA            complement(<14117..>16483)
                     /locus_tag="LMJF_27_0050"
                     /product="DEAD-box helicase-like protein"
                     /transcript_id="XM_003721763.1"
                     /db_xref="GeneID:12982042"
     CDS             complement(14117..16483)
                     /locus_tag="LMJF_27_0050"
                     /note="previous protein_id=AAZ09751.1"
                     /codon_start=1
                     /product="DEAD-box helicase-like protein"
                     /protein_id="XP_003721811.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982042"
                     /db_xref="GOA:E9ACY2"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR025313"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9ACY2"
                     /translation="MSSYVSVSGLSKVGEDDALQRLLSSREGSGNGSNALLEAMRKIQ
                     AENVFDAENVTFTPAAPPAPVAKAASKKESAASHASVEKPKANAVSLREPKKTSSGMS
                     PSPTVQLAASAVQASSFRATNPTDIDSLPALVELVHPKLLRPLTDSMKIEHLTRIQKL
                     CWAAMLDSDSDVLVRSETGSGKTLAYALPTLHRLLVECDKTPISRDVGTLIIIMCPTR
                     ELVLQVTETVTTLVRCAQFITVGGIHGGENRHKEKARLRKGLPILVTTPGRLLDHLKT
                     TASFTVAHAQTVIMDEADRLLDMGFEKALREIMELLERKCHHASDLKRVLVSATITDG
                     VERLSHFALRRNIARIGETQDTFSVPTTLKQHYVIVPVKHRLSVLLSFLRSQLDAGAN
                     KIIVFVSTADSTEFLYLLASRLQSPFHRRSYEGKVVTRSRGASMSAKKMVETANRHLD
                     NGGATDEVVTFEDVSDGETEGDARIDSTAALQRAFLDANVFKLHGNMLQVDRAAVFHA
                     FKFGTRKSRSDKSVLFCTDVAARGLDMPRIDWIVHYDPPIDPTSYVHRIGRTARIGNS
                     GDSILFLAPDERGYAAYLTHFIHSQMQQSDGKEATEMAERKYETFLFYLTKLDPKSNH
                     MWMQSTAALERAISRLAMQRDIERGEDAKENLYRVALFAYQSYLRAYAGMPRQTKSLF
                     FSSTLHLGHVAQSFGIDKSPSEVQRELQAYIREDRALARDNRKGTVTNSCDGERGKSK
                     RQRVELDHEDRYHSMLTQKQRKLTRDWAEKRRKESTKIRPLQFSEFDA"
     gene            complement(<17678..>17998)
                     /locus_tag="LMJF_27_0060"
                     /db_xref="GeneID:12982043"
     mRNA            complement(<17678..>17998)
                     /locus_tag="LMJF_27_0060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721764.1"
                     /db_xref="GeneID:12982043"
     CDS             complement(17678..17998)
                     /locus_tag="LMJF_27_0060"
                     /note="previous protein_id=AAZ09752.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721812.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982043"
                     /db_xref="UniProtKB/TrEMBL:E9ACY3"
                     /translation="MPCYSEAPLFLLTPLRTSSQIRPPFAQRHTRVPIVSMPRAHQKV
                     EADSSIFSRIVEQGWVSFLILGALMVGLRLYNVKQRRDRRKLLREGLMAEMGYRSKAS
                     RKGD"
     gene            complement(<18330..>19271)
                     /locus_tag="LMJF_27_0070"
                     /db_xref="GeneID:12982044"
     mRNA            complement(<18330..>19271)
                     /locus_tag="LMJF_27_0070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721765.1"
                     /db_xref="GeneID:12982044"
     CDS             complement(18330..19271)
                     /locus_tag="LMJF_27_0070"
                     /note="previous protein_id=AAZ09753.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721813.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982044"
                     /db_xref="UniProtKB/TrEMBL:E9ACY4"
                     /translation="MARTLLFLLSILVLAAAATAHELHLPADIYDRAAGEWSVEVVSS
                     CRSPLLGTVTFRNTTAVVEWKEVGAPEMRISGRSATSSLSVAALSDFLTKDSHELSYA
                     VCERQENYLATPQRPVQVAAMSTTYIKAYSGVLTSSFDGSTCDGTRERTIAIQALGAP
                     FTPSKGKAWQMQEALYAIDIILDTRNVEGTCASKRGAGVPDAVPGNDKRSRKRRAHRT
                     LSSGMVVSMADAMTTENGIVTLRFIRRSAAHQPWFLRYYTPIVFATIFIMYRMAYSFS
                     YGRAAKASPRSESSGGKTAGDAGRIAASGCNSNPIDT"
     gene            complement(<19735..>20331)
                     /locus_tag="LMJF_27_0080"
                     /db_xref="GeneID:12982045"
     mRNA            complement(<19735..>20331)
                     /locus_tag="LMJF_27_0080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721766.1"
                     /db_xref="GeneID:12982045"
     CDS             complement(19735..20331)
                     /locus_tag="LMJF_27_0080"
                     /note="previous protein_id=AAZ09754.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721814.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982045"
                     /db_xref="UniProtKB/TrEMBL:E9ACY5"
                     /translation="MALLEWARQDATMKSSLELYCGPASKDLMIMDIPANVAVDAYLW
                     EGLLVAESMLEADGTLLVVSPHAFSVRVRRFLQWRFLRAQCAVSEAGAVHYAVCSTVA
                     AGFGDAAVRRDDFPGQLATGKRRPCKWNPYRRPEKRKFVASLRPWFTNAPFVKDALRC
                     SLERERDAQERLRDADDAFFAVAHEMVEKGVHYSHPND"
     gene            complement(<21962..>23782)
                     /locus_tag="LMJF_27_0090"
                     /db_xref="GeneID:12982046"
     mRNA            complement(<21962..>23782)
                     /locus_tag="LMJF_27_0090"
                     /product="cytochrome p450-like protein"
                     /transcript_id="XM_003721767.1"
                     /db_xref="GeneID:12982046"
     CDS             complement(21962..23782)
                     /locus_tag="LMJF_27_0090"
                     /EC_number="1.14.-.-"
                     /note="previous protein_id=AAZ09755.1"
                     /codon_start=1
                     /product="cytochrome p450-like protein"
                     /protein_id="XP_003721815.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982046"
                     /db_xref="GOA:E9ACY6"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR002403"
                     /db_xref="UniProtKB/TrEMBL:E9ACY6"
                     /translation="MVFDTDFFVVNCSQMAANVLQSYIVAALHSAATQLPSSVQPYAM
                     MLTREDMVSTTLATAIATAVILYTVITVVLPVLRMDFYLSKLPTIKNSIPFLGHALLL
                     AGPSPWSKMSNWSLYPEKNLPQKKKSVDGPQTSRLVTYNVAGMRVIYINEPRLLRRVL
                     LTHQRNYRKALAAAYKHFMCLLGTGLVTSEDEQWKKGRLLLSHAMRIDILDSVPEMAM
                     KAVDRILLKLDAVDAKNPSVDLNEEYRHMTLQVISESALSLSAEESDRIFPALYLPIV
                     HECNKRVWAPWRAYMPFLHGSRMRNRCLSELNKVLRDIICRRWEQRNDSNYTAKPDIL
                     ALCISQIDRIDEKMIVGLIDDVKTILLAGHETSAALLTFATYEVLRHPEIRQKILEEA
                     TRLFDPARCTCTVQTRYGPRGVPALNDVRSLVWTPAVLRETLRRHSVVPLVMRYAAKD
                     DVWPAADTGLDADVRIPAGCTIAVGIEGVHNNPDVWNKPEVFDPTRFIDAEIANDTNY
                     LNQSTKDVKFAKKIDPYAFIPFINGPRNCLGQHLSMIETQVALAYMVLSYDLTIYRDP
                     SYKGDVAAYEDAVGRHHDFIIPQVPHDGLKVWGTPNKLFM"
     gene            complement(<25526..>27508)
                     /locus_tag="LMJF_27_0100"
                     /db_xref="GeneID:12982047"
     mRNA            complement(<25526..>27508)
                     /locus_tag="LMJF_27_0100"
                     /product="putative protein kinase"
                     /transcript_id="XM_003721768.1"
                     /db_xref="GeneID:12982047"
     CDS             complement(25526..27508)
                     /locus_tag="LMJF_27_0100"
                     /EC_number="2.7.11.1"
                     /note="previous protein_id=AAZ09756.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_003721816.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982047"
                     /db_xref="GOA:E9ACY7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9ACY7"
                     /translation="MDKYEILAQIGDGTFGSVAKAVSKKTGQLVAIKKMKQKFYTWEE
                     CVKLPEVDVVRRIHGHPNVVKLREVIRENNELFFVFEYMDGDLLGVIKKAKQQGGPPA
                     TTPSTAPLIPYPLVKNYMRQMLQALVYIHKRGYFHRDMKPENLLIRKEASGDEVLKLA
                     DFGLVKEIRARPPFTDYVSTRWYRAPELLLQDRFYGAAVDVWAAGCIMVELITMRPLF
                     PGTNEVDQLFKIMSVLGSPTEEVWAGGLRLAKKIRYTFPKVAGSGLAQALPSHIPLPA
                     LDLLRQMLVYDPKVRLTAEQCLQHPFFNVGIDECNAPSAAALDQLALMAKRMLPGSKT
                     APPALKSPTTDQVAALKAARASTDASLSDTSSRKFYLLGTLKDRAPSLPKLSVALSTS
                     PPSLDALPNASSPLRGRGVLSPAGMPVLANGHQCLSLTTTVAKGKRRSQETADTSLAK
                     KLAGLKNVPTGKGKLPVSYGLPAASAVHSPRAAPNLKVSASVARPCPLAPTANNRDAV
                     ASPRRHNPYKEAETTSPTAASAAAKVEIDLDELMEEFASEMTAMGVLAQRHDSGASAE
                     SKSESYVSQPALPPDPVATLLNNSRYKRKSTTSADPLLKGNNSPRATHQLDTRKVDDV
                     AAKSDLPRIDHSAPKGMSPSLKALLAKHKTSGLAFP"
     gene            complement(<28393..>28650)
                     /locus_tag="LMJF_27_0110"
                     /db_xref="GeneID:12982048"
     mRNA            complement(<28393..>28650)
                     /locus_tag="LMJF_27_0110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721769.1"
                     /db_xref="GeneID:12982048"
     CDS             complement(28393..28650)
                     /locus_tag="LMJF_27_0110"
                     /note="previous protein_id=AAZ09757.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721817.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982048"
                     /db_xref="UniProtKB/TrEMBL:E9ACY8"
                     /translation="MLRRTTARFYQSVTAPIGKGCVMPMKFDSLKPAYVPKSFTTQFF
                     VLGTWSISNMITNFVIGFLIIASANGGLSGAWPPDPHSLHP"
     gene            complement(<30223..>32127)
                     /locus_tag="LMJF_27_0120"
                     /db_xref="GeneID:12982049"
     mRNA            complement(<30223..>32127)
                     /locus_tag="LMJF_27_0120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721770.1"
                     /db_xref="GeneID:12982049"
     CDS             complement(30223..32127)
                     /locus_tag="LMJF_27_0120"
                     /note="previous protein_id=AAZ09758.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721818.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982049"
                     /db_xref="GOA:E9ACY9"
                     /db_xref="InterPro:IPR011016"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:E9ACY9"
                     /translation="MSFRQAVASVLAVLVLFSLALTSTHASSPAQWVPTLALFDINNS
                     RILSTTGTSEAVSLGQRSLFVSRYDPNPSISVASLTFYGSENSYATRTFDFLTVPYCV
                     VESGTTTACNLHDHMLYMMFRFRHRYETDFHAIVWQDPTPLSSTVKALQDFKAHLNRS
                     DVVYPENDGTMRVEEAATCSDIMDECYLSRAATYTRSYKEIDPAQYSARFLFRIGKQY
                     TMNGPLRVRLHSSLPHDAETIVDVVLVLCRQPSSNPLNHRWWIESVAGRLALLVVSVV
                     TTFAFLTVTREVGALMVRQRRGEDVLAPTLLYSEEASDGPLVSFQRFAKVASNSLQAG
                     VVYVWTKIHELICVNACCASRLRWLGARCPRVPAREHTAESQREITALNSTVFSEEED
                     PGPTCRICRCSEPHDDLFAPCACNGSSKFVHHNCLEQWREMTSNPQHRRVCAECKTPY
                     TFVRVVVPQNPDLLTGSPIIESVVRHFAAKFLYLAMTVLFAVGGAYCLKAAFFLTTLC
                     DTGVDWGFYHGYHWVLTAYFLAALTLNLSIMEPFVRGTMLTGVQLLFVLLSLFFIEIP
                     MSYAMSAFLSLIFDRLFTWEVSYGAGLASAALLHLMDTFSNFAKILESFSEEREVVAA
                     RAESETQRSV"
     gene            complement(<33891..>34343)
                     /locus_tag="LMJF_27_0130"
                     /db_xref="GeneID:12982050"
     mRNA            complement(<33891..>34343)
                     /locus_tag="LMJF_27_0130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721771.1"
                     /db_xref="GeneID:12982050"
     CDS             complement(33891..34343)
                     /locus_tag="LMJF_27_0130"
                     /note="previous protein_id=AAZ09759.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721819.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982050"
                     /db_xref="GOA:E9ACZ0"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="UniProtKB/TrEMBL:E9ACZ0"
                     /translation="MCPADRVPRRQHRGLPPLSSQSKIIILLTNSTSIKMQQPYFGQQ
                     PMLPPGWQLSYTADGKPYYIDHNTKTTHWSIPPTAYEPYYNNGRGRGAGYRGGRQGID
                     RSKMKSKMCIYWEKNGNCAWGDRCAFAHGAEELRNPASQPRNDAPASA"
     gene            complement(<35141..>35794)
                     /locus_tag="LMJF_27_0140"
                     /db_xref="GeneID:12982051"
     mRNA            complement(<35141..>35794)
                     /locus_tag="LMJF_27_0140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721772.1"
                     /db_xref="GeneID:12982051"
     CDS             complement(35141..35794)
                     /locus_tag="LMJF_27_0140"
                     /note="previous protein_id=AAZ09760.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721820.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982051"
                     /db_xref="UniProtKB/TrEMBL:E9ACZ1"
                     /translation="MRSQLIGHVSRSAVTPYGARVSKESAESVLLKQRMEVMKTVAAI
                     RANEDTFGGARVSRHGCALPQMKAAPRDKIRKPLYTATSTNQYKTIKDLKADDGTEPD
                     AAQLKRTSLVHDASGTLVTTESPHGNAPESRDPRKAVAEKHRAALVTPRPHVPTRIEQ
                     WIGSFGRSLGAVKPYAMGRSTKLATRHCFTDLPVDTNDRYVDRMQCCRPSKGLYAYY"
     gene            complement(<37754..>38305)
                     /locus_tag="LMJF_27_0150"
                     /db_xref="GeneID:12982052"
     mRNA            complement(<37754..>38305)
                     /locus_tag="LMJF_27_0150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721773.1"
                     /db_xref="GeneID:12982052"
     CDS             complement(37754..38305)
                     /locus_tag="LMJF_27_0150"
                     /note="previous protein_id=AAZ09761.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721821.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982052"
                     /db_xref="GOA:E9ACZ2"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:E9ACZ2"
                     /translation="MSLQAGGVVNGVIPGVVPPHDRTQEVCKYFVNGGCLRGANCPYL
                     HELPDERHLDVNGLGFILNPNVHNAQKTVASPQTQVAASTPSQPLKASGSSFTMMLNN
                     QNASQSRVFSPTKAAKHQPPSMSGSSSASPQTMQMGKLPAPPKYNPPEPYLELNLPPA
                     LAFPLKVPAKDTTATLTHLMLQN"
     gene            complement(<39782..>40567)
                     /locus_tag="LMJF_27_0160"
                     /db_xref="GeneID:12982053"
     mRNA            complement(<39782..>40567)
                     /locus_tag="LMJF_27_0160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721774.1"
                     /db_xref="GeneID:12982053"
     CDS             complement(39782..40567)
                     /locus_tag="LMJF_27_0160"
                     /note="previous protein_id=AAZ09762.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721822.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982053"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:E9ACZ3"
                     /translation="MNASFGGSFARGVFAEREIGYGREVMNLPAYCMYISENDRQPLR
                     EQVLIMTKEIFSKVVYGTPQEQQYVKHRILSLMSGGFSYFTRECDVFDFAEDVRAPGA
                     DGAFRNGTNCLMSGEFSSYDLQKLPLIVEFNRFEVDYRGRRGICLFPEASYLNHSCEP
                     NVELSIAYNSIKNNFFLSARAVRPIREGEELFINYMPGNNLPLSRLALAMKKRWGFEC
                     SCVKCKSRAVGAVTVVFVVLLIPIIVYIRRFIVERTKEKHRSL"
     gene            complement(<42200..>43612)
                     /locus_tag="LMJF_27_0170"
                     /db_xref="GeneID:12982054"
     mRNA            complement(<42200..>43612)
                     /locus_tag="LMJF_27_0170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721775.1"
                     /db_xref="GeneID:12982054"
     CDS             complement(42200..43612)
                     /locus_tag="LMJF_27_0170"
                     /note="previous protein_id=AAZ09763.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721823.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982054"
                     /db_xref="UniProtKB/TrEMBL:E9ACZ4"
                     /translation="MQDQWKIDVESEDHRSRRDMTEKSITRYVKGEVERQVTSSSTSS
                     SVFVSDCTWIMGASAAQPSYLCCGLSNGSVCLLNTSNLSKIYLFEVDRDSRRSQRDTD
                     RGGQGQGSGRESAASQQLVAVATHTVSAGTNPAAAQTLLCMTLDNVVGVCPMDMSTVL
                     ERKKVSRSDMAKVKPFPAVAAGAVLHSSVHFNSKGSGILALLCIEQESSAAPGASSIR
                     YCAAVLSSPDETVTLQSKYASEDDWHTLAPPSAGGDSRPGAPVELCYCGWWSADTLVC
                     VWSNSALQFLQAAGMQVVGECRLLRHCTSDAVTNATVTRPGAAEASDGASSGLVAVVL
                     DHNVAASFYVTVRHSASASAQEPKRHRGEAPLTVTLTPTMQTYCTEDIPVRELHFVRS
                     FSWTIVLLLESGALVFLDVETMRLSVHRPVNRLRAPDAGRYHAGPLMVAPRNFFCVLS
                     GKPFSAVVIEHNTAILLKSQ"
     gene            complement(<44488..>45027)
                     /locus_tag="LMJF_27_0180"
                     /db_xref="GeneID:12982610"
     mRNA            complement(<44488..>45027)
                     /locus_tag="LMJF_27_0180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721776.1"
                     /db_xref="GeneID:12982610"
     CDS             complement(44488..45027)
                     /locus_tag="LMJF_27_0180"
                     /note="previous protein_id=AAZ09764.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721824.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982610"
                     /db_xref="UniProtKB/TrEMBL:E9ACZ5"
                     /translation="MLRSSLRYGVHKVGYTHPHHLPVPCAQRWDLRLARARIFQEYIE
                     EKAPGAWQLEDERHMSPEFNTFTGYPMRNLRPGYGQNLPEFIMKKRLPNNTHYELFAR
                     RDIPNEDNAMYGKLLYDMTIHGTSLPSIYRMHKDINKAQRNDRKLSGNRFKVLNSSGA
                     KSPPSGFEAIPDAVEEEDD"
     gene            complement(<46101..>46817)
                     /locus_tag="LMJF_27_0190"
                     /db_xref="GeneID:12982611"
     mRNA            complement(<46101..>46817)
                     /locus_tag="LMJF_27_0190"
                     /product="putative proteasome alpha 7 subunit"
                     /transcript_id="XM_003721777.1"
                     /db_xref="GeneID:12982611"
     CDS             complement(46101..46817)
                     /locus_tag="LMJF_27_0190"
                     /EC_number="3.4.25.1"
                     /note="previous protein_id=AAZ09765.1"
                     /codon_start=1
                     /product="putative proteasome alpha 7 subunit"
                     /protein_id="XP_003721825.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982611"
                     /db_xref="GOA:E9ACZ6"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:E9ACZ6"
                     /translation="MAGTGSGHDQSTDVFSAEGRVFQVEYAGKAVDNSSTAVAACCKD
                     GVVVAVEKIHTSRMLEKGSNNRIHAVDRQAGICICGLLPDGRAIVSRARQEAENSRDI
                     FATPIRGSVLANRVGEFMHVYTTHFAYRPFGCSAIIASYADDGPQLFVSDPSGTVAGY
                     YGVALGKAKTVAKSELEKLDFSNLTCDDAVVKLANILHDVHDKQKDKLYDVEVAWVCD
                     KSDRKFVHVAADMIPSETSN"
     gene            complement(<47688..>48779)
                     /locus_tag="LMJF_27_0200"
                     /db_xref="GeneID:12982612"
     mRNA            complement(<47688..>48779)
                     /locus_tag="LMJF_27_0200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721778.1"
                     /db_xref="GeneID:12982612"
     CDS             complement(47688..48779)
                     /locus_tag="LMJF_27_0200"
                     /note="previous protein_id=AAZ09766.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721826.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982612"
                     /db_xref="GOA:E9ACZ7"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:E9ACZ7"
                     /translation="MESRGRVLGAVRTLSEAVSAQGKCENSRRLVIQVVSGGCESFSL
                     HQLEQALCYFTNRNSNYTNVYEDEFHVLAEETLNNLIRSILVYDDFSGFFGDAEVYSL
                     SMAFQYNLSVEALTLRGIDISDEAICSLCEALVRSRVNYIDLSNTPLEDEAGRSIAAL
                     AHINPYLRTVIVDDTLIADDVLDEIDVACQFNQSNFEGNKGEVDESMLRPADLGRLKH
                     RLQQIVRAQEKKVHYCVAHLFGCCPNGEMCLYSHSLGKSGMDETDTSLSAKISELFVN
                     GGNWEERLPPRPTDGPSWRNPEDEVKRTPRANNARRRREQASNTPAPAQQTRWSPLLS
                     GLAGMCCGFLAVGLVGVVARRLAPRSSPG"
     gene            complement(<49519..>50388)
                     /locus_tag="LMJF_27_0210"
                     /db_xref="GeneID:12982613"
     mRNA            complement(<49519..>50388)
                     /locus_tag="LMJF_27_0210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721779.1"
                     /db_xref="GeneID:12982613"
     CDS             complement(49519..50388)
                     /locus_tag="LMJF_27_0210"
                     /note="previous protein_id=AAZ09767.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721827.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982613"
                     /db_xref="InterPro:IPR008217"
                     /db_xref="UniProtKB/TrEMBL:E9ACZ8"
                     /translation="MSESTVLNVSATEKKGYKSCDAARAAFRAGDVEASRREHMKEMP
                     QENHNVSASEYVKSLVFGGLDGIMTTFAIIAAAAGSGGNKATVLIFGFSNVIADGFSM
                     GFGEYVSGEAERENAISERRREEWEVENSFDLEIDEMVQIYMAKGLSFDDAHTIVGII
                     SKDPKMFVDFMMVEELGLLMDMDDAHGPKKQGVVMFASFMFFGSIPLLAYLPGKGQGV
                     DFVFFVSCFLTMASLVFLGSVKGYLVGVSMGRSAVLMVLNGLISGIVSFMAGHLIQMA
                     LSSGAEATTSLPV"
     gene            complement(<52014..>52958)
                     /locus_tag="LMJF_27_0220"
                     /db_xref="GeneID:12982614"
     mRNA            complement(<52014..>52958)
                     /locus_tag="LMJF_27_0220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721780.1"
                     /db_xref="GeneID:12982614"
     CDS             complement(52014..52958)
                     /locus_tag="LMJF_27_0220"
                     /note="previous protein_id=AAZ09768.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721828.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982614"
                     /db_xref="UniProtKB/TrEMBL:E9ACZ9"
                     /translation="MHDSVDGFWAACSGCGVTSKRLSIHKTAVAASPIGLVAGEAVKH
                     GSPLINVPYNSVFNGQTLRGDVLPRALPSLRKMLLFLTRRGRMGVVTAHSLWLACFVA
                     CYRQQCAVTNEAERWLLQPLLSSSVYPPLPNLFLERNKFACPSLRANSASELEVMERR
                     VEDELDLTYSMLRHYMKRRGVSSKLRPSRDMLVQAHRTVMQRALLLPWNGEPSAPAEL
                     SELIETSTDLPLVPSLVPAIDLIRAAPLHSRAEAEEDEEAQSSGNCAIFTCVQSDFLS
                     SSSRRRIIVETAPLAARRVVVCATKPLKEGTELLMEFE"
     gene            complement(<53789..>54352)
                     /locus_tag="LMJF_27_0230"
                     /db_xref="GeneID:12982615"
     mRNA            complement(<53789..>54352)
                     /locus_tag="LMJF_27_0230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721781.1"
                     /db_xref="GeneID:12982615"
     CDS             complement(53789..54352)
                     /locus_tag="LMJF_27_0230"
                     /note="previous protein_id=AAZ09769.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721829.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982615"
                     /db_xref="UniProtKB/TrEMBL:E9AD00"
                     /translation="MSSGAVGRGSFHSVVAGANPRRIPTYYNSAYELIQLHRAHREVT
                     RNFLVRDKVFDNKFPGCSLANGLFKMVPNKRGNFHTRELTESIRHRTIWGQRIQQQRT
                     INAAILEDATKVLSPAQMEDRFSYRTPDAAAYFSPQEYTAANNWPNYWQHPTEKHVVP
                     KPRWRREPELGGITRVRDAVATPIADY"
     gene            complement(<56638..>58827)
                     /locus_tag="LMJF_27_0240"
                     /db_xref="GeneID:12982616"
     mRNA            complement(<56638..>58827)
                     /locus_tag="LMJF_27_0240"
                     /product="kinetoplast-associated protein-like protein"
                     /transcript_id="XM_003721782.1"
                     /db_xref="GeneID:12982616"
     CDS             complement(56638..58827)
                     /locus_tag="LMJF_27_0240"
                     /note="previous protein_id=AAZ09770.1"
                     /codon_start=1
                     /product="kinetoplast-associated protein-like protein"
                     /protein_id="XP_003721830.1"
                     /db_xref="GeneID:12982616"
                     /db_xref="UniProtKB/TrEMBL:E9AD01"
                     /translation="MPRYTTRATSKNTNRRGLSSRDETKRCVNMTLSEEEVQKSVSMQ
                     RHTNPKSTAHLQAEAEEAARLQAEAEEAARQQAEAEEAARLQAEAEEAARLQAEAEEA
                     ARQQAEAEEAARLQAEAEEAARLQAEAEEAARLQAEAEEAARLQAEAEEAARQQAEAE
                     EAARQQAEAEEAARLQAEAEEAARLQAEAEEAARLQAEAEEAARQQAEAEEAARQQAE
                     AEEAARLQAEAEEAARLQAEAEEAARQQAEAEEAARLQAEAEEAARLQAEAEEAARLQ
                     AEAEEAARQQAEAEEAARQQAEAEEAARLQAEAEEAARLQAEAEEAARQQAEAEEAAR
                     QQAEAEEAARQQAEAEEAARLQAEAEEAARLQAEAEEAARLQAEAEEAARQQAEAEEA
                     ARLQAEAEEAARQQAEAEEAARLQAEAEEAARLQAEAEEAARLQAEAEEAARQQAEAE
                     EAARQQAEAEEAARLQAEAEEAARLQAEAEEAARQQAEAEEAARLQAEAEEAARLQAE
                     AEEAARLQAEAEEAARQQAEAEEAARQQAEAEEAARQQAEAEEAARLQAEAEEAARLQ
                     AEAEEAARLQAEAEEAARLQAEAEEAARLQAEAEEAARQQAEAEEAARLQAEAEEAAR
                     QQAEAEEAARQQAEAEEAARLQAEAEEAARQQAEAEEAARQQAEAEEAARQQAEAEEA
                     ARQQAEAEEAARLQAEAEEAARQQAEAEEAARLQAEAEEAARLQAEA"
     gene            complement(<61230..>62417)
                     /locus_tag="LMJF_27_0250"
                     /db_xref="GeneID:12982617"
     mRNA            complement(<61230..>62417)
                     /locus_tag="LMJF_27_0250"
                     /product="putative flap endonuclease-1 (FEN-1)"
                     /transcript_id="XM_003721783.1"
                     /db_xref="GeneID:12982617"
     CDS             complement(61230..62417)
                     /locus_tag="LMJF_27_0250"
                     /note="previous protein_id=AAZ09771.1"
                     /codon_start=1
                     /product="putative flap endonuclease-1 (FEN-1)"
                     /protein_id="XP_003721831.1"
                     /db_xref="GeneID:12982617"
                     /db_xref="GOA:Q4FYU7"
                     /db_xref="InterPro:IPR006085"
                     /db_xref="InterPro:IPR006086"
                     /db_xref="InterPro:IPR008918"
                     /db_xref="InterPro:IPR019974"
                     /db_xref="InterPro:IPR020045"
                     /db_xref="InterPro:IPR023426"
                     /db_xref="InterPro:IPR029060"
                     /translation="MGILGLSKLLYDKSPNAIREQELKNFFGRRIAVDASMSIYQFII
                     AMKGFQDGQGLELTNEKGDVTSHLNGLFARTLRMIDEGIKPIYVFDGKPPKLKADELE
                     MRRQKAAEAERAFEKAKDAGDDEMMEKMSKRTVRVSRDQIDESKKLLRLMGIPVIQAP
                     SEAEAQCAELVKKGKAWAVGTEDMDALTFGSTVMLRHLNISDAKKRPIVEIHLDEVLQ
                     TTGLSMDQFVDLCILLGCDYVPKVPGIGPQKAWEGIQRYGSIESFLESLDTTKHPVPA
                     DFYYKEARAFFQNPEVTRAEEIDIQFSEPDEVGLIQFLVKEKLFNPDRVNKGIARLRA
                     AFTRKTQGRLDSFFTITKVPQQTAAARAPLVGTKRPRDGKYVHVSGTLRKATSGHKKA
                     VKK"
     gene            complement(<63078..>64064)
                     /locus_tag="LMJF_27_0260"
                     /db_xref="GeneID:12982618"
     mRNA            complement(<63078..>64064)
                     /locus_tag="LMJF_27_0260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721784.1"
                     /db_xref="GeneID:12982618"
     CDS             complement(63078..64064)
                     /locus_tag="LMJF_27_0260"
                     /note="previous protein_id=AAZ09772.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721832.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982618"
                     /db_xref="UniProtKB/TrEMBL:E9AD03"
                     /translation="MWRLHISTSLPAAPTHDGVSILIGQRSCVSSSANEAPCTVCVLA
                     GCVQCDDPSVAEEQIESLENVLPFGIEVLGFAGGTVALTSLAAELPDLKRKELLEVVV
                     LNGKRHLPSACRMFGAPAKKVEVLESDITFVEARCALHTYDSTLPLLISCSNALPQVV
                     DGGSYAPLTERALSSSSKIELIQTGAVPSTLRIHVVMAPSLMSASGLYETLFRQLKAA
                     WTARTMRLIELNSHNAHLSYCCRLECDADALDSTDTITEDEWAVVLEMMEDATGQRVS
                     RGDVRGIKPLLQPCRKSKTSAVEAAKKSPAQLPHFLLLGMIVVVMAVVVLVR"
     gene            complement(<66290..>69499)
                     /locus_tag="LMJF_27_0270"
                     /db_xref="GeneID:12982619"
     mRNA            complement(<66290..>69499)
                     /locus_tag="LMJF_27_0270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721785.1"
                     /db_xref="GeneID:12982619"
     CDS             complement(66290..69499)
                     /locus_tag="LMJF_27_0270"
                     /note="previous protein_id=AAZ09773.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721833.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982619"
                     /db_xref="UniProtKB/TrEMBL:E9AD04"
                     /translation="MHFVAGGAARRVGRVSDDEYETSSYEETESSDLLSDNSEDYVPL
                     TFEYISSNPKRRAGAPAYSKAPLGVLEEKEQQESLSSDAPLEVFLERSRTRRHCGPGA
                     KDSNRVEVKSSVGSHHKDEDGTSSTFSGALPIAFERRKKTRNIGKVKQSTYEVLDAEL
                     SVSLPDEDEAPLNAQLIYTLIKRLRNPSDEVSLEAFDFVDFSDENFKEELGPLKQIKA
                     LLEEKASNPMMENVKHDHAVKEAVQSLPPDNAIAAKVKAIKSCQIRPSKPRIRLYRGG
                     EAELKKAEAIADLVRRLKDPNTEVPLRAFEEVDWSNRDFDMILALLQPIRAYMEAKEV
                     AKEKPVEGTMSDASVLDNKIKEAIMSLPSEEAVAATMRVVKNRAMSSSPSNGDAIRHL
                     VARLKESGQTVKRCEFDKLDWNDRNFSRELEPLQQIRACMEAMEALEQKPGENVMATR
                     PALDEQIKVAIMSLPPEKVISVKTQMLKMYERASTTAQGSQRVKVTKLSAPAGTKKKL
                     KDSFIMSNPSKKSKAKEGSLSASSSQVMQVGARVMSLKQPKYAAKESTALSAPAKKVR
                     RSRIRGDRSVSISKVDDDTPPGEIIDDNQKLPESRELPLSEAGATSQCLSRMPSRPAG
                     TKKPERRTRNYRQVNISFSSVPTGEPGVIQEENELVGTKRKASRRRAPHKLCRSLSIT
                     SLPDLEADELLEEPSPLNTRGVAPAPLAPARKAKPRRLRTKVPGNNAQFDQPSNEVAS
                     DLDDNHTALRGKAHSVTKKKRRPRVNNKSCSFLEVYLDEVCEIHDESAAELKGAELHH
                     DASPPKRTQKLVRRRRPAGEGNGHALDYSKPEMGEAGKLDDAQHSNAATAKRRRVNVH
                     RPRSAHTSLIGELQSGEIVERPDETHILYTSSPASTPIPEEASARRVNRQALPARAQK
                     MSCMTCDFSSTARKRRQRLHMSKELSVSAIPENLVGEIVENAPDLLAATASVSGSFSN
                     ARLSKVHTGSARRLPLLKGSGRGSLRYADPPNSSLRSSAKSRKEVIMPNVDASFIPDT
                     VSSSPTPPSSALRRSAEAAPHVTMVAAKLCDDIQCIPSV"
     gene            complement(<69651..>69920)
                     /locus_tag="LMJF_27_0280"
                     /db_xref="GeneID:12982620"
     mRNA            complement(<69651..>69920)
                     /locus_tag="LMJF_27_0280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721786.1"
                     /db_xref="GeneID:12982620"
     CDS             complement(69651..69920)
                     /locus_tag="LMJF_27_0280"
                     /note="previous protein_id=AAZ09774.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721834.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982620"
                     /db_xref="UniProtKB/TrEMBL:E9AD05"
                     /translation="MDIISFPVRSAKPQSLFRLYVWRASNEVLIDVVNMFALLRKEHL
                     ACYSLLEIDYSAYILFSFQLYNLLYSFASLTTQHSRSIAFSHLKE"
     gene            complement(<70458..>70910)
                     /gene="ACP"
                     /locus_tag="LMJF_27_0290"
                     /db_xref="GeneID:12982621"
     mRNA            complement(<70458..>70910)
                     /gene="ACP"
                     /locus_tag="LMJF_27_0290"
                     /product="putative acyl carrier protein"
                     /transcript_id="XM_003721787.1"
                     /db_xref="GeneID:12982621"
     CDS             complement(70458..70910)
                     /gene="ACP"
                     /locus_tag="LMJF_27_0290"
                     /note="previous protein_id=AAZ09775.1"
                     /codon_start=1
                     /product="putative acyl carrier protein"
                     /protein_id="XP_003721835.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982621"
                     /db_xref="GOA:E9AD06"
                     /db_xref="InterPro:IPR003231"
                     /db_xref="InterPro:IPR006162"
                     /db_xref="InterPro:IPR009081"
                     /db_xref="PDB:2M5R"
                     /db_xref="UniProtKB/TrEMBL:E9AD06"
                     /translation="MQRQVIRRLGNRSAFPLVAAVARSSQIRGAVRGDSGSRARVIPS
                     FMCSLRAYSGGHHEEPSSRSGQYLLDKSDVLTRVLEVVKNFEKVDASKVTPESHFVKD
                     LGLNSLDVVEVVFAIEQEFILDIPDHDAEKIQSIPDAVEYIAQNPMAK"
     gene            <74546..>76717
                     /locus_tag="LMJF_27_0300"
                     /db_xref="GeneID:12982958"
     mRNA            <74546..>76717
                     /locus_tag="LMJF_27_0300"
                     /product="putative methylmalonyl-coenzyme a mutase"
                     /transcript_id="XM_003721788.1"
                     /db_xref="GeneID:12982958"
     CDS             74546..76717
                     /locus_tag="LMJF_27_0300"
                     /EC_number="5.4.99.2"
                     /note="previous protein_id=AAZ09776.1"
                     /codon_start=1
                     /product="putative methylmalonyl-coenzyme a mutase"
                     /protein_id="XP_003721836.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982958"
                     /db_xref="GOA:E9AD07"
                     /db_xref="InterPro:IPR006098"
                     /db_xref="InterPro:IPR006099"
                     /db_xref="InterPro:IPR006158"
                     /db_xref="InterPro:IPR006159"
                     /db_xref="InterPro:IPR014348"
                     /db_xref="InterPro:IPR016176"
                     /db_xref="UniProtKB/TrEMBL:E9AD07"
                     /translation="MMRRVPVLLSAAYLPEWIAAAKKELKNRDPSTLTIHSINGFDIK
                     PLYLADDVESHPALPGFFPYTRGVHATMYTGRPWTIRQYAGFSTAEESNNFYKTALKN
                     GQQGLSVAFDLATHRGYDSDHPRVTGDVGMAGVAVDSVEDMKLLFNDIPLDKVSVSMT
                     MNGAVIPVLAFFAVAAEESGVSQEKLRGTIQNDILKEFMVRNTYIFPPTPSMRILGDV
                     MAYVSKRQPKFNSISISGYHIQEAGGHGALELAFTIADGLEYIRCAEQRGLTVDDVAP
                     RFSFFFGIGMNFYCEIAKLRAARTLWATYVKKKFNPKNPKSLLLRTHSQTSGWSLTEQ
                     DMENNIIRTTIEAMAAVMGGVQSLHTNAFDEAVALPSVQSSRIARNTQIIIQEETCIC
                     SVVDPWGGSYMMEALTQEMIKKASAIIDDVEAKGGMTKCIEEGFPKLMIEESAARRQA
                     AIDSGAETIVGVNKYVNPVDKIHETLRIDDQKVRAGQIAALEKLKATRDKAKVQEMLK
                     KVTEACKDENVNILEAAVEAARARATLGEITSAMEEVYGRYVAKNQVVQGVYYNSYLR
                     GGNKEDQNHVAAVKARVDAFAAKEGRRPRIMVAKIGQDGHDRGAKVVATGLADMGYDV
                     DIGPLFQTPEEVARHAVENDVHICGASSLAAGHRTLIPQLIQELKKLGADDIIVTAGG
                     VIPPDDYQSLYDAGVKLIFGPGTPIPKCAEQMIEVLEARQK"
     gene            <78706..>82392
                     /locus_tag="LMJF_27_0310"
                     /db_xref="GeneID:12982622"
     mRNA            <78706..>82392
                     /locus_tag="LMJF_27_0310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721789.1"
                     /db_xref="GeneID:12982622"
     CDS             78706..82392
                     /locus_tag="LMJF_27_0310"
                     /note="previous protein_id=AAZ09777.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721837.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982622"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013932"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9AD08"
                     /translation="MAPFSACSFLRDIKHVDKDLRLMALFDLRRHVQSADENGITNDV
                     VDKVLSCLSTDERCEEVQNEAANALPDMVVKCSQRDVILQYLLSTITKTRVSDDSDGA
                     NLQYLSGMTFRKCCTEFASEARRNVAFWQTQIDVARHLCVCCAAQLEVDDLEDTAREI
                     LYTAVNALVPAYKDVLGERDALVKMAVRDFQKTNSIRHASLTLVESLLTLLRAATQES
                     VVAESLKLLVTATSSEQYVAYLQLCEVEMRALRSPPMPVVQQIIDSACERLVHAAEHY
                     DEGEDSTETLLEVVWSLLQLSASGGAPSWRGTFAAVKDLVTFDPYASGAEEDAYAADG
                     GYDEDYDEYYEYDNGTSDSTWKLRMWAVRVLQVLVAQHDDKELGMQSLNIVATTLQDR
                     VQVVQLEAVKLVRTVVRHSYVHDADCVALVTSRSHELCKLVGIEDEKATAFLVKALED
                     IFVTFAHAVAFCESTVPLLLNQVRAHFSAVAANAAAMEGCRSIVASIIRARGDGTLLS
                     SETVNLAKELPALCLCGGNSSATAACITKVSDTLAQVYSATHDVSVPAVLGSNYGALL
                     ENDTFPAACRAAAAESLANWAAAHGLLALEQPATALWRALDYDEVKLPVLRALSIMAG
                     SSASSASVPTCVLEKVAALAELGPASVRAASAEVLMRRLSAPNTPPLTASFLQHLTTQ
                     FAPGYPLSLSSCELAEMCALALLLAQLFRSQTEQGVSFHETYFAGVWEHVARLADAVL
                     WSRSLMNSALDSLMVLVGTVYEHEYASRLPIEDGVRQFLVSNQSHIPCICTVVHCVGA
                     GSPSAVSAFLHTLSPQLVERAHLLLCVGEAGQASGLSVDWSALVLDSVQSKEGELVRT
                     CGERSLSLCMLHPGNVETILMPCGERAADSGTAGRYYYVKSIKEAATLALSRYNTAFH
                     DAAVSKRLLSLFLQSSASADLAELYGACAGILSIFMLDAERGLMIADTLFETEASLDT
                     RVTCMVALRYFLSTLAERSASIEIHRHIVLRALLQLHRPTDTKESTAPSLPLRSMALR
                     LLITVLQQRPHWLLCEETRATIFPNLLTELREDTKLQGTFDLSGYTHRVDKGLECRKL
                     AFESLSAVFRAAHQHNVDLIEYCEAEASVVSTLIVACSSHGSGDSESSINDTAKNLIV
                     RFVERKPRFVFTPSQLDSLVSKLLHDIQWGTSSTDAQKTTLLYTIRCVMRLSSHPVFA
                     YHTGFQEVAEVARRSALLAQSLKL"
     gene            <83913..>85397
                     /locus_tag="LMJF_27_0320"
                     /db_xref="GeneID:12982623"
     mRNA            <83913..>85397
                     /locus_tag="LMJF_27_0320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721790.1"
                     /db_xref="GeneID:12982623"
     CDS             83913..85397
                     /locus_tag="LMJF_27_0320"
                     /note="previous protein_id=AAZ09778.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721838.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982623"
                     /db_xref="UniProtKB/TrEMBL:E9AD09"
                     /translation="MRRCIRLVYACSSGAKAGAAPPLAVLEASASSSVRLYQKCLNPM
                     TSAGDVANLTAALLRAIGRGELALHQQVQLLRTLAARSIRYEDVMLKCLWTVFKAPSP
                     TDDDFSVESSEGRGCYSLSELSAYTSSAFQVMAEQRFLNDPQMTAVALGRCVELIPYA
                     SLDGLRSTYRGLRAVNHMFFSVAEVAHHSSEVTEWMTTKEFYEAADVPDEETLRHQPN
                     LLDVLCGEVELQLRRLCDAFARGAPGPFEVEDALPAPVATGALLTPSAARDTQEEQWF
                     LDVLEALAVVGVLHASTLDSLTDLVSRYCTQSSAGFFIKALTHATLIEERVVDPLTYE
                     ESAGVRDARRRLTLHLSGKILQARSIHGYLRRHPQELLLLRRLFEHDTAERTLSPDLW
                     DAVRTIHVAHRHTVAASQTSRRPAGALFHKMYDVKVKPISVDNAEMERFVPPEFKTWR
                     SPAATPRGGHPRNRRPPRRMAFGTRRISKNYIKNKRRKFCPAVF"
     gene            <86103..>88478
                     /locus_tag="LMJF_27_0330"
                     /db_xref="GeneID:12982624"
     mRNA            <86103..>88478
                     /locus_tag="LMJF_27_0330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721791.1"
                     /db_xref="GeneID:12982624"
     CDS             86103..88478
                     /locus_tag="LMJF_27_0330"
                     /note="previous protein_id=AAZ09779.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721839.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982624"
                     /db_xref="UniProtKB/TrEMBL:E9AD10"
                     /translation="MLLLNQHIRGGAVARRSIPGDSWPSSVGAPCATAPRGDAHALRS
                     RKRKAATAAVAMLDPREPPRPSVQHVGRPAKTDTAVSRGRHRQQGPSAPSLDRGAYHL
                     APLDRALATVAAPHLPVQTRKASLPFAQLPAPLARQLVSSDAVIGPVQMWPAVTSSRQ
                     RRRQAALNSKAPLALQLEAFIRREHQQYRREHPLCSRADCLHIFREVFSTFVNHFSEY
                     KGILSIIRDEYDAALNEMSEKVKQMQMEYLESQTDRELHAMEIIQLKESMNATISNQK
                     AQLSAAQELVHAMRDQVTAAEHANSLLTLEMEQKRKTHMEAQQQVKLLSHAMIEESAR
                     TAAARESTRKMEKESQLQEARITVLKEKVAELEEALRRQTYAQIEGVGHLPATGAAAA
                     ALRGTLLCANQIPCEGGDATAGTYSKHFVTRILARIDALEMQLAMVPKKDTAAPAGAF
                     SVGNVALHPKPLPNPASGDTVARDFPAARSSVDAALPVIREWLQREGVGEAEVEPTDV
                     IVPPGRNPSEAMGFLSATLPVKHRHLSLPVTLQLMESMWTARAKTPESSRLPQFFLEW
                     LQTQAGNPAEAKALGVNLLDTCQHNIHHPDCRALLAILRGFLPEELVHMCRRRIVQLR
                     LSTATSAATLHNKMAFDAFFVEVRAVCPEKSLANMLHLRFTVFRSRNEAGEVELGHVL
                     SEDSYFVTLFKQQWLQEVEAFTLRVVEGIRDESDEKRNSASLAKATRVLQRLDAALGE
                     EVYTYVSLASQRPVIDVSATEGITVPLDAMLRRFRTSVLLYRRSPEELVDI"
     gene            <89511..>90632
                     /locus_tag="LMJF_27_0340"
                     /db_xref="GeneID:12982625"
     mRNA            <89511..>90632
                     /locus_tag="LMJF_27_0340"
                     /product="putative MP44"
                     /transcript_id="XM_003721792.1"
                     /db_xref="GeneID:12982625"
     CDS             89511..90632
                     /locus_tag="LMJF_27_0340"
                     /note="previous protein_id=AAZ09780.1"
                     /codon_start=1
                     /product="putative MP44"
                     /protein_id="XP_003721840.1"
                     /db_xref="GeneID:12982625"
                     /db_xref="GOA:E9AD11"
                     /db_xref="InterPro:IPR000999"
                     /db_xref="UniProtKB/TrEMBL:E9AD11"
                     /translation="MAPPQTTLSLDANLRNTLRSLLIERLCSPTQPLPAKQLYDELTN
                     RSRLVEEFHFSKTSRRITRQRLALQFLRRYNVLLHGLFFYSEGTRTWNTTTEFHRLAI
                     LGESVLLTEVRTRLLKLFPVMPYAAYVQSLPHMVGEEALAAAFDRYEMQNIVGAKPSN
                     QRSGTPLTRMQKSHMLCAIVAEMYWFTARTKPTDLTHNNALFPPSDVLILHVLSTHLL
                     ENLPAELIYNVVEPIVADIKRVWVNEPMSLPSQLRLTPRTVGALSLNAVPVDLRYTAK
                     EDAVMSLQKKHEEAHRRQHALTREPDHSCVKSFMRPSCNYRIFDGPRYQILSSDNRVA
                     PLPLAQERSSLPASAVCTVVDDADSAARAMELAKMAEQW"
     gene            <94059..>95546
                     /locus_tag="LMJF_27_0350"
                     /db_xref="GeneID:12982626"
     mRNA            <94059..>95546
                     /locus_tag="LMJF_27_0350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721793.1"
                     /db_xref="GeneID:12982626"
     CDS             94059..95546
                     /locus_tag="LMJF_27_0350"
                     /note="previous protein_id=AAZ09781.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721841.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982626"
                     /db_xref="GOA:E9AD12"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9AD12"
                     /translation="MMNFKQAKAWEDISLCRSVSTISSSASTAEATAGNDVSSFLFDD
                     YRDDAFSTKSRCKYWLSVGHLSLTTADAELKSLFYPYGADEAFTAWEGAIMTGFVGFD
                     SPEMADLAVQKMHAFIPRGQSQALTVHAVTLEEVSQARSKSPKSLLAVLYSECATQGI
                     SAMIRRSKAPVAVARDVAMEVARASPVVLQRLLAALSDLSPQWFGFASFSEELLKSLL
                     GSLLEAGELNAAQTINCGSAVGNLFQMKMVTGDPYYLAGRLLLKAGHRLGQLEGICAL
                     AHTCAMLPNCHMSRASFWAQVADIATKVTDPETNHALLGHLRRYTKTSAHVATTATSL
                     LSSSVPSPSVFSTMPCASATATPQQVVRQHVFPQHPRQDEMKRRTIYVSHLPGLLPQS
                     MLLELLTTAGPVNKVRICAGAGYCTLFAFVEMRTLEGAQRAMCMNGLQLMGFAIRVQT
                     ARNAVQDVVEEDARFDANGALIQPCLFGMSQAPLSKCLSPAEWTH"
     gene            <98891..>100861
                     /locus_tag="LMJF_27_0360"
                     /db_xref="GeneID:12982627"
     mRNA            <98891..>100861
                     /locus_tag="LMJF_27_0360"
                     /product="putative ATPase"
                     /transcript_id="XM_003721794.1"
                     /db_xref="GeneID:12982627"
     CDS             98891..100861
                     /locus_tag="LMJF_27_0360"
                     /note="previous protein_id=AAZ09782.1"
                     /codon_start=1
                     /product="putative ATPase"
                     /protein_id="XP_003721842.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982627"
                     /db_xref="GOA:E9AD13"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9AD13"
                     /translation="MIRVPSNWACAQSPCAFVEVGDECYLCRLVPVFAATLTYELETS
                     VRVSLLEARRFASQDFALAETHHVVHAPGPSGIEYHPCAPGDRSREAMVIRCPVFHYT
                     AKEVTVNGPRRATRATAAHIAAALMGRYVVVGAQFRTQDGVYTVRQVTLQKGYRGIAL
                     VSSDCRVRVNDAQRVGSGGLDGRGAARPIGLESETDQLLQLLACADKSAGALVGVMVR
                     GPRGCGVSSTVRYALERVAATHTVLGWSSWFSPSEVFQEGWGGTVVLVVTGTERVFAA
                     AEPEVAKLHLRKLQRDAAVLRGGGGGAARSVVVLCVSHDYGLCATDVLDELVAFHLVV
                     SFPGASQRAALLASVRGGSATDWLSAAQGLVGRTCAETLEAARRPDIASVLPFKAVRW
                     SEIGGLVEVKDRLHRALVWPQQQPELMQRFHLTPPRGILLYGPPGCAKTTLIKALCSE
                     GNFSLIYLDSATVVSAYVGESERYLRDVFTRARRQAPCIVFFDEVEVLGGRRVSGGHD
                     TEHVRLLSTLLTEMDGFADIHGVCFVGATNVPHLLDPALMRPGRFDYMVHVPLPTLAD
                     RESILQLLLCKTAADTRIIAEQTEGFSGADLKIFCSEALLALFKESAGVPLVLHERAG
                     VTAYLLQWASGFQRTHYDSAALDQFQREHASV"
     gene            <101715..>102299
                     /locus_tag="LMJF_27_0370"
                     /db_xref="GeneID:12982628"
     mRNA            <101715..>102299
                     /locus_tag="LMJF_27_0370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721795.1"
                     /db_xref="GeneID:12982628"
     CDS             101715..102299
                     /locus_tag="LMJF_27_0370"
                     /note="previous protein_id=AAZ09783.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721843.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982628"
                     /db_xref="UniProtKB/TrEMBL:E9AD14"
                     /translation="MNVEVTGRCFFTGDDYYISLPITNRAANRGEPRQLLCSEMIHWD
                     DYRQERGINDGKPPMQQLFASSYAEPLVRTFALGNDTYVTQVTGVSATQAGSSSQMFS
                     AEMLHWDDYCAARGINAGEPTMASLFRPFESKSILVFDLNERKLTEFEGNSVALISYG
                     ADRQTYCSEMEHRDDYIRAKTGQAPQPSMASLFA"
     gene            <103624..>108294
                     /locus_tag="LMJF_27_0380"
                     /db_xref="GeneID:12982629"
     mRNA            <103624..>108294
                     /locus_tag="LMJF_27_0380"
                     /product="putative nucleoporin"
                     /transcript_id="XM_003721796.1"
                     /db_xref="GeneID:12982629"
     CDS             103624..108294
                     /locus_tag="LMJF_27_0380"
                     /note="previous protein_id=AAZ09784.1"
                     /codon_start=1
                     /product="putative nucleoporin"
                     /protein_id="XP_003721844.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982629"
                     /db_xref="GOA:E9AD15"
                     /db_xref="InterPro:IPR007230"
                     /db_xref="InterPro:IPR021967"
                     /db_xref="UniProtKB/TrEMBL:E9AD15"
                     /translation="MNAFGGGFNQGKPGAFGPQSQPQQAAFGQQPQVGGFGQQLPQQV
                     GGFGQQTGGFGQPAQPQSGFGQAGMSQAAGGFGQAQQQPVAGFGQQPQVSGFGQQATQ
                     QAAGFGQQTGGFGQQSQQQGGFGQAAAAPQTGVFGQQPPQQMSGFGQQSQQQVGGFGL
                     QPATAIGGFGQQPQQSGGFGQQAGGFGQQSQQQGGFGQTPPQQQGGFGQAAAGGFGAG
                     RGGAGFGAAGGFNQPTAQGGGFGASQPAVNAFGRPQQVQGGFGTQTTAGAQFGGGQGT
                     GGFGAAPQGGFGSQQPAPGGFGQQTATGGFGQSAAPGGFGTAQQTGAGGFGAGRGTTG
                     FGGPQATAGGFGAGRGATGFGQAAQGGFGAQPPAASGFGQVQQQAAGFGAQQATAGGF
                     GQPAQGGFGSGVSQAITGGGFGAAQQQQPQGSAGGFGVQPSAAGGFGQGTGGFGAQQP
                     AASGFGQAAPGGAFGQQSQPAAGGFGAGRGTTGFDVGGGFGGSQQQPQSAAGGFGAPK
                     GAAGGFGQAACGGFGPAAGGFGAQQPKAGGFGQAAPASGFGQAAPAAGFGQAAPATGF
                     GAQPPATGGFGQAPAAAALASAPAAGAGVNVGRPTDLGFMSLPDYNAAPYGNVLLFDS
                     YERPQAAKTTAKTTEDDLKPVVPPARRAMHTWMVTQMRVPDENTLMKQVPASLASSAL
                     SPVALKEMLVPAVQLGGAAAGEPAGAQKRVTHDSPRRPSPTTVDAPIVNAAVPRCTNP
                     AYALEPSLAQLATYTPEELRRVSRFTISRLDGSCEVRFLEPVNLVRVDVAAVVHLGSD
                     GHVALYPDGDAPPLSSGLNVRAEVRVRDPTGEAAEGIARYCAESRAHFVGHRQGCCVY
                     RLNDSSAAAGVSRAALRQDASDTAPLSIIHDEDEHSHDLDRSSDGSEEEDTADMRSVE
                     QPQAATGSGGALAIADAEVRTYTVPPPPATRRPVVERRLALASAADFDLPYALPDMSV
                     KSKCEPFSVKLGTSRRTAEPRVYYVCAQKSIIQRTYLNHPPRLQPSERTIRGMLARSV
                     RAGWSTAGSIAFPSHAELRDGVEAGGAVPEVAGACVVAATPFQWHKPAQKVFTQCAVA
                     LLRLFLQHTDVADDAACPLASIHLHRNKSHNTLSAEKLKVASNVIESVISAAGEASLS
                     RVELLSTRQTCTVLSLLSALYALPEADAAVPNAMEEARYLTQLRHRNLAGWLKTELAA
                     FLDSSAMRAAKLSPAEELVQAMLCHRLREARASAQSVANAELARVLRVCGEGNQFGGY
                     VEMAKSGFKDGEEVRQRVVSLLSGKVEPFIRDEEYTGLNEETAEVRAAPTAATWKQLL
                     GIFTFYGCVPDTPAEDIIHAFLERLRAPSSRKLNPLPPYAERVDTAVLRTHRGKDVVR
                     RGNTFQDAALLLLEGFANGSAPPAACLHPHASSYSGADYLTPFVIVAAIRAVQVPREQ
                     AYRDAELSVLLGVTAELECNDETWFWGLLPLHMIESPANRLDAVRAFCKRNAMRASAQ
                     KQLGEPQADYNRLVSLMRVNEGWLEPVFVPPEEERSVAENMPSVRTHAALEKALAKLA
                     IEAW"
     gene            <109416..>112049
                     /locus_tag="LMJF_27_0390"
                     /db_xref="GeneID:12982630"
     mRNA            <109416..>112049
                     /locus_tag="LMJF_27_0390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721797.1"
                     /db_xref="GeneID:12982630"
     CDS             109416..112049
                     /locus_tag="LMJF_27_0390"
                     /note="previous protein_id=AAZ09785.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721845.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982630"
                     /db_xref="InterPro:IPR007241"
                     /db_xref="UniProtKB/TrEMBL:E9AD16"
                     /translation="MMRPYSLPLPSPFLSALSTSPTLHSCGFPLPAKRPFATTSEKHF
                     LTVHSLYYLTAAVCFAVSASLLFPRSCVRVRQHPGRPLAVGGFVPLLYVCLLVGSLGE
                     CVTCDARARAAPRRRLTLLSALLHPPGPIRPSPSRLKGSFSCLTIMAWQLRASVLRVP
                     RFTLRFAGSGRIEDMRLFTQTLYTYWYHKGFWGATVASAVDFLNTFVLFIVAVIFTMR
                     FDWAVALSCVESECAAHPLVRGLHAPYIFCSTFWGHLWGFIFLTSTVGSCAYELALFV
                     ETYYLQYEVEEVAREAGVDTGFLTPLHRWRYHLQRGLDGRAGHEFIGLCGGDAIALST
                     AGWGEFLETICAAVGRSGSVKFGAPGDPLDPLRAVQGLMQLENYLIALHEADALRGTA
                     LQYVSPSVIRTLIDSMFDAFRTVESRRKCVWAVRSTMVTYAVLYGAGFFFFCVYVTLK
                     VLVKNAAQVKVNYWALSQRMWTTEAQWRFRLYNEVEHLHACRLRAGSEVAERMVDRLR
                     VSNSVSRLVRRVSSTCVFVTAILSFLNPALLIGSSIGGLTLVWWLTLALMLYACAPEV
                     DPREREYAYITDLERLVDSIHYDTAEWFHSADAFYEHITTTFFKNRLLVVVTGLLESL
                     ALPVLLVYALGDGSVEALVEFVLQHSTTVDGVGSIAVGSDWSSSSLSRTPSGEHDSGG
                     FNHASASTQSKDADTSATLLGKPAAATGFAHKRAEKVQLSVASFAAVYSEWTLRHIDG
                     PTGRESPASCQDAALNDFLRQLSLRVRKAAITHAASVASSDELMISRDSLAPSKSVRS
                     ERRFMVPREAAEQRIDGADCETSGLPAFAAGSTTAHEREQLFVSQVSSSRHAFHFSRT
                     TQLPLNRREAADYGTEKGGAL"
     gene            <113047..>113469
                     /locus_tag="LMJF_27_0400"
                     /db_xref="GeneID:12982631"
     mRNA            <113047..>113469
                     /locus_tag="LMJF_27_0400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721798.1"
                     /db_xref="GeneID:12982631"
     CDS             113047..113469
                     /locus_tag="LMJF_27_0400"
                     /note="previous protein_id=AAZ09786.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721846.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982631"
                     /db_xref="UniProtKB/TrEMBL:E9AD17"
                     /translation="MNSTTTAQFEAAWCEVERQQRERLSASTELLNVEVERELALLLA
                     GVRDALTEDQRDIQSEFDKLIRMVEQFQQGVDMWQLKARSSIKMIEEKQRNFALLVEE
                     TSIRAAANRRDSISRLQKRAVETEAHCQQLIVAASKSM"
     gene            <114850..>115815
                     /locus_tag="LMJF_27_0410"
                     /db_xref="GeneID:12982632"
     mRNA            <114850..>115815
                     /locus_tag="LMJF_27_0410"
                     /product="putative heat shock protein DNAJ"
                     /transcript_id="XM_003721799.1"
                     /db_xref="GeneID:12982632"
     CDS             114850..115815
                     /locus_tag="LMJF_27_0410"
                     /note="previous protein_id=AAZ09787.1"
                     /codon_start=1
                     /product="putative heat shock protein DNAJ"
                     /protein_id="XP_003721847.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982632"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:E9AD18"
                     /translation="MQTDRRWQSDGTGQQDLYAVLGVRPDATQDEIKAAYKKSALEYH
                     PDRNHQPGAEEKFKSISAAYSVVGNREKRREYDAQRAMSRGIGGGLYNSGSSGRGASG
                     HSADFPGGMDRGNYQYHQMSKEEADQLFRELFGGMRVDQIFRNLEEEMRLGGIKGNGL
                     GGHVGRSFPDSEQAFRPFFSMESSTANVFVDEHGNRMEETTYTDSRGKRFTVRRMSST
                     DPNASVNQTTDEFYRGRHAGKDGRYRFGNVSSQFQRPNNDFTQNMLGVRSHGRSPLMA
                     FLILAAWTVILSTLLFCCIGFLARHPLFFASVLVLILLGRAARPF"
     gene            <117107..>118096
                     /locus_tag="LMJF_27_0420"
                     /db_xref="GeneID:12982633"
     mRNA            <117107..>118096
                     /locus_tag="LMJF_27_0420"
                     /product="putative ribokinase"
                     /transcript_id="XM_003721800.1"
                     /db_xref="GeneID:12982633"
     CDS             117107..118096
                     /locus_tag="LMJF_27_0420"
                     /EC_number="2.7.1.15"
                     /note="previous protein_id=AAZ09788.1"
                     /codon_start=1
                     /product="putative ribokinase"
                     /protein_id="XP_003721848.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982633"
                     /db_xref="GOA:E9AD19"
                     /db_xref="InterPro:IPR002139"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:E9AD19"
                     /translation="MHRVQNVQSHVGEYAPDILVVGSCFLDYVGYVDHMPQVGETMHS
                     ESFHKGFGGKGANQAVAAGRLGAKVAMVSMVGTDGDGSDYIKELERNGVHTAYMLRTG
                     KSSTGLAMILVDTKSSNNEIVICPNATNYFTPELLRAQTSNYEKILHTGLKYLICQNE
                     IPLPTTLDTIKEAHSRGVYTVFNSAPAPKPAEVEQIKPFLPYVSLFCPNEVEAALITG
                     MKVTDTESAFRAIKALQQLGVRDVVITLGAAGFALSENGAEPVHVTGKHVKAVDTTGA
                     GDCFVGSMVYFMSRGRNLLEACKRANECAAISVTRKGTQLSYPHPSELPAGVT"
     gene            <120228..>122060
                     /locus_tag="LMJF_27_0430"
                     /db_xref="GeneID:12982634"
     mRNA            <120228..>122060
                     /locus_tag="LMJF_27_0430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721801.1"
                     /db_xref="GeneID:12982634"
     CDS             120228..122060
                     /locus_tag="LMJF_27_0430"
                     /note="previous protein_id=AAZ09789.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721849.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982634"
                     /db_xref="GOA:E9AD20"
                     /db_xref="InterPro:IPR017956"
                     /db_xref="UniProtKB/TrEMBL:E9AD20"
                     /translation="MTDVTSSLRPSSRQGSPVPRRQLGILPVSQRSYSRVGSKGMIGD
                     DSPLMSPLPYYPRRRSVTFAGDQSVREERPNYNAAYSTSAPVSPARRGSPPPVSILKL
                     NSSFPAAEEEDSGAAPAYQAAAATVSGVLDRQDRARNSPVPVRGRSNSRQRLAARRKE
                     AQLHRSFYDDSFVEEYVLRAKTELEQEEAEQRRIQEQLRAEQERAKRAERRTSEATEK
                     INALQHAKEVLMAATVRRHTSVTPSPQRAPAEKSKRNSSLLRELEEDPDPEVQAALKE
                     LARSSLAKQQSRVHSSAHQRRRSISIVSADALAKSGEAEDGDDNDTRKRARLEKIVST
                     LLAKKAKSKSKRSVMVIDWSDLDSDADGDTAITEEDWEETAVGLKRQRGRPAKSRSIA
                     LGTEATLVSSAKHVQKPSTKRAASSRKRHVSAEPELGDSLLFEDEAEQPILLPRRQNT
                     RPAPTRSISHIEMGVDDDLLRNVASVERVVRRPPRATRAPVTRQRRIRLASTSTREGA
                     EDMSSFTDSTAWRGRAPQPPAATTGGATGVPPCRRRGSAPRADPNDPMAVFFEAAFPS
                     PSKFDEMMMQAGGLPETRRGGGGGGRGQGRHPNLVLPSSIGRRR"
     gene            <123494..>125155
                     /locus_tag="LMJF_27_0440"
                     /db_xref="GeneID:12982635"
     mRNA            <123494..>125155
                     /locus_tag="LMJF_27_0440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721802.1"
                     /db_xref="GeneID:12982635"
     CDS             123494..125155
                     /locus_tag="LMJF_27_0440"
                     /note="previous protein_id=AAZ09790.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721850.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982635"
                     /db_xref="UniProtKB/TrEMBL:E9AD21"
                     /translation="MSFSSSCTQVPLLLPEELRDEVLSGAAEIIVERGSRNRCFLHVY
                     SEEERLAKVEDIADPDDVVRHAHEKHLSELRWARDVLWADSRFQRFVRYADHILWPAY
                     ESLSKVVNVVHQLILCEEGDNATVLKRARDVAVANGILRREATLPGLHPLKETRLEGQ
                     AILYDVQQVRKRSRDAWAATMPSVLLRVDEEPVDSVAWIAEVKQASYSVSDILQLQLA
                     TTPLKRLVELLSQPEGSPAAAHTASAASTARQQWRGLLEKHRQWAEYHSLFADVEEAC
                     RGWGASEACVARDVHVALTSGSSVQLRTGVHASVLQRLELHILLSPRFRKLDSFTAAE
                     QAAFSAHCPARSWGECVKEGMVRVVALPPTGLTPAKLDTLVRQLFLTPALCDVPLAQC
                     CTVGEARSITADLQVVHVTSTFNPFVVVHGSRVSSGFAGDVPYFSSLQHERDRLITDR
                     TNAQLRQGLHEATSRGTSGAPSDFVSLQSSSQRAPLRITGDAAIAAFNRALISALAVS
                     PLSRVGIQHHPAMLEYRDAVNYEAVLKVALKEHAEFKGRKYQLRD"
     gene            <126793..>127785
                     /locus_tag="LMJF_27_0450"
                     /db_xref="GeneID:12982636"
     mRNA            <126793..>127785
                     /locus_tag="LMJF_27_0450"
                     /product="ribosome biogenesis protein"
                     /transcript_id="XM_003721803.1"
                     /db_xref="GeneID:12982636"
     CDS             126793..127785
                     /locus_tag="LMJF_27_0450"
                     /note="previous protein_id=AAZ09791.1"
                     /codon_start=1
                     /product="ribosome biogenesis protein"
                     /protein_id="XP_003721851.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982636"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR007109"
                     /db_xref="UniProtKB/TrEMBL:E9AD22"
                     /translation="MGKGARSKRSTRPYAKRQHVLESKAQEVDPALLERYRNTQQPIR
                     KSQLFTEILKQKKDTKRARRESRENERRHLKEKAPVKATPKTKERKRRVDVTIIENKE
                     DAEIINDEADDEFAAFFRDRKNPKTLITTGEHPCFRTKQLVKELLWLVPNSIYRPRKS
                     YTLKEITLFCCNREFTDLLVVTDRIKEPYNLIVSHLPEGPTATFRVSNFLSHAQLEDP
                     APRTEHYPELIFKNFDTRLGRRISRMLECLFPATRDYAGRAVATFHNQRDYIFLRTHR
                     YIFDGLEAVRLQEMGPRFTLRLLSLQSGTFDRQFGEYEWYRKKEHDADTLEWYM"
     gene            <128781..>130658
                     /locus_tag="LMJF_27_0460"
                     /db_xref="GeneID:12982637"
     mRNA            <128781..>130658
                     /locus_tag="LMJF_27_0460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721804.1"
                     /db_xref="GeneID:12982637"
     CDS             128781..130658
                     /locus_tag="LMJF_27_0460"
                     /note="previous protein_id=AAZ09792.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721852.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982637"
                     /db_xref="GOA:E9AD23"
                     /db_xref="InterPro:IPR028131"
                     /db_xref="UniProtKB/TrEMBL:E9AD23"
                     /translation="MSDKVLAIVEQLSQQNPFHDQEDLPDPPRPSETAIPRDRPSAEQ
                     VPFIQKQISILSYNHLPRTFFSLEKHRSLQSILFTAKEVLCEALPIRCLEATFVALHY
                     TQTLRDIDRIPLSFKSEANGNFYRHIVLVLRTRSAPALYGALGLSRKPTLMYKPLAYH
                     SLFDVVMDYKREYEALGHELLDIKLGIAVTHDERSRYDPCWRFIALKLDHYRDGTKER
                     SLKLSSTENHKPTSPRSLQTHARKTSGHVANDSFSSSNGGPTALPPLSPGPPRVETSA
                     HCINGDVSLERSAKAVCASHSETVAPAYSEQFPPLSTCDSTLSPRKPTSSVSPSLTHP
                     PSTTDAAVETYAPLAQLLSNYMRLLPTISEQYYKGIATVDNNNRALKLCFMDLDTAER
                     DSGAENQRRLQLIGEMQSPLSAEAKRVAANRTLKPPKRARGIAKNASGSGSSGAVGRR
                     KTNKRAPLALLPSVGAADGKRAIPSVAVQPHRPPQVQPSLVAPDISYPSASLCTSRSA
                     ESERAASLSALLTGNSHISRPCMPFERIVIDAQNTGSSASPLCSRDGGTEGCTSPCDA
                     DPDSFSEDAFAAPPLTPRNYDERKPLSHYEPSLRSTSSASDLFSTPFSLRAAAMCSPR
                     R"
     gene            <133149..>135215
                     /gene="ABCD1"
                     /locus_tag="LMJF_27_0470"
                     /db_xref="GeneID:12982638"
     mRNA            <133149..>135215
                     /gene="ABCD1"
                     /locus_tag="LMJF_27_0470"
                     /product="putative ATP-binding cassette protein subfamily
                     D,member 1"
                     /transcript_id="XM_003721805.1"
                     /db_xref="GeneID:12982638"
     CDS             133149..135215
                     /gene="ABCD1"
                     /locus_tag="LMJF_27_0470"
                     /note="previous protein_id=AAZ09793.1"
                     /codon_start=1
                     /product="putative ATP-binding cassette protein subfamily
                     D,member 1"
                     /protein_id="XP_003721853.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982638"
                     /db_xref="GOA:E9AD24"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010509"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9AD24"
                     /translation="MLRAHSDLEKWGSVSPAVYSMPLVHRLGVACTSAVFALVLLTQR
                     YYLRRYGQTISAVHTEDDTQVTWDLYHQLFQIARIALPTWRCRESAGSVIFILLFAVK
                     AVLRVWVSKANGEVLAAMLHGVPSERLPRFVSKVMARIAVGLTAGMTNGAIEGLRPWL
                     IGCYRERLSSTFQRRFYNGLVYYQGTMLDNRLEAADTAISTYCGEFAEHLAELPYYFV
                     LPGLGCVASMAALVEQAGLKSALMMSSIATTAVFVLRRVAPALGRIHSQLLSREDDYR
                     RMLTNYLNNVESIAMHDAGKYVLRQLDISLTKLKESLDHMALAKGTFEMMESAFSTFM
                     TVVAQCVTFAGARRSHYHRSINAVYLEIQLIEDLNSSVKDFVVNFRELSHLTEFATKM
                     SEFDNTLKSIAAGTFVHTRHDTNYASLPGSPLVYTQMKSIAHASDAKAFPLVKMEHVV
                     LESPAGQQLLSNMNVEFGSDEDWVIIGENGCGKTSLLRMLCGLWMPKSGVLSQDTSVR
                     FLLSPQHSYMTPQCTLYEQICFPDAVEAPTPEIRAAIREAVELAGAQTVVRVIGGYDS
                     AVMGLDLSNTDESYDWSSLSGGQKERISMARVFFHVLRMDRTKETPVAILDEATSMMD
                     DTEQDVLNHLRRMNVRMISITHRDVVIRHHTKILRIAHGGKWTVEKVRNPVKIDERVE
                     TENAVV"
     gene            <139778..>141565
                     /locus_tag="LMJF_27_0480"
                     /db_xref="GeneID:12982957"
     mRNA            <139778..>141565
                     /locus_tag="LMJF_27_0480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721806.1"
                     /db_xref="GeneID:12982957"
     CDS             139778..141565
                     /locus_tag="LMJF_27_0480"
                     /note="previous protein_id=AAZ09794.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721854.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982957"
                     /db_xref="UniProtKB/TrEMBL:E9AD25"
                     /translation="MSIAASSFMVERTGACAVLDVRHRTVVVAIEAELLDSWASVADG
                     ESMLYVLWALTIPMRVACFADGFYTATAPVPLAFADCVPGMPHHRIVVSLHRWDLSEG
                     TRSALLLAPLDAPSVLVREALEDALGVCRAEAQSPPPLKMAPVVRWRLSGTEMLSPDL
                     LAEVEWQPLLHRRWYELKSYVRQGTVVPHYSARGGRRTTNGADSYHGSAGSLNGGSPA
                     SASVMFAGDVKEADAVSANRACIKWTDGVVGLWDEVKPYYRVYQPARPEKTIRVRRFP
                     HRYADVVGEVPFGQRIEAFGRATDPFTAEPYVLVYLPAEEAFATHMSTYHLTYVEEGR
                     YIWGWSKLSGASGLPLLVEAEDNDAKAGHIPAGPGNGCAIASPARDTRSRVQEGDGSD
                     VMPLPEPTFYTPVRDGHPVSIRSMPCMSSSVVREMEMNEVRAAVALVTVPLRLPADPA
                     SALVSQVFLEWQGGGYSLLRNATESFLAPVQLSRVPRRFPIRTRSGGDDGTAAAPEVL
                     DLGRARSHTHRRSSAASADRDDESKLAEMMRPHRTSARVAVDTSLLSLHSLPACLQEA
                     LKKGVVRLEDLPAIGDDSEANQSDSSSAC"
     gene            <144134..>157795
                     /locus_tag="LMJF_27_0490"
                     /db_xref="GeneID:12982639"
     mRNA            <144134..>157795
                     /locus_tag="LMJF_27_0490"
                     /product="putative calpain-like cysteine peptidase"
                     /transcript_id="XM_003721807.1"
                     /db_xref="GeneID:12982639"
     CDS             144134..157795
                     /locus_tag="LMJF_27_0490"
                     /EC_number="3.4.22.-"
                     /note="previous protein_id=AAZ09795.1"
                     /codon_start=1
                     /product="putative calpain-like cysteine peptidase"
                     /protein_id="XP_003721855.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982639"
                     /db_xref="GOA:E9AD26"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="InterPro:IPR022682"
                     /db_xref="InterPro:IPR022684"
                     /db_xref="UniProtKB/TrEMBL:E9AD26"
                     /translation="MAASSIHEMPDSGEVFADHEFDKNNAGITDDWISIKQLYPSGVN
                     QPLLPEVFSREQFGQGNHYECFMLSALAPLIRFPDVIRNCFVTKKVRQDGRYTFQFFR
                     GQEWVKVEIDDRIAMEEGEVLYVRSPTEHWWPLLLEKAYAKFYTAYDHLEGCTLQETF
                     HDLTGNPVLNIPMDAKLAKAANCNVLEGRYWLDLAQRIQSGEFVASALTKDVEVETMG
                     LQREQQYGVLEIFSLHGTSALDDIVIHLHNPFEDDEFLYSGPLNPNDSAWSEKQRVKY
                     DVINPRSIFLPLNVFLRIVNSMQLCYISTVASDATYFEDEWKGESAGGNPTYVTWRKN
                     PLYCISNHGTEAVTLSFVVKQEDQRHRKGPEETITYKQCGMILSQYSYLYPIPTFWVT
                     GNNHKPIYKGLLLNSREVASSVIVPPQSLCYLVPSCIHQGEEAKFLLSAHRMVHEDYS
                     NITMKKLTVPEMDWESPAVGTVQLQMRTKDRLDFYVDEPTDVHILLHQTKPYVSPKTG
                     GDAMAQDYMGMYLYDDTDRKIAGVHAATNFRETSIIHRLPRSGRYAISITCPRGKGHI
                     PANVTIVSSFGSHIRRVNAPEDAAMLPDEAENVADSEGVDTRVARIDYNPFQEPPVDV
                     REHPDSNVPFEDRGFMLSNRDVTSEPWVHIGDLYPEGKTRPLLPNELSRDQFGQGAMY
                     ECCCLTGFATLLEHHPDVIRNCFISKNPRKDGRYTFQFHRYGQWIKVEIDDRIPMVKG
                     DTVFCRSPTHHWWPLLLEKAYAKFYTLYENLAGCSLAEVYHDFSGCPVINTPLDEPTA
                     KSAGFDITSPVYWVGLRDELRTTAVAAQCGDNAESLGLAPHQFYGILDILATSYPPRT
                     LSEVIVQLHNPYAEIFYTGPMSDPADPRWASREMRHCNATQNTIFVPVDVLLRSFFTI
                     SQAHLRGLMEPCWNFHSEWGDGTNGGNPSLLTWRENPLYIVRNTGSETVEMMGMIRQP
                     DKRHQLHLLPELSYVRCDLLLAQSMETDSIPTYLVTHNNHDVVHKRIFLNYREVASKI
                     RVPPKSQCYLVPTAMYHEKSIFLLSYWYRTPADEGAVSMERLRVNVARDLPAVKHVTL
                     VPEGKDRVDFFVDVPTDAHILLSQWNRDARGGSDVRTDNYVGMYLYDDANQQMAQVSA
                     ASNLKEIGLVAHLPAQGHYVLSITCPASRDEEVKCRVEIVCVEMARVRITDVYENPSS
                     FEELEEEPPVALVDSDTARSDARDDTQSVEATAKTRPPENTEAKEREKTPSLSFMRPR
                     YQGICTADLPLMETPAFAKMAGEREQLKRHALQNAAHMNSLQNKMEDMATRIADDMHD
                     QERVFLGPEVEGVPLELLPLNEDEEFTGLEHELRVAMRDPQKNCDDVVALRETLKERA
                     GEMAKKMKENERELFLNPMPLGISCDGLPLDTDPEFHALEVARLRERQEESCDEAKIH
                     KLNDALNERAEDLARAKLAADRQYLNPEHLRVAVDELPLNEDRNFILKEALRQEKLQN
                     SRESAAAIAALENELNNMAKAMAAEMLAKQRPSYLAPEHHGRRIEDLPLNDSDDFLKK
                     ERRRRDLLKQPSWDIDVVAEIDKELSEMADAMARAMNAAERPQYMKASYYDKTLSELS
                     LDTDSIIARLEAQRARLKRNPVRNAEAIHATEAAIISRAEALAKAMINEERARLYGKP
                     SGVPVNLLDLDDDQVIQRLEEERMELLKMPKTDPRAIASNEEKLKARAAKIAEDFRDN
                     MRVQITGEGHRSPSVMSIGSDAPCQDLEEKLYALLSEDPIANEDQISDIKDAIRKRNA
                     ELKRQAVQELRAFLDDKPFGILLADVGLDHDPEYMDREKKLKKGLADNLLAAQITSLQ
                     EGMQHRVNELAAEELTKRYPFIHTHPAGIPLAALPSVGRDQPFWEAIDNFDKAKTHNT
                     CPSQLSAYEKPVNERLVEIAEAVKWKERDSFLHSRPGGVPLKALPLDNDHDFIALETR
                     RRTSLQSGIDPQAEDIQTLESALRTRAHDLACEKKWADRDRVLDPKPEGVPLRCVPLD
                     EDPEFVALEDEWRGLLQDPQRNSMPLKDLERRMNDRAHDLACGRKWADRDRVLDPKPE
                     GVPLRCVPLDEDPEFVALEDEWRGLLQDPQRNSMPLKDLERRMNDRAHDLACGRKWAD
                     RDRVLDPKPEGVPLRCVPLDEDPEFVALEDEWRGLLQDPQRNSMPLKDLERRMNDRAH
                     DLACGRKWADRDRVLDPKPEGVPLRCVPLDEDPEFVALEDEWRGLQQDAQRNSMPLKD
                     LERRMNDRAHDLACGRKWADRDRVLDPKPEGVPLRCVPLDEDPEFVALEDEWRGLLQD
                     AQRNSMPLKDLERRMNDRAHDLACEKKWADRDRVLDPKPEGVPLRCVPLDEDPEFVAL
                     EDEWRGLLQDAQRNSMPLKDLERRMNDRAHDLACEKKWADRDRVLDPKPEGVPLRCVP
                     LDEDPEFVALEDEWRGLQQDAQRNSMPLKDLERRMNDRAHDLACEKKWADRDRVLDPK
                     PEGVPLRCVPLDEDPEFVALADEWRGLLQDAQRNSMPLKDLERRMNDRAHDLACEKKW
                     ADRDRVLDPKPEGVPLRCVPLDEDPEFVALEDEWRGLQQDAQRNSMPLKDLERRMNDR
                     AHDLACEKKWADRDRVLDPKPEGVPLRCVPLDEDPEFVALEDEWRGLLQDAQRNSMPL
                     KDLERRMNDRAHDLACGRKWADRDRVLDPKPEGVPLRCVPLDEDPEFVALEDEWRGLL
                     QDPQRNSMPLKDLERRMNDRAHDLACGKKWADRDRVLDPKPEGVPLRCVPLDEDPEFV
                     ALEDEWRGLQQDAQRNSMPLKDLERRMNDRAHDLACGRKWADRDRVLDPKPEGVPLRC
                     VPLDEDPEFVALEDEWRGLQQDAQRNSMPLKDLERRMNDRAHDLACEKKWADRDRVLD
                     PKPEGVPLRCVPLDEDPEFVALEDEWRGLLQDAQRNSMPLKDLERRMNDRAHDLACEK
                     KWADRDRVLDPKPEGVPLRCVPLDEDPEFVALEDEWRGLQQDAQRNSMPLKDLERRMN
                     DRAHDLACEKKWADRDRVLDPKPEGVPLRCVPLDEDPEFVALEDEWRGLLQDPQRNSM
                     PLKDLERRMNDRAHDLACEKKWADRDRVLDPKPEGVPLRCVPLDEDPEFVALEDEWRG
                     LLQDPQRNSMPLKDLERRMNDRAHDLACEKKWADRDRVLDPKPEGVPLRCVPLDEDPE
                     FVALEDERRGLLQDPQRNSMPLKDLERRMNDRAHDLACEKKWADRDRVLDPKPEGVPL
                     RCVPLDEDPEFVALEDEWRGLLQDPQRNSMPLKDLERRMNDRAHDLACEKKWADRDRV
                     LDPKPEGVPLRCVPLDEDPEFVALEDEWRGLQQDAQRNSMPLKDLERRMNDRAHDLAC
                     GRKWADRDRVLDPKPEGVPLRCVPLDEDPEFVALEDEWRGLQQDAQRNSMPLKDLERR
                     MNDRAHDLACEKKWADRDRVLDPKPEGVPLRCVPLDEDPEFVALEDERRGLLQDPQRN
                     SMPLKDLERRMNDRAHDLACGKKWADRDRVLDPKPEGVPLRCVPLDEDPEFVALEDEW
                     RGLLQDPQRNAKRIAGVEEDMSARALWVAQAINQWKEEGDREEYEEYVKRGASDFRDV
                     DDRNTDDLTLATSVVNGTLSMKEGFKELLGTEVDGVPILLLNLDEDSVFSERNRVYME
                     SGRLGLDRSRLSRLEEEMLDRAHALARRFKDAVRKVIVGEQMSQMAEGGAELDSDEMF
                     LALERELHNLEACDPHGKSGRRAALEESMRQRASELAKPLPHIDNRGIPVDMLNERSN
                     GDLCHKRPSGGQQRRSSTDTGHGELGMDKRGCHIADEAVADDALLFFGREVYGIPVDR
                     IPLREDEVFRGLAEERRRVTSHPEDYSAAYKEEVEDAMRRRVEELADEYKRDHAERTA
                     ARDERPKMPAKPNGVPKESGSAARRPRAKKKLKEVEERTEEHRLETVEEASPFTDPSF
                     HSANKQVADTWPRIADVYPEGLTQPLLPDYPKASDMASSAGDLTYLAPFLAALSRHPP
                     LLHRLFQTKMHPVRAPYRFVFFDPNSVPVTVEIDDRIPCDVNGVPRFTVSPSGAWWPL
                     LVERAYAKYVGGYERFDQCTSHETLRDLTGRPVTHLPLDAKLSAEVVGCNYRDVAFWR
                     RIHEQLERGDVFVAVSGDLVPDGIHPHCYYAVFDVIETVPGSNDPSDVVVKIHNCYHD
                     APQYRGPLAMGDSDWTPILRSVCKADPESEPEFLYLPQPVFLRNFSSMQRCHINCGDR
                     LTVSGEWADDCSGGSPTYTTFRQNPMYLLQNNSNCSVTVLAELRHSAPVYYDAHSMGV
                     YHLTALALLRPDRNAQLVAPLLAHNTHKFVQKGLLTDAREVCAEMELPANSTCYLIPY
                     TKKKACFGKYQLSVYPQDNPVNLTTLRPITETHNCMTKDVVVQPGSGTSARVDIMVSE
                     PCDVHALLHQNKVTDPTAMRRGDYLAEDEIFMAAYEKNALLVCSTGDASNAREHSVAF
                     RAARAGRYTFLIGCPSRPVSGDAPCTLIIYTPKFAQANFASVNESTRSRVPPRVQPVN
                     AATTSASARLGLRQFQAPQSSAPVSNGAVHTPRGNPRSREYSQ"
     gene            <164885..>183379
                     /locus_tag="LMJF_27_0500"
                     /db_xref="GeneID:12982640"
     mRNA            <164885..>183379
                     /locus_tag="LMJF_27_0500"
                     /product="putative calpain-like cysteine peptidase"
                     /transcript_id="XM_003721808.1"
                     /db_xref="GeneID:12982640"
     CDS             164885..183379
                     /locus_tag="LMJF_27_0500"
                     /note="previous protein_id=AAZ09796.1"
                     /codon_start=1
                     /product="putative calpain-like cysteine peptidase"
                     /protein_id="XP_003721856.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982640"
                     /db_xref="GOA:E9AD27"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="InterPro:IPR022682"
                     /db_xref="InterPro:IPR022684"
                     /db_xref="UniProtKB/TrEMBL:E9AD27"
                     /translation="MSVEEVPDSNKLFSDAVFDRENAHIAREWQRITEVYPAGVNQPL
                     LPEVFSREQFGQGNHYECFMLSALATLIRFPDVIRNCFVTKKVRQDGRYTFQFFRGQE
                     WVKVEIDDRIAMEEGEVLYVRSPTEHWWPLLLEKAYAKFYTAYDHLEGCTLQETFHDL
                     TGNPVLNIPMDAKLAKAAGAEVTEGFYWLVLAQRIQSGQFIASVLTKDIELETMGLQR
                     EQQYGVLEIFSLTGTSSINDIVIHLHNPFEDEEYLYKGPLNSKDMTWDGKQRAKHDVD
                     DERSIFLPLNTFLKIMNSVQLCYMSPVEADATYFHDEWKGESAGGNPTSVSWRKNPLY
                     FVRNSGSTAFEIVVVIKQEDQRRFTSPDEMTKYLQCGMVLIHYSYANPIPTFWVTGNN
                     HKPIHKSLFLNSREVANAITIPPNSLCYLVPSCMHKGADGPFTLALYRMKDVDYSDLT
                     INKLAIPGMNWANCATKNVELCQKEKDRVDFYVDEGTDIHILMHQTKPYVSKSGGDAM
                     TEDYMGMYLYDDTDRKIAGVHAATNFREISIIHRLPRSGRYAISITCPRAKGEVPAYI
                     TIVGSHASNVRIVDPPEDATMFDDEDIIDEGDDAALVDNPIDYAPVVFDVAHHDEQAE
                     SDSPFEDKRFYVDNRGATSEPWVHIGDLYPEGKTRPLLPNELSRDQFGQGDHYDCSTL
                     TAFAALLEHHPDVIRNCFISKNPRKDGRYTFQFHRYGQWIKVEIDDRIPMVKGDTVFC
                     RSPTHHWWPLLLEKAYAKFYTLYQNLEDISEGEVFHDFSGCPVIFIPMEADKAKVVNY
                     DIKSAQFWRDLNNELDQTALAALALGEQAEQYGLHHEGSYAVLGFIETRNAINLTPAD
                     VLVKMYNPYEDSPYTGPMHRDDSSWTSEMRSICNPAQRNIFYIPANVFLDVFANVQQG
                     YIKAPLGPSYNFNSEWGDTTSGGNVSLVTWRSNPLYVVRNKTEEPVQIIGMIRQPDQR
                     HLLHRQTNHELNYIQCALVLAESISAERIPTYLVTGNNHRRLRSGLYLHNREVADVMT
                     IPADSLCYIIPTGMRRDRGKFIFSYWFLRKGDNDKLDIERLNTDVARQLPAIAHLDLM
                     NRGHARVDILVDVPTDLHILLKQEKPFKHVSGGDAIAQDFLSMYLYDANDKRISPSTQ
                     ATNNREIGLVQHVSKPGRYAIGVNCTSGTGDVPCKVEVVAQERAHVRITEAPENAREL
                     GELDLSFLDPEPEGVPLADLPLEEDLKFQEQLDALKRLHHKPHRNEDEILALERKMNS
                     RAHELARALLGKDRCKYLIGQDIEKLAPLLDSDPEYMNAERERHNLKKDPRNAGRVRA
                     VEEELRERAAALADTSAGTDLGFMDLEYEGIPRDDIELLNDPAFGEMAQARAGLLSDP
                     AANARKINDMEDKMHDRATEMAKDMHKKERTYLDPEPEGVPLDLLPLNEDEAFSRMED
                     ELRALNRKPKRDAKAIKDLQRTLNDRAHELAGMLKSDERELFLDPVPLGIPVTDLPLD
                     TDPEFHLKEVERLQLRKEDPLGNRDDIKTLEDELNDRARELAKDQQVNQRAFLDQDPY
                     GVPLEKLCLDYNDDFLRKESELRALQKNPRRSAAAIADLKADMSDMVDALAAAEAARD
                     RNFLDPEVEGRLVHLLPLLENPEFKELDTKRRRVLNRGGDTSKVVSMEDRMNDVALEI
                     AHDMNVAERPDYMDTAYKGIPVEDLPLDEDPLFRSLEVKRQQQKQDPRRNARGIADTE
                     QDLNDRAMELAAEKLKGDRHYLDPEPEGVPLRLVPLDSDAAFAEMEAQRAKLKKDLRR
                     NTKPIAEIENLLNDRAHELAKSLKEKERPRFLDARFSGIPYTELPLDADQPFRDMEVQ
                     RLLLKEQPHKNATAIQDLEEALNDRAGELAKEKLAKERAFLDPCPLGIPLEELPLDST
                     PVFIAKEERLRSLNKDPYKNAAAIKMLQGEMDDMVNALAAEELARMRGFLDPEPEGRL
                     VESLPLNDDPQFHKLEAQYRDLKKSPKANPQDVADCEELMNDRAHELAKEMNREERPD
                     FMNMKPRGVLLEELPLDTDDEFSNLEAQRARLMRQPAKNKKAIGEIEDALNLRAEELA
                     QEKIQADRAFMDEAPQNIPLKYIPLDKDKEFGRMEAQRMALRAQSQNSRALIPKVREL
                     EDAMNQHANDMAKALKQQVRASVLPPRVGGIAREALQLDDDVPFTDLEVAQIAANGDG
                     DLDKGRDLCDAMQKRAADVAAKLRWEERANLGNPLGFSPEDLPLERSPEYLQKESALL
                     EMRANPKKNAQTIKGAEEDLHALAMEMAKEKAAEERVDYIDPEPEGRKLNDLGLDDDP
                     TFVGIEEQYRRSRKDPYADQDRLRDLEQMMNDRAHDLAKMKNARDRDMYLDRAPRNVP
                     IVELPLDTDEEFGRLEAQRAKLCQNPVRNAQSIRETEDALNDRADVLAAEALKNDRIF
                     LEAEPEGVSQRQLPLDLDQTFRSLELKRAALKSATVKDDRAIRAVEEQMNDHLRKMAR
                     EVKMDARGDMEPNSLGIPSEDLNPYLDEDPHFHELEDMYRDAKNNPTKAKKASRLLDQ
                     MNERAREIAQAVHDMERRPLNQAPNGIPLETLLLNEDPVFSALENEARALRKGPSGGK
                     KSAERLADVEDRLNARAEELANAARKQYVDATPEGVPMELLKLGDDPSFVNAEAELRR
                     LEKNPVANRQGIKDLKDELNSMAHEKVKRLLRGDRGYLHQAPDGVDLCHLPLDTDPVF
                     HELETRRAKLKSEDPRAHQKAIAALEDQLNDRAHELAKEVKEGELRALEPDPHGIPYA
                     VIIPHNDVEFNNCAKHLRDLKSDSKRNAAAIRETVDRMNDRGAELAEAMLKQDRSYLE
                     PQPAAVPLKYLPLDTDPQFNRIEVERAKLKARDPVKNAKKIQELEDQLNERANQLAEA
                     QKQEDLRGLDPKPEGIPLYVMDPHSDAKFASCLPQLRDMKADPRTRPEDLQQVVDAMN
                     NRAHELAGEKLRGDRLTYLEEEPKGVPLDLLSLDTDPQFHDIEAQRAVLKAQDPRRNA
                     AKIRDLEDRLRERSNELAEQQRAKDLENLDQVPEGLPITLVNPHDDPAFAKMVNQHRQ
                     LAKDSGKNSELLTKLDEKMNDRAHELAKLMLGSDHSFLDPAPQDVLLAELPLDTDPEF
                     HRLEVERAKLKAQDQRRNAAKIKDIEGQMNNRAHELAREQLAEDLRGVDSAPRGLPVE
                     LLNPHADSQFAEAVKQIRTLKKSPIADPKAKLAMLDKMNDRVRAMAEETMDRDYLDPE
                     PEGVALADLPLSSDPEFHDMEVERARLKLRDVKRNARAIKDLEQRLNDHAHELARRQL
                     EEDLAGCDPEPEGIPLALLKPVEDPKIAGMIPQLRALRKDPKKNAEAIWSVENEMNNR
                     ANELARQLLEGDRGYLEPNPENVALEYLSLDKDPEIAEMEVERAKLKAQDPRRNQHRI
                     ADLEDRLNDRAVELAVAKKAEELAHFAPQYNGIETAAMRPYDDPEFSALVDQLRKLEK
                     ASAGASPEAEKVLTDMDARLEVLAKEKVEGDLWFLDKEPEGIPLEEVGVESDPIFQQL
                     RQERANLKAKDPRRNADKVKSLEDQMGSRAHELAKHLKESDFDGVDTSPLGIPLELLR
                     PLEDPQVARILPELRRAKKSLRDTQKAQSLLSELNGRIHELAKNALSGDRSSYLDPNP
                     EGVPLSDLPLDTDGIYSGLEVERAKLSLKDPAKNAKQIEDLEDRLNERAHDLAQQVLK
                     DDLKNVDPKPRGIPIEAVRPHNNPDFHNLATRARELRKDSRRNANKLASIQEQMNDLA
                     NQMAAEMLGNDRGYLDPEPEGVPVEMLLLDEDPEFHEMEVQRAVLIAQDPVKNRQAIA
                     DLEGRLNDCAHKLAEAQKREDLRGLNNAPLGVPVSLLNPHDDPRFAAKLPELRAQKKE
                     GFPRAQSRLNDTQAKLDEILEELAEQYLEQDRAQYLHPTPEGIPVAALPLCVDPEFRQ
                     LEAERLDLISKNPKANKDAIKDLEAALNERACELAREQRKGDRGYLNAEPLGIPLDVL
                     PLDTDRQFSDLEAKRATLKTKDAVRNAAAIHDLEDQLNDRANQLAEDQITEDLRAVDP
                     TPEDIPVQMLKPHDDPEFARMVNALRLLKADPSADPKKVSDLEQDMNDRAHELAEEAL
                     AGDRPMYLDPKPEGIAVESLPLDSDPLYHRLEVERAKLLLQEPKKNQAKAADLEGRLN
                     DRAHELAKEQRARDLQDLDEAPRGIPVELLNPHEDETFASLALQRRDPNNTLRKALDI
                     GGTNGDPTRDMLNERLDEMAKQMLEGDRDYLDPNPEGVPLRVLPLNEDPEFHEMEVQR
                     AVLKAKNAKKNAVAIKDLEEKLNDRAHDLAKDALNGDRDYLAPEPEGVPLADLPLDKD
                     PQFHQMEVERAKLKAQDLKKNANKIKDLEDKLNDRAKTLAEVQKKEDLRNLDGKPRGI
                     PLESLNPHDDAEFASHLPELRRLKNEQPNHPKIKDLQAKLDNRADELAKAQIDRDRAF
                     LDPEPEGITLAQLPLDSDKLFTSLEKQLRQAKQDPKRNADKIADLQDCMNKRVHELAR
                     DLLKGDRGYLDPEPENVPIADVPIDADAMFRELEAQRAKLKEDPKRNADTIKDLEGKL
                     NDRAHELAKAEKEAARGFLNPTSHRVPKALLPLDEDAAFAKMEQQLRRLNKDPKRSAS
                     AIDNLKGMMQDRADELGENLLKGARDKYLDPNPEGVPVGYLPLDSDPQYSHAELQRAV
                     LKAQNAKGNAAKIADLEKALNDRAAELAKDQRQKDRAFLDPEPEGIPIADVPLDGDTK
                     FLRLEDYLRKLKKDPRRNADAIADTQESMNDRAHELAKGVVAEDLACLPRSAYRGIPK
                     EDLNLHTYLRFRDAANRQRDAKRRRLPTTDIQLIKDEMDRIASEIADDVIDNERAFLD
                     PEPEGMAIANVPLDADKEFAALEAERRRRSKDPRAAKRNKDVIRDLEDKMSDRAHQLA
                     KEEFAKQRDFMDQEPEGVPLERLPLDTDPEFKDAEIARYKTKTDPRADAKKVTALEKR
                     MNERAHELAKVELAKDRAFLDPEPEGVPLADLPLSDDPEFNALAKQRQALKNTRRGRD
                     PEMKDLEERMNDRVHGIAREFLSKNRGYLNPEPQNVPIADIPLNRDPVFREMENELMK
                     AMKDPRSNAGKIAELQDDLNNRADDLAKDLRRKELANQEQEPLGVPLEELPLNYDPIL
                     NPLERKRRDIKKNPKRNADALRNLEREIAARIDDIARDFLAKERAFLDQEPEGVQLER
                     LPLSDDKEFHEMERDLRALKKQPAKNKDAIEDLEERMNDRAHDLAKDYLAKDRDYLEK
                     EPLGVPVEELPLNEDVTFRDVEEKRRALKKDPRGNAKAIKDLEDQLNDRAEQLAQQKL
                     DKERAFLDPRPEGILLKDMQLDRDKAFKDMERQLRQLRKDPRKNANAIRDMEDDMNNR
                     AHVLAKRQLADDRNFLNPEPRGVPLVDLALEDDPEFRKTELARREAKRNPKNADRVRE
                     LESILNDHVDRIAGEYLKKDRAYLDPEPEGVPLEELPLDTDPDFHGMEADRRKLNKDP
                     AKNSRTIKDLEEQLNNRARELARDKKGYQDAVFHEANEDIAEQWPRIRELYPEGVYDP
                     VTPDTTLPSDVSSAPQDMGFLAPFIAALARHTVLISRLFQDKAHPQNQPYRVTLFNPD
                     SSPVTVEVDDRVPCDDKREPKFTQVPSRMWYPLLLEKAYAKFVGGYENFNNCNAHDTL
                     RDLTGRPVLHISLEDPKHAAATNMGDYTTPAFWRRVMEDLDRGDVFVCVANGSVPDGL
                     HPQCSYALMDVVEVKPCTSDPLDIVIKVHNCYTDAPHYNGPLRKGDSNWTADVKRACS
                     LSPDESDMIYMPLSTFLSNFSCMQRCHINCGDRLSSPGEWNDYTAGGTSKYTTFRSNP
                     IYLVENKTSRPATILAEVRHTHPLYVDETNCKQYPYTGLTLMQPSNAKLPPTPFITNG
                     THKFLQKGMMLDSREVCAEMELPPSSTCYLIPYTKDRGTMGEFFVSIYPDMAKVTLTP
                     LRHAGLTLKPLCTSLSLHPGDEEGERLDFMVNDASDVHILLHQTKISDPNSIRKGDAV
                     AEDEVTMTVFNEYGIKIGTTGDSSNAREHALIFKAPQGGRYSLLVNCTVSATGDPCTA
                     NLEIYTPTDVSADFVPVAPDAKPLNAQAQSRFPTLSRTATAPGASRGASRAGSNVRRT
                     DSLPPINQRSLSSRRGSREEVGHRSSRGRR"
     gene            <194587..>210663
                     /locus_tag="LMJF_27_0510"
                     /db_xref="GeneID:12982641"
     mRNA            <194587..>210663
                     /locus_tag="LMJF_27_0510"
                     /product="putative calpain-like cysteine peptidase"
                     /transcript_id="XM_003721809.1"
                     /db_xref="GeneID:12982641"
     CDS             194587..210663
                     /locus_tag="LMJF_27_0510"
                     /note="previous protein_id=AAZ09797.1"
                     /codon_start=1
                     /product="putative calpain-like cysteine peptidase"
                     /protein_id="XP_003721857.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982641"
                     /db_xref="GOA:E9AD28"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="InterPro:IPR022682"
                     /db_xref="InterPro:IPR022684"
                     /db_xref="UniProtKB/TrEMBL:E9AD28"
                     /translation="MSSPFTEVPDSNTLFKDTEFIASNQDVADQWVSIRDLYPSGVNQ
                     PLLPEVFSREQFGQGNHYECFMLSALAPLIRFPDVIRNCFVTKKVRQDGRYTFQFFRG
                     QEWVKVEIDDTIPLEDNAVLYARSPTEHWWPLLLEKAYAKFYTAYDHLEGCTLQETFH
                     DLTGNPVLNIPMNAKLAKAAGVNTKDGLYWLSMGECLLRGDHVLSALTTDADLESIGM
                     QSEQQYAILGIFSLTGSSALDDIVIHLHNPFEDDEYEYSGPLNKKDSKWTAKLRQQYP
                     VDDRYSIFIPLKLFLKSMNSIQHCFMRTIDAVSQTYSAAWEGESAGGNPTFVTWRKNP
                     LFLVRNSGPTELKIVTMIQQEDQRRLSSPDSDTSYAQCGVVVTRFTYQQPIPTFCVTG
                     NSHKTIFKGLFLNSREVANAITIPGHSMCYLVPSCMQKGVEARFQLSLYHFKDQDYSQ
                     LSVEPLSIPGMNWVNCATKNVELCQKEKDRVDFYVDEGTDIHILMHQTKPYVSKSGGD
                     AMTEDYMGMYLYDDTDRKIAGVHAATNFREISIIHRLPRSGRYAISITCPRAKGEVPA
                     YITIVGSHASNVRIVDPPEDATMFDDEDIIDEGDDAALVDNPIDYAPVVFDVAHHDEQ
                     AESDSPFEDKRFYVDNRGATSEPWVHIGDLYPEGKTRPLLPNELSRDQFGQGDHYDCS
                     TLTAFAALLEHHPDVIRNCFISKNPRKDGRYTFQFHRYGQWIKVEIDDRIPMVKGDTV
                     FCRSPTHHWWPLLLEKAYAKFYMRYENLEGISQEEVFHDYTGQPCVSVSTDPAAAKVN
                     MSYFDEVPYWKELASKLPDLCTTALASGREAEQYGLLKERYYAVLDIVSIANGERVRD
                     MLVKMYNPYEGSPYTGPMNAKDDAWTSELQSRFRPGDDSHAFYIPATNFVTAFSAMQM
                     GYVGGLAEPSRHFNSEWGSGTNGGDTSLISWRENPLFIFSNPTNDIVQVVAMLRQPDQ
                     RHLRHAMPNHELVYPMKGLSVAQANPSAEGIPTHLVTFDNHRLIHREEPVAVREVANV
                     LTIPPQSVCYVAGHCNNRAVSKFLLSYWFMRGEDAEKLRIERYRPKVTQHQPAIAHVD
                     LGNRASERVDFLIDTPTEVHALLRQEKAFESHQGGDVIAQDYVGVYLYDLQNNRIKGL
                     PSAMNYREVSLVTHLKTPGHYVFFITCPRSNGGVPCKVEIAAQEEAHARITEAPQNAA
                     PLSTLDMAFLDAHPESIPLSELPIDRDIPFQDDLAALERLLSDPSASAEEIQRLKDRL
                     NERAHALAKAILTSEQPIYLTCHDLHALNPLLNDDQAYMDAERERYYLKQDPRNHYKL
                     PAQEAKLRSIADNIADELLHVDLSFIDARPEGIPRDAIPMSSDKAFAEMTTELLRLRR
                     RPEKNPSAIRDVEHRLGKRAAEIARAMHDAERTYLDQHPEYVPLELLPLNTDERFCAD
                     EDELRQLLRSSSADQNTVTALQAKLNKHAHELAQQLKDGERGKLLADSYEGVPTSELP
                     LDTDAAFHEMEVERLRRVRTGTGADAEVARLEGEMRNRARELAVSKKANERVILRGME
                     IPLTAGQLDALLDKDAETADMERRLRELRKNPDKNATAIKALEKEVQKRAQELADGHL
                     AEERSKYLAAEYGGRAIGTLPLGDDAAYRDAEAAYMKMLESGHADPAALQRLMDTMNE
                     RAAGIAHDINVADRAQYVPKALRGVPLRALPLDDDAEFRRLEHERARAACTPGHKAEV
                     AALEAQLLARADELARARLAGDRAYLAPEPAGIPLELVPLDEDAEFCAKEAQRAELKE
                     SGQTDRSGIALRETELNARAVEVAQQLKDGERGKLLADSYEGVPTSELPLDTDAAFHE
                     MEVERLRRVRTGTGADAEVARLEGEMRNRARELAVSKKANERVILRGMEIPLTAGQLD
                     ALLDKDAETADMERRLRELRKNPDKNAAAIKALEKEVQKRAQELADGHLAEERSKYLA
                     AEYGGRAIGTLPLGDDAAYRDAEAAYMKMLESGHADPAALQRLMDTMNERAAGIAHDI
                     NVADRAQYVPKALRGVPLRALPLDDDAEFRRLEHERARAACTPGHKAEVAALEAQLLA
                     RADELARARLAGDRAYLAPEPAGIPLELVPLDEDAEFCAKEAQRAELKESGQTDRSGI
                     ALRETELNARAVEVAQQLKDGERGKLLADSYEGVPTSELPLDTDAAFHEMEVERLRRV
                     RTGTGADAEVARLEGEMRNRARELAVSKKANERVILRGMEIPLTAGQLDALLDKDAET
                     ADMERRLRELRKNPDKNATAIKALEKEVQKRAQELADGHLAEERSKYLAAEYGGRAIG
                     TLPLGDDAAYRDAEAAYMKMLESGHADPAALQWLMDTMNERAAGIAHDINVADRAQYV
                     PKALRGVPLRALPLDDDAEFRRLEHERARAACTPGHKAEVAALEAQLLARADELARAR
                     LAGDRAYLAPEPAGIPLELVPLDEDAEFCAKEAQRAELKESGQTDRSGIALRETELNA
                     RAVEVAQQLKDGERGKLLADSYEGVPTSELPLDTDAAFHEMEVERLRRVRTGTGADAE
                     VARLEGEMRNRARELAVSKKANERVILRGMEIPLTAGQLDALLDKDAETADMERRLRE
                     LRKNPDKNATAIKALEKEVQKRAQELADGHLAEERSKYLAAEYGGRAIGTLPLGDDAA
                     YRDAEAAYMKMLESGHADPAALQWLMDTMNERAAGIAHDINVADRAQYVPKALRGVPL
                     RALPLDDDAEFRRLEHERARAACTPGHKAEVAALEAQLLARADELARARLAGDRAYLA
                     PEPAGIPLELVPLDEDAEFCAKEAQRAELKESGQTDRSGIALRETELNARAVEVAQQL
                     KDGERGKLLADSYEGVPTSELPLDTDAAFHEMEVERLRLKATDTQPNGAKNGSLDAAL
                     NRRAAELARSLRVEDLSSVEGSPLGLAKEVLDLHSDSVGAALINDLRKLRKNPLGNAV
                     VLREKGSALNDRAFEVARRLLAGDRASYLDPRPRNILLEHIPLDEDDVFHALEVERSM
                     MKVTDPVNSVAAVRKAENMLKDRACQLAELVMKEDLAQFPSNYHGICTKDLKPHSDRL
                     FSEAAEKRRAGMRDGTVAFKENLDQIMDNRLSELARERKEGELYFIDPNPEGVPLSEL
                     PLSTDKAFNDLLQGRQELKESDPMENRKAIAGLEDEMNSRAAELARSVLNSDLDGLDK
                     LPLGIPLDLLKPRQDAGVVRLIEELRRSKRLPQLKNNVVDLQAKLNERLHELATAALE
                     EGRDAYLDPHPEGVPREILPLRTDAVFQKEVQRAILRLQDPVKHAGAIAHLESELKAC
                     VKELALAQKEEDLRGLDQHPHDLPLTLLQPHEDAQFGKMIDELRWLKALEGDQHIAVK
                     EVQSRMNDRCYAMADGVMKGDRSYLHPKPEKVPLRRLPLDTDAALHALEVERAKLKLT
                     DPRKNEQKIADLESQLNSRAAELARAVKTADLKPLTQTPRGIPLELLNLHEDPTFSAL
                     IAEKEQLPEGHSADLAARLLSSMNECAMKAADKLLRGDRGYLDQDPEGLPLGHLPLDT
                     DTAFHEMEVERALLKARDPVKNSSTIKGLEVQLNKRAHDLSNLALAMDRGYLSPRPEG
                     VSIEELPLFTDSKFHSMEVERAKLKMSRADGNAERMHELEGCLNKRAASLARKQLEED
                     LKGLDQEPEGYPLNFLRLHSDAVFAAEVVSLRRAKKEPLVSAAKVRDVQEALNVRAHV
                     LARERIAADRARLDQEPENVPLSLLALEEDALFVAMEMELRSLKASDKQNPKAIAEAE
                     GRMNDRVHVMAAKVKAEGRDFLRSKSFDIPKELLALDADKAFVAKEKELWKQKQQPHA
                     PHSSSAAADLRRELQARADEVGEAQLKSDRDKYLDMQPEGVDLCDIPLDTDDVYHGME
                     VERAILLAQDATGRRSAVEELEKELNARAHELAHEIVVGDRGYLPEEMHGIPVEELPL
                     DTDRKFMKLERQRRAHKRSPDMNKEVAADEEELRNHALKLADEVIAMDLESIKASYRG
                     IAKEELNLHADVAFRELAKKRRRHRGKGRVEAAEVAVIEDEMNRRACEIADDLITAER
                     AFLDPQPEGMYINEVPLDDDPAFQKLEQEYRRRSRDPRSAKQNGDVLRELTSAMNQRS
                     HTLARAAFAKTRGFMEQEQEGIPLAELGLDEDPEFKEAEIARYRMNHSASPNAATVAE
                     MELRMNERARELAWATLAADRVFLDPMPEGVLLEELPLDSDKAFGNLARERRRRKKAL
                     KGGIGEAEVRAIEEKMNARSHELAKEFLEAERAFLSREPEGVPLADLPLNADSLFRAM
                     EDERLQLKREPLSNAAMIAAKETDLEHRAHVIAKDLLRKERVLLDQEPLGVPLEELPL
                     NHDEILNPIERKRRELRAHPKRNHEAIRACEEQMVDRVGQIAEDFVQKQRAFLDQNPE
                     GVPLRYLPLNTDREFHERELHRRKLLQRPEKNRSELADTERKMNERVHVLAKDLVLKG
                     RAFLHGEPCGVPIADVPLNEDEDFRKMEEQRRALKEAGRSAASVKTIEEKLNNRAEEL
                     AQRLLDDERAFMDCAPLGIPLHDLPLNTDRRMREIERTRRHLRKFDPEGGAVDIAVLE
                     TGMNARAYELADQLLSSDRDYLKPEPCGVPLADLPLHTDRIFHEKELARFRAKKKGQT
                     DLFQMEDELNERAKELAAEFIQTERAYLDQEPEGIPLERLPLDTDPIFHNIELERRRL
                     KRSGENSLQVLELESLLNRRAHELSMELRGWQDPEFHAANEHVAEQWVRVCDLYPEGR
                     YEDFVPAVLAPNDVVSALQDMSYLVPFIAALSLHPVLLQRLIVTKEAPVNAPYTFIFF
                     DPQGNPVYIDVDDRVPCDDKSEPKFAQSPYNLWYPLLLEKAYAKFVGGYDQLVNCTPL
                     ETLRDLTGRPVTHTPFKRKLAAAGNLDNYTSVDFWLGVKEGMARGDVVVCSSNAEVPN
                     GIHPHCSYALVDVVITLEGSVNPSDVVIKLENSYCKDEPVYTGPLCHTDVNWSLALQR
                     VCQYDPERDDVLYLPLPTFLRNFSSMQTCHTNCGDRLTAEGTWNSRTSGGSAIFTTFR
                     NNPIFILQNSSSRPASVLAELRHAAPQFVDPEGRRHYPQSGIVLMEPTSSTAPLTPLI
                     TNSTARFLHKSIILDAREVCCVMEVPARSTCLFIPYTAKAGQHGAFYVSVYPGSAKVT
                     LAPLHYCGLSREPRSTAVTLTPGTEGQRVDFTISSACDVHVLLRQEKMTDRMGAIKGD
                     AIAEDDVMMVAFNEQATKLTSSGDPTNAREHSLVFRAEKPGYYSLLLISPNQPVSGDN
                     PCTVSIFTPKQVMVRFVAPPAGARQLQHARFPKLPQKRAAASGGNSSRQPRGASTACQ
                     SQQRQHDEKLPPLRGNGASTLNSGRVSGGDRFTCSF"
     gene            <213841..>214917
                     /locus_tag="LMJF_27_0520"
                     /db_xref="GeneID:12982642"
     mRNA            <213841..>214917
                     /locus_tag="LMJF_27_0520"
                     /product="putative radial spoke protein 3"
                     /transcript_id="XM_003721810.1"
                     /db_xref="GeneID:12982642"
     CDS             213841..214917
                     /locus_tag="LMJF_27_0520"
                     /note="previous protein_id=AAZ09798.1"
                     /codon_start=1
                     /product="putative radial spoke protein 3"
                     /protein_id="XP_003721858.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982642"
                     /db_xref="InterPro:IPR009290"
                     /db_xref="UniProtKB/TrEMBL:E9AD29"
                     /translation="MQQQVADSEVTAAAYTFRQPPQGFQEPKYRDPSSSRNASRYTHS
                     GSQRYGNIMYDRRVYRGNTYASPIMSIAARAEIERREMIDTQRRKQASQRAASIKRRK
                     QLEAARRHMATPDPGEGRYNTQIQTDEYLEELTDKVDQQVQETQTDPLMDRPVTPKYV
                     PIKSGRDAETQIHEGDLFRFDEAVEPILEVLVGKTLEQAMLEVMQEEELELLRQQQIE
                     FEQRRKEELLETQKLEAEERRKFEEKERRKKQEMERIQREKETREKLQARQFAKVCMS
                     NMENRVFSRLQDEGWFADRVLNEVELDFFPWLMAEVDRELAKKAKARALVDELIRDVV
                     RLNASQLEKSRAAAAPAAEEPVIA"
     gene            <216242..>218026
                     /locus_tag="LMJF_27_0530"
                     /db_xref="GeneID:12982643"
     mRNA            <216242..>218026
                     /locus_tag="LMJF_27_0530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721811.1"
                     /db_xref="GeneID:12982643"
     CDS             216242..218026
                     /locus_tag="LMJF_27_0530"
                     /note="previous protein_id=AAZ09799.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721859.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982643"
                     /db_xref="UniProtKB/TrEMBL:E9AD30"
                     /translation="MQSSTVTAALQDALEKGDIVELEQAITAAEDAIHVSAYSRKTPS
                     SPLGCLIARAKNMYLVHMNACKVYVEPLREACKELSERGIFEALVKARGAPDEVQLCM
                     YTDLCNAESLRREIIEAQRLAVQLLDSTSAQEVDDFLTECSPFLEDRTILALVQKRED
                     LIRETRRRTLGRATTTPQRAGAAKFMLNPSGRERNHRDPPECPRRFELEDDCVSPVTG
                     RHARSAYCSSSGDGPTSYGRRAVCSEPSEEVASSSNSARAAYPAVCDALEKARDSGLE
                     RAIMEGASPWMQTVRALRQQAYEAVVCHEHNTRRHLEDAEEDGRAELYRSEMLSRVRR
                     WTAAAEVFSAHHGEKKAAPKGDGEAGSTPRRPVLPLATVLPAPSPACPPSPPASRSQA
                     ATVAAADTVNQPLTRVHATNSLSAYAFHTGVRTLTPTRYSRAGAEATVEGAVLGNGVR
                     HRVAEELHTPRLSRDTPNISPIKDMSTTSGAVSLSEQDPLYHRDNTKTEWGDALERGT
                     PRGKVSGGSTSAAAGILAGSSTTTAMLPSLELRRIQARLRAVLQEEDIHRRDIEGTED
                     FDRSVFLFPVSARIALLRRTEAQRVRAF"
     gene            <218896..>219525
                     /locus_tag="LMJF_27_0540"
                     /db_xref="GeneID:12982644"
     mRNA            <218896..>219525
                     /locus_tag="LMJF_27_0540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721812.1"
                     /db_xref="GeneID:12982644"
     CDS             218896..219525
                     /locus_tag="LMJF_27_0540"
                     /note="previous protein_id=AAZ09800.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721860.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982644"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:E9AD31"
                     /translation="MQCYTITRTCVLLCATIALALAVLGVFTPFFEMPASIGRAVKLL
                     NASVQSPTFNIETDKAMLERFGVLVSGPPANSKMTLWKLTYGSSGANASIDLRDDYFT
                     CFQGNMLIQAAEGIAVVTCVLGAANFVMSMFLFLFSAVVKFPLVVYFFLAAAAAAVTF
                     GLTLNLYLHGWCSTPALKTQEWNLWYGFTFFVISCGVSLIASVLTVFSD"
     gene            <221089..>222171
                     /locus_tag="LMJF_27_0550"
                     /db_xref="GeneID:12982645"
     mRNA            <221089..>222171
                     /locus_tag="LMJF_27_0550"
                     /product="putative replication factor C, subunit 4"
                     /transcript_id="XM_003721813.1"
                     /db_xref="GeneID:12982645"
     CDS             221089..222171
                     /locus_tag="LMJF_27_0550"
                     /note="previous protein_id=AAZ09801.1"
                     /codon_start=1
                     /product="putative replication factor C, subunit 4"
                     /protein_id="XP_003721861.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982645"
                     /db_xref="GOA:E9AD32"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR008921"
                     /db_xref="InterPro:IPR013748"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9AD32"
                     /translation="MSTVDTPWVEKYRPQTVVDIVGNTEAISRLQVIAKQGNLPNLLL
                     CGPPGTGKTTSMLCLARDLLLQSTDTGSAGASPGGAMKDILKDAVLELNASDDRGLDV
                     VREKIKLFAQTKKTLPKKFFSTGEGVAKDDHVVHLHKIVLLDEADSMTPAAQQALRRT
                     MELHSSTTRFAFACNNSSRIIEPIQSRCAVVRFKKLSDADILKRLVYVIQHENVSYTD
                     DGLEALLYLAEGDLRQALNALQATHTGYGLVNADNVFKVCDQPHPLLVENVITACVTK
                     RNIEEAHREMNRLLNRGYAPVDVIATFFKVAQTHARLFRSELQQLEVLKIVGETTMRI
                     AEGVGTPLQLAAMLARMIAALENTPS"
     gene            <223417..>224400
                     /locus_tag="LMJF_27_0560"
                     /db_xref="GeneID:12982646"
     mRNA            <223417..>224400
                     /locus_tag="LMJF_27_0560"
                     /product="putative protein kinase"
                     /transcript_id="XM_003721814.1"
                     /db_xref="GeneID:12982646"
     CDS             223417..224400
                     /locus_tag="LMJF_27_0560"
                     /EC_number="2.7.1.-"
                     /note="previous protein_id=AAZ09802.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_003721862.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982646"
                     /db_xref="GOA:E9AD33"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9AD33"
                     /translation="MSASVNDLDGKLDLVDITALSAAYEPEEVLGEGTYGIVFRARNK
                     ATGAKYAIKKLRLDGFSEGVPATTIREATLLHDLNDNPNVVKLLDVVCSDHRVYLVFE
                     LLDEDLRIFIKRYRPVSGQKPTNGTAVPLHLVREFTRQILYALWTCHNNRILHRDLKP
                     GNILVANYRNTNGETKFYVKLADFGLARMFEMSVQTYTHEVMTLWYRSPEIILGDRHY
                     TPAADVWSVGCIVAEMILGYSLFRGENWRDQLDKVFYVVGTPTEQTWPGVTKLPGYDR
                     NFKVYHVAPLPTRLRDYDEKAVEFIAYLLVTNPKLRPTIPDILEHPFMKDA"
     gene            <225781..>227430
                     /locus_tag="LMJF_27_0570"
                     /db_xref="GeneID:12982647"
     mRNA            <225781..>227430
                     /locus_tag="LMJF_27_0570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721815.1"
                     /db_xref="GeneID:12982647"
     CDS             225781..227430
                     /locus_tag="LMJF_27_0570"
                     /note="previous protein_id=AAZ09803.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721863.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982647"
                     /db_xref="GOA:E9AD34"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:E9AD34"
                     /translation="MSSPSPSKSPASSPEVPERRCVTASAAPATSPAAPLESTEKYEN
                     ICGICLTDIHPVDNPRGRLNSCGHLFCSYCIKEWAKNTNVCPNCKARFTRIYTFHADS
                     GKEEETKVRKRNYVAWETSYYDEEGEDDAANEEALLNSVLCDVCQKSHNAARMIFCDR
                     RQCVYTAHLDCLGLAERPLTFLCAACTKLREEEGDDHVPLAHSFSATLFAAASPEPPV
                     PPTPVTVAAAPTRRRATARAAATPAVAVQTRATVAAVDTGGSGPSVEAPTSVFSGLAS
                     TSTVTAAPTSRVPRTANHSAVERPKDRRSPSSASSSPSMRTESSTMPRAPIDFSKPHL
                     HLMTPATTTSRRSLRHTPAPLHTGVASAADQDYYFLAPTSHAVAATIEFHRVKQARAA
                     EAQIRHQRERAKTERLQAACSVHHSDLLLSGARKRAHRSVADEVIAELESAEEEFRDP
                     QQRRLMEERMVRKWAADMLPVLRRRRYIEGDTATTESDLWAQATSQARTMVRQKLGAK
                     SESLRRRREQLVRAQAQREAAALAKLARIIAQHREGSLGVN"
     gene            <228225..>230315
                     /locus_tag="LMJF_27_0580"
                     /db_xref="GeneID:12982648"
     mRNA            <228225..>230315
                     /locus_tag="LMJF_27_0580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721816.1"
                     /db_xref="GeneID:12982648"
     CDS             228225..230315
                     /locus_tag="LMJF_27_0580"
                     /note="previous protein_id=AAZ09804.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721864.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982648"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:E9AD35"
                     /translation="MASLSSVPPSSRVIPHERVLQCVYEFLDENGYQQALRALQAESK
                     VPYNVIRVKSDGTGGPAGAAQASLSGKRSSAKGFAAASERNLEEAVMEGSWAEVLHVY
                     VDGLLLPEEIKATLYEVILEEMVELHGLAPAARSLLLNAPVFQLMKVDAPARYIRLEK
                     MVEHGQRTMCEGTLSNAATRHITPEMLHRRTTLLQQLKTAIRFTSEAPIGRLAAALAR
                     AAAADFGGVDSREHKADSSSVAPPPNGGPRSSAEATSVAARSRKRDRESVLPGDAAWA
                     DTFLQYPLAAPKEIRRRLPYAGERAACCCAPLLSASEELLIVGCASGAVEFVSVKAGE
                     SIGNPLRHSDGVLCMTRDTTDRAAPAPDWLAVGYRDGWVKVYNIDSRKLVRRFEKAHA
                     MGITAVFFSGPRNTASLFGHRSFIVTGSFDGGVKVLDIAAGAVVQTVANCHASAFVHA
                     LLPLESRGAVVDTLRYCFLSSGNDGTVSIWRLEDRREEGAEVAGRVEVLRVQGAVPLG
                     QVHHELRDAVPSQLYALPYVEDATHGATATSDSTSLPAATTQDALVLTRAGKACIVRV
                     TVTDDGNRYFCAFLQALCIVATAQPLRSAFPHVHTVVSMSVPLLTLYAADCEGTVSLH
                     NIEMKWYNDEQWSEFGGCMRVSSAADQSALVIVEAGKPLKDLQLTCIWSPTQHQPSSV
                     VAYSASLPAIYDMR"
     gene            <231319..>233100
                     /locus_tag="LMJF_27_0590"
                     /db_xref="GeneID:12982649"
     mRNA            <231319..>233100
                     /locus_tag="LMJF_27_0590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721817.1"
                     /db_xref="GeneID:12982649"
     CDS             231319..233100
                     /locus_tag="LMJF_27_0590"
                     /note="previous protein_id=AAZ09805.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721865.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982649"
                     /db_xref="InterPro:IPR027974"
                     /db_xref="InterPro:IPR028235"
                     /db_xref="UniProtKB/TrEMBL:E9AD36"
                     /translation="MSDKYLRNEQQHLLNSIGTEVCWGWSPAIDFVSLLAKRPRRSAE
                     HGASQDVIGRIVDRRHEVPPSASPVSATKTTPSSRSKDEAELDDLIALIQSRQAASTK
                     AAEATPGESAESQPHCTPPYSSSTASSAPAAVANDEVNILLAGASDIRHMLRTLSSLR
                     AAESADGKRRPQPTYHFYVYEPNLRLHCRHLFFLQWLLDSMFALEELEERVLMFLDVY
                     GNALMRDITAAQVRNVVQRLRKALETDCSPLLCIASFEEMKSKERDFVESQLAHWTRD
                     ASAADIREQWEQRVRQEMAERYDNRDNIIDWDFVFHLTEYTNLLKFPEYRTWRNTGVA
                     FDVSHINPRRGFNYEYKVPNKTLCFFSSAGRGVYAGDIKNGPFFSFGALTQNTHIRQR
                     TTDGTCRHGNGVVSMHNVRAWLYTLMTGLPWPWADHAFAWDDPNNYNYLPPGTPSGVS
                     YTAELPKVRVHFVGLQWDRFLRHCKEGQVPRMDAAFFGTSCTQYMSPTVLGDVMSGAA
                     HAVVVAETAKFIVDAEDVAKKIYIAKLDDLAHAGGWAREDALTNDLHEGKPDPLPVKG
                     TMTDAQKLSHERYMQPSLLAYVAKAPA"
     gene            <235141..>238107
                     /locus_tag="LMJF_27_0600"
                     /db_xref="GeneID:12982650"
     mRNA            <235141..>238107
                     /locus_tag="LMJF_27_0600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721818.1"
                     /db_xref="GeneID:12982650"
     CDS             235141..238107
                     /locus_tag="LMJF_27_0600"
                     /note="previous protein_id=AAZ09806.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721866.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982650"
                     /db_xref="UniProtKB/TrEMBL:E9AD37"
                     /translation="MPLEDKDSPKQLTSPLSDSVELGNVPISTQLRSTGWLDAVHGTR
                     PPASPSPPAASVANNACAPTPRHLSSAAGKKSAQSSTRSEQAPTENRHPAEATAMGSP
                     IPVDSDYSDAHIQQLVSRVREKAMPDHYANSTGPARGPATTPALPPAPAKQNAFPCTS
                     ASSHPSPSDSFPERSAPQAMSARSTATAPPPTPVPFQHSPFGDSHVAEANAQKTRSQW
                     CSDHGITNFAGDSLQRQDPQPLTAYSSALMQALSRTEGAASLKCSWTLATQRGGSSAY
                     YSESDVAKGSSSDLPPDMYVEGMRAKVAKQQWVALEKARQEVLEEARLRRDCPFAPQV
                     SPYAARIRRPTSLRPENRINAEVIRRKQWVAKKQSEEVERELQSCTFRPLTLRTAQLD
                     PAVIDSPRAVTTVFHDLYTEAENRRAFERDVKPQLVHQIEERRRPSPARMGPAQVAEV
                     VERLCARGVVRSGVRAGPQRDNADLVPYESDAGSVECAGAQSDQYHPTLSLETRRIVA
                     AKVISGERDGNVIKELYRHAEQGVVRGQLKRELDKEQARLARAEQAIALAHERKRLQQ
                     EYYRAVLVAKFRALAQHVACAQHCAYRATAPQPVVQLARAALDVLSTDEAEELLGAVE
                     HCGRHKLTEGEFVVVVLQHLAEQQVTPVQSALLRNAPPPPPSTRVAVSAATLKRADSA
                     PGIAGSAESSPAGLPRVKREKPDPEVIEQVRARRAQELVEWKKESQRRRAISDGVLAE
                     GADYTFQPAPRRLIPYACRPDVKVSVRSTKSEELRRAYVSARIQGIAPPVAVNSVAPS
                     VSAQVLNSSLAIARELFARGTSDMPPLSTRERSRSAAARVETPAQREGSAAALTLTAS
                     GPAATLPASLKCPSPEAARALSAALAGRKDPAAPERQRDLQAAAPVGPSALAARQPAS
                     APAAPAPASKGHPSRLAARPFSGSSRQGRCNVLAEPPSLVEQIMHSTAEDRARLGREL
                     LSRQVQEHQRRSGAFD"
     gene            <239017..>240405
                     /locus_tag="LMJF_27_0610"
                     /db_xref="GeneID:12982651"
     mRNA            <239017..>240405
                     /locus_tag="LMJF_27_0610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721819.1"
                     /db_xref="GeneID:12982651"
     CDS             239017..240405
                     /locus_tag="LMJF_27_0610"
                     /note="previous protein_id=AAZ09807.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721867.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982651"
                     /db_xref="UniProtKB/TrEMBL:E9AD38"
                     /translation="MVDRLPALTPSKGTETKSSLKKKTDDYALCQEYAAYIAQLRGLL
                     EETTGQPPAGVRTAEVEHRITLIQSALDEVERLSAEARWRIELRNNQRFLDTYERRIQ
                     MEEEAEQKRQTAEKERIAQVEEMRSMQHAYYKNRNDRTDAKAHQCRAYNEQVQEQTVM
                     KAGSNEERRTRNLANLEAERQRKQKELHDREQAKQDYARKVRERQARKDAEKLAEKMR
                     LAEIHQQEMEAKLCAIRESRRSKWVMKKEASRAKSVVVWKNGEAILETQRKNHGCLVE
                     ELEQRQRHQASRYAEEKAEQAAYIEQRRLLHAARQERQQENLRQLVEKRVARGVEIVK
                     TTEEKKERAEQAKERQATQYVEAGRLLDEDVQLHRQRARKLQERRANESLTQNYRRWN
                     HRAARIMEELHETMAKVEAEAEQRAAAANSQQRSLAYGNSRRSWTSFEQVDTPKRDCP
                     IVSLPSPTEFAV"
     gene            <242172..>243611
                     /locus_tag="LMJF_27_0620"
                     /db_xref="GeneID:12982652"
     mRNA            <242172..>243611
                     /locus_tag="LMJF_27_0620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721820.1"
                     /db_xref="GeneID:12982652"
     CDS             242172..243611
                     /locus_tag="LMJF_27_0620"
                     /note="previous protein_id=AAZ09808.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721868.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982652"
                     /db_xref="UniProtKB/TrEMBL:E9AD39"
                     /translation="MPPYFLRGSVGSTQSPSPPPSWLIAAHPQPSNASIGEANTSSIL
                     KELPSEVLIPTFLVLVMSSVMVTAVNAVFNVFVHQDRMVMETFQQWSRVLWMSKAAHI
                     VEAPSAEQAHRMTQTHHVAAVTARSTTPVMSPVELYNSAAFFRGIAAPTAPAASRTGA
                     TASSATDVILVGVASSCSATPLPSATSATPCTGDADVIAEAEVYHEENPPAAVPAPVV
                     AEALTNTMEAVRRESQHVIFEFHPYYIILCATKEFAMLIYIQYHFGGIHGGWRRFCVC
                     GAANIFSGLLTSVWEYAMMALLPLDLDRATPVVVKEETKADSVFIVELLLRISTLELN
                     DLPTVLMQGTTFVAFAAVLVPLLGTFCSSGLVRYMWIYVPLWLIYLVVRHIYYQGAGS
                     LPSPRARNAAAVVGMTNEMLKAFLMKALTVFVLLFTMQSSFLLGLAWAEGATYDEGLQ
                     YMALHEFGFHAGAFASSFQKVCLLSQLFL"
     gene            <244265..>246937
                     /locus_tag="LMJF_27_0630"
                     /db_xref="GeneID:12982653"
     mRNA            <244265..>246937
                     /locus_tag="LMJF_27_0630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721821.1"
                     /db_xref="GeneID:12982653"
     CDS             244265..246937
                     /locus_tag="LMJF_27_0630"
                     /note="previous protein_id=AAZ09809.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721869.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982653"
                     /db_xref="UniProtKB/TrEMBL:E9AD40"
                     /translation="MLRFPKQVRGGHGTCRVALCSSCRGVALTPQRMQLQHRDRIIGS
                     HGAGLVNHQSMATMEIRSNFTRVQNAAPAADLFRTKVHEGLGTSDKDPYLRTLPNQES
                     RPPESSVLRVAAATAPSLEERQCLHQKWGTLQYWLGDQYPRLPLFLEELLVSDALPVS
                     PAAEAMVQTFAAEVIPAMAKQGGPGAEEKLEALWKQAVQAYGKLTTSHVFDKVAFERE
                     LAALRARYQADMSALSPCEDSALALEVLRRKAIAKRNAFLREGLLPMVRNSPYVGYGD
                     GVWRVFFDSVAAHKRDLFSSSNSPVSATLGFAWEGLMMEDAVRTPAMTAPVALYLLLV
                     SISASHNRAPAELKTASAHLDEGIVSTEQRVVPSAFATVSPIVKRRFAADALKGLLGE
                     VKGCGRLAKALRSARLYDWSRDAALCEAMLDDRQLLRADVENMVDRFDSTAEVKSLLQ
                     SLMSGTDSAIKAHVSHVFQLPGMASKSHQLVDWDATMSAVDWPHCWREHARELLSDPA
                     TLEAVYRLLKNATGAKHATKRLFSDEYAAEVEAALQRRKERAEARKARAEQLVRNLTS
                     YEQVEGTLAVLRKVGVSLRELEGAELATAEQRTVRRPQVDNGVLDLLLEAIRQRHPSW
                     AKSGVLPAVASAAAKSPVWYLECMTRIYIRLSYVPQAAAALMAQRTRRRLGPVGTEPT
                     QFNVPTEMGMVEQYDNLQYKRYDWQGWYQRMVDVHNRNVSIKCRLDDLKRLDAYGNPF
                     VEMQTERRLRILADHRVGMGVLKLDSDKYEDQHDNITYGSTKLSELLADARKAQLGKE
                     YWPSVEVKVRRPSGQSKAYYSVLDDARIESKSKELYAKYREAKKRSLFVTPMDLWLDV
                     KGMQVRKAAETADAQGYTVDSLQYAMEDDSSDKG"
     gene            <248423..>249367
                     /locus_tag="LMJF_27_0640"
                     /db_xref="GeneID:12982654"
     mRNA            <248423..>249367
                     /locus_tag="LMJF_27_0640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721822.1"
                     /db_xref="GeneID:12982654"
     CDS             248423..249367
                     /locus_tag="LMJF_27_0640"
                     /note="previous protein_id=AAZ09810.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721870.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982654"
                     /db_xref="UniProtKB/TrEMBL:E9AD41"
                     /translation="MLSASSSSSELETADDASVEHAALAYERVRREHALQRYLKAREA
                     YEVACIARERRQLVVQSHNHTLRLLGQVVCDVKAVVDGTLKEGLSVRESTATAAEMLL
                     ASSCYKRAERGLVTLLAHEGRQHEVLRAATSPATETSRIPQVFSSGSRAEKPVASSPA
                     KHMLRPLLLLCEWRLDYATLLCRQRLPLFSELARAQRVVSNSRESAREARGRMSAPTT
                     PVVQRCQVQVAEARASLAKARAFQRSLKDRLHQLHQMLSRSAPVHAESGVFVDAGVAE
                     EIQARLRQELAVGHVTLLRILCESLSGAFDERGRLTAL"
     gene            <250073..>250576
                     /locus_tag="LMJF_27_0650"
                     /db_xref="GeneID:12982655"
     mRNA            <250073..>250576
                     /locus_tag="LMJF_27_0650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721823.1"
                     /db_xref="GeneID:12982655"
     CDS             250073..250576
                     /locus_tag="LMJF_27_0650"
                     /note="previous protein_id=AAZ09811.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721871.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982655"
                     /db_xref="UniProtKB/TrEMBL:E9AD42"
                     /translation="MKVELTMQYLDEWMLRWRKFQTESDWQIEKNRQWWRQANIVTAG
                     AVMGGLVMYTAGAATIRRQFGAPHFFDVGVDAKIKEAICDTMTSRWRYTPQGYGRLML
                     VGLPTFFVFAISEHIQERRRLRAYVKQNTVFGEQARRLVQNGKIEEYLAVDIKASLPQ
                     NQTQLYA"
     gene            <255072..>256589
                     /locus_tag="LMJF_27_0660"
                     /db_xref="GeneID:12982656"
     mRNA            <255072..>256589
                     /locus_tag="LMJF_27_0660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721824.1"
                     /db_xref="GeneID:12982656"
     CDS             255072..256589
                     /locus_tag="LMJF_27_0660"
                     /note="previous protein_id=AAZ09812.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721872.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982656"
                     /db_xref="UniProtKB/TrEMBL:E9AD43"
                     /translation="MPCVCSGAYTMSISSRHRYKRPLQRGLLSVCALALFVCVVFTHA
                     SAPVYDASNVKIIVENTFDSTQRSSHIQVCEAKGGVLVPDVSDAIHQELVNAMTAVGA
                     TSYCGYLGGTTLLSSSSCTTSKATLDCIWYWDEGRYSGIESAYAFYKGNYFPASGSNG
                     GLAGAGMLSTDSSNHWTTKKGVQAYPGRKYQRYAMLILPQTSSTAGWMDSAESGFSYG
                     EAPTNRYYAMCLVEQATTTTTTTTTTTTTTTTTTTTTTTTTTAAPLITTTTTTTPPTT
                     TTLPPTTSTTSEPTTREESDQKVTMWVGISIFLVLAMALVFALIMGRARQKGWCCFAA
                     KEPAGAASTTSGKLVAPAASLSEKRRRSRRPSLASKSSFHSNSSSSGTVRSFHVASPH
                     RDRSGRRSILRNDDEQMEDYPEHHDACSSARSQDLAGSERLDPIALVEMVPLRFSEQR
                     MVSTLPVELAQPPLYSEPLIQQSLWNSRSSQCADERIMDTPRPRLRRTSSVSFID"
     gene            <261190..>262692
                     /gene="AAT23.1"
                     /locus_tag="LMJF_27_0670"
                     /db_xref="GeneID:12982657"
     mRNA            <261190..>262692
                     /gene="AAT23.1"
                     /locus_tag="LMJF_27_0670"
                     /product="putative amino acid permease"
                     /transcript_id="XM_003721825.1"
                     /db_xref="GeneID:12982657"
     CDS             261190..262692
                     /gene="AAT23.1"
                     /locus_tag="LMJF_27_0670"
                     /note="previous protein_id=AAZ09813.1"
                     /codon_start=1
                     /product="putative amino acid permease"
                     /protein_id="XP_003721873.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982657"
                     /db_xref="GOA:E9AD44"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:E9AD44"
                     /translation="MASEETNPLNVQYCESAGNQVHQDSLDLRSEFQMKVAQRYDAKH
                     VRRAEDVSSAEAPDPYDFSQYDPKRQIELQDKIRADRVARRLVPANVFQKYFDYLVPY
                     GGLVSTGLNLASSSIGAGIIALPYAFNASGLVMAIIYMLMIAYLTIYSYYLLGQVGTK
                     TGLRNYEQIVRALLGPGADYFLAFCMWFLSFGGEVSYVISVKDVLTAFLEDADNTPAF
                     LLNIWGQRLLTFLVWLVAMLPLCLPKEINSLRYFSCVAIVFIVYFVIAMVVHSAQNGL
                     RADPRPEIRMFTTGNTAVSAMSTFIFAFLSQLNAYESYEEMSNPTPLRLTLGATISVG
                     IVFVLYFFAGLFGYLDFGAEMTGSALKKYTPVKDVMMGIGYVGILFKLCVGFGLHMIP
                     VRDAIYHCVRVDVHMFPWWKNACVCAFMALLSLVAGLFIPSINVVFGLVGGFSGGFIG
                     FIYPSFMVMYSGNWSLSSVGWFHYLSTYFLLIVGVVGVVWGTASSIYGEV"
     gene            <267340..>268947
                     /gene="AAT23.2"
                     /locus_tag="LMJF_27_0680"
                     /db_xref="GeneID:12982952"
     mRNA            <267340..>268947
                     /gene="AAT23.2"
                     /locus_tag="LMJF_27_0680"
                     /product="putative amino acid permease"
                     /transcript_id="XM_003721826.1"
                     /db_xref="GeneID:12982952"
     CDS             267340..268947
                     /gene="AAT23.2"
                     /locus_tag="LMJF_27_0680"
                     /note="previous protein_id=AAZ09814.1"
                     /codon_start=1
                     /product="putative amino acid permease"
                     /protein_id="XP_003721874.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982952"
                     /db_xref="GOA:E9AD45"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:E9AD45"
                     /translation="MSANRHHNTNYAPYPQHGQGRSTSDNMPEDPPEYGEDGLHMLND
                     GHSQEHLADEVVVGASDVEGRTKGSKKLDSPSLTDDGELAAKGNKQHSAYMDIAQQII
                     EADQRSREDRVWRRRHTTNPVLRALQVIMPYGGILASAFSIASSTIGGGIIGLPAAFQ
                     MSGMGMAIIYLIVVVIMAIYSFVLLAIVSHKTGLYNWEIIARRLMGRGWDYFVVFVMW
                     VLCFGGDVSYIIALKSILTGFLKNSPTASEYIKSEPGYRLITSMLWIAVILPMCLPKE
                     INSLRIVSTVAILFVVFFTITCIIHSSQSLHARGMRDDLVSFQTGNTAINGLSSLMFA
                     FIAQVNAPEISREMYKFSVHRVFLSALLGMSLCAILYFLTGLFGYLDFGPEVSDSILA
                     MYNPLKDHLMAVSYVGMMLKICVGFALHLIPCRDCVYYMIGTEVSHVPWWKNAILCSL
                     QAAAALVAGLFIPRITTVFGLLGGFCGGFVGFIFPSLFMMYSGGFSAARVGWGHFLGT
                     YALLLTGVVAVVWGTSAAIHGAVLSSW"
     gene            <273850..>276540
                     /locus_tag="LMJF_27_0690"
                     /db_xref="GeneID:12982953"
     mRNA            <273850..>276540
                     /locus_tag="LMJF_27_0690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721827.1"
                     /db_xref="GeneID:12982953"
     CDS             273850..276540
                     /locus_tag="LMJF_27_0690"
                     /note="previous protein_id=AAZ09815.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721875.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982953"
                     /db_xref="UniProtKB/TrEMBL:E9AD46"
                     /translation="MVRSDAYCAEEDESETERNRRYGADGSTISASYTDSSSVPKQVP
                     VTLSLVFQYFSLLASYHGAVHVPRYWADLLRPSSVAGAKDDDASTSEHAHECANELIS
                     PVTEIDLSVCYVGPTMLLALADLLRVHCVTVQRGCSQRWHVSGKAGMGTLPSVMAPLW
                     GAGSRCPRKGEEVMCSLLPHLTTLRLTHLAMDFTVPYDATGLKGGNAVLRNMLEALQG
                     HPSLKVLDLSGNPVAAALVPTISRLVQMTPSLTTLMLDDTLVADSEKEMLCAQCLLNE
                     LRLQRAAVDGAAATVSDDASLATSPESATRGLWAAQMLENVLMAVERGVSAVPWLLGK
                     STALIRRYSTSKPSQAEASAFEGSARSSRTSDIADGLSQFGSSSVNSSYATDVAPSLE
                     ITYLSYDYTSESSAAAVATAPPPAGATWSAECTEVARCAFMPRSLAQRTVLGGRSVWP
                     NVPKPLEAVVSTDLSAPSAAAVAATDLLLTLRQHVLPEPEAPPGLRRGSARDGAFLTT
                     AEETYWSVRKKQEVQWGYVLQKVSENLTPVFVRNGHTLYAEGSECDSIYLLPVSMQET
                     RTYAELHVSANPGHVNRVLPGQWVGEAEILDCLSVYAKYSSSSADGSAAVPNSETVLQ
                     RRSTVRVFTEATDDVVLWALPFRVAFFYLYAPYQLLHKQFVHRTPMSAFAHIHPVHLS
                     CVPVHMHASHGSWPASAGQGRDSGAAPVLCRYAFMSRHVLLLEEGEFLLRLPSLASHV
                     GPRNGDRTAASTRVGMEDHHLLSGVTVITQPLLDLDAALRAAVAAELTAEHGGATVTY
                     ARGPHGTLALGKQAELCRFRAAKMEQTAASATVSHSGASGTAETVGDSHENAVVLRQC
                     RTGGTAAQWRYSAITNEEFTALCPALRVALTRHICVVHDL"
     gene            <281302..>282681
                     /locus_tag="LMJF_27_0700"
                     /db_xref="GeneID:12982658"
     mRNA            <281302..>282681
                     /locus_tag="LMJF_27_0700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721828.1"
                     /db_xref="GeneID:12982658"
     CDS             281302..282681
                     /locus_tag="LMJF_27_0700"
                     /note="previous protein_id=AAZ09816.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721876.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982658"
                     /db_xref="UniProtKB/TrEMBL:E9AD47"
                     /translation="MQNSNSSYPSQKPYRGRGITDGSNMGTPHSTYSQQNPPTSPLVF
                     AAPCGGTPPQQQDPLSTSLHAEPLQMNYKAPLGRHNSRTLIEVEDSPIKVTCLTKGGA
                     RSPYMAPMPSDMAPDADRSGRHNPYTFSYSGSSSPMQVSTPTHSPQSSAFDSSAAASH
                     RMQGRGPYGCTELPPADARLVQGHNVRLDTTFALPPEVVHRALKDRCRYIQFPANLPV
                     FPKAGTLGPNANNGNNSSSNGSTGSGGSGESSLPIALFIGQVRFETTAAELLWLVHRT
                     CGACASHLESRGAGCYLLYCKSEADLTLVRSLHKRILFDIGGVWLARTADEVDAMCEY
                     IALDAPLLSKKARLPRDSMVVEELKADAINSGGRRGHGAGGGHGKRAMSNHSISGNRR
                     GGGCGASAQGSGVDDMSQTASGDVRQQPMQQQQQQRRDQERLPTYEESAPPYPGYPPQ
                     SFGEYPLYK"
     gene            <285598..>286950
                     /locus_tag="LMJF_27_0710"
                     /db_xref="GeneID:12982659"
     mRNA            <285598..>286950
                     /locus_tag="LMJF_27_0710"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721829.1"
                     /db_xref="GeneID:12982659"
     CDS             285598..286950
                     /locus_tag="LMJF_27_0710"
                     /note="previous protein_id=AAZ09817.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721877.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982659"
                     /db_xref="UniProtKB/TrEMBL:E9AD48"
                     /translation="MRLRSPCGVKGIAADALVDLVQSCYPSATVLFTSVANNVAAADN
                     SELRISSSLDAWQAKLHTRRAWRQGLSVDTPGFQRILARRHIVPARSAEAAASSWWAL
                     LYAADATNRPRVALPRQPSQSLPPSHIAHPILCCPDAIVYIGGVEVRDVTQVVAPTLV
                     DAVTRVEAPHSTVGAASATHRAERQAPSYCRRRVDWPTVWADKRCAMRGADLLELSLA
                     VPSDLGHRHADVRERVLVSIANPDVTLADLQRQPHAGRRGPLRTSFGFSLPCVQAALP
                     AAVIRAVRVLRRWQRDVAHCIPSTSAFWVSSIGHLLETSVGDAASPLTQWAEACTRQE
                     QELGMSETQMRHLFAIVQPDSDQTSTRVPLPEDATKLLTFLLTSTVLQLACTSPLEAW
                     NGTNYFLPAERFDGTTDAEVLLRTMRSVAGTHLTFPIFSSLYGSPCGAEQGPLSQSSP
                     "
     gene            <288641..>289876
                     /locus_tag="LMJF_27_0720"
                     /db_xref="GeneID:12982660"
     mRNA            <288641..>289876
                     /locus_tag="LMJF_27_0720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721830.1"
                     /db_xref="GeneID:12982660"
     CDS             288641..289876
                     /locus_tag="LMJF_27_0720"
                     /note="previous protein_id=AAZ09818.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721878.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982660"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR006636"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR015496"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="UniProtKB/TrEMBL:E9AD49"
                     /translation="MEYQIISSKGDKLALCIDDDMTVGDVKGVAAAMLDAPDDVIMTV
                     SLNGKLLKDDVETWGELRRRLFRSQQPHPMQRKLFCNVTDRPVVESQSAEMLRMLSSK
                     EEKKLEQEKEREKVAAMDSMVDTLADNPAFLESMLSMNPMIKKMQKKSPEVARMLKDP
                     DTLRMLLKSSVDPQRRREMERNAELQLAHIAALPGGQQMINHYMDQLTEDEEETDTQR
                     QLRIGRSTAEVSDELAHPDPTKEANNDPLPNPWTTPAATESGAASQTGSAFPFGDAEG
                     LPFFSPFGFPPAAASSSRGAATDPVASSFVGGSAAASSSGPDQAAMNAMMQMMMQSMM
                     TSPSAPTTAATNAPSPLTAAAPVSASPTAVSEEAMQRGLSALREMGFEDEALCREALT
                     ACGGDAEAAVDYIAEHQEE"
     gene            <291396..>292385
                     /locus_tag="LMJF_27_0730"
                     /db_xref="GeneID:12982661"
     mRNA            <291396..>292385
                     /locus_tag="LMJF_27_0730"
                     /product="putative reductase"
                     /transcript_id="XM_003721831.1"
                     /db_xref="GeneID:12982661"
     CDS             291396..292385
                     /locus_tag="LMJF_27_0730"
                     /note="previous protein_id=AAZ09819.1"
                     /codon_start=1
                     /product="putative reductase"
                     /protein_id="XP_003721879.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982661"
                     /db_xref="GOA:E9AD50"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001834"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="UniProtKB/TrEMBL:E9AD50"
                     /translation="MRFAVSCVAGAVGAWVWRRPSGQDAECYQGIQNAITFRNPQRQG
                     RVFSQRYEPYQLGEIIPITADVALFRFLLHNSEDEFNLRPCSTLQACYKYGVQPKDQC
                     QRFYTPVTANHTAGYFDLIVKRKKDGLMTNHLFGMHVGDTLLFRSVAFKIQYRPNRWK
                     HVGMIGGGTGFTPFLQIVRHALTEPVDSKEVDRTKLSFLFCNRTERHILLGGVFDDLA
                     RRFPDRFRMFYTIDLAVDKDKWLEQENHFLGYVTTDMIRRSMPAPEEKNKIIMLCGPD
                     PLLSHVAGTPMSTMSSMSGSLSIQPMATDINNLVSLGGLLKELGYDNTDVYRF"
     gene            <295081..>295686
                     /locus_tag="LMJF_27_0740"
                     /db_xref="GeneID:12982662"
     mRNA            <295081..>295686
                     /locus_tag="LMJF_27_0740"
                     /product="NADH-ubiquinone oxidoreductase 20 kDa
                     subunit,mitochondrial precursor"
                     /transcript_id="XM_003721832.1"
                     /db_xref="GeneID:12982662"
     CDS             295081..295686
                     /locus_tag="LMJF_27_0740"
                     /EC_number="1.6.5.3"
                     /note="previous protein_id=AAZ09820.1"
                     /codon_start=1
                     /product="NADH-ubiquinone oxidoreductase 20 kDa
                     subunit,mitochondrial precursor"
                     /protein_id="XP_003721880.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982662"
                     /db_xref="GOA:E9AD51"
                     /db_xref="InterPro:IPR006137"
                     /db_xref="InterPro:IPR006138"
                     /db_xref="UniProtKB/TrEMBL:E9AD51"
                     /translation="MLRFTRASFTGRAMISRGSPEWSHRLDLKKGKKTTLAHKLGTSK
                     PNNALQYAQMTLHDLTEWVVAYSPWPLTFGLACCAVEMMHSYSSRYDLDRFGIVPRPS
                     PRQAEIIIVSGTVTNKMAPLLRNIYVQMVNPKWVISMGSCANGGGYYHFSYAVLRGCE
                     RAIPVDFWIPGCPPSAESLVFCLHNLQKKIRWHEIQKYSVR"
     gene            298272..298809
                     /locus_tag="LMJF_27_0745"
                     /pseudo
                     /db_xref="GeneID:12982663"
     misc_feature    298272..298809
                     /locus_tag="LMJF_27_0745"
                     /pseudo
                     /db_xref="GeneID:12982663"
     gene            <299448..>299831
                     /locus_tag="LMJF_27_0750"
                     /db_xref="GeneID:12982664"
     mRNA            <299448..>299831
                     /locus_tag="LMJF_27_0750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721833.1"
                     /db_xref="GeneID:12982664"
     CDS             299448..299831
                     /locus_tag="LMJF_27_0750"
                     /note="previous protein_id=AAZ09821.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721881.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982664"
                     /db_xref="InterPro:IPR011008"
                     /db_xref="InterPro:IPR013097"
                     /db_xref="UniProtKB/TrEMBL:E9AD52"
                     /translation="MELNSSKAKERAHHKSLNPQVNSVCHCAHLRLKGPLHVEKLREL
                     LKRVRTTVPGLIELHFGESMNVSASSADSAEGNTHALFSRHQNGQYLKMYKTHPAHMD
                     LMNYLMSRAERPATVVDFVNVASSL"
     gene            <301861..>302463
                     /locus_tag="LMJF_27_0760"
                     /db_xref="GeneID:12982665"
     mRNA            <301861..>302463
                     /locus_tag="LMJF_27_0760"
                     /product="putative small GTP-binding protein Rab1"
                     /transcript_id="XM_003721834.1"
                     /db_xref="GeneID:12982665"
     CDS             301861..302463
                     /locus_tag="LMJF_27_0760"
                     /note="previous protein_id=AAZ09822.1"
                     /codon_start=1
                     /product="putative small GTP-binding protein Rab1"
                     /protein_id="XP_003721882.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982665"
                     /db_xref="GOA:E9AD53"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9AD53"
                     /translation="MTAEYDYLFKLLLIGDSGVGKSCLLLRFADDSYTDSYISTIGVD
                     FKIRTLNLESKVIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDTTDMESFNNVKTW
                     LSEIEKYASENVNKILVGNKCDLVTKKAVDTQMAKDFADSLGIPFLETSAKNSTNVEE
                     AFIQMASGIKARLAVSGEAKSAARPNLQNPPTVKKEDSCC"
     gene            <305526..>309524
                     /locus_tag="LMJF_27_0770"
                     /db_xref="GeneID:12982666"
     mRNA            <305526..>309524
                     /locus_tag="LMJF_27_0770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721835.1"
                     /db_xref="GeneID:12982666"
     CDS             305526..309524
                     /locus_tag="LMJF_27_0770"
                     /note="previous protein_id=AAZ09823.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721883.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982666"
                     /db_xref="GOA:E9AD54"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9AD54"
                     /translation="MVTSPKPLLGGLHKITDRSVFFIPLEKDHLDLTTLSTAPPSHRG
                     VLQRNGLVAKAFVGVTFYDACTSAAHSSSRTSPAREMCESDATDSAEHRKLSAAQRED
                     LWRAALVYGGLLHDKWDALATPEELTATPWPVHTEMQYAELMEELLARKACTTANTSS
                     FCVPVLSIDEFVYKHKGVRVCLGVAWMPRYAYNLREWAATVEQSGHRVPEASLLALLH
                     HVTTGALALRTATGTADKKDAALSLSVTLEKVLVYRASEAEKKIAKEADSDEAGEGLV
                     FALSTGSFRWRRAEPCADKNSRTNVPTRSRIRALTNHLIVPEEGQLLYRTPEECSPGL
                     YPTHGSAAAKRDVWTLGVALYLVASGVAGTGHAATTSPSNRGPRFAPLRELTPLNSAA
                     LTPDSLWKRLRGELERRGYSSTIVTVIAQLLSLDPLTRPSLSTMDRMLQDLHRPTPVC
                     RFPFALGSYDLLRMPNPTDIKLNPGARRYTMEGVCVLCKKHRGSTPLCAKGGDHVPGL
                     SSPSWSDEELLPQLHGMDLHYITFLYPLCGSSDERRRRKQAAHALRSCHDGINASSSV
                     ARAATPLLDSTLLFQVFGGFAVYERVPELNAKGQVFHRVTVKEVLVPYPSQGLRRSEL
                     PLVKLTIDFSGGLPWPSCCTEILQKNGRVSRNVPFGFTGAHHGVKWFGWVLPGERFSL
                     PNGGHWTAPRDGAFVFWFHSDLRPTDRDRYFALTSVRAATLPAKLPRTVMPHSLFRIH
                     AGDQRHTSNRLPRRVGSGNRADSRLGRGSIAHRRSCQTVTDIALPSATHEIVEADEVR
                     TLLGHRPLSLSAPQLQNTQEESPAHGRRRWSSAKDRVPSRHSAAFPADVVDALETSDE
                     ARESRGAARARSTLRSAGETGRSGVVLTPQLHAPDLLLNTPKPDTHAGADHESPKSPD
                     WERTSDQARLSERNSTQPPMDGNTTAKRTQALAAPEKSSSPAASQSLSSGRKKAPKLR
                     GTTVSSEEFRAGAALQFVASAPASVGAEHPIVSTMVSAQSVLTEQSSVLGGSPRLVNL
                     RHVSQHGAKKQSVQATSLSATPMLPPIVDALSAGLGELHVCGLWLPSEAVDAAFGSLT
                     FCILSTGEHGYMHPPVKTSARVAHAIRAPPGTEFLAFLSNQVPLFHRNHPRLERAGVS
                     LMLPHHGFTCYAADGTLLGVLGLRCSTKGDPDVMAGEFELVMRTSAAFRGSSAASWTV
                     YASHLSESVGVEAHVRRAAASAVNARRDCEDEDGRASTLRLVPSLLRRASGSRNLFAN
                     SPEQQTLTFTSARHLVGEFTPDESGDVLRSRKGEGEAVLPACWISFDGVSTALLFADA
                     PQSVWVPYRIGG"
     gene            <312021..>312980
                     /locus_tag="LMJF_27_0780"
                     /db_xref="GeneID:12982667"
     mRNA            <312021..>312980
                     /locus_tag="LMJF_27_0780"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721836.1"
                     /db_xref="GeneID:12982667"
     CDS             312021..312980
                     /locus_tag="LMJF_27_0780"
                     /note="previous protein_id=AAZ09824.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721884.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982667"
                     /db_xref="InterPro:IPR006769"
                     /db_xref="UniProtKB/TrEMBL:E9AD55"
                     /translation="MQPLSGTIFRRSGGLLPSAQSTSTLAHWRRRLSTLGHRFAAARA
                     AHASAPASSALSAHDFAALTPLLLLRQMLQQHTQLDGIGLGAQLHPNEQHIVISRTKF
                     CHFCAASHVADPNAALADLEAAGVVVVLDGGNIVHLRPVLFLETLEMIRNVARPSSSG
                     DGTLETSSKPLVAVGSFMLEEAERRVAALTERERAMRYRLQPAIARAARWRRTVWGGA
                     LLYAGAQLAIISRLTYFDLNWDIMEPVSYMITVANTLLFFLYYLRFDEEHSYTAYDQR
                     FLPRKVRQYAPRDFDWAAYADVCQQLAEERAMLDSMLKWSAKH"
     gene            <315245..>317920
                     /locus_tag="LMJF_27_0790"
                     /db_xref="GeneID:12982668"
     mRNA            <315245..>317920
                     /locus_tag="LMJF_27_0790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721837.1"
                     /db_xref="GeneID:12982668"
     CDS             315245..317920
                     /locus_tag="LMJF_27_0790"
                     /note="previous protein_id=AAZ09825.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721885.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982668"
                     /db_xref="GOA:E9AD56"
                     /db_xref="InterPro:IPR002528"
                     /db_xref="UniProtKB/TrEMBL:E9AD56"
                     /translation="MSHPSFRDTQRMTRERADASVRTSSNGHGGPASVLVSDVPQVRE
                     SCAKQRHVATHQQRHYGTMQDSINVMVRSSSMPEHSSHMVYARKHSRQLTVGQQSARL
                     AEKAKKNYFHGSFTSAHGSVFTVPNKAQQMATNRPSRAPLMAYSSMSRSTSAARRRPA
                     PISLDVSGVSAIKKTAASPTKAGSCSREDNDTDVLLTIREPNFLDGSIVLPRRALSAD
                     ARLGWRHGLDVSTCISKLRLSISGADLSASQLSEMTFRDSSPDLLALQLMRDHSAKQE
                     KRQLLSPTTISRAVRALRAFEERNMRLGGGAHSNARDAVNADEVDSALDGTPLTQAVK
                     KSETSLIPAVARCVRIKPDAEGNVVEEAIAGFEEDDDESFESGNGFSWFGATMDLLYL
                     AVPAAVSICFTFSMSVVPLSFVGRYLGPRQLTGASVGYFLLSILITYPTIGLTFALDT
                     LCSHEYGRNPLSPEMGLVLQRGALINLIILIPPCVCIYALDGILVPLYGKVLAEEAGE
                     FLLYSPLYLIPMVLFIAMNKFLNNQMQPHIPMIALTAGVILTPFLQLKLTPMGVRYTM
                     LGMAITAWFQLAIVTVITVFKRETRITLGKWRIAEALDWADVKEYMRLAVPSAIFVAA
                     EASSFDVTVLMCARFGEVDGAVWSGIMNCLFIFASFPGGLSASACANIGRCIGAYDPA
                     SAKRFVCMSILITFVVGLVDSALLVAFFDRLMSLFGTEGTTLELAREVLYLLPILHVC
                     DAVQFTFQGIFSGMGKNYIGALILLTSLWGVGVPLAFLLGEYLGYRTFGVCVGITIGL
                     CIEAPVMVYSASTTDYVAVCEKFMEDEEDEETEESEESEEYDNEYVEEVMRRSGISIN
                     SAELTEGNPEHYRKLLPPRRCGRPRRVVEYQDEDD"
     gene            <319386..>320444
                     /locus_tag="LMJF_27_0800"
                     /db_xref="GeneID:12982669"
     mRNA            <319386..>320444
                     /locus_tag="LMJF_27_0800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721838.1"
                     /db_xref="GeneID:12982669"
     CDS             319386..320444
                     /locus_tag="LMJF_27_0800"
                     /note="previous protein_id=AAZ09826.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721886.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982669"
                     /db_xref="UniProtKB/TrEMBL:E9AD57"
                     /translation="MGAHLRDVLLASLQRDVEKHQRVAQRNATPPGFVLKVHGVQLQS
                     SVAAKDRKRHRDRADHTPPRRSENSISQGEAWPSLVLAALSSVLQQLESDAQEQQREA
                     AHESAAPSAVSALRSVAGVEVRHCRLQAHHLCADDRCATDSVSLADILLSPQRLWNSA
                     TQTAPSPAYMRLVTLDLECNELGDAGVRLLCSGLLVHLRGLRRLLLASNNITKDGLLV
                     LVDSARSHDEGHLPPNLETIGLTNNPLGTHALRTVHGHPSENAFCDAFRTLVLRLSST
                     LRRVHLNHAGLSTREVSSVLQALFECVVQHPGPCAFDTVYLRENEHVDKEEALRLLCS
                     KVEDLEKLDTFLRRHVSM"
     gene            <321192..>321521
                     /locus_tag="LMJF_27_0810"
                     /db_xref="GeneID:12982670"
     mRNA            <321192..>321521
                     /locus_tag="LMJF_27_0810"
                     /product="glutaredoxin-like protein"
                     /transcript_id="XM_003721839.1"
                     /db_xref="GeneID:12982670"
     CDS             321192..321521
                     /locus_tag="LMJF_27_0810"
                     /note="previous protein_id=AAZ09827.1"
                     /codon_start=1
                     /product="glutaredoxin-like protein"
                     /protein_id="XP_003721887.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982670"
                     /db_xref="GOA:E9AD58"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR011767"
                     /db_xref="InterPro:IPR011899"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR014025"
                     /db_xref="UniProtKB/TrEMBL:E9AD58"
                     /translation="MFSSRFLYRSSSTMPATVAELITQHKVVVFSWVHCPYCSRAKEI
                     LKSLAKDIQVYECDQMDNGEELRTQILQAYNHDTVPAIFINGEFIGGCSDLQAIQKSG
                     ELAAKLA"
     gene            <324973..>334803
                     /locus_tag="LMJF_27_0820"
                     /db_xref="GeneID:12982671"
     mRNA            <324973..>334803
                     /locus_tag="LMJF_27_0820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721840.1"
                     /db_xref="GeneID:12982671"
     CDS             324973..334803
                     /locus_tag="LMJF_27_0820"
                     /note="previous protein_id=AAZ09828.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721888.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982671"
                     /db_xref="InterPro:IPR006626"
                     /db_xref="InterPro:IPR006633"
                     /db_xref="InterPro:IPR011050"
                     /db_xref="InterPro:IPR012334"
                     /db_xref="InterPro:IPR022441"
                     /db_xref="UniProtKB/TrEMBL:E9AD59"
                     /translation="MYEEAGYAVVQRYSRWQKKKVRTIIVNAHAKIVSGKSIAGAIAL
                     AKPFDRIELTGGEYHESVAVQMPLELVASEGEDPHIFSRLSTITIATSGIEVYMERII
                     VSSRSGSKLDAAVVAVAGNPILFRCHCSSLVIGGNAVAHVDECTVKESDSGVGIVVHE
                     SGGGIIKSSTIRNHRNVCFDIDTRGELAVTGCTIDNNTGGDAMSISGAVSSITRDSGS
                     SSTSCSQVEVTHCHFSISHDASSGASGVVSMSSVGSACGIILAQGAAPTIASNEFIEG
                     EIGVLIEGPGTAQLKGNVIRCQRRCGILTLVGESSGYAPNHQTLRITGDNVIDRCRVG
                     IDAQCAISRASYIQQQNSATSMTGAGSGVRAPAEADLNVGAIGGNRSEPDRFLSDELP
                     NPKRAFAWAPVQGSTSSPSSCDASCFLPSTSPTTPLVCIESKWCSLDKLRANLQQLVT
                     MTLQANPTCLQPAFEICTSTASIVNEGLDATSANPFAAILNNMLGTQLSHRTDTPASQ
                     REVLRLRGNKGIDIVNTKFSNCDICAIRFGRQGYGVVEDCVFEDCGAYAIVVDCAAHP
                     LITGCRFLRSRGASILVTNFANPLIIGNEVVSGKRDGIQLASMSRGLIIGNIIATHVG
                     AGIRVDKYSQPLICANAISQNRHGGIAVAEGSKPTILLNKLSANLYAQVNCTEGADAF
                     ISHNHITASADAGIRIDSCSRCTVFSNTISFNGDGILVKLDADPYVQDNDITDNTRAG
                     VRACNNALGVFVGNRIRKNTGPNVLLTEGASSVFRANRIEDSSQGGVVVCNEGHGFFE
                     RNTIATNAIANVLVAGAYSEPEFLRNVISSSRSGCGIVCGRSAGGSFLRNSIHGNYQC
                     GVFILEGSNPTFRANNIAREAVGVLVSDGGKGSFTQNVIEDCYGSGVLAQRQADPVFS
                     QNRVTGSQMSGLHIAPDSVGLFERNEVTRNDIGVQFGSSMDSAVIQIHSAYLADADTS
                     NKDLSASLQRRASRTAQHRSNVFATNTDASVLHSIASASLQRSATVVRLPTSVVRGNI
                     ITANLRGGVLLDAFPNGTLEQNDIFQNNAYGVRGDVTYGAARALAMLTTTLGVTDRSS
                     VIRPPSLQQQQQSSFEQLQTLMLIRANNIYGHDEANIFLDHFDGDKHETTITENTIHG
                     APYGVCVANNSTVHSMSKNEVHTCMDGFAFASGGHGCYTANHIRDCTYSGVYISDRAY
                     PDFTDANRIENCGFSGVLVDVNGQGVFLNNTICHCATGVVVFCGPTTPFHVSYEEVIH
                     ARILSSAPTFTANTIEENELHGVLLLSVISGCPLRSPLLLSCSGAGGKSAGVPPADSS
                     TDEPLHDAPVPYSCAVGGIATARGNRLCATFEKNIIRRNRMMGVYHDRFEHWDLSALE
                     KTHAETKPSAGNPVKNAHGGYEVLLGTSQILDNDEHQRQRQLKQVSLIENIVTECSVG
                     VGAGYGCHPYLQRNKIHHNTFFGLLLRFGSAVSAYANDICDNGLAGVYAAIGAKGYIA
                     KGIIESNNGWCRPEASPHMPRSFDDCTFSKSFFTQAIVGTMEEKVRATAVTAGRTLRA
                     CCRAYEQMSRLAEVHVFTMTDALRYLAELVAASSGGLTLASGCAPSALFEGVEDASSS
                     VKGTAALGRRWLGGVALADYADVSTADGGIGVWVQAGSRVTIQGNRIGKHQNSGVLIT
                     KGVLQHHSVLHKSFNMEEGRKGNKKLEMVASLPGRAKSMRTTASSTTVDIFAGQREAP
                     PLACVEPGALFTTQMLYATGILAAVQVAASTTFESLDAEFASFLHHSLSLSSLNGLEA
                     EEKRQRVDSLHHVHIADNVISSNRDGVHVEVFHCLQACTTPSAAAAAAASVSRIKPRS
                     GAGANSMSDLTPHAPTEAHALPRFQRASSPKLSVAATSALGASSHDIDVMECAYSASD
                     FTIVVEGNTVTQNRRYGVYAVHVANVHCERWLSGRGALNETIAAQYDSIRSKLVLGKE
                     PTRVSVTLPFELHALQQKVGHALFRKNDLFRNQDMQVYVTSRYVALTQDGDRTLLQLD
                     TTTPLSGSNYASQVLVGVPVMASLLQLPPPGLLLWDENKVRDAKSGVLLCGHLGPHSV
                     RFQRNTFANIASDALCVQGHLACATVGKGNVFERNGVGLRLAQQQRIRLVTSPATALG
                     HLRTRVFHNTFREAKDSSILLECVGEEAPLVYQNEFSGQTAGTVALYLQSERAGGAAV
                     VQGNVFSENYIPVFLVGGSESGLESRLHASPVTLVENRFTCNYVGAIVCNGAAPILER
                     NLFEKNARAGLEVVGSGTRPQLRHCIFREHRRNGDGGKLTMPYPTHGMLQLECRNFSL
                     KLLPENARVLTATSQARLPAGLLIGPLTEPVVDACGFFNNDTGVDAVRDAASPAIALA
                     GPKAHFKGCLFTQHQVCGVLVRGFHGAADGSGGGGRGVDGTGGGAAKETAEGRKWTDG
                     AVDVSSALNMADTTVFEGCVFTDNTTANGGGDVVAMEDGCATFRENVFCGTVVGKTGG
                     VACFTQNSFIALSDGNAATLAGVAHDLSPCSGAANSAAAAVVIQEGGRIVADQNTIVH
                     RKVGVKCLPGAEGVATDNRIVQCVTGLVLAPFNRTGVNKNRVLDSVDCGAVAYGGRME
                     DNTIIKAPTGILVQHSSAYKGINAVPSHKRDALGFLCIGNRIVDCAKSGLLITTAGVF
                     DGNSVSRCKSGIHIVSPLNGGPAGSCPVIKNCSVYDNGVGVCMEHESESAVRDNDIFD
                     NETVGLLVAATATGTLQDNRISSPAEQGAAEMAVESSLTSFGNIIRNQFSPAFQRGTR
                     ASRAKDYQVAQANLDRELRDLDGTVEQAHHIMEAVSSGLWSLEQELVNMHSKSIASFT
                     TVMAGPAGRALRVASARADTTTAAVGSDKKDDRPTPGNPSTSNAKSILGSGNSVTGAA
                     ASRKRSLGSVGRWTTGASSSRASAVSMGIRKQSKVGLSTKADAGGKATRSAASADPMK
                     VLVHVFTSAATSSGADAVGQAITGVLAKAPLSKYNFISTISTSTSQLRRLLGGPQPMR
                     PFLCVVVVDANFDHFSPSDHDALKQLYKSACVDRLTTHQGATEAAGRNSQEVSSLFYT
                     VLPSSFCKKDEASPSGDGAMSMEAYAAPHHPFTYTASVEEVLDVLHDRISQDMNVSTA
                     SAANCLSRSITLQDVPVSVTESTVDNPPIDDDSRSRSASVSGGCSALTCESRRGSTLL
                     TVEHVSALFSKLTPEALGLEPSKDARNMKRRKSSVVLSFQGEGDVGELDHTKRSGGGS
                     VQYRRGSTASKAAGQGAPAGRRRSSVVGSKSGRRTSVASKKS"
     gene            <335935..>337353
                     /locus_tag="LMJF_27_0830"
                     /db_xref="GeneID:12982672"
     mRNA            <335935..>337353
                     /locus_tag="LMJF_27_0830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721841.1"
                     /db_xref="GeneID:12982672"
     CDS             335935..337353
                     /locus_tag="LMJF_27_0830"
                     /note="previous protein_id=AAZ09829.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721889.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982672"
                     /db_xref="UniProtKB/TrEMBL:E9AD60"
                     /translation="MPSANAHFSLSAGSAEETRRSIDSDCPLFNCFGVLSGGVIIDPI
                     DGSFMEFTDAAVYTPSTVAAQVDTGNDTQDDLARCTLQQANEHAFRTGATHLIRPECP
                     LILCTSELPLPPRSSDRPLNRFKCRSSPLSAAGSTGPTVTSARHAAQMGMENVEKWLN
                     QLAPHPGHRPQSPRRQAWTTVWADAEEFRLSMRAHSDVRASEASLYLPPRIPFPLRFR
                     GQPISLIEEGANESPAASQQQQPDREANSATAVPPDGVRCAAASFTCYTGVPRFATAT
                     DTAPRFDSAEFAKGTAVARLRKRLRPYCETSSLGRRRSSSDYDEADREGFLIPFTDST
                     PRHAAFALFLLYFNHLGVLCNGVRVTGETAASSCLDGLDVGSTTWGLCPKYLYDVRAE
                     VERKRRVTRELREHPERTFAGGTRWSTTARNRDAVAAAWTALLLSSRTALLERITELN
                     RHIHKLHDEKQRRRHADDQENQ"
     gene            <338345..>340951
                     /locus_tag="LMJF_27_0840"
                     /db_xref="GeneID:12982673"
     mRNA            <338345..>340951
                     /locus_tag="LMJF_27_0840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721842.1"
                     /db_xref="GeneID:12982673"
     CDS             338345..340951
                     /locus_tag="LMJF_27_0840"
                     /note="previous protein_id=AAZ09830.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721890.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982673"
                     /db_xref="UniProtKB/TrEMBL:E9AD61"
                     /translation="MLRIGRRSLAVVTAAAITDAATKLNALLDIKHRTHPAPQGEIKR
                     FLKTEVMPVLAGTELDRRGNSTDLRHFLGQLTRDAAFAAVIVGARPEASFVQAIVTCI
                     KEDHQRMRFLPKMSSPQASKIVEYLCKAGVTDTEVYPVLISRLNFGTLNELGRVMFAL
                     TESGFHALNMLVVVPLYSGEQWVLDFDKTKRKRNASSCSAFDAVRVLRALSKSCRAYV
                     EECRRAPKEGMTGVPSESLNLLRNNLLRFIFENASVLRGAHWLNVARALLNFPREFSE
                     LRNFVRDYPAIEKEVRSALGVSRDSTVASSSHDAAAPCAVNCETVGAAAMQCVFQYAE
                     QRSVIEDVGVGCPVSAEFPFDLSYGDLVKLLPLLDQFPRMTSAQKAQQRAELVLRVMC
                     ANVHRLRLQDLVAALQALRRIRPSATATAAVETIAQEAGNRLTVSSAEEVLDAISFRT
                     VARLAAALAALRVNRCDGFVTFVTTRRDIYPSSLTVDTALSFINALAALKMTRSSLCH
                     GALESILRGVLNFYRQQLRNGPLLDAFPIFVARMLRGCVLLDYIPPAPILQSLLGSAE
                     APLRMSDEVHSADGVLVFDLSRSLSHFLKQARATAPEREKDLWDVGVVRVALPLAVAC
                     TEDTVHAMENYRQASSSSHTAVSWRSTVEMLALFIDPQMNSTDRGTMVQRLLEVFSEV
                     EALMRAAATATRAHLEQCSRHIHHADEARQRSRQTPFNANCNVHFLSALLIFEYVIFH
                     ANTKAGRLPSSVAGQPTTSVLGDVEKDTATLAGLKNQYCEFLRTPISESVTDTPMDIV
                     RRIFECPLSGPIAGSAAAPPTVVLLEKTDAVEITTTLPFALSLAMDPGPVNEFFTERC
                     MSIMVSDAEEAH"
     gene            <341891..>343606
                     /locus_tag="LMJF_27_0850"
                     /db_xref="GeneID:12982674"
     mRNA            <341891..>343606
                     /locus_tag="LMJF_27_0850"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721843.1"
                     /db_xref="GeneID:12982674"
     CDS             341891..343606
                     /locus_tag="LMJF_27_0850"
                     /note="previous protein_id=AAZ09831.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721891.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982674"
                     /db_xref="UniProtKB/TrEMBL:E9AD62"
                     /translation="MPSEADLDRLRCRLHQSGAIVSSRSVASRADANFDLEVVNVGDG
                     RRATPVEHLLARLEQHGLRRRLVAEDDAAAYAVDAAARADTEENADDDGDEMYASEEG
                     NTEDPRAVSSCSSGDGAFSSPAPSKAPETREAYYYLCVPCELRLTRISRRPPRWRALE
                     DVHFHFSSAAHRATASWMADDDIDETLHSTPLVTPTHYYSRIYVNGVPTLLSRRPGGG
                     DMFYPLPHEQDLVAPPSAAAARDGNRVDCLHGSRTVSNSSEASGAPAGRFFPPSTLRG
                     AQGGQPVLWHRALPSLCTRTVQVVRRTRSSSLTDLPADRRRYRVARTRSRVMVGVDHC
                     SLDEYRQQSWMPLHKVPLSLAVYRLRRERVPKPLLARPESAGPQGQAVPLRFSESAVR
                     AAQAADVAHRTVYTQPYHPIAEGSRDYHRQGDAFTAAVPVPTTVFEDECYRVALVSAA
                     EQARREGLSHPEASRKVSHSLFPADVASEEIHRPVLTLELLMQHTQSTSQSWRPAFGL
                     NTALDSSFVPSTAPPSPSRRSSISHLTRSSSSGSTSSSTSSEHSSTSRSSTHTRKRVK
                     LDGCL"
     gene            <344410..>347523
                     /locus_tag="LMJF_27_0860"
                     /db_xref="GeneID:12982675"
     mRNA            <344410..>347523
                     /locus_tag="LMJF_27_0860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721844.1"
                     /db_xref="GeneID:12982675"
     CDS             344410..347523
                     /locus_tag="LMJF_27_0860"
                     /note="previous protein_id=AAZ09832.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721892.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982675"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:E9AD63"
                     /translation="MQGTFFSVNVLRSPFGVRGAHLVPPPDTELAMGKVSTVTDAKVT
                     DSYAQVLPLHTTLGRETRQSYAVSGTRGIQQLVANTRSASFSAPSILVAAQELNSRGH
                     SMPSATPQLQVISKHEKGRLLVWNGLTGAVVAACIFPPTFNVDHCAVAASYVYTTVEG
                     SAAKSAAEEEACVYVWSRSTLRSVTVLRGHSGRLTALGVWPMETSTLIATASLDGTVR
                     LWRHQHSPGAWDGAVANEDPVQLLWVLATAELGSVHSLRFLAVDTVVAAATRCALAFL
                     RFPDAPAKRKGRGSLVSMGTADALAFQMVRSIVDPNGSTTFLHVCPYNRTSGGVVAVT
                     PALGNFSLSSLASSSSPRVSAAAPVSESSTVYLLTGSTSGYIQEWTVDVENTASAEAL
                     PKLAASSAEPVYVDIKCRWHHKAHSATVDCVVTDEDVVVSTSLFDRVNIYHRTSGATC
                     AITSTPAIPVLVPQLKELVWGTIDGALSVASYARFASGVENELQLLWTARPHATAIRG
                     VCLSLTPDLRWDTLCTGAADGSVCVWRAMPESGRAAGGSAAARKESAAPLIAHLLHVL
                     ALPPNTAAKGDADGKRVAAVAAGLKASTTGTQGAILVVELTAIGEVGQVAAVLLKDNV
                     EVSCAHLCRGDKGTLSLWVGTRCGKLLHAFNKPAQKVWTALMPVHWDGKPNGSVAAIA
                     DDAASSAMMVAVAEAPDSRRASQRLFLSALQLEPGATVVKTVLSRWESDVALSCNAYA
                     AGRRERTFAMTWVSKVGSDEQASPRTIGGLLVCCSDGTMVRCLRTSMADAAPSVGPWN
                     TPEVLVMAAASSGEANTIQRNFDESPSFSATAVASQSRDSDLLCVDMFDNSKRLLMPS
                     KVRTTQLTALLCDVGTERVRLAAVRQEKPDVASEVALFDNAGREFGRVTHDGAVLQSN
                     DTSTASASKGLISYTPKVQGASLRRSSAAAVPPAARAANCTAIAAHAGDRIAFIGYDD
                     GLLQMVDTADVYVFCRRWAADATGVARPIVDVRYSGSGVVVVLLANHHLCSFAVPPRS
                     LLDQPSL"
     gene            <349677..>351947
                     /locus_tag="LMJF_27_0870"
                     /db_xref="GeneID:12982676"
     mRNA            <349677..>351947
                     /locus_tag="LMJF_27_0870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721845.1"
                     /db_xref="GeneID:12982676"
     CDS             349677..351947
                     /locus_tag="LMJF_27_0870"
                     /note="previous protein_id=AAZ09833.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721893.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982676"
                     /db_xref="GOA:E9AD64"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR006602"
                     /db_xref="InterPro:IPR010554"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:E9AD64"
                     /translation="MAYHQSQQMQKEFRLPMVPGLSCGEEMMRRNYDRRQIHGVKLDC
                     ATAIAGVPADRTLTGGSSDYPGSTLKAAVTAVAEAAEADEQGAEDPTGRVLRYYGYCI
                     EPVSDSVLETERVRKVILNFYLEDGTMSVTEPKQDNSGFAFPANLKRHIVPNPDGTPI
                     TAAQLKVGESVSFYGRTYELYDADPFTRALLKEAGEEVPPAIVPPTDAYTTMRGRPVA
                     KAHDVPSIAASSPLNTMLSPAQVRAARQFLEFDRKVLRCDCTWDDTTSLYGTKHFLTL
                     YYFLSDGSIAFVEKDVQNSGRDPFPKFLSRQRIAKPTSASGKFDSSSLGSVTFKENAN
                     TVYYTDEDIRIGNVLNLYGRQVKIHDYNQYTRDHMAKKFGITAHAPIPGATPPPFVPP
                     CSTRREISEETVREHHNEKHEELRRHRFANSVVKFLARLDNGKEEDKVRRFVLAVYLA
                     DNSVSIFEPVIRNSGIVGGKFLQRQKVRRADGEYFRADDFYVGARVVLNSFPFVILNS
                     DEHSLNYMEHNPEEFGHSDINKIVRKMQAMLQSCTTGLAEAFRLADENRSGGLDMEVF
                     LSIMKELNLDITEQEILTVLRYFDKNNESYVSYEEVASRIMPEGGAVASDNRPWEAIY
                     QEGADHATASFLDDPKEAEEKERKSRENAAASRGAAEFLKLYDQRRQLFMKEFHAITD
                     YAKDSLIGSDEFKMCTRRKLELSSISDEEMCALAKNLFPAVAPRVSYEEFMRLLNGTS
                     TYAHTVAAIASHGASK"
     gene            353292..353744
                     /locus_tag="LMJF_27_0875"
                     /pseudo
                     /db_xref="GeneID:12982677"
     misc_feature    353292..353744
                     /locus_tag="LMJF_27_0875"
                     /pseudo
                     /db_xref="GeneID:12982677"
     gene            <355386..>358406
                     /locus_tag="LMJF_27_0880"
                     /db_xref="GeneID:12982678"
     mRNA            <355386..>358406
                     /locus_tag="LMJF_27_0880"
                     /product="putative 2-oxoglutarate dehydrogenase subunit"
                     /transcript_id="XM_003721846.1"
                     /db_xref="GeneID:12982678"
     CDS             355386..358406
                     /locus_tag="LMJF_27_0880"
                     /note="previous protein_id=AAZ09834.1"
                     /codon_start=1
                     /product="putative 2-oxoglutarate dehydrogenase subunit"
                     /protein_id="XP_003721894.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982678"
                     /db_xref="GOA:E9AD65"
                     /db_xref="InterPro:IPR001017"
                     /db_xref="InterPro:IPR005475"
                     /db_xref="InterPro:IPR011603"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:E9AD65"
                     /translation="MMRRALSGVVAVRASAMRSYTDARTIRKPNPYDQLVNAENQHYV
                     EDLMRQYEADSALVDPSWVPVLEAIRSGSDDSPVVATFSRPTDAKSLSEKQRHDNMRL
                     SWMIREYERFGHHMANVDPLSGYHADNCILGSRTLAPEEFGFTKDDLTHVFNVTFGAS
                     HEATFVSGGTAMTLQQIIDQLRRLYCGPIGFEFMSSGFFELRNWFRQEVMDSLQSLPT
                     EERRLYYNDVVKACGFEKFLQLKYATKHRFGLDGGEALIPALKAAILTSSDLGVQSAI
                     IGMPHRGRLNVLANVLRKSLRAILNEFEGRVAIEDAHLTGDVEYHLGKRKHVSLPNNK
                     SIELDLLPNPSHLEAVNPLVLGKARARQTYTNDVECTAVLPILIHGDAAFAGQGSCYE
                     TMGFCELENFHVGGTLHLVINNQIGFTTNPKDSRASAYCTDLSKVNNAPVMHVNGDDV
                     DACVKAAKIAARFRQQFHHDIIIDLVCYRRYGHNETDLPDFTQPQLYHQIRQHPSVVD
                     IYTKTLIKDGVLTAEEAKAKDKDWEGVLRQAYDRMNSAQNFVKVMPVFDPESENTSAD
                     LSSAKIAATRVPPPVSAVDTGVETQTLRAAGLRLASIPKEMQKPHPVVERTYAARKKG
                     TEQGDAIEWCQAELMALATLSMQGVPIRLTGEDVERGTFTQRHAGITDMKTNLKYFPV
                     KMLSPSQALITISNSSLSELGVCGFEMGYNMENTRSITIWEAQFGDFANGAQVIFDQF
                     LSCCEEKWNEHSSLVLSLPHGYSGAGPEHSSARVERFLQLSDDSDRVPSDFRHFPNDQ
                     ALEIRIRRHNWQVTYPSTPANYFHLLRRQGLREFAKPLINLFSKARLRAPNLSKLSDM
                     TQGTSFKAVIDTARAKDTVARKVVFCSGQIESIVNDAKTAMQKETPGVHDDVVLVTVE
                     QLAPFPWEEVADVMEKYAQRNPNTEFVWLQEEPRNMGMWTHMRPRMNSLMRHLGLKQT
                     RVNVVSRPSAASPSTGYGSVHVAEEKKLIAETLA"
     gene            <360592..>365982
                     /locus_tag="LMJF_27_0890"
                     /db_xref="GeneID:12982679"
     mRNA            <360592..>365982
                     /locus_tag="LMJF_27_0890"
                     /product="putative phosphatidylinositol (3,5) kinase"
                     /transcript_id="XM_003721847.1"
                     /db_xref="GeneID:12982679"
     CDS             360592..365982
                     /locus_tag="LMJF_27_0890"
                     /note="previous protein_id=AAZ09835.1"
                     /codon_start=1
                     /product="putative phosphatidylinositol (3,5) kinase"
                     /protein_id="XP_003721895.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982679"
                     /db_xref="GOA:E9AD66"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR002498"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017455"
                     /db_xref="InterPro:IPR023610"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027483"
                     /db_xref="InterPro:IPR027484"
                     /db_xref="UniProtKB/TrEMBL:E9AD66"
                     /translation="MRLPCPTHIPLSSAETHFVGTVAAACPLGLVRVGVFSLRQERID
                     SDTCRGSTSPPPPQSSHRCIPVYFFFVTPPPPPPPRVLVSPELKMPTDRSLWVEDKYA
                     LRCRGCGKKFTAFRRRHHCRRCGQVFCYECLHPLSTAASTPQNIVFSVYQWFSSSPAT
                     PLSTPTSPQARKTTEKTEVVSSSRDGAAAAAGATAAAAELSMRLCCRCAATIAENAAR
                     EASLSHDEFEPSSLPVHSTAPLGAKMPPPLMPSVSLPCPPLSKVSTPMRLSERSLPEE
                     EPSPAPPRTPPFFVTARQSEAEDPHYMVAPELLGSTAMHAETAEEREVTYSIGRVRRP
                     PPSVMTQWRRAHQEALTNKEARAFPVQRTSPCASALESAGALVRTLSGHADFHARFFL
                     GEDVTQSPSDPNDGVMGSAAVIPVADAPAPLRGFLNDFGAACTTHLEARIQHTLQSSF
                     PNLGGSRLCCHLADVAWHIVSHTAVALDASILDHLSSFFIHDPAQPAQCIVYPGLVNR
                     RRLPSKRAMSPCDHPRVLLLAGHLSYPVQPTEDLVEYVRSYSGYLDKLFQRLVMWHPD
                     VIVVEGGMHHYLRARIEQEGQMRLMLDVGRDFLVQLSWCLRADIIADLQYVGVGDLAT
                     TAPLGHCTRFEVLELAEEVRCCGFRGFDALSYHTLILRGGSPSGGVVAHDSSNGERQW
                     ETMEKVVREAVAVAYHLALQAHGAAALVRKDLPVSVSGAAPTAEEAAAAAAITMNLGC
                     HFPSSVQSACRDAASPAALSALKDSIVVNIVHMDELFEGGAGGGGGGAVVSTLAKSRS
                     TELSLERGSSRGSLTLFQGGSHHDLPASGAASASSSAPLLSPPLGRAEAPAANAYAVV
                     QQKSALTFYGAGDESLFHFLVNRCAGTESQMLYLHGAHRVKVTTSISPPLPSAAAILT
                     ESGLAGVLGAAQMLAFHKVTSRQSAARALAAAEPLDTHALAAFVAHLKGYFSLRIRVM
                     DEDARVAAADAVVVAAAPVDAVVEVCEPHLLNLSTAAFLEWVLYGWIPALSRRFAQPN
                     LQLHFQFHSLGTAAQPQEPGAINVSAYANAVTFLVEAVSLSRIEYARTMMPRADPAPQ
                     GEGSSEGDAMSIVDCLYARDDAEEMESLLAELQQVTRTSLDRMDQLENAKAGVPAAAS
                     PVGAAHVPEDAEGKAAAAARPSSMPTLERSTRDLRQLSEDVQHALSLLHDARQRGHAD
                     VVLLLANMRSRLLPALLAAYRGWHVAQRRATTKSPATTPTDAAAATAAECPSCLRQLD
                     GCLYHKERAQWIRLAEPSSILAAALLHLYRPLPPSTLCIPSTTKGAAAGTELELNKPV
                     DSEAAAAASATPHGAFAVKRTHTASSLDASPATRSGQPPLLSMVSQLSPTEALEVLRQ
                     SSRSDAALPTSLKCTLSGYQSVVHLGVGGPAGLAGGAVATLSSAASVASMIGGGSGNA
                     EPTITVDVLFPLSFAALHVLYTDGAPFHICAALVRCRPFSTDGGKSHSKFFVTQDGRF
                     LIKSVKPMELRHFREWAPRYFARMEEHYTSLQRQQQQQQQQPSDGETCAHLFEAQSTL
                     GKIMGLYAVHVQGSRSRASTSPATSSGAALGDATPQLWGLLTDGTHYFMVVEQLLFQR
                     PVREKWDLKGSQRNRTTEHTAAVRLDVDLVQERLRLGNFFFCTPEAKSLLMDHLSRDT
                     ALLADSGIMDYSLMVSVGDGSVCVGIIDFLHPYSSAKVLESKMKSSLDTMLGYTRRDP
                     TIIDPASYAARFMRWMDGYFNGVPDRLFPLTSARQRREDRESGVVEKRPRLPPLFRET
                     TKRQASGGGRGD"
     gene            <368014..>368604
                     /locus_tag="LMJF_27_0900"
                     /db_xref="GeneID:12982680"
     mRNA            <368014..>368604
                     /locus_tag="LMJF_27_0900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721848.1"
                     /db_xref="GeneID:12982680"
     CDS             368014..368604
                     /locus_tag="LMJF_27_0900"
                     /note="previous protein_id=AAZ09836.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721896.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982680"
                     /db_xref="InterPro:IPR008496"
                     /db_xref="UniProtKB/TrEMBL:E9AD67"
                     /translation="MESRTRFKADTPVQLPPAIDPVRERYPFCIVWSPIPVLSWILPF
                     VGHTAVCDSQGRIYDFQGAYRIGQDRMLFGNPVKYWDVSRDYIPSFYNADQQNSAERE
                     EAVKREVAAYDAALMSTISHFRQTEVYNFFTNNCHSFVAASMNEQQLKKQHMGMVSIA
                     IGMMTRGRYISVSRFMQAHLPSILLIVIILILVALL"
     gene            369613..369698
                     /gene="LM27Cs1C2.2"
                     /locus_tag="LMJF_27_snoRNA0001"
                     /old_locus_tag="LMJF_27_snoRNA0171"
                     /db_xref="GeneID:12982681"
     ncRNA           369613..369698
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C2.2"
                     /locus_tag="LMJF_27_snoRNA0001"
                     /old_locus_tag="LMJF_27_snoRNA0171"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460860.1"
                     /db_xref="GeneID:12982681"
     ncRNA           369615..369698
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C2.2"
                     /locus_tag="LMJF_27_snoRNA0001"
                     /old_locus_tag="LMJF_27_snoRNA0171"
                     /note="hit to all_bases 0..0 score: 81 percent id: 100"
                     /transcript_id="XR_002460861.1"
                     /db_xref="GeneID:12982681"
     gene            369779..369869
                     /gene="LM27Cs1C3.1"
                     /locus_tag="LMJF_27_snoRNA0002"
                     /old_locus_tag="LMJF_27_snoRNA0123"
                     /db_xref="GeneID:12982907"
     ncRNA           369779..369869
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C3.1"
                     /locus_tag="LMJF_27_snoRNA0002"
                     /old_locus_tag="LMJF_27_snoRNA0123"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460862.1"
                     /db_xref="GeneID:12982907"
     ncRNA           369781..369869
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C3.1"
                     /locus_tag="LMJF_27_snoRNA0002"
                     /old_locus_tag="LMJF_27_snoRNA0123"
                     /note="hit to all_bases 0..0 score: 89 percent id: 100"
                     /transcript_id="XR_002460863.1"
                     /db_xref="GeneID:12982907"
     gene            369939..370007
                     /gene="LM27Cs1H3.10"
                     /locus_tag="LMJF_27_snoRNA0172"
                     /db_xref="GeneID:12982908"
     ncRNA           369939..370007
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1H3.10"
                     /locus_tag="LMJF_27_snoRNA0172"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460964.1"
                     /db_xref="GeneID:12982908"
     gene            370081..370170
                     /gene="LM27Cs1C1.16"
                     /locus_tag="LMJF_27_snoRNA0004"
                     /old_locus_tag="LMJF_27_snoRNA0150"
                     /db_xref="GeneID:12983012"
     ncRNA           370081..370170
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C1.16"
                     /locus_tag="LMJF_27_snoRNA0004"
                     /old_locus_tag="LMJF_27_snoRNA0150"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460864.1"
                     /db_xref="GeneID:12983012"
     ncRNA           370083..370170
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C1.16"
                     /locus_tag="LMJF_27_snoRNA0004"
                     /old_locus_tag="LMJF_27_snoRNA0150"
                     /note="hit to all_bases 0..0 score: 88 percent id: 100"
                     /transcript_id="XR_002460865.1"
                     /db_xref="GeneID:12983012"
     gene            370212..370297
                     /gene="LM27Cs1C2.1"
                     /locus_tag="LMJF_27_snoRNA0005"
                     /old_locus_tag="LMJF_27_snoRNA0170"
                     /db_xref="GeneID:12982909"
     ncRNA           370212..370297
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C2.1"
                     /locus_tag="LMJF_27_snoRNA0005"
                     /old_locus_tag="LMJF_27_snoRNA0170"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460866.1"
                     /db_xref="GeneID:12982909"
     ncRNA           370214..370297
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C2.1"
                     /locus_tag="LMJF_27_snoRNA0005"
                     /old_locus_tag="LMJF_27_snoRNA0170"
                     /note="hit to all_bases 0..0 score: 84 percent id: 100"
                     /transcript_id="XR_002460867.1"
                     /db_xref="GeneID:12982909"
     gene            370378..370468
                     /gene="LM27Cs1C3.2"
                     /locus_tag="LMJF_27_snoRNA0006"
                     /old_locus_tag="LMJF_27_snoRNA0124"
                     /db_xref="GeneID:12982910"
     ncRNA           370378..370468
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C3.2"
                     /locus_tag="LMJF_27_snoRNA0006"
                     /old_locus_tag="LMJF_27_snoRNA0124"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460868.1"
                     /db_xref="GeneID:12982910"
     ncRNA           370380..370468
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C3.2"
                     /locus_tag="LMJF_27_snoRNA0006"
                     /old_locus_tag="LMJF_27_snoRNA0124"
                     /note="hit to all_bases 0..0 score: 89 percent id: 100"
                     /transcript_id="XR_002460869.1"
                     /db_xref="GeneID:12982910"
     gene            370538..370606
                     /gene="LM27Cs1H3.11"
                     /locus_tag="LMJF_27_snoRNA0173"
                     /db_xref="GeneID:12982911"
     ncRNA           370538..370606
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1H3.11"
                     /locus_tag="LMJF_27_snoRNA0173"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460965.1"
                     /db_xref="GeneID:12982911"
     gene            370680..370769
                     /gene="LM27Cs1C1.17"
                     /locus_tag="LMJF_27_snoRNA0008"
                     /old_locus_tag="LMJF_27_snoRNA0151"
                     /db_xref="GeneID:12983013"
     ncRNA           370680..370769
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C1.17"
                     /locus_tag="LMJF_27_snoRNA0008"
                     /old_locus_tag="LMJF_27_snoRNA0151"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460870.1"
                     /db_xref="GeneID:12983013"
     ncRNA           370682..370769
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C1.17"
                     /locus_tag="LMJF_27_snoRNA0008"
                     /old_locus_tag="LMJF_27_snoRNA0151"
                     /note="hit to all_bases 0..0 score: 88 percent id: 100"
                     /transcript_id="XR_002460871.1"
                     /db_xref="GeneID:12983013"
     gene            <371631..>374906
                     /locus_tag="LMJF_27_0910"
                     /db_xref="GeneID:12982912"
     mRNA            <371631..>374906
                     /locus_tag="LMJF_27_0910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721849.1"
                     /db_xref="GeneID:12982912"
     CDS             371631..374906
                     /locus_tag="LMJF_27_0910"
                     /note="previous protein_id=AAZ09837.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721897.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982912"
                     /db_xref="GOA:E9AD68"
                     /db_xref="InterPro:IPR000547"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR007810"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019453"
                     /db_xref="UniProtKB/TrEMBL:E9AD68"
                     /translation="MAQAVPPNNRSHVEALHDPVAPHFELVSYPLSDSQDAIEDADCQ
                     GGVLAVLRRSGRLEVRDAEEDRVLLRTLVRNPHKVFVHPQGTYVVVTASDGEVSVQNT
                     FDARMCATTQLQATDVLGTVAQGSQDVVVGECVGWLPQDSYGVAADDNPEVLAARAVS
                     AFTTQGSSTAGAAEWSYLMGVNKGSAIFALHICVSSSNPNRLKMRAVLVWSLPSPASC
                     AFPIRSIAFAATGAGGCVLLISTAINLHEAHSSSIAAPAPLFHALRSGTVKLRTQTVP
                     LYAGSASAPEANGRVLLYRRSYAAAPQSYVWNSAAGVVHGLFDRDVSTDMVDENERLL
                     FRTSSVSETSVPSVGEAGARVNEQSFSLAKVADSTGAAGAGVDRAARPPSAVPIAVVP
                     TAFHMIVLYPRRCIVLHQPPGASWRSPADGGGAAERFAPPLPAEVAQRIRFDPFRASP
                     PPSSELCGVIHDAEARRFYLFSRTHLWEVLIEDEAHQQWRLFLERGRDAQASLAVRKR
                     YMDAACRLAFYSDTQRNLCLFRRGQFFLDCGATRHAIAQFAKCDWFEDIYALLTTYRN
                     TNVRTAFVEARFQFLLSHLASLDDWAPQLTSMFVILMLAKLDQIARSAPASAAAEADF
                     HKFLLSTVEQCGVFLKENAVYELVLRLLEEQGRPESALIFAKAMQRTRYVVASHIVQQ
                     QFDEAVKVLGACHGSAARLQPWYEFTSVLIQHRPVALTTALLRALTKEARAGRVLPLQ
                     MERLMPSFVRYDISMNEVADNTEHQVVVLLDQCIHRYDCSSGAVHNYYARLLAQTHDA
                     VRLDDFISTSLFLDTGYALRMCLKHGCTTAAVALYKHMHLYRDAVTTALYVPHERRNS
                     GSGNADEDASVAARSEDKDVLPGLVAAEDTLRGLVGKVRNDELHQLWMLTAEQALASH
                     NVAAALAVVQESGGVLRTEDVLRKIEDVNLIDDFRDVICEYFDAYADQKRQLSRTQDE
                     VYQTAEEVKKDLRQAREQFGYITASQRCPLCHRTLLQSSTPYFVYPNCGHVVHEVCAV
                     SRLESIGGLETFLADEGIAPHVLDGISDVHQLAKQDCVLCGEAVVVEVDIPLFRKDAS
                     WDL"
     gene            complement(375175..375260)
                     /gene="LM27Cs1C2.6"
                     /locus_tag="LMJF_27_snoRNA0009"
                     /old_locus_tag="LMJF_27_snoRNA0177"
                     /db_xref="GeneID:12982682"
     ncRNA           complement(375175..375260)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C2.6"
                     /locus_tag="LMJF_27_snoRNA0009"
                     /old_locus_tag="LMJF_27_snoRNA0177"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460872.1"
                     /db_xref="GeneID:12982682"
     ncRNA           complement(375175..375258)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C2.6"
                     /locus_tag="LMJF_27_snoRNA0009"
                     /old_locus_tag="LMJF_27_snoRNA0177"
                     /note="hit to all_bases 0..0 score: 81 percent id: 100"
                     /transcript_id="XR_002460873.1"
                     /db_xref="GeneID:12982682"
     gene            complement(375302..375391)
                     /gene="LM27Cs1C1.1"
                     /locus_tag="LMJF_27_snoRNA0010"
                     /old_locus_tag="LMJF_27_snoRNA0125"
                     /db_xref="GeneID:12982913"
     ncRNA           complement(375302..375391)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C1.1"
                     /locus_tag="LMJF_27_snoRNA0010"
                     /old_locus_tag="LMJF_27_snoRNA0125"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460874.1"
                     /db_xref="GeneID:12982913"
     ncRNA           complement(375302..375389)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C1.1"
                     /locus_tag="LMJF_27_snoRNA0010"
                     /old_locus_tag="LMJF_27_snoRNA0125"
                     /note="hit to all_bases 0..0 score: 88 percent id: 100"
                     /transcript_id="XR_002460875.1"
                     /db_xref="GeneID:12982913"
     gene            complement(375437..375505)
                     /gene="LM27Cs1H2.1"
                     /locus_tag="LMJF_27_snoRNA0011"
                     /old_locus_tag="LMJF_27_snoRNA0145"
                     /db_xref="GeneID:12982914"
     ncRNA           complement(375437..375505)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1H2.1"
                     /locus_tag="LMJF_27_snoRNA0011"
                     /old_locus_tag="LMJF_27_snoRNA0145"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460876.1"
                     /db_xref="GeneID:12982914"
     ncRNA           complement(375437..375502)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1H2.1"
                     /locus_tag="LMJF_27_snoRNA0011"
                     /old_locus_tag="LMJF_27_snoRNA0145"
                     /note="hit to all_bases 0..0 score: 65 percent id: 100"
                     /transcript_id="XR_002460877.1"
                     /db_xref="GeneID:12982914"
     gene            complement(375627..375692)
                     /gene="LM27Cs1H1.1"
                     /locus_tag="LMJF_27_snoRNA0140"
                     /db_xref="GeneID:12982915"
     ncRNA           complement(375627..375692)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1H1.1"
                     /locus_tag="LMJF_27_snoRNA0140"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460950.1"
                     /db_xref="GeneID:12982915"
     gene            complement(375776..375865)
                     /gene="LM27Cs1C1.2"
                     /locus_tag="LMJF_27_snoRNA0013"
                     /old_locus_tag="LMJF_27_snoRNA0126"
                     /db_xref="GeneID:12983001"
     ncRNA           complement(375776..375865)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C1.2"
                     /locus_tag="LMJF_27_snoRNA0013"
                     /old_locus_tag="LMJF_27_snoRNA0126"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460878.1"
                     /db_xref="GeneID:12983001"
     ncRNA           complement(375776..375863)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C1.2"
                     /locus_tag="LMJF_27_snoRNA0013"
                     /old_locus_tag="LMJF_27_snoRNA0126"
                     /note="hit to all_bases 0..0 score: 88 percent id: 100"
                     /transcript_id="XR_002460879.1"
                     /db_xref="GeneID:12983001"
     gene            complement(375939..376007)
                     /gene="LM27Cs1H3.1"
                     /locus_tag="LMJF_27_snoRNA0161"
                     /db_xref="GeneID:12982916"
     ncRNA           complement(375939..376007)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1H3.1"
                     /locus_tag="LMJF_27_snoRNA0161"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460955.1"
                     /db_xref="GeneID:12982916"
     gene            complement(376077..376167)
                     /gene="LM27Cs1C3.9"
                     /locus_tag="LMJF_27_snoRNA0015"
                     /old_locus_tag="LMJF_27_snoRNA0158"
                     /db_xref="GeneID:12983011"
     ncRNA           complement(376077..376167)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C3.9"
                     /locus_tag="LMJF_27_snoRNA0015"
                     /old_locus_tag="LMJF_27_snoRNA0158"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460880.1"
                     /db_xref="GeneID:12983011"
     ncRNA           complement(376077..376163)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C3.9"
                     /locus_tag="LMJF_27_snoRNA0015"
                     /old_locus_tag="LMJF_27_snoRNA0158"
                     /note="hit to all_bases 0..0 score: 87 percent id: 100"
                     /transcript_id="XR_002460881.1"
                     /db_xref="GeneID:12983011"
     gene            complement(376249..376334)
                     /gene="LM27Cs1C2.7"
                     /locus_tag="LMJF_27_snoRNA0016"
                     /old_locus_tag="LMJF_27_snoRNA0178"
                     /db_xref="GeneID:12982917"
     ncRNA           complement(376249..376334)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C2.7"
                     /locus_tag="LMJF_27_snoRNA0016"
                     /old_locus_tag="LMJF_27_snoRNA0178"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460882.1"
                     /db_xref="GeneID:12982917"
     ncRNA           complement(376249..376332)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C2.7"
                     /locus_tag="LMJF_27_snoRNA0016"
                     /old_locus_tag="LMJF_27_snoRNA0178"
                     /note="hit to all_bases 0..0 score: 81 percent id: 100"
                     /transcript_id="XR_002460883.1"
                     /db_xref="GeneID:12982917"
     gene            complement(376376..376465)
                     /gene="LM27Cs1C1.3"
                     /locus_tag="LMJF_27_snoRNA0017"
                     /old_locus_tag="LMJF_27_snoRNA0127"
                     /db_xref="GeneID:12982918"
     ncRNA           complement(376376..376465)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C1.3"
                     /locus_tag="LMJF_27_snoRNA0017"
                     /old_locus_tag="LMJF_27_snoRNA0127"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460884.1"
                     /db_xref="GeneID:12982918"
     ncRNA           complement(376376..376463)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C1.3"
                     /locus_tag="LMJF_27_snoRNA0017"
                     /old_locus_tag="LMJF_27_snoRNA0127"
                     /note="hit to all_bases 0..0 score: 88 percent id: 100"
                     /transcript_id="XR_002460885.1"
                     /db_xref="GeneID:12982918"
     gene            complement(376539..376607)
                     /gene="LM27Cs1H3.2"
                     /locus_tag="LMJF_27_snoRNA0162"
                     /db_xref="GeneID:12982919"
     ncRNA           complement(376539..376607)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1H3.2"
                     /locus_tag="LMJF_27_snoRNA0162"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460956.1"
                     /db_xref="GeneID:12982919"
     gene            complement(376677..376767)
                     /gene="LM27Cs1C3.10"
                     /locus_tag="LMJF_27_snoRNA0019"
                     /old_locus_tag="LMJF_27_snoRNA0159"
                     /db_xref="GeneID:12983014"
     ncRNA           complement(376677..376767)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C3.10"
                     /locus_tag="LMJF_27_snoRNA0019"
                     /old_locus_tag="LMJF_27_snoRNA0159"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460886.1"
                     /db_xref="GeneID:12983014"
     ncRNA           complement(376677..376763)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C3.10"
                     /locus_tag="LMJF_27_snoRNA0019"
                     /old_locus_tag="LMJF_27_snoRNA0159"
                     /note="hit to all_bases 0..0 score: 87 percent id: 100"
                     /transcript_id="XR_002460887.1"
                     /db_xref="GeneID:12983014"
     gene            complement(376849..376934)
                     /gene="LM27Cs1C2.8"
                     /locus_tag="LMJF_27_snoRNA0020"
                     /old_locus_tag="LMJF_27_snoRNA0179"
                     /db_xref="GeneID:12982920"
     ncRNA           complement(376849..376934)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C2.8"
                     /locus_tag="LMJF_27_snoRNA0020"
                     /old_locus_tag="LMJF_27_snoRNA0179"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460888.1"
                     /db_xref="GeneID:12982920"
     ncRNA           complement(376849..376932)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C2.8"
                     /locus_tag="LMJF_27_snoRNA0020"
                     /old_locus_tag="LMJF_27_snoRNA0179"
                     /note="hit to all_bases 0..0 score: 81 percent id: 100"
                     /transcript_id="XR_002460889.1"
                     /db_xref="GeneID:12982920"
     gene            complement(376976..377065)
                     /gene="LM27Cs1C1.4"
                     /locus_tag="LMJF_27_snoRNA0021"
                     /old_locus_tag="LMJF_27_snoRNA0128"
                     /db_xref="GeneID:12982921"
     ncRNA           complement(376976..377065)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C1.4"
                     /locus_tag="LMJF_27_snoRNA0021"
                     /old_locus_tag="LMJF_27_snoRNA0128"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460890.1"
                     /db_xref="GeneID:12982921"
     ncRNA           complement(376976..377063)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C1.4"
                     /locus_tag="LMJF_27_snoRNA0021"
                     /old_locus_tag="LMJF_27_snoRNA0128"
                     /note="hit to all_bases 0..0 score: 88 percent id: 100"
                     /transcript_id="XR_002460891.1"
                     /db_xref="GeneID:12982921"
     gene            complement(377139..377207)
                     /gene="LM27Cs1H3.3"
                     /locus_tag="LMJF_27_snoRNA0163"
                     /db_xref="GeneID:12982922"
     ncRNA           complement(377139..377207)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1H3.3"
                     /locus_tag="LMJF_27_snoRNA0163"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460957.1"
                     /db_xref="GeneID:12982922"
     gene            complement(377277..377367)
                     /gene="LM27Cs1C3.3"
                     /locus_tag="LMJF_27_snoRNA0023"
                     /old_locus_tag="LMJF_27_snoRNA0152"
                     /db_xref="GeneID:12983015"
     ncRNA           complement(377277..377367)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C3.3"
                     /locus_tag="LMJF_27_snoRNA0023"
                     /old_locus_tag="LMJF_27_snoRNA0152"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460892.1"
                     /db_xref="GeneID:12983015"
     ncRNA           complement(377277..377365)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C3.3"
                     /locus_tag="LMJF_27_snoRNA0023"
                     /old_locus_tag="LMJF_27_snoRNA0152"
                     /note="hit to all_bases 0..0 score: 89 percent id: 100"
                     /transcript_id="XR_002460893.1"
                     /db_xref="GeneID:12983015"
     gene            complement(377448..377533)
                     /gene="LM27Cs1C2.3"
                     /locus_tag="LMJF_27_snoRNA0024"
                     /old_locus_tag="LMJF_27_snoRNA0174"
                     /db_xref="GeneID:12982923"
     ncRNA           complement(377448..377533)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C2.3"
                     /locus_tag="LMJF_27_snoRNA0024"
                     /old_locus_tag="LMJF_27_snoRNA0174"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460894.1"
                     /db_xref="GeneID:12982923"
     ncRNA           complement(377448..377531)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C2.3"
                     /locus_tag="LMJF_27_snoRNA0024"
                     /old_locus_tag="LMJF_27_snoRNA0174"
                     /note="hit to all_bases 0..0 score: 84 percent id: 100"
                     /transcript_id="XR_002460895.1"
                     /db_xref="GeneID:12982923"
     gene            complement(377575..377664)
                     /gene="LM27Cs1C1.5"
                     /locus_tag="LMJF_27_snoRNA0025"
                     /old_locus_tag="LMJF_27_snoRNA0129"
                     /db_xref="GeneID:12982924"
     ncRNA           complement(377575..377664)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C1.5"
                     /locus_tag="LMJF_27_snoRNA0025"
                     /old_locus_tag="LMJF_27_snoRNA0129"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460896.1"
                     /db_xref="GeneID:12982924"
     ncRNA           complement(377575..377662)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C1.5"
                     /locus_tag="LMJF_27_snoRNA0025"
                     /old_locus_tag="LMJF_27_snoRNA0129"
                     /note="hit to all_bases 0..0 score: 88 percent id: 100"
                     /transcript_id="XR_002460897.1"
                     /db_xref="GeneID:12982924"
     gene            complement(377710..377778)
                     /gene="LM27Cs1H2.2"
                     /locus_tag="LMJF_27_snoRNA0026"
                     /old_locus_tag="LMJF_27_snoRNA0146"
                     /db_xref="GeneID:12982925"
     ncRNA           complement(377710..377778)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1H2.2"
                     /locus_tag="LMJF_27_snoRNA0026"
                     /old_locus_tag="LMJF_27_snoRNA0146"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460898.1"
                     /db_xref="GeneID:12982925"
     ncRNA           complement(377710..377775)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1H2.2"
                     /locus_tag="LMJF_27_snoRNA0026"
                     /old_locus_tag="LMJF_27_snoRNA0146"
                     /note="hit to all_bases 0..0 score: 65 percent id: 100"
                     /transcript_id="XR_002460899.1"
                     /db_xref="GeneID:12982925"
     gene            complement(377900..377965)
                     /gene="LM27Cs1H1.2"
                     /locus_tag="LMJF_27_snoRNA0141"
                     /db_xref="GeneID:12982926"
     ncRNA           complement(377900..377965)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1H1.2"
                     /locus_tag="LMJF_27_snoRNA0141"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460951.1"
                     /db_xref="GeneID:12982926"
     gene            complement(378049..378138)
                     /gene="LM27Cs1C1.6"
                     /locus_tag="LMJF_27_snoRNA0028"
                     /old_locus_tag="LMJF_27_snoRNA0130"
                     /db_xref="GeneID:12983002"
     ncRNA           complement(378049..378138)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C1.6"
                     /locus_tag="LMJF_27_snoRNA0028"
                     /old_locus_tag="LMJF_27_snoRNA0130"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460900.1"
                     /db_xref="GeneID:12983002"
     ncRNA           complement(378049..378136)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C1.6"
                     /locus_tag="LMJF_27_snoRNA0028"
                     /old_locus_tag="LMJF_27_snoRNA0130"
                     /note="hit to all_bases 0..0 score: 88 percent id: 100"
                     /transcript_id="XR_002460901.1"
                     /db_xref="GeneID:12983002"
     gene            complement(378212..378280)
                     /gene="LM27Cs1H3.4"
                     /locus_tag="LMJF_27_snoRNA0164"
                     /db_xref="GeneID:12982927"
     ncRNA           complement(378212..378280)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1H3.4"
                     /locus_tag="LMJF_27_snoRNA0164"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460958.1"
                     /db_xref="GeneID:12982927"
     gene            complement(378350..378440)
                     /gene="LM27Cs1C3.4"
                     /locus_tag="LMJF_27_snoRNA0030"
                     /old_locus_tag="LMJF_27_snoRNA0153"
                     /db_xref="GeneID:12983016"
     ncRNA           complement(378350..378440)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C3.4"
                     /locus_tag="LMJF_27_snoRNA0030"
                     /old_locus_tag="LMJF_27_snoRNA0153"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460902.1"
                     /db_xref="GeneID:12983016"
     ncRNA           complement(378350..378438)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C3.4"
                     /locus_tag="LMJF_27_snoRNA0030"
                     /old_locus_tag="LMJF_27_snoRNA0153"
                     /note="hit to all_bases 0..0 score: 89 percent id: 100"
                     /transcript_id="XR_002460903.1"
                     /db_xref="GeneID:12983016"
     gene            complement(378522..378607)
                     /gene="LM27Cs1C2.9"
                     /locus_tag="LMJF_27_snoRNA0031"
                     /old_locus_tag="LMJF_27_snoRNA0180"
                     /db_xref="GeneID:12982928"
     ncRNA           complement(378522..378607)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C2.9"
                     /locus_tag="LMJF_27_snoRNA0031"
                     /old_locus_tag="LMJF_27_snoRNA0180"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460904.1"
                     /db_xref="GeneID:12982928"
     ncRNA           complement(378522..378605)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C2.9"
                     /locus_tag="LMJF_27_snoRNA0031"
                     /old_locus_tag="LMJF_27_snoRNA0180"
                     /note="hit to all_bases 0..0 score: 81 percent id: 100"
                     /transcript_id="XR_002460905.1"
                     /db_xref="GeneID:12982928"
     gene            complement(378649..378738)
                     /gene="LM27Cs1C1.7"
                     /locus_tag="LMJF_27_snoRNA0032"
                     /old_locus_tag="LMJF_27_snoRNA0131"
                     /db_xref="GeneID:12982929"
     ncRNA           complement(378649..378738)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C1.7"
                     /locus_tag="LMJF_27_snoRNA0032"
                     /old_locus_tag="LMJF_27_snoRNA0131"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460906.1"
                     /db_xref="GeneID:12982929"
     ncRNA           complement(378649..378736)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C1.7"
                     /locus_tag="LMJF_27_snoRNA0032"
                     /old_locus_tag="LMJF_27_snoRNA0131"
                     /note="hit to all_bases 0..0 score: 88 percent id: 100"
                     /transcript_id="XR_002460907.1"
                     /db_xref="GeneID:12982929"
     gene            complement(378812..378880)
                     /gene="LM27Cs1H3.5"
                     /locus_tag="LMJF_27_snoRNA0165"
                     /db_xref="GeneID:12982930"
     ncRNA           complement(378812..378880)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1H3.5"
                     /locus_tag="LMJF_27_snoRNA0165"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460959.1"
                     /db_xref="GeneID:12982930"
     gene            complement(378950..379040)
                     /gene="LM27Cs1C3.5"
                     /locus_tag="LMJF_27_snoRNA0034"
                     /old_locus_tag="LMJF_27_snoRNA0154"
                     /db_xref="GeneID:12983017"
     ncRNA           complement(378950..379040)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C3.5"
                     /locus_tag="LMJF_27_snoRNA0034"
                     /old_locus_tag="LMJF_27_snoRNA0154"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460908.1"
                     /db_xref="GeneID:12983017"
     ncRNA           complement(378950..379038)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C3.5"
                     /locus_tag="LMJF_27_snoRNA0034"
                     /old_locus_tag="LMJF_27_snoRNA0154"
                     /note="hit to all_bases 0..0 score: 89 percent id: 100"
                     /transcript_id="XR_002460909.1"
                     /db_xref="GeneID:12983017"
     gene            complement(379122..379207)
                     /gene="LM27Cs1C2.4"
                     /locus_tag="LMJF_27_snoRNA0035"
                     /old_locus_tag="LMJF_27_snoRNA0175"
                     /db_xref="GeneID:12982931"
     ncRNA           complement(379122..379207)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C2.4"
                     /locus_tag="LMJF_27_snoRNA0035"
                     /old_locus_tag="LMJF_27_snoRNA0175"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460910.1"
                     /db_xref="GeneID:12982931"
     ncRNA           complement(379122..379205)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C2.4"
                     /locus_tag="LMJF_27_snoRNA0035"
                     /old_locus_tag="LMJF_27_snoRNA0175"
                     /note="hit to all_bases 0..0 score: 84 percent id: 100"
                     /transcript_id="XR_002460911.1"
                     /db_xref="GeneID:12982931"
     gene            complement(379249..379338)
                     /gene="LM27Cs1C1.8"
                     /locus_tag="LMJF_27_snoRNA0036"
                     /old_locus_tag="LMJF_27_snoRNA0132"
                     /db_xref="GeneID:12982932"
     ncRNA           complement(379249..379338)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C1.8"
                     /locus_tag="LMJF_27_snoRNA0036"
                     /old_locus_tag="LMJF_27_snoRNA0132"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460912.1"
                     /db_xref="GeneID:12982932"
     ncRNA           complement(379249..379336)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C1.8"
                     /locus_tag="LMJF_27_snoRNA0036"
                     /old_locus_tag="LMJF_27_snoRNA0132"
                     /note="hit to all_bases 0..0 score: 88 percent id: 100"
                     /transcript_id="XR_002460913.1"
                     /db_xref="GeneID:12982932"
     gene            complement(379384..379452)
                     /gene="LM27Cs1H2.3"
                     /locus_tag="LMJF_27_snoRNA0037"
                     /old_locus_tag="LMJF_27_snoRNA0147"
                     /db_xref="GeneID:12982933"
     ncRNA           complement(379384..379452)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1H2.3"
                     /locus_tag="LMJF_27_snoRNA0037"
                     /old_locus_tag="LMJF_27_snoRNA0147"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460914.1"
                     /db_xref="GeneID:12982933"
     ncRNA           complement(379384..379449)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1H2.3"
                     /locus_tag="LMJF_27_snoRNA0037"
                     /old_locus_tag="LMJF_27_snoRNA0147"
                     /note="hit to all_bases 0..0 score: 65 percent id: 100"
                     /transcript_id="XR_002460915.1"
                     /db_xref="GeneID:12982933"
     gene            complement(379574..379639)
                     /gene="LM27Cs1H1.3"
                     /locus_tag="LMJF_27_snoRNA0142"
                     /db_xref="GeneID:12982934"
     ncRNA           complement(379574..379639)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1H1.3"
                     /locus_tag="LMJF_27_snoRNA0142"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460952.1"
                     /db_xref="GeneID:12982934"
     gene            complement(379723..379812)
                     /gene="LM27Cs1C1.9"
                     /locus_tag="LMJF_27_snoRNA0039"
                     /old_locus_tag="LMJF_27_snoRNA0133"
                     /db_xref="GeneID:12983003"
     ncRNA           complement(379723..379812)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C1.9"
                     /locus_tag="LMJF_27_snoRNA0039"
                     /old_locus_tag="LMJF_27_snoRNA0133"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460916.1"
                     /db_xref="GeneID:12983003"
     ncRNA           complement(379723..379810)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C1.9"
                     /locus_tag="LMJF_27_snoRNA0039"
                     /old_locus_tag="LMJF_27_snoRNA0133"
                     /note="hit to all_bases 0..0 score: 88 percent id: 100"
                     /transcript_id="XR_002460917.1"
                     /db_xref="GeneID:12983003"
     gene            complement(379886..379954)
                     /gene="LM27Cs1H3.6"
                     /locus_tag="LMJF_27_snoRNA0166"
                     /db_xref="GeneID:12982935"
     ncRNA           complement(379886..379954)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1H3.6"
                     /locus_tag="LMJF_27_snoRNA0166"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460960.1"
                     /db_xref="GeneID:12982935"
     gene            complement(380024..380114)
                     /gene="LM27Cs1C3.11"
                     /locus_tag="LMJF_27_snoRNA0041"
                     /old_locus_tag="LMJF_27_snoRNA0160"
                     /db_xref="GeneID:12983018"
     ncRNA           complement(380024..380114)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C3.11"
                     /locus_tag="LMJF_27_snoRNA0041"
                     /old_locus_tag="LMJF_27_snoRNA0160"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460918.1"
                     /db_xref="GeneID:12983018"
     ncRNA           complement(380024..380110)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C3.11"
                     /locus_tag="LMJF_27_snoRNA0041"
                     /old_locus_tag="LMJF_27_snoRNA0160"
                     /note="hit to all_bases 0..0 score: 87 percent id: 100"
                     /transcript_id="XR_002460919.1"
                     /db_xref="GeneID:12983018"
     gene            complement(380196..380281)
                     /gene="LM27Cs1C2.10"
                     /locus_tag="LMJF_27_snoRNA0042"
                     /old_locus_tag="LMJF_27_snoRNA0181"
                     /db_xref="GeneID:12982936"
     ncRNA           complement(380196..380281)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C2.10"
                     /locus_tag="LMJF_27_snoRNA0042"
                     /old_locus_tag="LMJF_27_snoRNA0181"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460920.1"
                     /db_xref="GeneID:12982936"
     ncRNA           complement(380196..380279)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C2.10"
                     /locus_tag="LMJF_27_snoRNA0042"
                     /old_locus_tag="LMJF_27_snoRNA0181"
                     /note="hit to all_bases 0..0 score: 81 percent id: 100"
                     /transcript_id="XR_002460921.1"
                     /db_xref="GeneID:12982936"
     gene            complement(380323..380412)
                     /gene="LM27Cs1C1.10"
                     /locus_tag="LMJF_27_snoRNA0043"
                     /old_locus_tag="LMJF_27_snoRNA0134"
                     /db_xref="GeneID:12982937"
     ncRNA           complement(380323..380412)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C1.10"
                     /locus_tag="LMJF_27_snoRNA0043"
                     /old_locus_tag="LMJF_27_snoRNA0134"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460922.1"
                     /db_xref="GeneID:12982937"
     ncRNA           complement(380323..380410)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C1.10"
                     /locus_tag="LMJF_27_snoRNA0043"
                     /old_locus_tag="LMJF_27_snoRNA0134"
                     /note="hit to all_bases 0..0 score: 88 percent id: 100"
                     /transcript_id="XR_002460923.1"
                     /db_xref="GeneID:12982937"
     gene            complement(380486..380554)
                     /gene="LM27Cs1H3.7"
                     /locus_tag="LMJF_27_snoRNA0167"
                     /db_xref="GeneID:12982938"
     ncRNA           complement(380486..380554)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1H3.7"
                     /locus_tag="LMJF_27_snoRNA0167"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460961.1"
                     /db_xref="GeneID:12982938"
     gene            complement(380624..380714)
                     /gene="LM27Cs1C3.6"
                     /locus_tag="LMJF_27_snoRNA0045"
                     /old_locus_tag="LMJF_27_snoRNA0155"
                     /db_xref="GeneID:12983019"
     ncRNA           complement(380624..380714)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C3.6"
                     /locus_tag="LMJF_27_snoRNA0045"
                     /old_locus_tag="LMJF_27_snoRNA0155"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460924.1"
                     /db_xref="GeneID:12983019"
     ncRNA           complement(380624..380712)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C3.6"
                     /locus_tag="LMJF_27_snoRNA0045"
                     /old_locus_tag="LMJF_27_snoRNA0155"
                     /note="hit to all_bases 0..0 score: 89 percent id: 100"
                     /transcript_id="XR_002460925.1"
                     /db_xref="GeneID:12983019"
     gene            complement(380796..380881)
                     /gene="LM27Cs1C2.11"
                     /locus_tag="LMJF_27_snoRNA0046"
                     /old_locus_tag="LMJF_27_snoRNA0182"
                     /db_xref="GeneID:12982939"
     ncRNA           complement(380796..380881)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C2.11"
                     /locus_tag="LMJF_27_snoRNA0046"
                     /old_locus_tag="LMJF_27_snoRNA0182"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460926.1"
                     /db_xref="GeneID:12982939"
     ncRNA           complement(380796..380879)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C2.11"
                     /locus_tag="LMJF_27_snoRNA0046"
                     /old_locus_tag="LMJF_27_snoRNA0182"
                     /note="hit to all_bases 0..0 score: 81 percent id: 100"
                     /transcript_id="XR_002460927.1"
                     /db_xref="GeneID:12982939"
     gene            complement(380923..381012)
                     /gene="LM27Cs1C1.11"
                     /locus_tag="LMJF_27_snoRNA0047"
                     /old_locus_tag="LMJF_27_snoRNA0135"
                     /db_xref="GeneID:12982940"
     ncRNA           complement(380923..381012)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C1.11"
                     /locus_tag="LMJF_27_snoRNA0047"
                     /old_locus_tag="LMJF_27_snoRNA0135"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460928.1"
                     /db_xref="GeneID:12982940"
     ncRNA           complement(380923..381010)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C1.11"
                     /locus_tag="LMJF_27_snoRNA0047"
                     /old_locus_tag="LMJF_27_snoRNA0135"
                     /note="hit to all_bases 0..0 score: 88 percent id: 100"
                     /transcript_id="XR_002460929.1"
                     /db_xref="GeneID:12982940"
     gene            complement(381086..381154)
                     /gene="LM27Cs1H3.9"
                     /locus_tag="LMJF_27_snoRNA0169"
                     /db_xref="GeneID:12982941"
     ncRNA           complement(381086..381154)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1H3.9"
                     /locus_tag="LMJF_27_snoRNA0169"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460963.1"
                     /db_xref="GeneID:12982941"
     gene            complement(381224..381314)
                     /gene="LM27Cs1C3.7"
                     /locus_tag="LMJF_27_snoRNA0049"
                     /old_locus_tag="LMJF_27_snoRNA0156"
                     /db_xref="GeneID:12983021"
     ncRNA           complement(381224..381314)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C3.7"
                     /locus_tag="LMJF_27_snoRNA0049"
                     /old_locus_tag="LMJF_27_snoRNA0156"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460930.1"
                     /db_xref="GeneID:12983021"
     ncRNA           complement(381224..381312)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C3.7"
                     /locus_tag="LMJF_27_snoRNA0049"
                     /old_locus_tag="LMJF_27_snoRNA0156"
                     /note="hit to all_bases 0..0 score: 89 percent id: 100"
                     /transcript_id="XR_002460931.1"
                     /db_xref="GeneID:12983021"
     gene            complement(381396..381481)
                     /gene="LM27Cs1C2.5"
                     /locus_tag="LMJF_27_snoRNA0050"
                     /old_locus_tag="LMJF_27_snoRNA0176"
                     /db_xref="GeneID:12982942"
     ncRNA           complement(381396..381481)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C2.5"
                     /locus_tag="LMJF_27_snoRNA0050"
                     /old_locus_tag="LMJF_27_snoRNA0176"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460932.1"
                     /db_xref="GeneID:12982942"
     ncRNA           complement(381396..381479)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C2.5"
                     /locus_tag="LMJF_27_snoRNA0050"
                     /old_locus_tag="LMJF_27_snoRNA0176"
                     /note="hit to all_bases 0..0 score: 84 percent id: 100"
                     /transcript_id="XR_002460933.1"
                     /db_xref="GeneID:12982942"
     gene            complement(381523..381612)
                     /gene="LM27Cs1C1.12"
                     /locus_tag="LMJF_27_snoRNA0051"
                     /old_locus_tag="LMJF_27_snoRNA0136"
                     /db_xref="GeneID:12982943"
     ncRNA           complement(381523..381612)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C1.12"
                     /locus_tag="LMJF_27_snoRNA0051"
                     /old_locus_tag="LMJF_27_snoRNA0136"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460934.1"
                     /db_xref="GeneID:12982943"
     ncRNA           complement(381523..381610)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C1.12"
                     /locus_tag="LMJF_27_snoRNA0051"
                     /old_locus_tag="LMJF_27_snoRNA0136"
                     /note="hit to all_bases 0..0 score: 88 percent id: 100"
                     /transcript_id="XR_002460935.1"
                     /db_xref="GeneID:12982943"
     gene            complement(381658..381726)
                     /gene="LM27Cs1H2.4"
                     /locus_tag="LMJF_27_snoRNA0052"
                     /old_locus_tag="LMJF_27_snoRNA0148"
                     /db_xref="GeneID:12982944"
     ncRNA           complement(381658..381726)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1H2.4"
                     /locus_tag="LMJF_27_snoRNA0052"
                     /old_locus_tag="LMJF_27_snoRNA0148"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460936.1"
                     /db_xref="GeneID:12982944"
     ncRNA           complement(381658..381723)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1H2.4"
                     /locus_tag="LMJF_27_snoRNA0052"
                     /old_locus_tag="LMJF_27_snoRNA0148"
                     /note="hit to all_bases 0..0 score: 65 percent id: 100"
                     /transcript_id="XR_002460937.1"
                     /db_xref="GeneID:12982944"
     gene            complement(381848..381913)
                     /gene="LM27Cs1H1.4"
                     /locus_tag="LMJF_27_snoRNA0143"
                     /db_xref="GeneID:12982945"
     ncRNA           complement(381848..381913)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1H1.4"
                     /locus_tag="LMJF_27_snoRNA0143"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460953.1"
                     /db_xref="GeneID:12982945"
     gene            complement(381997..382086)
                     /gene="LM27Cs1C1.13"
                     /locus_tag="LMJF_27_snoRNA0054"
                     /old_locus_tag="LMJF_27_snoRNA0137"
                     /db_xref="GeneID:12983004"
     ncRNA           complement(381997..382086)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C1.13"
                     /locus_tag="LMJF_27_snoRNA0054"
                     /old_locus_tag="LMJF_27_snoRNA0137"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460938.1"
                     /db_xref="GeneID:12983004"
     ncRNA           complement(381997..382084)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C1.13"
                     /locus_tag="LMJF_27_snoRNA0054"
                     /old_locus_tag="LMJF_27_snoRNA0137"
                     /note="hit to all_bases 0..0 score: 88 percent id: 100"
                     /transcript_id="XR_002460939.1"
                     /db_xref="GeneID:12983004"
     gene            complement(382160..382228)
                     /gene="LM27Cs1H3.8"
                     /locus_tag="LMJF_27_snoRNA0168"
                     /db_xref="GeneID:12982946"
     ncRNA           complement(382160..382228)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1H3.8"
                     /locus_tag="LMJF_27_snoRNA0168"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460962.1"
                     /db_xref="GeneID:12982946"
     gene            complement(382298..382388)
                     /gene="LM27Cs1C3.8"
                     /locus_tag="LMJF_27_snoRNA0056"
                     /old_locus_tag="LMJF_27_snoRNA0157"
                     /db_xref="GeneID:12983020"
     ncRNA           complement(382298..382388)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C3.8"
                     /locus_tag="LMJF_27_snoRNA0056"
                     /old_locus_tag="LMJF_27_snoRNA0157"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460940.1"
                     /db_xref="GeneID:12983020"
     ncRNA           complement(382298..382386)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C3.8"
                     /locus_tag="LMJF_27_snoRNA0056"
                     /old_locus_tag="LMJF_27_snoRNA0157"
                     /note="hit to all_bases 0..0 score: 89 percent id: 100"
                     /transcript_id="XR_002460941.1"
                     /db_xref="GeneID:12983020"
     gene            complement(382469..382554)
                     /gene="LM27Cs1C2.12"
                     /locus_tag="LMJF_27_snoRNA0057"
                     /old_locus_tag="LMJF_27_snoRNA0183"
                     /db_xref="GeneID:12982947"
     ncRNA           complement(382469..382554)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C2.12"
                     /locus_tag="LMJF_27_snoRNA0057"
                     /old_locus_tag="LMJF_27_snoRNA0183"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460942.1"
                     /db_xref="GeneID:12982947"
     ncRNA           complement(382469..382552)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C2.12"
                     /locus_tag="LMJF_27_snoRNA0057"
                     /old_locus_tag="LMJF_27_snoRNA0183"
                     /note="hit to all_bases 0..0 score: 81 percent id: 100"
                     /transcript_id="XR_002460943.1"
                     /db_xref="GeneID:12982947"
     gene            complement(382596..382685)
                     /gene="LM27Cs1C1.15"
                     /locus_tag="LMJF_27_snoRNA0058"
                     /old_locus_tag="LMJF_27_snoRNA0139"
                     /db_xref="GeneID:12982948"
     ncRNA           complement(382596..382685)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C1.15"
                     /locus_tag="LMJF_27_snoRNA0058"
                     /old_locus_tag="LMJF_27_snoRNA0139"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460944.1"
                     /db_xref="GeneID:12982948"
     ncRNA           complement(382596..382682)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C1.15"
                     /locus_tag="LMJF_27_snoRNA0058"
                     /old_locus_tag="LMJF_27_snoRNA0139"
                     /note="hit to all_bases 0..0 score: 87 percent id: 100"
                     /transcript_id="XR_002460945.1"
                     /db_xref="GeneID:12982948"
     gene            complement(382731..382799)
                     /gene="LM27Cs1H2.5"
                     /locus_tag="LMJF_27_snoRNA0059"
                     /old_locus_tag="LMJF_27_snoRNA0149"
                     /db_xref="GeneID:12982949"
     ncRNA           complement(382731..382799)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1H2.5"
                     /locus_tag="LMJF_27_snoRNA0059"
                     /old_locus_tag="LMJF_27_snoRNA0149"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460946.1"
                     /db_xref="GeneID:12982949"
     ncRNA           complement(382731..382796)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1H2.5"
                     /locus_tag="LMJF_27_snoRNA0059"
                     /old_locus_tag="LMJF_27_snoRNA0149"
                     /note="hit to all_bases 0..0 score: 65 percent id: 100"
                     /transcript_id="XR_002460947.1"
                     /db_xref="GeneID:12982949"
     gene            complement(382921..382986)
                     /gene="LM27Cs1H1.5"
                     /locus_tag="LMJF_27_snoRNA0144"
                     /db_xref="GeneID:12982950"
     ncRNA           complement(382921..382986)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1H1.5"
                     /locus_tag="LMJF_27_snoRNA0144"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460954.1"
                     /db_xref="GeneID:12982950"
     gene            complement(383070..383159)
                     /gene="LM27Cs1C1.14"
                     /locus_tag="LMJF_27_snoRNA0061"
                     /old_locus_tag="LMJF_27_snoRNA0138"
                     /db_xref="GeneID:12983005"
     ncRNA           complement(383070..383159)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C1.14"
                     /locus_tag="LMJF_27_snoRNA0061"
                     /old_locus_tag="LMJF_27_snoRNA0138"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460948.1"
                     /db_xref="GeneID:12983005"
     ncRNA           complement(383070..383157)
                     /ncRNA_class="snoRNA"
                     /gene="LM27Cs1C1.14"
                     /locus_tag="LMJF_27_snoRNA0061"
                     /old_locus_tag="LMJF_27_snoRNA0138"
                     /note="hit to all_bases 0..0 score: 88 percent id: 100"
                     /transcript_id="XR_002460949.1"
                     /db_xref="GeneID:12983005"
     gene            complement(<385084..>386010)
                     /locus_tag="LMJF_27_0920"
                     /db_xref="GeneID:12982951"
     mRNA            complement(<385084..>386010)
                     /locus_tag="LMJF_27_0920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721850.1"
                     /db_xref="GeneID:12982951"
     CDS             complement(385084..386010)
                     /locus_tag="LMJF_27_0920"
                     /note="previous protein_id=AAZ09838.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721898.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982951"
                     /db_xref="InterPro:IPR010721"
                     /db_xref="UniProtKB/TrEMBL:E9AD69"
                     /translation="MESFSSAVAAVTVTSLALSGTLMVVAALVLFIAAHRNDNYSWVD
                     RSWSILPVVYTWIHVYYTHQQARGAAVRRAAGQSFPLSTATLFGLVITVWGCRLTFNF
                     FRRGGYARGGEDYRWSYVHTWRIFSRSPVVWTLFNFFVISSFQTWLLWAITLPVMQFP
                     ATPATAKEVTFGVLLVALITFEAICDEQQWRFQCAKVRTPHQAPYCYGFCVTGVFGYS
                     RHLNVFCEASLWVMLAVAAHSCGTASMAWWQWSGCTLLGLLILFSTAMITEQLTAKKY
                     PGYAVYQSITPMLFPSLYSTTGKVLLALKKMG"
     gene            complement(<388125..>389357)
                     /locus_tag="LMJF_27_0930"
                     /db_xref="GeneID:12982683"
     mRNA            complement(<388125..>389357)
                     /locus_tag="LMJF_27_0930"
                     /product="putative isovaleryl-coA dehydrogenase"
                     /transcript_id="XM_003721851.1"
                     /db_xref="GeneID:12982683"
     CDS             complement(388125..389357)
                     /locus_tag="LMJF_27_0930"
                     /EC_number="1.3.8.4"
                     /note="previous protein_id=AAZ09839.1"
                     /codon_start=1
                     /product="putative isovaleryl-coA dehydrogenase"
                     /protein_id="XP_003721899.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982683"
                     /db_xref="GOA:E9AD70"
                     /db_xref="InterPro:IPR006089"
                     /db_xref="InterPro:IPR006091"
                     /db_xref="InterPro:IPR009075"
                     /db_xref="InterPro:IPR009100"
                     /db_xref="InterPro:IPR013786"
                     /db_xref="UniProtKB/TrEMBL:E9AD70"
                     /translation="MRRVLQSSLDRRSAMCGWTAAVTMTSASRAFMDLYNPTPEHAAL
                     RETVAKFSREVVDKHAREDDVNGHFNRDLFKQLGDLGVMGVTIPEADGGAGMDAVAAV
                     IIHHELSKYDPGFCLAYLAHSMLFVNNFYYSASPEQRARWLPKVLTGEHVGAMGMSEP
                     SAGTDVLGMRMTAKKDSNGNYVLNGSKIWITNGSVADVFLIYAKVDGKITAFTVERGT
                     KGFTQGPKIDKCGMRASHMCQLFLEDVVVPAENLLGEEGKGMVGMMRNLELERVTLAA
                     MAVGIAERSVELMTSYASERNAFGQPISNFGQIQRYIAEGYADTEAAKALVYSVSHNV
                     HPDNKNRLGSDAAKLFATPIAKKVADSAIQVMGGMGYSKGMPVERLWRDAKLLEIGGG
                     TIEAHHKNITKDLLKRLK"
     gene            complement(<390295..>392052)
                     /locus_tag="LMJF_27_0940"
                     /db_xref="GeneID:12982684"
     mRNA            complement(<390295..>392052)
                     /locus_tag="LMJF_27_0940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721852.1"
                     /db_xref="GeneID:12982684"
     CDS             complement(390295..392052)
                     /locus_tag="LMJF_27_0940"
                     /note="previous protein_id=AAZ09840.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721900.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982684"
                     /db_xref="GOA:E9AD71"
                     /db_xref="InterPro:IPR004859"
                     /db_xref="InterPro:IPR027073"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:E9AD71"
                     /translation="MGVKGLWSYVEHHSIQYAFPNKNARADCYAVNPRHLLVDMNAVL
                     HMAYDSTRPTTAATLRAVVAKMDELLTRVRARDTLVLVYDGVAPIAKLKTQKERRNSL
                     SVHPPRPAKTVASSKGSGNGSIRVSPWYTCDPVLGEVPLHREEILCGAEFVLACEEYI
                     TTYLQQRKAHYSWAKLIVSGCCEPGEGEVKISALLRRLWAETVADGSYSQDDVVTMVG
                     NDSDLILVAMVAVPYSYYTLIDPFDLSLTSLRELMNHWSQAVPNPPLPAELLPSYRID
                     FVFLMLLSGDDYYKGIGGDSVALWRRYRHLRVNEGYFRRALISGRHLELDVEFLRAVL
                     TRSGSMATQLLRVPRNKRKTAKVLLRGGGGGGGGGAKEGTQLLAAALWSLRSYVFGRC
                     PDYGFFPHQEGLPSVGSLRAAAHARGLSRKVDSGAAEGAANAETADTGKVEEVTRPVG
                     PVFAPLEQCIAVLGIRGRFSAELARAIRASTKDDGHRLTTSTSIGLLTENVKSVMASV
                     DTTQLTEAERRLSHCPTAGAEDEDAGAFMRLAAILSRKAAPAAVEGAKRPNQSDEAHQ
                     VRTEYSDGEDDEDDEAAAA"
     gene            complement(<395067..>397730)
                     /locus_tag="LMJF_27_0950"
                     /db_xref="GeneID:12982685"
     mRNA            complement(<395067..>397730)
                     /locus_tag="LMJF_27_0950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721853.1"
                     /db_xref="GeneID:12982685"
     CDS             complement(395067..397730)
                     /locus_tag="LMJF_27_0950"
                     /note="previous protein_id=AAZ09841.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721901.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982685"
                     /db_xref="UniProtKB/TrEMBL:E9AD72"
                     /translation="MDISRSSQHSATKESATDSSFVETQRAGSSLYIGPEMVPEEANR
                     RSAHPNKSMKTSREQLLYLQALYPYAHYDELMAVISSTDSADEAAERAYEALNPDYNG
                     FAYLKEQHDLFTSEKLRSAERATAFAGLKESLEERAASAFRPGHFGNLSQLQEYHDTV
                     GLFIVDTSDWDRATLLPSRDLAEMAFMDLPLLEERTSYEAARATINGDSNDVNGLRRE
                     SWSQVCSPSLTASNNATCFLDLQPSRKLCPVSTTAPASLSGGKVGKCYREPSRDASEE
                     QLTGGHNGSRAVGVGGDSAAASVVYVQRNDPPRAAPIIAWAPEAIRVGPAEARRECEG
                     ILRVFDEATFFKEPLLRSATPPPAPTGALLHAHVSPQESALAAPPSPQATLPSFMGEE
                     SEAHEPFDSGSGAVPNCGGGDKVHDANAEELLSAQAPSASHSHHRRRTCLPKPYADTQ
                     SGPTASTSTAYGTPNGTREISGDNDSAAFSNALSAQCRMRDAACKALKRRKPHPLTTS
                     ETVRQRIRSRTPVGNLIFRATSQHTPVLSPKQQESSNGRPNVVCSPGLALPRAAARDE
                     ASVLNGTAQSTERQQAAHHSCEDIPVDGSDAADGGAGAPHGERPLSTGMLAIPAAHSG
                     CSSLDPVTFLNAEEERWEAIAMMLAPYEEVFGSKSRCALTRCIHDECPKLRDNATVIL
                     QRLLHVVGKALCGKEIVEGMTEEPLEVPLLGPILLSTSPIKLTELRFREDKCSIEFCE
                     DGTQLQAKLNVKAMSLDAIQFAYIGEADAARQARTARQSQRRIPGSYWRAAARTQHGS
                     EQDQYTTGVTHGTATIKAANVRVKGKVCIWLMTSGKMHVVFQKTSVSVGSFRLSTTVR
                     KLNVLCTLGAPILRLMVQRGIKQALQSGHSL"
     gene            complement(<399174..>403472)
                     /locus_tag="LMJF_27_0960"
                     /db_xref="GeneID:12982686"
     mRNA            complement(<399174..>403472)
                     /locus_tag="LMJF_27_0960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721854.1"
                     /db_xref="GeneID:12982686"
     CDS             complement(399174..403472)
                     /locus_tag="LMJF_27_0960"
                     /note="previous protein_id=AAZ09842.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721902.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982686"
                     /db_xref="UniProtKB/TrEMBL:E9AD73"
                     /translation="MHAWRLYLLTSQAVRYLRVYDPVDASMTVAALGELDCRLSVSTT
                     TFFLSLAPSLPHYDSTQLTRVFAGLSRLRVAHYMITAYILKLFLSSLTRDCGSATAST
                     SPVNGGSRPRCAAAEQLAAVAGMVHILQLHHTQRTTRAFLAAEERALAPLMASCGDAC
                     SVLGRRGQKDGEACVTSPASARLMAVQVLFLLEVYVNARVRVTAPHTPLWLLNMVFHA
                     PWTSFTLSELLHVYSRLFPGASAHRPAGCAADFSATFLIQELLTENILYRAGGAEREG
                     GTRCRCAPPAAGAEDAAVGVSLRSSDFSVAVQSRCRVWRRRSPGEQYALLRCTVWRLA
                     QHPTERARDAEACELLRFLTPALFCQLSAEFGGRMRGSALRWWMKVLPRSAVERCGVM
                     DSRESDALREGAVGEAVQICIALLQLLYTQHVAAGEEASSSARSAVACHTEDSAGTRQ
                     GAGVLVSVQRLVACLRTVASLVPNHMGDEREWELLALLLDVHVPSSCTTTGGTFTHWL
                     ETEAHQSGDASHMWRCLSVATEAARDVLMARWCHFWTHHRSANRFGNPMAKSKCRSAT
                     LARATEDDGVTHLGKLAEDALLLHWCIANLVNEWLQRSHRASQLCGCPTPPPAHLTSP
                     RFSFQQIWREMLAETVAELDDSHQRVAAGVSPYPFMKLETDLLVIMAESLDPNRTARV
                     RSDDAQPAPLLGSLADAIGQSALPEALCAALEQAQAHSTDAPSRTVPSYAEARVQRER
                     WRRRMWWAASTSAPGTSMSLQAAQVMLLNALFPPSANGCTCASAALVSLRGLSVQWPY
                     RMLAVCLRSSAPLQQPGVTHHAAAEGCGSEWRARIPPWERKDIRDLDAEHHALGSLTP
                     CDSANFTEDPRTPAIDEPSSTQRSLFVCAKGLSNTLMCNIESLVAWQQRCGVLPANTL
                     RGRGEDGRFLPPDLCGAIATPYRMWYRDDTPITLVREPVLAPRPFENPIGGVVASDFA
                     ESVPGAASAHGTDVLVPLCETVALLTRAAMPLNASCASLLALPPTRSSPCWTSCTDSA
                     ASSSLFTPLSPLRPFAATEALYAELCFRFWECCQRLAEALLPLCAVSRTDSRDYEEVS
                     TSATAAEALAIAGAVEWRLFSRYVSDASPPAEPFCDTYALAAAQGRASALLLPLMWRC
                     VHCCVAGPSPATSRISKCHRPIRGVLLDVWRLHLFATHLCGKLPLPARCERAQERLWW
                     CLQAALSDALPVEQRVSLRDEPSVGSEDQAALELAMCDLKASLRERHWFDSTTETTER
                     PLTFLRDTVISMCDGLGAAPVVSRDGDTAVTSPMDTYVQRLLPSHPFVLAGPTRVRTH
                     LLCGVRLVVLTWMHILLLESIAAYHPRIFSHECTQQLSWVQTRIRAYEQGLYHAILPT
                     APSCNHGVAHSTGSSTRAASRRRGLLAECLIRELDAAVSELMTWSRGPPCISAP"
     gene            complement(<410527..>416061)
                     /gene="ABCA8"
                     /locus_tag="LMJF_27_0970"
                     /db_xref="GeneID:12982687"
     mRNA            complement(<410527..>416061)
                     /gene="ABCA8"
                     /locus_tag="LMJF_27_0970"
                     /product="putative ATP-binding cassette protein subfamily
                     A,member 8"
                     /transcript_id="XM_003721855.1"
                     /db_xref="GeneID:12982687"
     CDS             complement(410527..416061)
                     /gene="ABCA8"
                     /locus_tag="LMJF_27_0970"
                     /note="previous protein_id=AAZ09843.1"
                     /codon_start=1
                     /product="putative ATP-binding cassette protein subfamily
                     A,member 8"
                     /protein_id="XP_003721903.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982687"
                     /db_xref="GOA:E9AD74"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR026082"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9AD74"
                     /translation="MYGAGPFVPSPNSTATTQKPLLSFASPGAPSAVSFSQRDSEAFG
                     DSARLPPAVGDEYSPVSGGSSALFRSDERVMSYTALRTGKTRTTTLEAGDRASPSSAE
                     NDVNDGSCVEMTADQIPLAQADDQYNVLNRRSASHKSPARCRSRAGCCQQLGHTILRV
                     LMLMKREWCSMLCEFLIPVLFVFGTVMLWAIFGTAEDSAGLYYSSTGPDKVFAMTEKI
                     SSSLCYNASLASGIAGLTPCLEGKRYYCPHGRGIPTGFCYDPPLKTVVAQLLGALPLT
                     TSPILPLDTLIACQWVAMDQSLRASTPFSHGGLLYFAPRTPEVESLVSYMRTQSKLFD
                     NAYGGTFATAADATSHILSLTHDDPPTWGVVELNSYTADTFNVKIMVNSSALPATSDS
                     ILSGYLGGLDMSTNSPYIFSGYTTLQTLVYNHYTTSVLGKPTTKPLTYTAMPTKAYNT
                     SSFLSSGASLAPLILVLGFLYPVSQLTKRIVVEKELRIREAMLIMGLSEWTMYLAWLV
                     VYGVWYTVVSIIITVLLRLTYLPESSPGYVFFMFLLFSWSTIALSGAIAAVFSKARLA
                     AIIAPLIYFVMAIPLFAMERASGGAKMGIMILSPSAFAVGFSLLFEHEMSGGAGVSAL
                     AYFRDDPKLIVVFVLLFVDIFVYLLLMMYFDRVVPKEWGTTKNPLFFIMDPVRWCFCR
                     RRAGDDDDDGGDGAGDGRAGDGVFEAVDPAVEEAAAVRIRGLRKTFRRGGKAFVAVDN
                     LCWSLSEGEISVLLGHNGAGKSTTMNLMTGMLEADGGDCYVYGHSVRRELSAVRQEIG
                     LCPQHNILWPQLTVREHLDYYAAIKGLMGSEKEDAIRRLLAAVDLEDKEHYMSKALSG
                     GQKRKLSVAIAFVGGSRLVILDEPTAGMDVGARRHTWSLLKEMAKWHTILLTTHFMDE
                     ADLLGDTVAIMSKGRLQCAGSNMFLKSKLGVGFVLTMSVVPHARRGPIEQMVQTLVPA
                     AEAIGSGAGEVAYRLPMSSKPVFPDLLCAVEEGIPGLGINAYSLSATTLEEVFIKIAE
                     GPDAERDADALAAAEKAEATEAVWNVEMEKGRWARRRLQLRAMMVKRLWNALRDRRTQ
                     FFQIVCPVACVLLAMLLTLVRLFSTPTMVLSSDVYGTAVDIPLANCEGVLDVTTPFST
                     KAHMDIWTDAPDASAFSTKLNRTYQTHARERYGGVSCAAAGSGQLYHSVFYNTSALHE
                     VAIETANVFAAHLRVATGRDNVSVTTVVAPLPKTSQQRAVESSLYAMMISVIIMIPFT
                     FVPSTFVGWIVRERECKARHLQNVSGLSFYIYWLSNFLFDLCSYIVTMCLVIVVFLVF
                     GRDEYVALNNIGATFVVFLLYGVSGILMAYVLSFAFDNHSTAQNVVMLVNFIVGFLLV
                     LAVSALMLKGSTRNLVKVLRWIFRIVPSYCVGEAINNLAMLKATRAFGIDTNTWDMDV
                     VGWVCVYMAIEIPVFLFITLFIDHPRRRQRSQRLFHNPDGAAEVIEDEDGDVAAERRA
                     VLEGGEREGDLVRVLNLRKEYPNGKVAVRNIALGVRPGEVFGFLGTNGAGKTTTISIL
                     CQEFYPTSGRAYVCGNDIVTESSEALRCIGYCPQFDACLDLLTVEEHLYLYAGVRGIS
                     SRACDRVVRGLMKLCGLTEYRRTKSHELSGGNRRKLSVAVSLIGGPRVVFFDEPSAGM
                     DPVARRGLWNAIETVADNCSVVLTTHHLEEVEALAHRVAIMVDGTLRCIGDKTHLKQK
                     YGTGFEVAVRVADESPEVMAGVELFFEEEFPSSKLTEVRAGRFTYQLPSTVRLSSVFT
                     ALEQQKEKLQIRDYSVSQTSIEQVFMRISEKAELEHEEEHRQRMESKKSCCMCCCGGL
                     QR"
     gene            complement(<421573..>427215)
                     /gene="ABCA9"
                     /locus_tag="LMJF_27_0980"
                     /db_xref="GeneID:12982955"
     mRNA            complement(<421573..>427215)
                     /gene="ABCA9"
                     /locus_tag="LMJF_27_0980"
                     /product="putative ATP-binding cassette protein subfamily
                     A,member 9"
                     /transcript_id="XM_003721856.1"
                     /db_xref="GeneID:12982955"
     CDS             complement(421573..427215)
                     /gene="ABCA9"
                     /locus_tag="LMJF_27_0980"
                     /note="previous protein_id=AAZ09844.1"
                     /codon_start=1
                     /product="putative ATP-binding cassette protein subfamily
                     A,member 9"
                     /protein_id="XP_003721904.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982955"
                     /db_xref="GOA:E9AD75"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR026082"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9AD75"
                     /translation="MRPPTNPLAPSSHAHACNAYLPAFPTSPVHRPASPLVDLDDMFH
                     DASTFVLHDEDLSTAPAPPYAVPAYLAAAQCAHIQPQRTLNAGVPSEVKDDAYSSDME
                     LIMLDTESRSSRISLKQRQQPRRKRRSSSECTREERSQVSYARASTGTRSHGASDYGS
                     YDYSLYPRRQSSIYNVYSDESLSAYGRHSGCCQQLGHTILRVLMLMKREWCSTLCEFF
                     IPIFFLGGSILLWALYGTASADDSDYYNSLGPLAVLQAAANISSSLCYNASLASGIAG
                     LTPCLEGKRYYCPHGRGIPTGFCYDPPLKTVVAQLLGALPLTTSPILPLDTLIACQWV
                     AMDQSLRASTPFSHGGLLYFAPRTPEVESLVSYMRTQSKLFDNAYGGTFATAADATSH
                     ILSLTHDDPPTWGVVELNSYTADTFNVKIMVNSSALPATSDSILSGYLGGLDMSTNSP
                     YIFSGYTTLQTLVYNHYTTSVLGKPTTKPLTYTAMPTKAYNTSSFLSSGASLAPLILV
                     LGFLYPVSQLTKRIVVEKELRIREAMLIMGLSEWTMYLAWLVVYGVWYTVVSIIITVL
                     LRLTYLPESSPGYVFFMFLLFSWSTIALSGAIAAVFSKARLAAIIAPLIYFVMAIPLF
                     AMERASGGAKMGIMILSPSAFAVGFSLLFEHEMSGGAGVSALAYFRDDPKLIVVFVLL
                     FVDIFVYLLLMMYFDRVVPKEWGTTKNPLFFIMDPVRWCFCRRRAGDDDDDGGDGAGD
                     GRAGDGVFEAVDPAVEEAAAVRIRGLRKTFRRGGKAFVAVDNLCWSLSEGEISVLLGH
                     NGAGKSTTMNLMTGMLEADGGDCYVYGHSVRRELSAVRQEIGLCPQHNILWPQLTVRE
                     HLDYYAAIKGLMGSEKEDAIRRLLAAVDLEDKEHYMSKALSGGQKRKLSVAIAFVGGS
                     RLVILDEPTAGMDVGARRHTWSLLKEMAKWHTILLTTHFMDEADLLGDTVAIMSKGRL
                     QCAGSNMFLKSKLGVGFVLTMSVVPHARRGPIEQMVQTLVPAAEAIGSGAGEVAYRLP
                     MSSKPVFPDLLCAVEEGIPGLGINAYSLSATTLEEVFIKIAEGPDAERDADALAAAEK
                     AEATEAVWNVEMEKGRWARRRLQLRAMMVKRLWNALRDRRTQFFQIVCPVACVLLAML
                     LTLVRLFSTPTMVLSSDVYGTAVDIPLANCEGVLDVTTPFSTKAHMDIWTDAPDASAF
                     STKLNRTYQTHARERYGGVSCAAAGSGQLYHSVFYNTSALHEVAIETANVFAAHLRVA
                     TGRDNVSVTTVVAPLPKTSQQRAVESSLYAMMISVIIMIPFTFVPSTFVGWIVREREC
                     KARHLQNVSGLSFYIYWLSNFLFDLCSYIVTMCLVIVVFLVFGRDEYVALNNIGATFV
                     VFLLYGVSGILMAYVLSFAFDNHSTAQNVVMLVNFIVGFLLVLAVSALTLVESTNTVA
                     KALRFIFRIVPSYCVGEAINNLAMLKATRAFGIDTNTWDMDVVGWVCVYMAIEIPVFL
                     FITLFIDHPGRRQRSQRLFHNPDGAAEVIEDEDGDVAAERRAVLEGGEREGDLVRVLN
                     LRKEYPNGKVAVRNIALGVRPGEVFGFLGTNGAGKTTTISILCQEFYPTSGRAYVCGN
                     DIVTESSEALRCIGYCPQFDACLDLLTVEEHLYLYAGVRGISSRACDRVVRGLMKLCG
                     LTEYRRTKSHELSGGNRRKLSVAVSLIGGPRVVFFDEPSAGMDPVARRGLWNAIETVA
                     DNCSVVLTTHHLEEVEALAHRVAIMVDGTLRCIGDKTHLKQKYGTGFEVAVRVADESP
                     EVMAGVELFFEEEFPSSKLTEVRAGRFTYQLPSTVRLSSVFTALEQQKEKLQIRDYSV
                     SQTSIEQVFMRISEKAELEHEEEHRQRMESKKSCCMCC"
     gene            complement(<430268..>431110)
                     /locus_tag="LMJF_27_0990"
                     /db_xref="GeneID:12982956"
     mRNA            complement(<430268..>431110)
                     /locus_tag="LMJF_27_0990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721857.1"
                     /db_xref="GeneID:12982956"
     CDS             complement(430268..431110)
                     /locus_tag="LMJF_27_0990"
                     /note="previous protein_id=AAZ09845.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721905.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.0990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.0990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982956"
                     /db_xref="UniProtKB/TrEMBL:E9AD76"
                     /translation="MKRGREEDKEAEVGGSRVGPSDRRSAATSTEHKPRRLLKGADVG
                     LPLHESVIEETCEVEETHAVLVRFPCFDFFRHVRVCERTRDLQPATSDDAAKASASLA
                     SALSDTTFRSGAPPVTSTHDTADVAFAPEAAVFIPGTLETDAPRLLLNGGTPHEMLFE
                     GQWTEVTGEGVSVTNRAVVHLSAKTAGIAVSPAALPLNTSPIMSDAAKSPELARAAAE
                     SFPASASQATATPALPIASLLTHTLAGVTADEERRQRAEQQKGWTYDRIDVPSAVLVM
                     HRVR"
     gene            complement(<431902..>433041)
                     /locus_tag="LMJF_27_1000"
                     /db_xref="GeneID:12982688"
     mRNA            complement(<431902..>433041)
                     /locus_tag="LMJF_27_1000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721858.1"
                     /db_xref="GeneID:12982688"
     CDS             complement(431902..433041)
                     /locus_tag="LMJF_27_1000"
                     /note="previous protein_id=AAZ09846.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721906.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982688"
                     /db_xref="GOA:E9AD77"
                     /db_xref="InterPro:IPR001130"
                     /db_xref="UniProtKB/TrEMBL:E9AD77"
                     /translation="MPAAVPVRTPPYLVDVAANLTDCVFRGVDWKSNRLHDDDFDYVL
                     ARAQERNVQQIIITGTSLAQSVKAIALCRRYPDRRLLCTVGVHPAHCGEFLRPLDRDE
                     VQRVAESASSVVMPHHEKSAAAMTAEREEAWAQERLDYLVDLATRNRDVVVAMGEIGI
                     DYAEVACCPREVQEKYFARQLTAFAPLQLPFLFHSRACGMMFVSHLQDTWTRIASDAA
                     ATEAVADNAGASSPSPHAQLRGVVHSFNGTLEEQEALLSMGLYLSLNSSAFREASLAA
                     QVALIPLGRLMFETDAPWCDVRSKDYGAQFVRTVFKTIKRKKPFEMGACLERRNEPCH
                     LVQVMEEYLGCAKASATSPEDPLSRMDEATLVAAVYENCKRLFQL"
     gene            complement(<434415..>437219)
                     /locus_tag="LMJF_27_1010"
                     /db_xref="GeneID:12982689"
     mRNA            complement(<434415..>437219)
                     /locus_tag="LMJF_27_1010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721859.1"
                     /db_xref="GeneID:12982689"
     CDS             complement(434415..437219)
                     /locus_tag="LMJF_27_1010"
                     /note="previous protein_id=AAZ09847.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721907.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982689"
                     /db_xref="UniProtKB/TrEMBL:E9AD78"
                     /translation="MSRSITKGQQRATDVVSGARNGFAGGGATGSPTSKASAAFTKER
                     FYTAEELLPYINEEEKASLKQEVLNSINTELLLNTDLEVTVPRLLRSCQSESRELRRA
                     MNSIASSQIVEAQRALQIVKSNYGKVQELRELFLKQGDLIQGLGADTLSYKHLRQLHC
                     LRDNVSSVIKWSEALKEVRYGNLYMLVEQQSFRFMYDRLRNLQLIRRTVITKAGARYR
                     SFQAVFEPYFEKLDVILSMFVNQVYKFLREDAMVIAIQRALEDGPSDDASHCGTGFAG
                     VGENKGDEEAPEPFECLRQCIAICGDEIENPVLNFGSDGVETESQINEEAVYLAVAKG
                     VAQLWEEQIMQDVVDPFGQISVYLEQMKKVEPLLGAFELTLFPLSTKLPFFSLVVQAV
                     HAEVMNVMQSYSNPGAELEANGLIEASLFIQWYGEMMVTNSYAQYVDFSAIDELSASF
                     MTAAVGGLSTHLTRLCRACAITVCNDLKGPTILSSGLPITTGPVDVFSVLQQSLAGMN
                     TAIDVTVMRQIGKACADAIYSYLDECKQRSDFDYWEDENNSLPNPQPAEEWQQRRMLF
                     LYAFCNDCTTIESNLDTIELKFASCWDYDSPGAGDDQGDGTSAGAGGDGGDIFSTPFR
                     KLQDVLLEDAFYYLDEIAAQVERIVEDEWEKVFRTEEWYADATNPVQLIVNTEAEYIE
                     EEFATMLQDQRSRKLTRQMLIRNIVKYINTLVEFLADVIRNPKKNTVNSWLTFVDCVQ
                     RDIDISLSMWREHLSDRQGRLLDLAQRSLEVLKQLLSVKKPVDLGYLLQDKLLDDFGD
                     CPTFVIRFCVEARSQEVDRETSERLMAVWAERTAYQKRDSKDKPTVGWSQPPSFLGSV
                     DRSLAELEKPSGFFGRSIKQRRAAERQQKAMAEKSAKRAARKARRDADAAATKILTPT
                     ASPKANAGAVEVASLADILK"
     gene            complement(<438204..>438824)
                     /locus_tag="LMJF_27_1020"
                     /db_xref="GeneID:12982690"
     mRNA            complement(<438204..>438824)
                     /locus_tag="LMJF_27_1020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721860.1"
                     /db_xref="GeneID:12982690"
     CDS             complement(438204..438824)
                     /locus_tag="LMJF_27_1020"
                     /note="previous protein_id=AAZ09848.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721908.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982690"
                     /db_xref="UniProtKB/TrEMBL:E9AD79"
                     /translation="MFSQGKQGSLFSLGRGPGSMTANDKTRNKPLTQAEKYEQALVTA
                     KVFLEDSRARMTKSMDKYSAVVNSNYWFYGYFGGNMVATMAACLALGNRWAFFRSYSG
                     WIAVFGGYFGGKACLAAHSSVLLGGVVAQLNHEIEEAKRMDEQTDHIVPDYLREAERL
                     TQVKYELVPTLPEAVEARAHHTEQTLDDRANALIEAYMKRKEALEK"
     gene            complement(<439682..>442363)
                     /locus_tag="LMJF_27_1030"
                     /db_xref="GeneID:12982691"
     mRNA            complement(<439682..>442363)
                     /locus_tag="LMJF_27_1030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721861.1"
                     /db_xref="GeneID:12982691"
     CDS             complement(439682..442363)
                     /locus_tag="LMJF_27_1030"
                     /note="previous protein_id=AAZ09849.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721909.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982691"
                     /db_xref="UniProtKB/TrEMBL:E9AD80"
                     /translation="MRFDNAAPPPPPPPEAAGSTTTSSSTAASALPRVSYRTLPSSMY
                     PKEVSSDFIPFPLPKHDASMGFGPVRLRNVPDIEEARARMAKAAQGPPRGSASTQLQD
                     ADGDNAEAASALWAELSGETTATSVGLSTTSVTGASPEDPEALSRPPDAQDEDLVGYH
                     VHRHFPLLDVLGCDRSVNDLLAQFWNRPQREARTATVLDFAATLQRHSNEELTRVLYE
                     LSSLFEWDGNGLQFIAAKVLKYGRSYTVSSELTKAFVQLVDAMTVAFVEEQPHRLAES
                     PALLAQVLHFLALVKIMEPNKWYTLNPNAPQNRADYTHPRGVNRTCGHVTTGRALLDF
                     LEDMVTSGHNWTGEAAVDDQQGSLARSPVPQHATNRFTEGWSEDDILDVMAGFSGVMP
                     DGKASSPVLYALLDELWMRWSKVGFVLSGSEQAVRLERLYMLLQVMDMQRDAVLDALL
                     GGQLRAHSTAPSTSTLPTLFCERDDTPPLTLAQSLTQTRGPDFFSAVSRDKRAMVKAA
                     ALRLLTASLAKARDDSDAVLHQALVESGTELLQSLTSKSAALSFAQREQFDVITLRAV
                     PHMADVAERLAEQRAEAPFFPLTASAGGLPDTAAVLAHLSSHPAPYIVLCKGRRVHPV
                     RTLVSNLDHVAAVENVFLLHSSGVSKCVDALVAVARRLRSGKDALIVTASCLRALQAA
                     AQYGATEKRRATADRALDIVSYELEAGRAILMPVTDELYLHDAGTYCDEDLMLWTLAA
                     YLARDVPLVKVHTIMSSRSRARNPQHALRGEHSPLTSTDDLYNKSTPLLQALRSKELR
                     AVTHHPVVQRPVRDPPQTLYNVNPIRARFVYRRDKALFDKYHVTARNLAPGFSQGALN
                     SDLRALGFYTPDHPQVPYTPLSELKCHPVPANPPASQ"
     gene            complement(<443921..>445180)
                     /locus_tag="LMJF_27_1040"
                     /db_xref="GeneID:12982692"
     mRNA            complement(<443921..>445180)
                     /locus_tag="LMJF_27_1040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721862.1"
                     /db_xref="GeneID:12982692"
     CDS             complement(443921..445180)
                     /locus_tag="LMJF_27_1040"
                     /note="previous protein_id=AAZ09850.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721910.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982692"
                     /db_xref="UniProtKB/TrEMBL:E9AD81"
                     /translation="MQPNGVGDFPVPVATSGAPTDDGQSTRQVPANTISSEEVPTASF
                     RAHMPYERSTISSKQRRGGNLVLFVKPNENESEAASRGTSFSPHQQQANGSGADGDVE
                     GFSEEGDENVAKDQEDAPSLVISTFVNAAGSVGSMATGATRRPLVTAALVLLYFILLD
                     LVLLSGNERLNRVLRRMRAAEDDALILLSTSLVRQMAEAKQELRDAVTQRGGNVKTDG
                     FEMARHKLEALERVCNRSISRLHAKLMFPGSVEDLLFLIESHATYDERLRELAAHELH
                     WATTVMTGHVVHAGGDDVEESQPHGPGTARPAAHSPAAGGDAHPSAQEGNTDAALNPL
                     RNVRLQHVRQYRAPTKLAASSYAWRLSTRAKSTATSRRQSGGTSAFASAVSAVAKATR
                     GLLELVSNKLVAFLLICALLSAVLRMG"
     gene            complement(<446129..>446569)
                     /locus_tag="LMJF_27_1045"
                     /db_xref="GeneID:12982693"
     mRNA            complement(<446129..>446569)
                     /locus_tag="LMJF_27_1045"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721863.1"
                     /db_xref="GeneID:12982693"
     CDS             complement(446129..446569)
                     /locus_tag="LMJF_27_1045"
                     /note="previous protein_id=AAZ09851.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721911.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1045"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1045"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982693"
                     /db_xref="UniProtKB/TrEMBL:E9AD82"
                     /translation="MLRRCFPRLEVLRPAVERRKRRGRAEVGGAKKVGSRNPGMPDLP
                     KSAGGYVFQQLRLHLPIRWRYGWRWSSLKAVWVGGWSSFICYVAYVMFFKYTDSEIAE
                     QATQYTYVRNDRGEVVDIGFKPIVDAGRRARRRADRLLDPDERD"
     gene            complement(<447297..>449297)
                     /locus_tag="LMJF_27_1050"
                     /db_xref="GeneID:12982694"
     mRNA            complement(<447297..>449297)
                     /locus_tag="LMJF_27_1050"
                     /product="putative vesicular transport protein (CDC48
                     homologue)"
                     /transcript_id="XM_003721864.1"
                     /db_xref="GeneID:12982694"
     CDS             complement(447297..449297)
                     /locus_tag="LMJF_27_1050"
                     /note="previous protein_id=AAZ09852.1"
                     /codon_start=1
                     /product="putative vesicular transport protein (CDC48
                     homologue)"
                     /protein_id="XP_003721912.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982694"
                     /db_xref="GOA:E9AD83"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9AD83"
                     /translation="MSDMSDRLKGRLKQMARQTPNGYRKQRPGSGPRHFADDNYPFHA
                     KRPRDEEEERPQGSKSSSSRVHSGKEAGKSASGDGEGEALGVIPKITLEDMGGLAKEL
                     PVIKELIELPIRMPHLFNCLGADPPCGVLLHGPPGVGKTKLVHAIAGSLQVPLFFVAA
                     PEIVSGISGDSEAKLRNLFMDAIAAAPSIVFIDEIDTIAGRREDAQRAMESRIVGQLL
                     TCMDQVSQAWRQHNKVVCVMGATNRPEALDTALRRAGRFDREIALGIPSIDERQSILS
                     IICAKINLSDGVDFFELANMTPGYVGADLHLLVKEACILAIRRKYKELDEHGAVDGVQ
                     TEELAGFCVTFDELKEATTRVQPSAMREGFTTIPNVSWDDVGALEDVREELMTSILQP
                     IRAPKLHHRFGLDHPVGVLLYGPPGCGKTLVAKAIANQSGANFISIKGPELLNKFVGE
                     SERSVRMVFARGRASAPCVLFFDELDALAPRRGSDRANPSSERVVNQLLTELDGVEGR
                     KDVYVIGATNRPDMIDSAMLRPGRLDKLLYVPLPSPAQRESILRTHARKYPVDAEVNL
                     ERLARDERLTGFSGADLAALMREASLTALKGVYKSHTKDELEELERDITGKSADTANL
                     PTITADNFEASLTKIRPSVSAADRANYENMSIEIRNNAKNTG"
     gene            complement(<451518..>452840)
                     /locus_tag="LMJF_27_1060"
                     /db_xref="GeneID:12982695"
     mRNA            complement(<451518..>452840)
                     /locus_tag="LMJF_27_1060"
                     /product="putative cysteine desulfurase"
                     /transcript_id="XM_003721865.1"
                     /db_xref="GeneID:12982695"
     CDS             complement(451518..452840)
                     /locus_tag="LMJF_27_1060"
                     /EC_number="2.8.1.7"
                     /note="previous protein_id=AAZ09853.1"
                     /codon_start=1
                     /product="putative cysteine desulfurase"
                     /protein_id="XP_003721913.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982695"
                     /db_xref="GOA:E9AD84"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR016454"
                     /db_xref="InterPro:IPR020578"
                     /db_xref="UniProtKB/TrEMBL:E9AD84"
                     /translation="MRCMSRVFLCAAASTANGAGAASKAAAAVTAPPSTLPVFKTRPI
                     YMDNQATTPLDPRVLDAMLPYMTEEYGNPNSRTHQYGWSAEEAVEKARRQVADLIGAS
                     PKEIFFTSGATECNNIAIKGVGNFLKAKKNHIITLQTEHKCVLDSCRYLEMEGFEVTY
                     LPVQKNGILDLKVLEAAIKPTTCLVSCMAAHNEIGVLQPIREIGALCHAKKVLFHTDA
                     AQALGKVKVDVNADNIDLMSMSSHKVYGPKGCGALYVRRRPRVRLRSPVSGGGQERGV
                     RSGTVAAALVVGMGAACEVAMKEWKRDAAHTERLQERLLKGLQSRLSHLVVNGDLKHR
                     LPGNLNISFSCVEGESLLMGMRDVAVSSGSACTSASLEPSYVLRALGVDAENAHTSIR
                     FGIGRFTTAKEVDLVIEECVRNVERLRELSPLWDLMQEGKTLADVQWR"
     gene            complement(<454359..>457352)
                     /locus_tag="LMJF_27_1070"
                     /db_xref="GeneID:12982696"
     mRNA            complement(<454359..>457352)
                     /locus_tag="LMJF_27_1070"
                     /product="putative vesicular-fusion ATPase-like protein"
                     /transcript_id="XM_003721866.1"
                     /db_xref="GeneID:12982696"
     CDS             complement(454359..457352)
                     /locus_tag="LMJF_27_1070"
                     /note="previous protein_id=AAZ09854.1"
                     /codon_start=1
                     /product="putative vesicular-fusion ATPase-like protein"
                     /protein_id="XP_003721914.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982696"
                     /db_xref="GOA:E9AD85"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9AD85"
                     /translation="MRHSLYRLCQCAKLSFTILVLAVSILSCVDVLARAQADDAAPEI
                     LYVRGCRDGAAEARETTGCFAAPAGASASSPTALVPIASVTLSLQGVHLPAEVRDTDN
                     GDSQAVLHRVLLQEHRRPPLLGQEQSEADTRLLEKIVLSCSRPMASLVFPTQLISCEL
                     ENPLLSLAGVEGMAPQLVRLVSQPMWFDVRLEERRSGEEAYRTVTVLRRAVQLRVSNT
                     TNAKDEMAAETPRGQAEKVSWEEVRQHPLERLYAPLPASQDRAERADEPYDGDGAANG
                     DEVWAELGIGGLKRELRTLFRRVFLSRLPSLAPLAEALQLQHVRGVILYGPPGNGKTL
                     IARNLFRLLGPNTRLSIVNAADILSKFVGESEKNLRDVFEGYDIGTTSKEETAQQESQ
                     RFDRSAHKKSGATKKGALLVLVIDELEALFRRRGHSSDESSAKAVYDGVTNTLLSLMD
                     GVKSRNDLLVVGLTNRLQAIDSALLRPGRFEVLIEIPAPDVPGREDIFFIHTERLRER
                     SFLAPDVVLRDLALESGGFSGSDIAGTVRSALSYALLRYRRDGLFQGGPQSTEAGEGS
                     SGVADAEMIGHRAGDVGGLVLEGTGGSGSMSSSASSPSLFKVTREDFERAFKDIRSAK
                     DEASVLSHLSADGDRVSAEIVDHDGTVSTNVKRATAVIERVMQSNRTVTGMLAITGAP
                     GTGKSTVAQALTRVYDFTTVRYLSCRRLAQLPDHEEQLGKLRDALNDASHTESGIVVL
                     DDYDVLVGVMSSGGYAGNTLRSLLYEYMHRSGGVSRALAANSPLAAADEVGHNLAMNA
                     ESRVSADRNHRILVLTSSLSSVLQQLSFDAHLRVHPVLRRGAEALLQEYRVADPVQSV
                     KAAAAYPVSMSYRTFLRLTDISLQRWVQEVENTAAAIGDSQSSDVGSSASTMELPAYF
                     ATSHQMRAVYNEMRARQVAANFYAVSDDAASRSFISAVRTTVADMGLMDPYQGWGGEG
                     SDDEDGKEAAVDVDELVGAADELLW"
     gene            complement(<459191..>463450)
                     /locus_tag="LMJF_27_1080"
                     /db_xref="GeneID:12982697"
     mRNA            complement(<459191..>463450)
                     /locus_tag="LMJF_27_1080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721867.1"
                     /db_xref="GeneID:12982697"
     CDS             complement(459191..463450)
                     /locus_tag="LMJF_27_1080"
                     /note="previous protein_id=AAZ09855.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721915.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982697"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="UniProtKB/TrEMBL:E9AD86"
                     /translation="MRSRRASDSPRRRATPKQEAKRLLRSLDHNASCASAAAGNPISA
                     PTKGKEGKGLRRVTLAATAEANAQAAIPSPRPRRPAANSPSAAAAKGERGKAASLTTA
                     QLLQHLQLTSFVDRVTERVKAWASSLAEWAQPAFDPALRGWERQLSLSLRKDSFADCT
                     AVQNAMQQRYEDQFGHNHNDVAFLTLYARVLVNNAIFCLVSFETYRSTQLLQEAVHVA
                     KEAHVLQRRLAQGQEDGATAAAQGKARGETGTSTAAAAANASKQPSLVGDPECHLLLL
                     RVLLANAYASDQQYWKAAEQYQLALSAMERNPMWCPEQVAPGLASPLPFNHTLVTEDA
                     KLFYEDSVRVAHAISQGRAHLLLLQSKGPTATSARLLQVQLAMARLHRHAGQYAESQN
                     LYESYLDGVTEHVESEDVGGAMLELGRLLLYKVNNSDAAVIYLEAASSILLEDAEALL
                     QVAEAHGGSSGSSRSNEATAAEARIAAGNATHRAAGGLIDAAMAFHTVGKTGQAIGLL
                     EGCLQLLDRADLGSISGWVRRQYADMLASVALVDRALEEYSRTIELLRNGCGAVAQLG
                     TAGEMVPLNFAEVEGHMAFCLQTYVGDHKRAMKHYRNIVKGPHKKDASVTSAQVRLNK
                     RARRQRASATAVAATAAGSTRVSDGVAFTSDQANAGSSPAPPRVDVSLQPDVMHWVLS
                     NYVACCERVGAYAEAVGVQSRLIEIEGALGGGVVDSYLKLISLARQAGDMEKTLALCF
                     YIFFLPDDMMPSETRLSVANSFASCCHRLGNSRMGSVLLQAVQQVRGDHDASSLARYA
                     MGLKTLDPSDCVQLDCVDIEANIDTIGRVFRRAASIVVADMVVNGVEDEERISRDGRR
                     ASNSDSSAAAAALSDGGNESSVPSLASPSLWTLERVDRTLNSLIVLSRGAFFFHQNRF
                     IKDAEELYAVALQHVDHIIASMPVLTERHQREMGILLVNYATLKSATDPELAATLYER
                     AAAVCPTYLEVAEVVADVFVQSGDYAKGSVYMKRVMRANPSAATEMHMRLARIGTGSA
                     WDTMSHGQRMEVMEHLLKGLGVAPERVAAALAAGVQSELTNTNNANVVMSLGNLAPLL
                     LDGVATATSEDAVCFATYVVQTRFQEPQLLNRMYRRALLRFPQHATILVNYATLCMHS
                     GCHTLARKYIAKAYAASSGDSNCTMCYAHYLCRSFDDRQVGCGEALYAHFLERYPNAA
                     QAHAAFANYMAGVMPTPFKTEQHFKAALELAPPSEDVLLQYGQFMWACTDSKTVYTND
                     EVRRRVFDRAEQLFKEAVAINPNSFTACHQLGTFYANGQYRFEDAMTMLQRAHMLQPG
                     NIEVVRHILGVLHGECMRLKKEELRRGSTVALQGTNTQSFSGQLRSLVDATKEMFEHV
                     LGMDPNDEATLEGYARFAVETLQDPKLAATIYRRIEELNRR"
     gene            complement(<466548..>467138)
                     /locus_tag="LMJF_27_1090"
                     /db_xref="GeneID:12982698"
     mRNA            complement(<466548..>467138)
                     /locus_tag="LMJF_27_1090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721868.1"
                     /db_xref="GeneID:12982698"
     CDS             complement(466548..467138)
                     /locus_tag="LMJF_27_1090"
                     /note="previous protein_id=AAZ09856.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721916.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982698"
                     /db_xref="GOA:E9AD87"
                     /db_xref="InterPro:IPR007905"
                     /db_xref="UniProtKB/TrEMBL:E9AD87"
                     /translation="MPQATVPLLAKIWFLAVAPVVILDAIFVLTRAKSVNLPHPLAEV
                     VPFRYWAIYAQYDRRYAANDDSFVVVQSWLNLVEVAVGLFVTLLAICDAQNVAIKLAI
                     VVCLMTLYKTVFYCLIEIAEGGKYTRHNTVQEKLTMLIAPLSVWIVVPSLILRQCFRA
                     LAVASVPGPFKPKAAASQHHQQKYFGNSNNQGKKKN"
     gene            complement(<467987..>469930)
                     /locus_tag="LMJF_27_1100"
                     /db_xref="GeneID:12982699"
     mRNA            complement(<467987..>469930)
                     /locus_tag="LMJF_27_1100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721869.1"
                     /db_xref="GeneID:12982699"
     CDS             complement(467987..469930)
                     /locus_tag="LMJF_27_1100"
                     /note="previous protein_id=AAZ09857.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721917.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982699"
                     /db_xref="UniProtKB/TrEMBL:E9AD88"
                     /translation="MRSLLLRSSPRFAAAQVAPRAAYALSLHTPHRSFFVRELSTPAT
                     LESGDSSVAPSPARLLWQFSSKRPRHLVLCVREPLPAVAPLALENTSEGLSAAEAVGA
                     SAARTVAVDGAPRAQEEFMYGRLFLRPYNVAQLLTVLQGWSDSPAVVERPRSSLMVSA
                     VPPSSTSEKLANSSSVDERPREVMLTARVTRKTTLAAPGDAGRAAIRGVEAYSSTDAD
                     PGAEEDQLDTVYVDGDTSTLHVVLRDADLVLLTTHLESVLSDLFGIEHCSRKMERRKA
                     FSSPHSRVSHRTGARPSSFERSSARQPQYLSDRRAPATGTQGNMMEKGYQDRRRQRGN
                     RGGSRHHSVTTAPAQGERRLFEAAPAKTAPTTATNEAEDDDYQEIVEDVEEVEDGEDN
                     HKDATRTCSGATPSSQAVASAASAASSTSYITTHTRERGEMTVESADRYAEARFMRDG
                     SVAASEVEEVDRVGEFDVRRRTREAQGSTEKGDSRTTVHATATTGAFRSRSGEVIGSF
                     SYERLSTTTEATSATTAAAAAAATAIPLRCETAEGDSEVAAAIDITAIESQPSAEVDD
                     RKPGESASDERPVGEAKSAEAGSAKRTRKRQASGSAAAAGKKKTAKRKSRKASAKRKA
                     ATSTTASVSAPQGTTEFADTRVL"
     gene            complement(<471463..>472167)
                     /locus_tag="LMJF_27_1110"
                     /db_xref="GeneID:12982700"
     mRNA            complement(<471463..>472167)
                     /locus_tag="LMJF_27_1110"
                     /product="mitochondrial RNA binding protein 1"
                     /transcript_id="XM_003721870.1"
                     /db_xref="GeneID:12982700"
     CDS             complement(471463..472167)
                     /locus_tag="LMJF_27_1110"
                     /note="previous protein_id=AAZ09858.1"
                     /codon_start=1
                     /product="mitochondrial RNA binding protein 1"
                     /protein_id="XP_003721918.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982700"
                     /db_xref="GOA:E9AD89"
                     /db_xref="InterPro:IPR009044"
                     /db_xref="InterPro:IPR018539"
                     /db_xref="UniProtKB/TrEMBL:E9AD89"
                     /translation="MLRLVSASLPLATATALSVRFQSSSALPAMNQNRRSQNRRNFIS
                     TNSLPKFEIHDVRDDPEHGSMTRVSVDGKQLLVSQFPQLGPRKADPNDTTPQFDRDRR
                     ISMRFRHIDLAGFVSVVENRISSHHVKNNAFDMAFEKTTNGYVLKGQVHRSNSQANEE
                     WAVRFENQFAVTMEHFLESALTESFGFAQHQRALVRGDSPPTDSPQNNQDRNRNQNRN
                     QSRRRNNNSNAENQES"
     gene            complement(<473466..>474131)
                     /locus_tag="LMJF_27_1120"
                     /db_xref="GeneID:12982701"
     mRNA            complement(<473466..>474131)
                     /locus_tag="LMJF_27_1120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721871.1"
                     /db_xref="GeneID:12982701"
     CDS             complement(473466..474131)
                     /locus_tag="LMJF_27_1120"
                     /note="previous protein_id=AAZ09859.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721919.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982701"
                     /db_xref="UniProtKB/TrEMBL:E9AD90"
                     /translation="MQSNSAPVSYGAQLRASMQTLRANDTQFEQFTRGLGAVLQQWTA
                     LQLVAQHCDSRAPAVLYEDLCAWHKHDGEVYVDDMEVYFEEFFDNIRSARIEDDSMQE
                     VGTVLHDMYCRCCLNDFSLVEHYLETLAMYVQTNPVAMSVNGGTNENLEDDAEEDAEL
                     GGDAVCEEGVDNEDEESEPMQAPTPKAPQQPPQPPRHQQQPQRKKRKNTSVRSRDGWN
                     IVQ"
     gene            complement(474783..476081)
                     /locus_tag="LMJF_27_1125"
                     /pseudo
                     /db_xref="GeneID:12982702"
     misc_feature    complement(474783..476081)
                     /locus_tag="LMJF_27_1125"
                     /pseudo
                     /db_xref="GeneID:12982702"
     gene            complement(<477673..>480108)
                     /locus_tag="LMJF_27_1130"
                     /db_xref="GeneID:12982703"
     mRNA            complement(<477673..>480108)
                     /locus_tag="LMJF_27_1130"
                     /product="putative intraflagellar transport protein IFT88"
                     /transcript_id="XM_003721872.1"
                     /db_xref="GeneID:12982703"
     CDS             complement(477673..480108)
                     /locus_tag="LMJF_27_1130"
                     /note="previous protein_id=AAZ09860.1"
                     /codon_start=1
                     /product="putative intraflagellar transport protein IFT88"
                     /protein_id="XP_003721920.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982703"
                     /db_xref="GOA:E9AD91"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:E9AD91"
                     /translation="MNGNDEDIYAAFQTPDIGSNPWTTSTNPFEAPAQEAMGGNPLMQ
                     APPSQWGRAGMGSAWGVPGSRMETRGCGIPGATRPMTSNRAVGFNSASTGAAAALFDP
                     TGQARMANMAMGPAPPLKKRSENSQEEELAEMEKQVNKLIEESAMLALQKDYGAALEK
                     AKDAGKLERSLCKKREQYGLAEQINVDLTYAVHFNLAVQYQNHQLYTEALNTYNLIIR
                     NVQFPQAGRLRVNMGNIYLAQQNYLLAIKMYRKVLDETPAAGKEFRYHLCRNIANAFV
                     KLGQYRDAANSYETVVEGNGDVNATFNLILCYYALGETEKMKRTFTRLMNCRLAGLDG
                     EEDFEEEEKRKDVLVDDSLSRMRKERRARYLKYIITAARLIAPVLHKDWCVGYDYIIS
                     QLRTYEMRDPTSHVASELEMCKNLNYLKHKRYQEAINGLKEFEKKDRSLRARAATNLA
                     YLYFLEGDYENGEQYSDLSLVANQYNAKALVNKGNFSFVKKDYDKAKELYNKALAVEA
                     DNVEAIYNLGLAAKKLGLYEEAVRMFKRVQALVDSSEVLYQIADLSDLVGDPAALEWF
                     NRLIGRVPTDPNALARIGSLYARDSDDVQAFHYYLEAYRYYQVNMDVISWLGAYFVKN
                     EVYDKAVQFFERASHIQPQEVKWQLMVASCHRRRGDYVQAKRLYEQVHRRYPDNIECL
                     NYLVQLCKDAGLNEEANEWFKATKKVERQQIHSSSSSVGGESGDDDVESSVEGGNNIN
                     GHHRRRTSGTAAPDTAVAGRRAGGGAAADKEFSVGLFDDDIVDGKAKQNGAKRQKKAK
                     SSDSDDEIDLPGI"
     gene            complement(<483084..>484835)
                     /locus_tag="LMJF_27_1140"
                     /db_xref="GeneID:12982704"
     mRNA            complement(<483084..>484835)
                     /locus_tag="LMJF_27_1140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721873.1"
                     /db_xref="GeneID:12982704"
     CDS             complement(483084..484835)
                     /locus_tag="LMJF_27_1140"
                     /note="previous protein_id=AAZ09861.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721921.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982704"
                     /db_xref="UniProtKB/TrEMBL:E9AD92"
                     /translation="MSIRAVCWLQSKLGLDIGGRSSGDDGSGTLGSGELAGFSTTQNR
                     SYSTDPVATVNGTPESSRNDRGIGGGAGTFSGLASGWDLKLGQVWRQASDKATQYWNT
                     NMRRRGSTDPFGFRTAGAQGDFGGNTAAGDNPELDENGLPVTRNWYYYDVQLGRWTVS
                     RDAPESVQQEYYEKLEEAERERLGQKKVGPPPPAAIAGGPPPLLGAAGGGHGSQSPHY
                     AIPDYFGNAGATPAAPPQQAQPYGVYGGAPPQHAQSTAPGVFPPSAGMSTHPGTYYPP
                     TPPISSTTASATMQATTYRQPLSVHSQVAPPPPPAQAYLPAMPSISVPTYPVTGGAYP
                     AASVSPTSNTHALSLQPPSHVAASEPPKTAMTVSSLPPPILASPTPSHPLSQPHVYSS
                     PAHNGMSASPPAPALSQHYASPLLQSQAPEPNRSASGNSAAGVSSLPFAHASAPAPAP
                     CTSAAPDAYPYGGGSVNNSVQDSTTAVASAGIPTPSQRSFGLKAAVHGPQPPPSTSNP
                     YAYPSTATTTAAAQAFAPAPAVPVQPQPLKVEANGNNEHPSASSLGTFQTTSAAAARP
                     SAIGLPPPPSFKPFSPS"
     gene            complement(<486847..>488307)
                     /locus_tag="LMJF_27_1150"
                     /db_xref="GeneID:12982705"
     mRNA            complement(<486847..>488307)
                     /locus_tag="LMJF_27_1150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721874.1"
                     /db_xref="GeneID:12982705"
     CDS             complement(486847..488307)
                     /locus_tag="LMJF_27_1150"
                     /note="previous protein_id=AAZ09862.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721922.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982705"
                     /db_xref="InterPro:IPR003347"
                     /db_xref="UniProtKB/TrEMBL:E9AD93"
                     /translation="MLELDGTTLTYEVFRDACLRPNRPAVIRNACRDASGGICFDLAA
                     LKRRLCPRELCRCLGPQTLAPVYPVSSTAQVASCDSTPTAREERRHEPPTTVSDDEEE
                     ADEEGRCKMVPLEAVLHSWAASASAAACSPSPSHVYYLKDWHLQAALESTAATETATT
                     SSAASSQLCEYAKSRASGTHGDGLYRVPRFLGADWMDSFCCRHVVPSNEVLRKTAPAH
                     DTDASAQIGFGNGESDYRFCYIGPVGSWTPLHCDVFGTYSWSFNVCGDKHWFFPTVAG
                     NAYLHDHLLPLFPTPPDIRVLTGFELEAVVQHPGDLVFVPALFYHQVHNITGEVFPLF
                     AGEGAAAEDDCGQDAVEPVASAEVDVCLSAALTVSLNHNWCNAFNLERMTKAFLADAR
                     QLASHLSVEDLALICVTRDSAVWRRFADRILHNGTNWSFASMTCFLDHCLAQLDTGAD
                     AAVGAEDERSVAADELHRLRGQVAEEYAHLLEEKRH"
     gene            complement(<489190..>492189)
                     /locus_tag="LMJF_27_1160"
                     /db_xref="GeneID:12982706"
     mRNA            complement(<489190..>492189)
                     /locus_tag="LMJF_27_1160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721875.1"
                     /db_xref="GeneID:12982706"
     CDS             complement(489190..492189)
                     /locus_tag="LMJF_27_1160"
                     /note="previous protein_id=AAZ09863.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721923.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982706"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR019384"
                     /db_xref="UniProtKB/TrEMBL:E9AD94"
                     /translation="MSRPAGMVARRGAAATAHISKGPSRSMQASTGAKSAPAAAASLA
                     PLSTRRLPADHHSPASMMAVIQEQWLQLCEYFQRVQCANTHDERTSLMRELGSVEKAL
                     SVILDALLTDRAMLVANHPALNQHSHVFGGSFRSESAPPSPPESSGDMGALGRAETMT
                     TATHIGTSPSASLSSSCLLDGVDGACLALPPCYRFLFADSHSVPIPPPPTDERGAVSK
                     TKDTAAFSNEPPPIGNIFLLMLCQYAKQDEPPGVRSVILDFLARLLQEADLPTDRSAY
                     PAGEQAMSLLQLRPSVLIVPLLDMVRKVSKALDPANAAALHPTTTSTSASASTVAVTE
                     TYRWAIDDPRDGTLLQDAGRTQFVIFLSTLAEKMERVPALANFFVVEDGSQERNLLVP
                     LDALLPYLTHDCSTQEWTHRRDTCRFALSAVVSLAKCSDPWIQDVVAKEERVASRTLN
                     AARTTLLTLCKIPENDDGATQLLYLRDVMRFWATLLTMAPSVADTLHLLPLIEKEFVC
                     QTLLPLLQSPDSHVYSAACVVVSNILADLQGSAPLLKVCFAKALLSTTIRKASGRIVP
                     NKQFYEVLVQNPVTAASATRTGGLAVTRGQQEEKAAASLPEHPITSFFTYYILPHLSS
                     NPCLSEEDKESSTLLGFTTTRWSATKATLLLVQTLAEHVPHVFLREVFLMDVTSLSDV
                     QRKQTACALHTADSGGCKSAQSRGSAITPPHLNIHDCFLSSLLSAAATNPKVGLQPDC
                     VGEAVLSRLLRVEANMPVAALRARQRMMSAMKPPCGSSSTAATATADAAKTTEAPAAA
                     AEPANCWFHAGVQTSPFTTALCEMVQHLDSSPYTVSSLVADLVVSIAVMPDLRVLYTL
                     LDSKRGPLVTALCGLRSVLQLHLERKVAETSPIKKNTGGRGPFASTSTAPRPLAVSMP
                     FLYDMLLQHWDLLVDDEAERTKSPVTPNHSSSGSEVSAEALREVIRKHGNVLYACLYS
                     EYLHAYLDAVIGYTALSQNLIYLKMPD"
     gene            complement(<492930..>493667)
                     /locus_tag="LMJF_27_1170"
                     /db_xref="GeneID:12982707"
     mRNA            complement(<492930..>493667)
                     /locus_tag="LMJF_27_1170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721876.1"
                     /db_xref="GeneID:12982707"
     CDS             complement(492930..493667)
                     /locus_tag="LMJF_27_1170"
                     /note="previous protein_id=AAZ09864.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721924.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982707"
                     /db_xref="UniProtKB/TrEMBL:E9AD95"
                     /translation="MSGAGRKHRAKHLTQQYLDASGWVGPKEGERLAICMESPHGQHV
                     RVLLLVHPNSAPASSSTEAPAPDGSSSSDAPHGAKESEAGVSASPPSAAPLLEVEQVV
                     HLPRKFHKVIWLSIKDVVVIADGTVSFKPSPEQVESFLKDPRNKGWRERVATAQHRAE
                     DQRAALQRMPHYAATAQTTTSVLTGPQVRSGVRATANGTSEQDSEGSEGEADDMRNPN
                     WRNIKHQQHFFYGLGDDSDEIEEEEDA"
     gene            complement(<496820..>498088)
                     /locus_tag="LMJF_27_1180"
                     /db_xref="GeneID:12982708"
     mRNA            complement(<496820..>498088)
                     /locus_tag="LMJF_27_1180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721877.1"
                     /db_xref="GeneID:12982708"
     CDS             complement(496820..498088)
                     /locus_tag="LMJF_27_1180"
                     /note="previous protein_id=AAZ09865.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721925.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982708"
                     /db_xref="GOA:E9AD96"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="UniProtKB/TrEMBL:E9AD96"
                     /translation="MLRRIGSRYGKRFSFFCRNVRAVSQSEKAERGGEDAFLSLPNVQ
                     AVLDGVSWWKENADLNAGLYSAALARCMYEYVEDELLGDAPASSFRLLERGYESCKHS
                     DVLGTCTALVATLQEPQEDIQSRDHYELVLLDGPSLPIVGVSSTGGLLAATSAASAAA
                     AATAAVAAADDTMSSTEAAKESASDSDAAVTRVKTTIDLHQAFARFQRTDSAENYLLD
                     VVYVGDCTMMLIRNGRVCYVTEEQAHQLDYPYQLGTGSNDTPKDGVRLLIPVEKGDIV
                     VMGTDGIFDNLYPHRIVELIWPHLERVFSQHGYLQALGGAETAKAPANAVSYVKNRNL
                     RTLLDDIMAALDMGANAVMADAMTVSRDVRCDSPYASKCIENGALFEGGKPDDMTLLI
                     SVIGESDDGEPSEQFSGSETAFPLPYRDWP"
     gene            complement(<501330..>501620)
                     /locus_tag="LMJF_27_1190"
                     /db_xref="GeneID:12982709"
     mRNA            complement(<501330..>501620)
                     /locus_tag="LMJF_27_1190"
                     /product="putative histone H1"
                     /transcript_id="XM_003721878.1"
                     /db_xref="GeneID:12982709"
     CDS             complement(501330..501620)
                     /locus_tag="LMJF_27_1190"
                     /note="previous protein_id=AAZ09866.1"
                     /codon_start=1
                     /product="putative histone H1"
                     /protein_id="XP_003721926.1"
                     /db_xref="GeneID:12982709"
                     /db_xref="UniProtKB/TrEMBL:E9AD97"
                     /translation="MSSNSAAAAVSAATTSPQKSSRSSPKRAAVAKKTGAKKVAKKPA
                     KKVAKKPAKKVVKKPAKKVVKKAVKAVKKAVKKVVKAVKTAKKSSKKSSAKK"
     gene            complement(<505603..>506850)
                     /locus_tag="LMJF_27_1200"
                     /db_xref="GeneID:12982710"
     mRNA            complement(<505603..>506850)
                     /locus_tag="LMJF_27_1200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721879.1"
                     /db_xref="GeneID:12982710"
     CDS             complement(505603..506850)
                     /locus_tag="LMJF_27_1200"
                     /note="previous protein_id=AAZ09867.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721927.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982710"
                     /db_xref="GOA:E9AD98"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR024766"
                     /db_xref="UniProtKB/TrEMBL:E9AD98"
                     /translation="MLSTMDSRASPVCPSPSSKSYTTRRVCSPVVLSLVEDNLRESCS
                     GETFGSSQPTSLTSSGGGPRTSALSPRRTGKSVLRAEERESPLTTYTPNSRPRRKSDT
                     AVTLSSSASVQGSQEKGSNSKLRAVKLCKVSVPPQAPHTSTSLDTCTSPVQRSVSSQQ
                     ARRSVSLTSSVLTSRPTEEFAASSTPSNPPLTSGSPAPSSLREHSVSISEEADECCIC
                     LEVYTNENPMFRGACQHHFHLPCLMEWKQRSSLCPMCCAETLRGIGDFEGSHHSGAAD
                     PAEVARQRAIAKRDAEIARNLQHSYLLQAQLRGRQYAYATQAVRSFQALHSGSPSSST
                     SRSPLHATEVEEHPLSTLPVYNRCNAQRLGGIVRQSPPLDNVRQPRATANVHSQLTAP
                     PVHPSTEESRRSRSKPQAGCAVM"
     gene            complement(<510722..>512392)
                     /locus_tag="LMJF_27_1210"
                     /db_xref="GeneID:12982711"
     mRNA            complement(<510722..>512392)
                     /locus_tag="LMJF_27_1210"
                     /product="putative translation initiation factor eIF2B
                     subunit-like protein"
                     /transcript_id="XM_003721880.1"
                     /db_xref="GeneID:12982711"
     CDS             complement(510722..512392)
                     /locus_tag="LMJF_27_1210"
                     /note="previous protein_id=AAZ09868.1"
                     /codon_start=1
                     /product="putative translation initiation factor eIF2B
                     subunit-like protein"
                     /protein_id="XP_003721928.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982711"
                     /db_xref="GOA:E9AD99"
                     /db_xref="InterPro:IPR000649"
                     /db_xref="UniProtKB/TrEMBL:E9AD99"
                     /translation="MSSSAEEKEAKKQEELRLAGSDSEGVRAAVKAQRELKKKRDALR
                     KVQKKIRSGGSDAEVAAAIEQEAALLAEIGHLEALRGASSAPSTAHVAAASFTSTPAT
                     AAASPGALVTVATNKSSGAKAARSGEPAKEITAEERAASAKRLHDLVQGAMDANRLKC
                     LHVLPRDAVVHPRIAEVAVLMEQMLLVGGSARALALISAFRELSRTTTVLAVPSLNEV
                     NTTAFEKLIQINFDFVRRKREASAGMRHVKDVLVRRFVALRDEVIHPKPNMVDLIKDL
                     GGPREVTLKILDAIEAELKMSFKSIVEDRSLPYVSSSDTILVFGRSSLVEYILLSRSR
                     DPQCKPKRVIVIDSAPLFEGRQLAEKLSSAGIDVTYGLITACCTLMPKCTRVFMGASA
                     VLQNGDMFGRCGMALVAACAKLFRKPVLCFSESYKFVPEVWVGNLAQNTKLADMRPAA
                     EVHGSDTGTHSPLVYPTPPTLSPPQLRASGGWGTPARGADFLTRSGGGGAVPFSSSAS
                     GYLYDLTPASYIDMIICEMGCLHTSAIVAAIKDREGRDTSQLLNLVRG"
     gene            complement(<515151..>516389)
                     /locus_tag="LMJF_27_1220"
                     /db_xref="GeneID:12982712"
     mRNA            complement(<515151..>516389)
                     /locus_tag="LMJF_27_1220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721881.1"
                     /db_xref="GeneID:12982712"
     CDS             complement(515151..516389)
                     /locus_tag="LMJF_27_1220"
                     /note="previous protein_id=AAZ09869.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721929.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982712"
                     /db_xref="UniProtKB/TrEMBL:E9ADA0"
                     /translation="MLSPSVLELSKQLVQLDSQAKALRKEVEYLRATKRSLEVSNMTE
                     GKLSEMRESTGSTAKSKSQRSRASARRSGTASSTSLSLPHDLIDDMAHKCSDVEASIR
                     THKELLREKEALQAALAKAEDATEAAEQEYLGIVEVVGINTDGNSSSAIVLKKNAYST
                     ALKNAVAVYHLRENVRIQMEGQSRELLRLAAILQETTDAESQRAEAVEVLAERKAKLE
                     ALRHECNTIARAAARRETMAGRNQHGLTSEDCIRHRNFDRRVALHELSKEDNLIKQND
                     LAIRYRAMQIAKIQAHLELIGDAVTGDDMEEEERIDADIADELAKEINDLYDSHIVAN
                     LRMDTIDCDIEKMVWRASAFQHAKDSTVVEMERVRREHRRYLDELQRTVDKERLSNGQ
                     TILHLQHELETLPRSSARKK"
     gene            complement(<517683..>519239)
                     /locus_tag="LMJF_27_1230"
                     /db_xref="GeneID:12982713"
     mRNA            complement(<517683..>519239)
                     /locus_tag="LMJF_27_1230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721882.1"
                     /db_xref="GeneID:12982713"
     CDS             complement(517683..519239)
                     /locus_tag="LMJF_27_1230"
                     /note="previous protein_id=AAZ09870.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721930.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982713"
                     /db_xref="UniProtKB/TrEMBL:E9ADA1"
                     /translation="MGAAAAKPVREAPVRYVAKQMPRLDKIPVEQQFRKPQFTAQGIN
                     TRQDDVNTEPLMYVETSKDASSTELTDHVAPRWYLNTYLEMSDNMRTDQTVISGNLPL
                     AWERDKHEPYSLVRGRIDDEDLRWVLQPEQRKKPVDELLGHTKLERQVLQDILDTVEL
                     PRTQYRNYKGKLHKSIDDANTHMTARKEQIEKAREAELLRQIGYTEEEVLKEEQYLTN
                     RRRGVRTLDDLGASDRGKRRQQRAAEASELEDMLKERRIEQLERGEATVTAEEVAEKP
                     EVLQMRNKHFSTHKNVYKRMYAADIGKDERNQSKFVWWLDRTRRIKRAVDTIHGVPVY
                     NDRLSANEEQTRKQMQEAAEFNFSISRSQGAKGFTDPRGHYDQFMDIMRHNKEEMQSD
                     THVEVHEDSSAEHPIFQFPHTREHGVKPAPTRFADRRDRAQRVDTDVTKLFGFEGESP
                     AATAATPAAPVHSKSSPSEQATSGADGLTYPSGRASAGGWEKVKGASGSIPAACTEAS
                     PPTSKDDREH"
     gene            complement(<520612..>520902)
                     /locus_tag="LMJF_27_1240"
                     /db_xref="GeneID:12982714"
     mRNA            complement(<520612..>520902)
                     /locus_tag="LMJF_27_1240"
                     /product="putative histone H1"
                     /transcript_id="XM_003721883.1"
                     /db_xref="GeneID:12982714"
     CDS             complement(520612..520902)
                     /locus_tag="LMJF_27_1240"
                     /note="previous protein_id=AAZ09871.1"
                     /codon_start=1
                     /product="putative histone H1"
                     /protein_id="XP_003721931.1"
                     /db_xref="GeneID:12982714"
                     /db_xref="UniProtKB/TrEMBL:E9AD97"
                     /translation="MSSNSAAAAVSAATTSPQKSSRSSPKRAAVAKKTGAKKVAKKPA
                     KKVAKKPAKKVVKKPAKKVVKKAVKAVKKAVKKVVKAVKTAKKSSKKSSAKK"
     gene            complement(521187..522956)
                     /locus_tag="LMJF_27_1245"
                     /pseudo
                     /db_xref="GeneID:12982715"
     misc_feature    complement(521187..522956)
                     /locus_tag="LMJF_27_1245"
                     /pseudo
                     /db_xref="GeneID:12982715"
     gene            complement(<525698..>526663)
                     /locus_tag="LMJF_27_1250"
                     /db_xref="GeneID:12982716"
     mRNA            complement(<525698..>526663)
                     /locus_tag="LMJF_27_1250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721884.1"
                     /db_xref="GeneID:12982716"
     CDS             complement(525698..526663)
                     /locus_tag="LMJF_27_1250"
                     /note="previous protein_id=AAZ09872.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721932.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982716"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:E9ADA3"
                     /translation="MSKYVAPTGKVAPAAPAADNGVADITKVKICSGHTRPVCHINYS
                     EIIDGTFWFVTSCHDAKPMLRNGQTGDWVGTFEGHKGAVFCSAFNSGATRLVTGSGDY
                     SAMVWDALTGKKLHVWSHPKYIKSCDWMDQRIATGCFDGNIRIYDATRYDADPLSFGS
                     PDAINVKSTYFLDTNTMVTACENVIMKWDLRDTSGPYLRREIPGLNFVEYTHRHSIVA
                     AHEKSISFIDITSLEVKDSFTTSEDVECASLSPDGQRVAAGSKLKAKEFTLDGVEVES
                     NRGHHGPVFHIRWASDGNSYASGAEDGMVRVWPSHEIIEKYDTDA"
     gene            complement(<527916..>529505)
                     /locus_tag="LMJF_27_1260"
                     /db_xref="GeneID:12982717"
     mRNA            complement(<527916..>529505)
                     /locus_tag="LMJF_27_1260"
                     /product="putative T-complex protein 1, beta subunit"
                     /transcript_id="XM_003721885.1"
                     /db_xref="GeneID:12982717"
     CDS             complement(527916..529505)
                     /locus_tag="LMJF_27_1260"
                     /note="previous protein_id=AAZ09873.1"
                     /codon_start=1
                     /product="putative T-complex protein 1, beta subunit"
                     /protein_id="XP_003721933.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982717"
                     /db_xref="GOA:E9ADA4"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012716"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:E9ADA4"
                     /translation="MFFANQASQVLRQGASEEKGERARLMNIMGAVSVADIVKTTLGP
                     KGMDKILQGMDRTQSVRVTNDGATILKSLFMDNPAAKILIDMSKTQDDEVGDGTTSVT
                     VFAGELLRNAEKLLDQSIHPQTIIEGYRMATDTAQKALAESTEDHGADEKLFYEDLIR
                     IAKTTLSSKIITVESDHFAKLCVDAVLRLKGSGNLEMINIMKKLGGTLRDSYLEPGFL
                     LDKKIGIGQPRRLENAKILVANTPMDTDKIKIFGAKVNVESVSQLAEVEASEKGKMKS
                     KCMKIIKHNINCFINRQLIYNYPEEIFAHHGIMAIEHADFDGIERLAKALGADVVSTF
                     EDTSNVQYGFAEKIDEIMIGESTVIRFSGLHKGEACTIVLRGASRHILDEAERSIHDA
                     VCVISETVKETRTVLGAGCSEFLMANAVEEKAKAVAGKKQLAMMAFAAALRTLPAIIA
                     DNAGLDSNDLVTRLQAEHYQGHKSYGIDVIRGDIADVKTLGITESYKVKSSVVAYASE
                     AAEMILRVDDVLRAVPRQRTQ"
     gene            complement(<530258..>532093)
                     /locus_tag="LMJF_27_1265"
                     /db_xref="GeneID:12982718"
     mRNA            complement(<530258..>532093)
                     /locus_tag="LMJF_27_1265"
                     /product="putative cation transporter"
                     /transcript_id="XM_003721886.1"
                     /db_xref="GeneID:12982718"
     CDS             complement(530258..532093)
                     /locus_tag="LMJF_27_1265"
                     /note="previous protein_id=AAZ09874.1"
                     /codon_start=1
                     /product="putative cation transporter"
                     /protein_id="XP_003721934.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1265"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1265"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982718"
                     /db_xref="GOA:E9ADA5"
                     /db_xref="InterPro:IPR002524"
                     /db_xref="InterPro:IPR027469"
                     /db_xref="UniProtKB/TrEMBL:E9ADA5"
                     /translation="MHFSAALMTLAASACLVFAYHCARLSGTSFVWLSSFVALLTFLA
                     RLPRTLRSKGAAVCDTPRDKNRLLSAGACALFCLSATYGLATLGALRFACACACVAGA
                     DHIARTRGSSRNAKMTCTVLSCVILALTSDPGQQARPFMLVGGLGVLCAACAVSLSMK
                     DVVQKAHQTAFLFAACGLSIVGFIITLVQHKPTVENEMLLLLVFCISGIVLAGCVSAG
                     LALQGTAANFVAAAAGMLAGSVICGEKVFPAVYDWESLALLTSASLIFAAHKGLTFAD
                     SPGASLSGISLDPKQVLKTTQHREERGIIVTLLSNSRERKLFIFLLLTVGIMFLELIY
                     GLAVNSLGLISDSFHMMLDGTSIVIGLYAAHAASWLPDEKTHPFGYARYEVFGGFVNG
                     ILLLFIALYVMVESIQRFLDPPEIEGPYLLLVSVIGLAVNVVGIIFFHDSHGHSHSHS
                     HGEGGSGHADHNMRGVYLHILADLLGSVSVIISSILIYLFGLWIADPICSAISAILVL
                     LSAFPLLEETGKVLLLSAPNYESNYSDKLREALLATSLFQDVESPKLWIHSTPPRELT
                     ICTVAGKLRNSTEYTSARKKITETVTAHMMHHLDVHNVSFVLHIE"
     gene            <533909..>535636
                     /locus_tag="LMJF_27_1270"
                     /db_xref="GeneID:12982719"
     mRNA            <533909..>535636
                     /locus_tag="LMJF_27_1270"
                     /product="putative ubiquitin hydrolase"
                     /transcript_id="XM_003721887.1"
                     /db_xref="GeneID:12982719"
     CDS             533909..535636
                     /locus_tag="LMJF_27_1270"
                     /note="previous protein_id=AAZ09875.1"
                     /codon_start=1
                     /product="putative ubiquitin hydrolase"
                     /protein_id="XP_003721935.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982719"
                     /db_xref="GOA:E9ADA6"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:E9ADA6"
                     /translation="MFKFDYKISYDEFVRTIYHHARQYEIKVSDPHKQCVTVNALITK
                     AKDEESKRNYANAYYYVNKCLLFFDKEENPVDFTQRDPSTKRVFAEALDLEAKLKLKE
                     LPIEYKTMIEEIDRREPERRRIVAQQLESDRGDGDGNKQLSRAVDMHLTRQQQLLSSE
                     NSSVDELLQRLRYASVPGTRNITPGIVSNGPPAPSPMYTTVSRPEPSPAPVNPAPADN
                     HALPASASHRSYTTCILNPSNAFLSVRRRGIVNLGNTCYMNSVLQVLNSTPLGQYFLT
                     DTYVSYLLNTKGKLTRLINSFSFVIRELNRSDCKFSVSASPFKSALGDYYEGFQNSSQ
                     QDANEFLRVVLDGIHGALNVNDSNRIEFPEIDNSKGTDDELARRYWGQYYQKNSSVIV
                     DYCAFQERSAVVCPSCDHQSRSFNISLSIEIPIPRTLSKVSLDDCFAAYCREEILDNS
                     SMYMCPNCHQKVNARKQLLFYSAPPVLFITLKRFRCYGDFTTASKVNSSVFFSKTLDI
                     ASYMCSGFSKTKYHLVGIINHQGNMYGGHYTADAVGADGVWCHFSDEQVTKADVADNN
                     LAYILCYVR"
     gene            <536208..>537539
                     /locus_tag="LMJF_27_1275"
                     /db_xref="GeneID:12982720"
     mRNA            <536208..>537539
                     /locus_tag="LMJF_27_1275"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721888.1"
                     /db_xref="GeneID:12982720"
     CDS             536208..537539
                     /locus_tag="LMJF_27_1275"
                     /note="previous protein_id=AAZ09876.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721936.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1275"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1275"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982720"
                     /db_xref="UniProtKB/TrEMBL:E9ADA7"
                     /translation="MQSRVFNFPGKESKPDYEHRISGRVNEMLRQSSPQARSSRTSLQ
                     RNWQPYAPILSIHPQLLQKAESRSPSRANVTHLTRASSASFLTPHGSQVVSPSRLRYV
                     GTESTKQVNPNDLLRGASVAKFRQRSCSQCIQDSPRHSKASNTHPVNHESFSAVLPCS
                     LHPLLQQALLLIESAELEERLAFCQEEMDAFDSIITVFGVAKEVEVIRVAAFEMFHIE
                     RASRRALKRQERHERQILRLWYCESYKDALLSEEVRVIRQQSEESRRFFGHSPSRSQS
                     TSPKQQSQDLFDMAAPRNGSLSSKKVPSSQKSNKIAHMASLLFSASRRQGEGIRGSSP
                     TDNCDEVLHSSPRALSPMPSEPYFSHTVGSSCSLHKPSDSVNVADRRRYYREYSDRCR
                     RTLGSMEADLEDRIARQEALLLPARQSYQSSVPFSLITRQAPPLLPKSAED"
     gene            <538242..>538919
                     /locus_tag="LMJF_27_1280"
                     /db_xref="GeneID:12982721"
     mRNA            <538242..>538919
                     /locus_tag="LMJF_27_1280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721889.1"
                     /db_xref="GeneID:12982721"
     CDS             538242..538919
                     /locus_tag="LMJF_27_1280"
                     /note="previous protein_id=AAZ09877.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721937.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982721"
                     /db_xref="GOA:E9ADA8"
                     /db_xref="InterPro:IPR000999"
                     /db_xref="UniProtKB/TrEMBL:E9ADA8"
                     /translation="MRRCFKLQAPPGVLSILSDLAQPRTSTSYQELLRNSHLPAQPLP
                     FLPPPRWAAELSRVLHRTFPDVVQHHHTRFLQVFVHPSFTTAAGVSGTMQPLVAVGES
                     LLERIGGLWILATFESTRREEYASLLALLTSDTALCRVLRDHWRLEHMVLTDASADLF
                     SRQRLSSTKGLVCWLSSHGNVNGAQSLPEPFGAGCVKAMVAAVLLEHGNDAAEHFVKS
                     EVLPYVL"
     gene            <539536..>540726
                     /locus_tag="LMJF_27_1290"
                     /db_xref="GeneID:12982722"
     mRNA            <539536..>540726
                     /locus_tag="LMJF_27_1290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721890.1"
                     /db_xref="GeneID:12982722"
     CDS             539536..540726
                     /locus_tag="LMJF_27_1290"
                     /note="previous protein_id=AAZ09878.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721938.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982722"
                     /db_xref="UniProtKB/TrEMBL:E9ADA9"
                     /translation="MVDSTTGEADPALSSSQPILLAYEEEASRCKPPEELLAERLQAL
                     KRYKYPIPEDPESDVSGAKAYLAVCAELAKATGVKGATSSIAKDLAAESEVLDLSYAG
                     LGAKGCTALAAALCVTSAVQSLILVGNYITPSAALEVVRAINDARNIQSLNLSKNQMG
                     RVEAMRKGAHHLNTFSGGAVVNEALAPGSTLRFLSLSDNHLGDTDIAVFADTLAENIT
                     LQELDLSYNRIGFVGATELAKVLSRNGDLRVLNMEWNPLRAAGAQLLLSEGLLQNNTI
                     KQCNLSSCGLDDKCGQLVARVISENAIEEVIIANNRIGRVGAEAIARTLPSTSALTTL
                     IMDGNPIGDTGSAALLDVALSGSVSTLRVISLQHCSCNDPAILRRGQEASAATLAIRI
                     SESV"
     gene            <541977..>542405
                     /locus_tag="LMJF_27_1295"
                     /db_xref="GeneID:12982723"
     mRNA            <541977..>542405
                     /locus_tag="LMJF_27_1295"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721891.1"
                     /db_xref="GeneID:12982723"
     CDS             541977..542405
                     /locus_tag="LMJF_27_1295"
                     /note="previous protein_id=AAZ09879.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721939.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1295"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1295"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982723"
                     /db_xref="UniProtKB/TrEMBL:E9ADB0"
                     /translation="MTHATLNAVSGFLSTISSRSAQSQRTHRPCLPYVLDAMEHHFSE
                     MDILFGGTVTPSALTVNDEGGKFVPQRGSVQILVNAFHYAHCMETSKERAEEAKTKRC
                     SAARCFQPAPSLDDWRSRPFSAVTLKSGVVTRFSRCAARV"
     gene            <544308..>545897
                     /locus_tag="LMJF_27_1300"
                     /db_xref="GeneID:12982724"
     mRNA            <544308..>545897
                     /locus_tag="LMJF_27_1300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721892.1"
                     /db_xref="GeneID:12982724"
     CDS             544308..545897
                     /locus_tag="LMJF_27_1300"
                     /note="previous protein_id=AAZ09880.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721940.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982724"
                     /db_xref="GOA:E9ADB1"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9ADB1"
                     /translation="MSQQNAVEALLARLQMGDTIPAFQSMGVDRIVSLRKMSEEALSQ
                     AVPDPEQRQALMDAIESRGHLQSRRAGPPAGQPHPPRSADADFARGGNDEGRGGYAPR
                     GDRGGRIARGGRGGGRGAGAPNGDDAARVCRHVFTPEGCKYGDKCRYSHDENDRRRAQ
                     EVPTGSGMAQRSLERPPPNFKFSIEVEIPTERIKYLLGSQGNNMKFINETCGTYNERF
                     DHVDEKEETFTIRILGGSEEAINKAKEMLLLSAGVKREEEKKDRFQYAVNELDANTHA
                     ARLFAACNTKNKDTTRHLSDSIMRNIVSSFHFVRPQEVRHFYMYTSSSDKDKLEMVSK
                     IVSQLKGVQAILFCDQKRVEEMCKGSQRIARHFNGVEPQFVYRQLSKEDRMMALERFK
                     KGVENENGVRQRLLVTNEDYAKLARKTIIPYVNLVINFSVPRAEEYYVLQSQVAGRQG
                     TIGASFLCVSNYEEALFRELEKNIQFERFEDEEHFRTTAVELSYDTTAQPLTPEDADP
                     PADWREHLNDKKPRQNFGKRR"
     gene            <549105..>551183
                     /locus_tag="LMJF_27_1310"
                     /db_xref="GeneID:12982725"
     mRNA            <549105..>551183
                     /locus_tag="LMJF_27_1310"
                     /product="putative arginyl-tRNA synthetase"
                     /transcript_id="XM_003721893.1"
                     /db_xref="GeneID:12982725"
     CDS             549105..551183
                     /locus_tag="LMJF_27_1310"
                     /EC_number="6.1.1.19"
                     /note="previous protein_id=AAZ09881.1"
                     /codon_start=1
                     /product="putative arginyl-tRNA synthetase"
                     /protein_id="XP_003721941.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982725"
                     /db_xref="GOA:E9ADB2"
                     /db_xref="InterPro:IPR001278"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR005148"
                     /db_xref="InterPro:IPR008909"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:E9ADB2"
                     /translation="MCAAAATVNVELALKEIVKATIAKTFPLVPTQEPLITVGKVSEY
                     QCNNAMGLVKVLSQQQQPIKMSPQMVGEELKKNLVDNDIIDEFEPTSKGFINVSIRKE
                     WLARMVKEVLKQGIRPPVVKKQRVLVDFSAPNIAKEMHVGHLRSTIIGESISRLLEFC
                     QHDVARINHIGDWGTAFGMLVLYIKRNFPDYTTNPPDISDLTAFYRAAKKCFDEDQEF
                     KEKARLEVVKLQALEEDSIQAWKYICDVSREEFSKVYTRLGATIEERGESFYNPLIPK
                     VLGLLEEAGQIEVSDGAKLIVSKEERKLCSLDARDMTKLASQHLALVSRDGPSYHPNL
                     IAAMKKAGILTGAEGEESVALSKKEVKPWKKFDIRVDLDKLMAQLAPLYKKQLDPLFL
                     EVFEAAGIVKGDSILVPRFSFPLMVVKSDGGYTYDTTDVTATYHRFVIEKMNRVIYCT
                     DLGQYEHFRMCLQTAKDMGWMEHATWDHAGFGLVTGADGKKIKTRSGETVKLKDLMDE
                     AVERSLAILKEREAGERSQGHSEEVMQKLSNIIGIGAIKYFDLKQTRTGDYAFSYDKM
                     LDMSGNTAVFLLYQYARICSIQRKAGIADEELFKITDISLETPQEKSLALCALRFQTV
                     ILKTVEDLFPHHLADFAYELMTNFSNFFQNCRVLDDPLQNSRLCLVELTRITLKKTLE
                     LLNIETAERI"
     gene            <552535..>554337
                     /locus_tag="LMJF_27_1320"
                     /db_xref="GeneID:12982726"
     mRNA            <552535..>554337
                     /locus_tag="LMJF_27_1320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721894.1"
                     /db_xref="GeneID:12982726"
     CDS             552535..554337
                     /locus_tag="LMJF_27_1320"
                     /note="previous protein_id=AAZ09882.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721942.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982726"
                     /db_xref="InterPro:IPR003347"
                     /db_xref="UniProtKB/TrEMBL:E9ADB3"
                     /translation="MQTWYRPHPYGIYPRGNAVKRSDIFDRLGTLSLFTAATMDGDKE
                     HTEQPYLELVQCFLAFLEVPDLCRLSRSCTGWYVLVHCTDAFKAAYTALSPSYLRFRG
                     SWKETAVRGYVAVHGGTPNAVSAASITNSTPSKKRSKVESKRMRAAAAPAGETPAAFA
                     RHTPVCVCRRFFCDQLFQAWMCTILPPYYHLRPVAEEPEEASPSLSSSAAGTEKSAGQ
                     NSGSKSRKSQQDGAWVAAASTSSTAELVDSVDAPQRRSPRYVSKFRPVERCSRISVAE
                     FHDRFEKPNVPVVITDVATEWPLFTILQGRFANLADKKNSLVRSGCPVTSPLRCEHTS
                     MDLEDYVHYATGQNDERPIYMFDAEFGSVLDAEKLYTTPPYFARDDFFSTLGDCRPKF
                     RWIVAGPQRSGSSFHVDPNYTNAWNANMTGRKRWLLFPPGATPPGVVPSADMAEVATP
                     VSLTEWLLNYYDASLQELQHCGYECICEPGDIMFVPCGWWHFIINLEDSIAITQNYVS
                     RCNLPKVIKFLRAMKGSISGIDEDADTATEESTARRQRGFAKEFEAAMQAAHPALMQD
                     VARQLEEEHQAREKRRLGRLTLLDPSSGGFTFSF"
     gene            <555528..>556829
                     /locus_tag="LMJF_27_1330"
                     /db_xref="GeneID:12982727"
     mRNA            <555528..>556829
                     /locus_tag="LMJF_27_1330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721895.1"
                     /db_xref="GeneID:12982727"
     CDS             555528..556829
                     /locus_tag="LMJF_27_1330"
                     /note="previous protein_id=AAZ09883.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721943.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982727"
                     /db_xref="UniProtKB/TrEMBL:E9ADB4"
                     /translation="MGILTNWYESLAQEKRLELLVTLGMYDERVYEVVERYHLAPDIL
                     QTLPSPLTAHFLARGMCYDAINEEVVRNFVRICMMLSRYRTVEEASTLAELIGSCGLP
                     EQYRMQMFNFSETYRHMILSQSYFPQRAVLRLLSYIFCDDVLSDAVAQLQYKSDILNH
                     VNKVFVTTPDFVSWRFSVRCMSLAGGFNEDRSDVEYTELLTRAVSQALPEFFSYLLVA
                     FCYARFRFYPHRVRGITPRWLVRQRACFSALYCALLGVYCNAILEYRVHEHRVLYELR
                     KSREMRRRRGAERRGLPYENNPYFDNLEGVTRRVYMMQLSAYTFTGLGLAVSMLPLTS
                     VKFPKFMGDVAWRHPFVPRLFPALLGMHAASRCLIPFVVAPFTAVSLAMHGNWGTTLY
                     DRYVELRMRLWHRKVDVAFDTSTEMDEVDITGADTTRKSAS"
     gene            <559603..>560685
                     /locus_tag="LMJF_27_1340"
                     /db_xref="GeneID:12982728"
     mRNA            <559603..>560685
                     /locus_tag="LMJF_27_1340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721896.1"
                     /db_xref="GeneID:12982728"
     CDS             559603..560685
                     /locus_tag="LMJF_27_1340"
                     /note="previous protein_id=AAZ09884.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721944.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982728"
                     /db_xref="UniProtKB/TrEMBL:E9ADB5"
                     /translation="MKTDDHLSQIHRMCRALGIRPGAPAPLIQPALTLQCPRLHTPMV
                     VHEKPAAKIALPMLLSDSSGDVSYLAGQDSVGTLRMTPPGSPRTPALTSVSNMRHHAH
                     LATSELPVSVLVASALSFVAAWRTEDSACTAQKDLIHCCLKARCDLELEEAGGRHRLN
                     QLLLTVSEQMHRFVVMGEYSKFVVFCVDQEPVWRQAARQLQKENEARLHTTENIYSRF
                     LMEEIAVSDKMRMFQEASDFVVSQGHAAREQRRRAQILAARRRCDRQSAPQETPMPFA
                     PQSHLHPHQHKNESNAAALAGGWTPPQRQRPRDDSTDRRSGSSKERSSKNAKSHSTTE
                     VDRYRQRWRKIIWFLSNGERGKPAPH"
     gene            <564123..>565076
                     /locus_tag="LMJF_27_1350"
                     /db_xref="GeneID:12982729"
     mRNA            <564123..>565076
                     /locus_tag="LMJF_27_1350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721897.1"
                     /db_xref="GeneID:12982729"
     CDS             564123..565076
                     /locus_tag="LMJF_27_1350"
                     /note="previous protein_id=AAZ09885.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721945.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982729"
                     /db_xref="UniProtKB/TrEMBL:E9ADB6"
                     /translation="MLNTRVQRPPPPPRRAPPAAAMIKDASSDACISTHVILSLSGAA
                     LISQQLLQVKDQVSDIKMAVTTADDSLKAISTNPAVRPPSPSNGATTGGDDVQSLAFA
                     SVALSKLAEEEETQDAFYAKLSETAVVRAEVQKGSQDVRLQRYKQQVECRLASSMADG
                     LLPPQQRKNSVSPGKRQILLNPYSTARRKLPNTVTKKGNSTLPSADTSMPPTITSPYR
                     TSTSSIAPSPQSPFYSTPAVTNGGYTSYSSHSSGAAGSPSRATARYGATATPQPVTHE
                     AHSDRRPLRQGNAIAGMHFGQPPQQLHQNHQQSSWPHYQAL"
     gene            <566795..>568855
                     /locus_tag="LMJF_27_1360"
                     /db_xref="GeneID:12982730"
     mRNA            <566795..>568855
                     /locus_tag="LMJF_27_1360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721898.1"
                     /db_xref="GeneID:12982730"
     CDS             566795..568855
                     /locus_tag="LMJF_27_1360"
                     /note="previous protein_id=AAZ09886.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721946.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982730"
                     /db_xref="UniProtKB/TrEMBL:E9ADB7"
                     /translation="MFPLPLIGLPPTTLLAKVDVAPQLADIHKEFAPLLRLCGICAAS
                     SGGTAAGPNGTSTGAGVSNGGLFSSEEEDLRGRRSPAASPVRTVESKLAELMAPVMVT
                     LPPPMSNEDAASIAHYVRRFHVQEEYERSYIALIFQEYKKRKSMEQKWERDLALWRSE
                     LKQLQERELPPELRAAASVIVSEEAAARKAVHDAYDKFLKWVEETVPQWIEAAQRQEQ
                     QRVDNENAKKAAMAAAREALAHELAMGKRLSDANGCTSFQNAGAVTGPKEDGVLSYEP
                     AVSVETQVQASREATEELSPTELRRKAIRMLEAKEAEMKRRREEQLRLLRVREEQLRA
                     EIALKEKYKQEEAERRQREAEQKRKDELARRYDALLKEEFTLQSRMREREEMEARQEA
                     ERRAKLAQVAAEEEELRRRIQETEDRRKASEEEAARVARDKKMREVREKEEMLRQRIA
                     ERAAAAEAERLEREAEARIHAEAEAVRAQQEEALRQARMQQEEREKKQQLAYLRDQEE
                     AYKRRIREKELAEIEEKRLAAESQWKHRAATTLALAAHSVSSTSANPIVMPPAAALPA
                     PHVMAPQVPMSSYAPAVPSHAYQPIPAAPAPSAAAPGGCCLYPNPVATVVPTAGMPPP
                     SRPEYGVYPFAQPPCVPVAQQYPQPYPPATVGYYPGVPQGGAIPGVMTLQTSPCSPAA
                     MHTL"
     gene            <571588..>576144
                     /locus_tag="LMJF_27_1370"
                     /db_xref="GeneID:12982731"
     mRNA            <571588..>576144
                     /locus_tag="LMJF_27_1370"
                     /product="putative protein kinase"
                     /transcript_id="XM_003721899.1"
                     /db_xref="GeneID:12982731"
     CDS             571588..576144
                     /locus_tag="LMJF_27_1370"
                     /EC_number="2.7.11.1"
                     /note="previous protein_id=AAZ09887.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_003721947.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982731"
                     /db_xref="GOA:E9ADB8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9ADB8"
                     /translation="MSSSPADAHSSAFPDTTSVAAAFSRDDFFECPRCHRHCKSRTWF
                     LKHLEACSKSASSSSTHGNTVSGEGSGRSPRAAVFTTKVNNHHRHPSRSSVTEDVTPP
                     LLESTTSTTLSSPATSYSHVHSHKPSGLARPTGSHGREVAPSNLIEAGLSVSTGLSHS
                     SAVGVGGCRDGRRESNNTTPTATSQTSPHWPVDDLPIASSASGVGTGAGGSIVAKGVS
                     RPASPSQGSSLYAGSPRGFRAGESCGESGSAHVSTAFGRTSAPAAAAASSSFCTAQRD
                     EVEQHRQPARQDSFRLQSDFTWTQYTPSASEEDGDDEALGEHDGSILDHSSRQLLPSL
                     GRVQGSSNPAAREAGTSFCSTGADRLMDPGSADKTPDRWAYEQQLSGKSSHHRSTPPS
                     AAGDVGCHSATGMLQGASFPLEGEQQMPRRFSASIGEFSPPERNVIGAADGSQSVGSG
                     ANSDRFHRSARDRASPVSPSCMSSASPVLVQAIGSPSLLHINVSPTSATAAGSSMSRL
                     NGMNASSSGGGGRTPRHSDRSGAVTPRTISFQRGRAVGSGGFGTVYQAILSDGSLAAV
                     KKLKLENANLKAIDREVRAMSSIPPHPNCVRYLGSRYSAHHYYIIMEYISGGSINSLR
                     KSVGRFRESVFQRYAYMVLLGLSHLHTNGILHRDIKGANVLLDESGCAKIVDFGCSGN
                     LNQATTTLSGGGTPLWMAPEVCRGEPATEKSDVWAFGCLCLEMANDTGVPWNFPPGMT
                     LQGVVYALACAKSPPAIPADLSPEAQDFLRRCLRIDPGERATVAELLQHPFFDVDLME
                     DSEEDELLSSYGASARQSAVKRAVRQVNRSSALDAAAHQQDRQQYCGEGDEVGGVAKD
                     MQMSPPVQGFAGVSLPPQGMHSSGHGPISDPDADALLRSLNSHSKSASGPQLDHYTRS
                     VNIGFSLQAVDEDDDDDGGDAGKAGDNVGPNHSFLGGSPPAIPETAASTDRCHTTSFK
                     SASVEEDENEYTQMITEIITQAREAYTDEERRLTERRRRLNMMYRSSDEDTSLTASMS
                     SGSDTSNNGGGDGSDGGRFAEEGERSDHVDVESDLSTLSGSDGYVEVSSGSVGGPRHH
                     SLGTTWRDQSARASTATESAEELQNTDREVPQHETACAARVKDPTAPSASALSACRSR
                     FPGSDASSSAALAATSLTSAHVGSWDTSISLYATSPSSSTRGLEAGPPFQRPPHGVAL
                     PPPLVSSYPPQQQQQQQQQQRPCPVSPPTRHREVMRRELPRDARRSRGDTSFGKSPYS
                     GVVAKAAGGVARAPRKPGGPVGVATTIRQPVGSSPPSPHTSASAETPPPLSSSAATQN
                     STVCGVVFTERSSSSRTPPLTVGGPHRQTPPQQLATTTATSSAPSDIVTCPIEWYTAG
                     SGRLDVSSATWRTGASGHLPKELSMAQKELQEMLDWGTSSDRRHALSSSSPDIGRHSS
                     KALPTATNSAVRRGEGHHDYHRLHHLSHNHGDDLDSECTAETESLSHCESRGLSATET
                     VIAAQQPAKRKLWGLGIFRNLRSK"
     gene            <578147..>579118
                     /locus_tag="LMJF_27_1380"
                     /db_xref="GeneID:12982732"
     mRNA            <578147..>579118
                     /locus_tag="LMJF_27_1380"
                     /product="putative 60S acidic ribosomal subunit protein"
                     /transcript_id="XM_003721900.1"
                     /db_xref="GeneID:12982732"
     CDS             578147..579118
                     /locus_tag="LMJF_27_1380"
                     /note="previous protein_id=AAZ09888.1"
                     /codon_start=1
                     /product="putative 60S acidic ribosomal subunit protein"
                     /protein_id="XP_003721948.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1380"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982732"
                     /db_xref="GOA:E9ADB9"
                     /db_xref="InterPro:IPR001790"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="UniProtKB/TrEMBL:E9ADB9"
                     /translation="MPSITTAKREYEERLVDCLTKYSCVLFVGMDNVRSQQVHDVRRA
                     LRGKAEFMMGKKTLQAKIVEKRAQAKDASAEAKHFNDQCEEYNLLSGNTGLIFTNNAV
                     QEITSVLDAHRVKAPARVGAISPCDVIVPAGSTGMEPTQTSFFQALNIATKIAKGMVE
                     IVTEKKVLSVGDKVDNSTATLLQKLNISPFYYQVNVLSVWDRGVLFTREDLMMTEDMV
                     EKMLMDGLSNVAAMALGAGIPTPSTIGPMLVDAFKNLLAVSVATSYEFEEHNGKELRE
                     AAINGLLAGSCSAAAEPAAAAPAAPSAAAKEEPEESDEDDFGMGGLF"
     gene            <580546..>581517
                     /locus_tag="LMJF_27_1390"
                     /db_xref="GeneID:12982733"
     mRNA            <580546..>581517
                     /locus_tag="LMJF_27_1390"
                     /product="putative 60S acidic ribosomal subunit protein"
                     /transcript_id="XM_003721901.1"
                     /db_xref="GeneID:12982733"
     CDS             580546..581517
                     /locus_tag="LMJF_27_1390"
                     /note="previous protein_id=AAZ09889.1"
                     /codon_start=1
                     /product="putative 60S acidic ribosomal subunit protein"
                     /protein_id="XP_003721949.1"
                     /db_xref="GeneID:12982733"
                     /db_xref="GOA:E9ADB9"
                     /db_xref="InterPro:IPR001790"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="UniProtKB/TrEMBL:E9ADB9"
                     /translation="MPSITTAKREYEERLVDCLTKYSCVLFVGMDNVRSQQVHDVRRA
                     LRGKAEFMMGKKTLQAKIVEKRAQAKDASAEAKHFNDQCEEYNLLSGNTGLIFTNNAV
                     QEITSVLDAHRVKAPARVGAISPCDVIVPAGSTGMEPTQTSFFQALNIATKIAKGMVE
                     IVTEKKVLSVGDKVDNSTATLLQKLNISPFYYQVNVLSVWDRGVLFTREDLMMTEDMV
                     EKMLMDGLSNVAAMALGAGIPTPSTIGPMLVDAFKNLLAVSVATSYEFEEHNGKELRE
                     AAINGLLAGSCSAAAEPAAAAPAAPSAAAKEEPEESDEDDFGMGGLF"
     gene            <582851..>583285
                     /locus_tag="LMJF_27_1400"
                     /db_xref="GeneID:12982734"
     mRNA            <582851..>583285
                     /locus_tag="LMJF_27_1400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721902.1"
                     /db_xref="GeneID:12982734"
     CDS             582851..583285
                     /locus_tag="LMJF_27_1400"
                     /note="previous protein_id=AAZ09890.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721950.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982734"
                     /db_xref="UniProtKB/TrEMBL:E9ADC1"
                     /translation="MSRVLTVLLTYDDPECGGAADALVEHLERDAVAVEGHCQLSVKP
                     IQVLQNGSHRDALYGSLQDLFQMKPQDIYVIAFLKGSQPEEYRKVNELCNSVRPNAVK
                     CQVLTHLANYNDVGLIIRNLVRLVLDEVTREEASRGSTEPSK"
     gene            <584601..>585728
                     /locus_tag="LMJF_27_1410"
                     /db_xref="GeneID:12982735"
     mRNA            <584601..>585728
                     /locus_tag="LMJF_27_1410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721903.1"
                     /db_xref="GeneID:12982735"
     CDS             584601..585728
                     /locus_tag="LMJF_27_1410"
                     /note="previous protein_id=AAZ09891.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721951.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982735"
                     /db_xref="UniProtKB/TrEMBL:E9ADC2"
                     /translation="MEEWIKASLKDKYIDKVDASSVQSGVFCEAFTSPWYDGGVVFDW
                     TALHQRLTRPTVALSDVTKAVTALRRFGAEALMAASGEGDKKCFSTVVELREPWTLHP
                     LSEQAQRLSVFDVLSVTASSAPTAAAASKSLAPSSSNSRQLYTFLRGPPGQRTVREDM
                     TRVLSSAAEQLRGSGLCVVSFLSSFILFGSDFTDMLHSTAAVFRALTEAGFCIDSHGS
                     CLGPRVVTPLRVNADDWWTTSPLQQIESEEDVAAFLVALFYQWLQDAYVWCCTAPIRL
                     FPDAKETHATQSTRLLERFVRGLVLPRARAIGLDALYASLPEEGGSLLELAAVGLEKK
                     QAPTGLQRWSVVELRVVLAQLGAYEHIPSAYLGQPQNNTRR"
     gene            587764..589062
                     /locus_tag="LMJF_27_ncRNA1:ncRNA"
                     /db_xref="GeneID:12982736"
     ncRNA           587764..589062
                     /ncRNA_class="snoRNA"
                     /locus_tag="LMJF_27_ncRNA1:ncRNA"
                     /transcript_id="XR_002460807.1"
                     /db_xref="GeneID:12982736"
     gene            <589884..>591812
                     /locus_tag="LMJF_27_1420"
                     /db_xref="GeneID:12982854"
     mRNA            <589884..>591812
                     /locus_tag="LMJF_27_1420"
                     /product="choline kinase"
                     /transcript_id="XM_003721904.1"
                     /db_xref="GeneID:12982854"
     CDS             589884..591812
                     /locus_tag="LMJF_27_1420"
                     /EC_number="2.7.1.32"
                     /note="previous protein_id=AAZ09892.1"
                     /codon_start=1
                     /product="choline kinase"
                     /protein_id="XP_003721952.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982854"
                     /db_xref="GOA:E9ADC3"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9ADC3"
                     /translation="MVQFTDTWITDDPLLRQIQIVEVVLTHCASVLWRYNEAKLKGAP
                     EWAAKLRALLKAKAKRLGGDSSCRSPESCASQRSMTPQKKHKGLTAASADAIVYRENS
                     KEDHPPQTTPTPQLPSSQQSFQVPPSHKRATAGAILPDAIPTTQGGSVFVDVAHSATH
                     TNVNTFSESNTCSSTSLPHYPEAGAGNNRVCHFRAGPSPFVTPGVLFSSCRSTEEHLE
                     ELGAPPTAETTRQSEVAAVRASSSPPIERSNTPELPSAPLQMKRLSGGITNELFHVYD
                     EDDPSASVVVRVFGKETDRVISRESELFYQSLFIPTYVHGSNFLVYDYLDGYYTLPYQ
                     DMAAEAMPIARAIAAFQVRATRAALRDHGHPLLRDSQNKDYWKIVDNQMLAIEGSTTS
                     SHDTCKDESRFERESNYLIGSLTKWVDLVLSQEIIDRVREDQRESFLMMGRSLQSACA
                     WMLSMLERQKAYLPEGVCHNDLLSANVMIHKVRKDVRVIDFDYTKRSFLLYDVANHFN
                     EYPGLDCDYDTYFPSDAHMSTFIAEYRRGMRDALEAAWAENSSPTSSTDCASREHEIF
                     PNARELFWSDREEAEAQVVAHWTRLAKLLTLASHLSWSVWSLLQEAVSALDVDFLNYA
                     QTRYNRYLAVRAECSENL"
     gene            <594118..>596835
                     /locus_tag="LMJF_27_1430"
                     /db_xref="GeneID:12982737"
     mRNA            <594118..>596835
                     /locus_tag="LMJF_27_1430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721905.1"
                     /db_xref="GeneID:12982737"
     CDS             594118..596835
                     /locus_tag="LMJF_27_1430"
                     /note="previous protein_id=AAZ09893.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721953.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982737"
                     /db_xref="UniProtKB/TrEMBL:E9ADC4"
                     /translation="MEVDLSPFFEGAMCALVDSNGAELAISRAFASAANACHEAHQPQ
                     RSRASVVVQLRITSPLPLWTRQAKDVVLRCVDRAVTRIFPPLDVLQYIGADSPVFLAA
                     DAGASGEKAVPHLRVSFAVQPSAALWPSRVLKQHAVEGEVMAGVQLGDSETGATAALQ
                     WMRDTLSDMDLWNRARAAHQLYDASIALDGVQQRSGGMSASETTSIDTAVALPSRQQA
                     YEANHTQLQWQLARWLTELFMNEGSWARLPASPSTGIPGSAQKRPVNAATRHLFQSPF
                     RPSFSNVVDAALSAPPTTAQNTASGSAVPRRLLHTDVRGVECDGLLVGHTSRYAYIAV
                     PYFTAQGEAAATGASSPSCVWSFISRIPIPAILSESTGRDPEGRHGEKGRSPRKRPRT
                     SASHHPDSVASEEEESSCAAAARSVLAHCLNVEEAMRHDTNAEAVFRLADAPFVVTVR
                     AHRVYCARADPARHPRTHPTTPSSDHFSTKPHPAASPYALSLMLEDAYAMQVRPALSD
                     ARAAPTSSAPTTAHWATSLLSGYDPQQRPEDDGEAGHSAAQQTVNATVARAPHTFPDV
                     VSVVRESCRRFQRTHERFCALYARCVQACDPNASPAASATAKEAGVVTGGASSATAQQ
                     VPATAAALVPEAAVTTQTLSPAVASQNLRLLRRAEAVYGALSDSVSVRFGKLRGAARM
                     PVPAVRTAADVAQLEECHNVEFKARVGRVTNGSSAGADSHPQRHPVLMDAERLRNTMA
                     AMAACRGGVILLGVADDGRILGHARQLGVARQLRTSGFCPAMVKDTVQVKELRWLSAS
                     GGLADAGKAVLGESSGNGASAPVKRAMPENWWKNGATPPAPDLPKTSATAEAGASAGD
                     QVITVVSVQKGQAPFYATSKNAPPYQRGCASTTVMPTMVVARRIMKELA"
     gene            <598300..>598947
                     /locus_tag="LMJF_27_1440"
                     /db_xref="GeneID:12982738"
     mRNA            <598300..>598947
                     /locus_tag="LMJF_27_1440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721906.1"
                     /db_xref="GeneID:12982738"
     CDS             598300..598947
                     /locus_tag="LMJF_27_1440"
                     /note="previous protein_id=AAZ09894.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721954.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982738"
                     /db_xref="GOA:E9ADC5"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:E9ADC5"
                     /translation="MGLTDLFRRETPQERIRMYKRQLDRTCRDLDRERNKLSTQERKI
                     MMEMKKMAKQDQVDAVRIMARDLVRTRKYNQKMYRMRTQIQGVSLRMQTMQSSAQMAD
                     AMKGVTKAMRSMNKKMNIPEIQKIMREFEKQNEMMGMKEDMMNDAVDEVMDDDGMEEE
                     ETEQEIQKVMDEAGLEFRTKVGVTDTALPQKSTETQGETDEELDARLAALKASMK"
     gene            <601939..>604500
                     /locus_tag="LMJF_27_1450"
                     /db_xref="GeneID:12982739"
     mRNA            <601939..>604500
                     /locus_tag="LMJF_27_1450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721907.1"
                     /db_xref="GeneID:12982739"
     CDS             601939..604500
                     /locus_tag="LMJF_27_1450"
                     /note="previous protein_id=AAZ09895.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721955.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982739"
                     /db_xref="InterPro:IPR005612"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9ADC6"
                     /translation="MSSSSVLDLHKKWFMVPLPLRTCSLRDVATFTVTKEQMDAYYEE
                     AQSILDGEGKAAQMDRGRWYSSQFMSRGTTSDKIATAAVKLADTDFMFYLDGFTLLFD
                     TARTDTHHYEAALKALAAVWPKLLPPRPLKRFVSQYFATLPTDEVARKTTLVYWYLED
                     YLKRTYAQFLALSESMLKDRIVQRRDTWLDVVGKLLCSVAEGRSAAMAMMIDKLGDPV
                     SSVAHKAYHHLLKLLSESSTHQSMLFTELEKIIFMKNCPLRTMRYAANVMNQLVFSKE
                     ERKLALKCVQTYLSLFRQLALTGNVDSTVTTAIIVGLRRAFPYAGVDLAPLEEHLNAL
                     FILANTGNFQQRVATLTLLQLLAFNKGTAESFLNRWYRTLYGLLLLSPKQIPQSAQLT
                     NFFSLLHKAMRADKSKARVAAFVHRLLQRAVFFNDAMICAVLLLVGEMSQAHPHVRNM
                     LKAHANLPAAPAALAQKGKAGNSTGTASAASAGCNYDPKAREPLFANAAGECIWTLNM
                     LSRHSHPSVVKLSILLLFGEDIVFDVHPLDDMTPLNFLNMFVDARSNAKDDDDAKASN
                     TTTGISVFHRTAHKASLPSTSDPYFINASAQDVDVAALFLHRYAVQRQRFLEGLSQVR
                     STWGDTSGEADVAMRVTNLDAALFGPSGTLADPVGTASAAAASCGTKKAAAAPKRAAA
                     KGKDEEVSGEGERDGQGSTDGLAGDGDDASDDGLDDFDAEASDNGLEWGLDDEAAYDA
                     EFDDEEVEEEEDREDNEDALGGSVAASAAMADEGGEFGELIEANAKEMSKKRKRELDW
                     LEGRSAGGSGSSSGFGRGRGGAGRTGGASPYGRGRLRGRVSSRGQRGDGFKRGRY"
     gene            <606171..>607175
                     /locus_tag="LMJF_27_1460"
                     /db_xref="GeneID:12982740"
     mRNA            <606171..>607175
                     /locus_tag="LMJF_27_1460"
                     /product="putative proteasome regulatory non-ATP-ase
                     subunit 3"
                     /transcript_id="XM_003721908.1"
                     /db_xref="GeneID:12982740"
     CDS             606171..607175
                     /locus_tag="LMJF_27_1460"
                     /note="previous protein_id=AAZ09896.1"
                     /codon_start=1
                     /product="putative proteasome regulatory non-ATP-ase
                     subunit 3"
                     /protein_id="XP_003721956.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982740"
                     /db_xref="GOA:E9ADC7"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR013143"
                     /db_xref="InterPro:IPR013586"
                     /db_xref="UniProtKB/TrEMBL:E9ADC7"
                     /translation="MPLAAAKTPINATAATKRAEAEQLTRLMTLYRAVCVRHDELGME
                     IVLNDILAFLTSTHQHEQAEAFIATCNITLPHRANNQAARYFYYVGLTRALRLEYVDA
                     HQCLQQALRKAPERAFGFRIAATKLSLVVQLLLGEIPPRSDFLAKDMRDSLAPYLQLA
                     SCVRFGQVDRFMTVLREHQVTFEHDRTHSLILRVHQHVIKTGLRRICQAYSRISISDV
                     CSKLAMSNVADAEYILSKAIHDGVIDAVLDNEKGELISSDSIDVYSTSEPLYALQRRI
                     QFLNLTHNDAKRAMRYDVTDPEIIEERRKEAKAERDELERAIQDESTGMDNVNFEDGL
                     "
     gene            608566..612606
                     /gene="LmjF27.1470"
                     /locus_tag="LMJF_27_1480"
                     /pseudo
                     /db_xref="GeneID:12982741"
     misc_feature    608566..612606
                     /gene="LmjF27.1470"
                     /locus_tag="LMJF_27_1480"
                     /note="previous protein_id=AAZ09898.1"
                     /pseudo
                     /db_xref="GeneID:12982741"
     gene            <615101..>617203
                     /locus_tag="LMJF_27_1490"
                     /db_xref="GeneID:12983022"
     mRNA            <615101..>617203
                     /locus_tag="LMJF_27_1490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721909.1"
                     /db_xref="GeneID:12983022"
     CDS             615101..617203
                     /locus_tag="LMJF_27_1490"
                     /note="previous protein_id=AAZ09899.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721957.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12983022"
                     /db_xref="UniProtKB/TrEMBL:E9ADC8"
                     /translation="MSDVNWTLEENGAHIAEVSHEAVHVASIASNLLKLREDQLWITG
                     DAPQHVTVSLSPSHPPLQYAGWHVWHDYLTNPHLVEIASGASPDTMRALLVCQALPGA
                     GTQVWKLPHAIPQDHQYVRFRIMSTFGPGPTYMNNIVLLENDPGPNYNAYGQLVEDSA
                     TTADDVLHGESAARHPSAATALPYTSPPTSVLRPPGSGGGVDRSPLPRRVPPTSVLPG
                     ASPISTANPRDDRSADVGVLIALGPSASAHHGERANGGAGGRSPGGARSSSRMSQLLR
                     DLDDDIKMLKPIKIVSPRKKTLLCVPQDSHAKSAESGSEDDDFEARQGGGNRERSANG
                     KVHHSGENESSEHRRHHRHHRRSSSRRRNFSGREERSGNSSSAQLEGSHAPQSVPMGA
                     KQMALAVWPPPAVPPSPVELSSLHGERFSALEQAVAVLHATVQHQRDDLSMIKRVLLQ
                     QATERRKEAEQRYEEKQKMGTVAVALPAALAAPPAAPSPTVATDVKAPVLQIAAPDQR
                     LTHRSITVGFPEDALRAYVESVLDHKLRKQMKKVEATLLQRLDKQLHDVIKVLSVTIE
                     GRLAGLAPPSATAQQQAAPSHRPFYAGRATPTQAGGLPTASSSAVREIPRSSAMGGGT
                     GIDPSDAASSPSSSKGYYYHTPLTRAGSSARGLAGGSTAAATAAFPVSYLAMRNSPNA
                     YRATTGAPPVSITKGRFF"
     gene            <618974..>619447
                     /locus_tag="LMJF_27_1500"
                     /db_xref="GeneID:12982742"
     mRNA            <618974..>619447
                     /locus_tag="LMJF_27_1500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721910.1"
                     /db_xref="GeneID:12982742"
     CDS             618974..619447
                     /locus_tag="LMJF_27_1500"
                     /note="previous protein_id=AAZ09900.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721958.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982742"
                     /db_xref="UniProtKB/TrEMBL:E9ADC9"
                     /translation="MQARRNSMIRRVARRYARVPGEHGDASVPAFFPIAINPGWWGQP
                     FGKVKDGTSQLLFFFGVIFPVAFYWLFDVTFGQRTRIAQVGKRAMASNFLFRQLDLDD
                     PDHAIKYEQLQQEMAENKLDVRWGGTNFLASYLWQPGDPEPDIRRKEAPAHHHHH"
     gene            <620695..>622254
                     /locus_tag="LMJF_27_1510"
                     /db_xref="GeneID:12982743"
     mRNA            <620695..>622254
                     /locus_tag="LMJF_27_1510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721911.1"
                     /db_xref="GeneID:12982743"
     CDS             620695..622254
                     /locus_tag="LMJF_27_1510"
                     /note="previous protein_id=AAZ09901.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721959.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982743"
                     /db_xref="UniProtKB/TrEMBL:E9ADD0"
                     /translation="MRAVLSRIARPATQTRPIFSIDPPLHVLFPSSTTALRQANSVSL
                     NVALAMLVECIDSMPVRVALVYWSMSFVVLLLRLFCAEFAGLSSYGGRSAGAAAIPGV
                     CKAERDRVGKYSAAVAATTLTRWCATPVHWLASSFLGRWRTTRKQSFTAFYVTGLVTS
                     AALFGIRWIAHRSNAASSHPSLVALSSPAPAHPLLCVPQVLFTLHCAVRLTETCLVQR
                     FREHDTVTLFAAVAGSTFYVMAAISSAAPSHTSVPRASQWLHRLPVMRCVFGAGTTAH
                     LSLQAIQVTVHTILTRLRQSPSHTVSSTKETQMRGWEEGLWRRVQAHLATSSVDQGES
                     PNGLSTPPELYGAWRRYRYPYSSNVCFQVVLDPHYTCEVAMYAVNTILLLLCVLPDAT
                     EPATDIAAGAARGMGSRFTSGEPQWCRIACASVPWFSALASVGVTVFTAANLGITSAE
                     HRRFWMAANATRRLVGSALRTILDEEQAKPLSNGGGRLPAEIVGAAEYMLREAVVEEV
                     VPRWNVFPFVW"
     gene            <622918..>625152
                     /locus_tag="LMJF_27_1520"
                     /db_xref="GeneID:12982744"
     mRNA            <622918..>625152
                     /locus_tag="LMJF_27_1520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721912.1"
                     /db_xref="GeneID:12982744"
     CDS             622918..625152
                     /locus_tag="LMJF_27_1520"
                     /note="previous protein_id=AAZ09902.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721960.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982744"
                     /db_xref="UniProtKB/TrEMBL:E9ADD1"
                     /translation="MPSVGSGYTFADFLQRLERSPASQMPLLYHEHRLLFVNRPDMLS
                     RAVLSVSWERGLTILQAAYYTQPVAAETYRALLARMLRHNRHVSKTGAGQLVSWQAAI
                     KVMSEAVLAHGTSLPTRVSVSTLRLLAPHRQWRTAIDVLKLNQANGQLTKPMLVDAAH
                     ACATSAAWPHALQLLMHLHQQDPPLLFDAIQSMRPPGTTTLTAAASAHALLPSVRDGG
                     APTPAQQHILSVLNSVVGSVPHEVAARSPLCTSYLTHLLASTTLAPELKVQRATAAMA
                     QLPWTAALALLSDLSEPALLTDAEWTRVRDTVVLPSNSDVGKGDGGSGVGEERQRRRP
                     LSAKRRPKRERDASSVVTLPDAVEPEKDEEAAEGAVPSSFTSLNASISPSAPSVTSAA
                     ASHPHQDTAVLSTAVLFSRMQLLRASPLTAAAMIAVIVEKLPTPEMAAAFLQSCAAHL
                     AQPVPAPSSAPDALDTALHGGGPTVGSVAAARHPVVVHALLRNCARHENGWAIAAPAL
                     LGHSAAQATTPPELLSSLVRQLRQAKQVALAVRLLHEHIIPSGSLLTPTSWEDMLECT
                     LAHNRAIRLRHLQRKRGNSRDGSVAAKAAPRLSSVHWVSALSWVKNRQTTSSEDRICK
                     TGTGPSQGATQRHPLEVVALERPLSHKTLSLLINVCVLGGSPQGALHVLGYARRVNKT
                     ELPCTSQIRALLYCMQYDRPCEAEAIVEQCAKREGEAAAQPLRHLLRLIGEGKSNDDE
                     GDEG"
     gene            <626894..>627220
                     /locus_tag="LMJF_27_1530"
                     /db_xref="GeneID:12982745"
     mRNA            <626894..>627220
                     /locus_tag="LMJF_27_1530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721913.1"
                     /db_xref="GeneID:12982745"
     CDS             626894..627220
                     /locus_tag="LMJF_27_1530"
                     /note="previous protein_id=AAZ09903.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721961.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982745"
                     /db_xref="InterPro:IPR007512"
                     /db_xref="UniProtKB/TrEMBL:E9ADD2"
                     /translation="MSATPKQPSTATTSISSDEKWDHSLETLIRKSTIGFASGILPGL
                     LLARSPAARSAIIALCTGVGSGIAYGEARYLFDHDIMFDKRHLIQVQVVGGSSSQQSG
                     AQKSME"
     gene            <628746..>629264
                     /locus_tag="LMJF_27_1540"
                     /db_xref="GeneID:12982746"
     mRNA            <628746..>629264
                     /locus_tag="LMJF_27_1540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721914.1"
                     /db_xref="GeneID:12982746"
     CDS             628746..629264
                     /locus_tag="LMJF_27_1540"
                     /note="previous protein_id=AAZ09904.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721962.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982746"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR027365"
                     /db_xref="UniProtKB/TrEMBL:E9ADD3"
                     /translation="MPLIEAHLPALRPYIRYPVVAATGSFDVGRLQQYATVCPATYVI
                     ETITEALAELTRRMKWSFDLCGNFRDAADFAARGISFVALERATGNIAAGASSFCICD
                     GGVEVGVETAESHQRRGLALACSARLILERLKHGLYPNWDAHVPHSAHLAEKLGYTRG
                     TPYKAYVDELQT"
     gene            <630289..>630693
                     /locus_tag="LMJF_27_1550"
                     /db_xref="GeneID:12982747"
     mRNA            <630289..>630693
                     /locus_tag="LMJF_27_1550"
                     /product="DNA-directed RNA polymerase II-like protein"
                     /transcript_id="XM_003721915.1"
                     /db_xref="GeneID:12982747"
     CDS             630289..630693
                     /locus_tag="LMJF_27_1550"
                     /EC_number="2.7.7.6"
                     /note="previous protein_id=AAZ09905.1"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase II-like protein"
                     /protein_id="XP_003721963.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982747"
                     /db_xref="GOA:E9ADD4"
                     /db_xref="InterPro:IPR008193"
                     /db_xref="InterPro:IPR009025"
                     /db_xref="UniProtKB/TrEMBL:E9ADD4"
                     /translation="MAVPHGMLISRNDITPDSLVDVPGDRKIVEQISNTMANSSLFKM
                     EKEDHTLANLLRMKLHESPFVQIAGYRVPHPTKHNVELRVQTASNGTDAPVPAPKKAL
                     QDAVDGCLKDLEVFEEQLRREAQLKGLEASPS"
     gene            <633514..>638184
                     /locus_tag="LMJF_27_1560"
                     /db_xref="GeneID:12982748"
     mRNA            <633514..>638184
                     /locus_tag="LMJF_27_1560"
                     /product="putative diacylglycerol acyltransferase"
                     /transcript_id="XM_003721916.1"
                     /db_xref="GeneID:12982748"
     CDS             633514..638184
                     /locus_tag="LMJF_27_1560"
                     /EC_number="2.3.1.20"
                     /note="previous protein_id=AAZ09906.1"
                     /codon_start=1
                     /product="putative diacylglycerol acyltransferase"
                     /protein_id="XP_003721964.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982748"
                     /db_xref="GOA:E9ADD5"
                     /db_xref="InterPro:IPR007130"
                     /db_xref="UniProtKB/TrEMBL:E9ADD5"
                     /translation="MLESQAQLSRSHGPVSISRPHSDVGLDGERAAPFEVPHFSTVSL
                     LTVWMLDCAVGLFSLVLSDVYVNQYPEFPLMFFLALGSHLNLLAGFFVYLLGREKYGH
                     KVYRLYQPFAGGVQFVTLQCFGVTCVSSSLLLTAAYGLLFEPSVNHSHGFMSTIGVLA
                     LFGNILLLLSLRSFTFHDCAKASEPGSNTASSGTGSAFLADKGLSAFLRYLRRRPNAE
                     SALEVALLTTQSAFSMVAIRFPGLQESIFLVNLAITLACGTLSLFFVGYRRSLGFISF
                     RLRMHRTFDTVLLWLSRFLYVAAVFASVLLLFNAGVHTVTPLSVLAVQGLSVVSCVAL
                     LMFLRTMRYEALANTPNVPSSVFELGGVVAVVTALLLACLNVSIFFYVQNYPDGLDEA
                     MEGTSWTCQGVLVLVSQLAQLVSLLLTPMVYVSGVIMHDDHFRMLARNRSVETLPVLL
                     LQALSYLLYVAAIISFMLFLSSSAPAIASLEAVLSTLSVFCMTCAVRLCSSLTFKGRA
                     FLAALVEEPTSEQTTAGKKPATKAAVNLDSVLLVHTEPSPGPRSRMAEELANTAYIMN
                     GEMIFSYLLCLTNLLLRLLVDISLHHVWGEVELPHARLIMMADACFIACVPLVHYSGR
                     DKGVRGFHPFTGSGSFVALQVLGWMIYAICVIVIIVGTIVASNSKSIPAEWHALIAEG
                     PVMHTLFGVLELIPVVFITLSIAIEARYTMAAALQQRLAKESFLELRRFMREELADKS
                     DEEKAVAQVAFRTLMTAALHSFDIPCTDSLLRICKDPAAERRTGRGSRAQRSYSTGSD
                     EEDSSTEGNKSRESSDGSWSGEDLTIRRRRHEGARVLVFLLCCASAAFFVIAAFMAKV
                     MILSLAFAVTAMLICTISCVGVHAGYGMVLHGEPSVFVPFMPFRGGSQFVIRQMAGWC
                     CYAGAFLVTLITSIESAEVSATAMLIAALLSVTSQVFIFSSVPLFSHRRGEPTFLEVN
                     GEGIVALFTFSGAMAFGRVYTPLVAFFGCDTQHYLHYGDESSASRRTRVPFVLAVMSL
                     SLAVPCTLIALSRTKLQWERVMRTGTAAEAISKESPSSTRRAHHRTNLAKGISNLIEV
                     LAILFATFTPLSIVFLIFYFFTQYTPRLVQVMEAYLPVCFAVTALTLVLSVVPYVVDV
                     GVPMFVVTVRVTAVTWMLYCMPMLTSGLLLLPALIAPRHSTLFLACGALALLLAGNFK
                     KVRLALKLAVYAVIGYLTYQRCMLHVVGGPSWGMARALGVHVVDCAVLGALLWYLPLY
                     SGKPYHTGSQRSLRFTEFARNYLFADAVKYFNFRVIVDDPAVQMRDDTSQYLFSFHPH
                     GVFPGTALFASLTAEWALKVGVNAQRYVSTHVASVVLNVPLLRDFNLRLGALSVSRRS
                     VEASLARGNSVLIVTGGQAEMLRAQVSSERMILITQHTGFIRLAIASRVPLVPLLCFA
                     ENNVLGMLQFPRIQRLSLKLLGFPFPVIPFGRFGLPLPFRTPLTLVVGPPLAIPEGAD
                     ENNPDDMRRVSEAYFQSLKDLFYRRRAEAGYPGMELVLLDDEEARKRKQACEAAASTA
                     KRAA"
     gene            <639392..>640699
                     /locus_tag="LMJF_27_1570"
                     /db_xref="GeneID:12982749"
     mRNA            <639392..>640699
                     /locus_tag="LMJF_27_1570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721917.1"
                     /db_xref="GeneID:12982749"
     CDS             639392..640699
                     /locus_tag="LMJF_27_1570"
                     /note="previous protein_id=AAZ09907.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721965.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982749"
                     /db_xref="UniProtKB/TrEMBL:E9ADD6"
                     /translation="MLRRVPLRLARRKHGQTAWSPNNTSSGAAPTNGITAQEALQIAY
                     RPMPPANTVEYEEDFGPNMMIHREFVSSRHRTRMASDISALAYSDVELARARQQLAGV
                     MNRERRGALVGSGGEAGDRVLFNSDVDETTREVKSARFLFNEQRMRFCDRFQTFFRER
                     IERWAAGDAGAGEDDHPYFSLMEACAVLHGCDTVDAREVYYRRFLGLDLDTLEAEEAA
                     LRARAADAAEVGARLTRGEAGAGGGALVAAAAGGAGGAGSATDVVQDIIDALPPLFPQ
                     PAAAEVGEASEAVADAPPARARAAGAGELPPATAAAPAHLAEDAAPLYKAYLAHARGE
                     SPVGSYDVTTLGAHAAHAERRRWRSLMDKIAAEDYHELTAAELEDAHVLNGQLHTVKF
                     FDLKVGDTVREIVQLLERETGSSASGDRDVPVEMSPTHPERRV"
     gene            <641450..>642892
                     /gene="AAT24"
                     /locus_tag="LMJF_27_1580"
                     /db_xref="GeneID:12982750"
     mRNA            <641450..>642892
                     /gene="AAT24"
                     /locus_tag="LMJF_27_1580"
                     /product="putative amino acid transporter"
                     /transcript_id="XM_003721918.1"
                     /db_xref="GeneID:12982750"
     CDS             641450..642892
                     /gene="AAT24"
                     /locus_tag="LMJF_27_1580"
                     /note="previous protein_id=AAZ09908.1"
                     /codon_start=1
                     /product="putative amino acid transporter"
                     /protein_id="XP_003721966.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982750"
                     /db_xref="GOA:E9ADD7"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:E9ADD7"
                     /translation="MQSTHSPDTPMDRVSEGGASFSDDAVMVNKVGEAQVKDMVDRPI
                     TPGTDKLVDATRCRPCNRLTTLLNKAVPHGGTLSNAYSLGAVTLGSGVIALPSTFQAT
                     GVVMSVIVLIAITMSTVYSVYIMMQAADKTGRRLYSYEALARGLLGRGWDYLAAFHLW
                     MFCFGSCVSYVISTGDLLSRATDDPSVNSFVRSAWGNRVLVFVIWSCVMLPLSIPKEI
                     NSLRYFSVVGVSCMMNFVATIVIHSAMNGFESGQPIHQPRMFKTGNNAIVGLSSILFA
                     FLAQTNVFEVARETPNPTPGRIAKDLAISQVVCCALYVLAGMFGYLEFGEQITDSILL
                     HYNVRSDVLVAIAYVGIGVKMCVGFAICMQPSRDAVYYCLSWHFPMFKDIRTVPFWLN
                     AVICTGLSVFALVLGLFIPNVNVVFGLVGSFCGGFLGFIYPALYIMYAGNWGLQQVGW
                     LHYVSTYLLLIAGVVAVVFGTVASIYGEIH"
     gene            <647326..>648318
                     /locus_tag="LMJF_27_1590"
                     /db_xref="GeneID:12982954"
     mRNA            <647326..>648318
                     /locus_tag="LMJF_27_1590"
                     /product="putative diacylglycerol acyltransferase"
                     /transcript_id="XM_003721919.1"
                     /db_xref="GeneID:12982954"
     CDS             647326..648318
                     /locus_tag="LMJF_27_1590"
                     /EC_number="2.3.1.20"
                     /note="previous protein_id=AAZ09909.1"
                     /codon_start=1
                     /product="putative diacylglycerol acyltransferase"
                     /protein_id="XP_003721967.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982954"
                     /db_xref="GOA:E9ADD8"
                     /db_xref="InterPro:IPR007130"
                     /db_xref="UniProtKB/TrEMBL:E9ADD8"
                     /translation="MLHVVGGPSWGMARALGVHVVDCAVLGALLWYLPLYSGKPYHTG
                     SQRSLRFTEFARNYLFADAVKYFNFRVIVDDPAVQMRDDTSQYLFSFHPHGVFPGTAL
                     FASLTAEWALKVGVNAQRYVSTHVASVVLNVPLLRDFNLRLGALSVSRRSVEASLARG
                     NSVLIVTGGQAEMLRAQVSSERMILITQHTGFIRLAIASRVPLVPLLCFAENNVLGML
                     QFPRIQRLSLKLLGFPFPVIPFGRFGLPLPFRTPLTLVVGPPLAIPEGADENNPDDMR
                     RVSEAYFQSLKDLFYRRRAEAGYPGMELVLLDDEEARKRKQACEAAASTAKRAA"
     gene            <653655..>654446
                     /locus_tag="LMJF_27_1600"
                     /db_xref="GeneID:12982751"
     mRNA            <653655..>654446
                     /locus_tag="LMJF_27_1600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721920.1"
                     /db_xref="GeneID:12982751"
     CDS             653655..654446
                     /locus_tag="LMJF_27_1600"
                     /note="previous protein_id=AAZ09910.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721968.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982751"
                     /db_xref="UniProtKB/TrEMBL:E9ADD9"
                     /translation="MRVASFCLPLHLLSFGAQARGCFRHSTGGSSSVFCAARPFRLSH
                     TMAASACSSAVHLDNFRLLAAGHDATHAAPSSAPLTAPISFSLTFHFQRYDGADFESF
                     ISSLGVSVDFVADVASEQTTLTLLPLTPVSGPWARRDTAAANGAFLMAASASDSSTSS
                     SDYAAGAPLDGAAGAAPGMMYQLRVYLSDFRALEKVQLKHLLQVSMMHVRLAHLGTSD
                     GVGNSDSSDPRTEERSVAAWNVIWRVRRNPQNEQELIRTVLDPLA"
     gene            <656671..>656847
                     /locus_tag="LMJF_27_1605"
                     /db_xref="GeneID:12982752"
     mRNA            <656671..>656847
                     /locus_tag="LMJF_27_1605"
                     /product="ghistone H1 like"
                     /transcript_id="XM_003721921.1"
                     /db_xref="GeneID:12982752"
     CDS             656671..656847
                     /locus_tag="LMJF_27_1605"
                     /codon_start=1
                     /product="ghistone H1 like"
                     /protein_id="XP_003721969.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1605"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1605"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982752"
                     /db_xref="UniProtKB/TrEMBL:E9ADE0"
                     /translation="MATSPHAAVKKAGSKKAGSKKAAPKASAPKKAKKAAPKKAKSTG
                     SKKKSGATKAAAKK"
     gene            <663153..>663797
                     /gene="EIF4E1"
                     /locus_tag="LMJF_27_1620"
                     /db_xref="GeneID:12982753"
     mRNA            <663153..>663797
                     /gene="EIF4E1"
                     /locus_tag="LMJF_27_1620"
                     /product="putative eukaryotic translation initiation
                     factor eIF-4E"
                     /transcript_id="XM_003721922.1"
                     /db_xref="GeneID:12982753"
     CDS             663153..663797
                     /gene="EIF4E1"
                     /locus_tag="LMJF_27_1620"
                     /note="previous protein_id=AAZ09911.1"
                     /codon_start=1
                     /product="putative eukaryotic translation initiation
                     factor eIF-4E"
                     /protein_id="XP_003721970.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982753"
                     /db_xref="GOA:E9ADE1"
                     /db_xref="InterPro:IPR001040"
                     /db_xref="InterPro:IPR023398"
                     /db_xref="UniProtKB/TrEMBL:E9ADE1"
                     /translation="MSAPSSVPPHKMANLHKLQRAWTLWYDSPSTYNTENWEMSLVPI
                     MTVHSVEEFFVMLRYMKPLHALRTSSQYHFFQEGVKPMWEDPANKKGGKLWVNLDITS
                     ANGRSSNNNTSGTSAADGSAAEAKTDLDKAWENVLMATVGEYLDCVDKKDTPTEPFVT
                     GIVMSKRKYHNRLAVWVSDASATDKIEALKKALTKEASLAPIASMVFTKHGEAS"
     gene            <668585..>671110
                     /locus_tag="LMJF_27_1630"
                     /db_xref="GeneID:12982959"
     mRNA            <668585..>671110
                     /locus_tag="LMJF_27_1630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721923.1"
                     /db_xref="GeneID:12982959"
     CDS             668585..671110
                     /locus_tag="LMJF_27_1630"
                     /note="previous protein_id=AAZ09912.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721971.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982959"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:E9ADE2"
                     /translation="MSATAVPKVLAPHPAKLASDVFVATAATAATTAASAASGSAAAA
                     PAAPIELVTKELLQLAEELRVVVPQGTWMSQGSEKEIRKRSDKDAVGAPAIPSRLPIT
                     VHFEVARHAILRHRTSAHKNYVTKEASEDSRDLRSVDNPLYEVMHDEVDTGVQAVPRR
                     TVASTQTHHARRVNAVAQAEPTVVDACIRHLPPPKEEQPNLCAFMEKVLPRTLLCLTQ
                     NYQIPIYTDDFRNFTEDDAVIATHDELVLIEKANYVHSSTKGRKVSGVSWRSGRKRDH
                     FVCVASIGLQTLPERLQANRRCESSVSLVWDLSDPMHPRYLLEAPEEVQVLHFHPSEP
                     NLVAGGSLNGQVFLWDLSKADVASFFSSARQHKQKQKSNTAAAAAVDGGGGETGEFRE
                     VGEVPRMPDSLKGVSLEADGDVQVPCLQPFQQSRVELSHQGPVHDLQWLPDSLEFGFD
                     GKQTVVKETHQFVTISEDGTMLVWDTRPQYLPQDKLRKIKHQSRSGGGEQPWVPLLRY
                     QLTKPDGTGEMPGFRFFLSGCTVDEAPSYAAAVASADGELGFCSMITQHERRSSIVVP
                     TFGYTKDTRFVRSVVPVAHAGPVYSVQQHPTIGDVYLTCGDGCFKVWRYGLLMPLYEC
                     PQRLGSVMCAAWSPARPGLIIIGTGNGMVEVWDLLDRNPEPMLTHHLVQDAITSIAFQ
                     PLPHRVTRRYSQQLLLGTNLGSFHWYVLPPALSRASSGERKYMRAMLERETRRVAYYD
                     WRWSERQSEIDRFGLQGAAARLRGTIAQTASSSGVAGVSGKEKSEPDDPLLVERRPDK
                     EAADSRDLDNPYAQDPQRDEEFLEMVEKLHQKELEHMELESAA"
     gene            <672831..>675575
                     /locus_tag="LMJF_27_1640"
                     /db_xref="GeneID:12982754"
     mRNA            <672831..>675575
                     /locus_tag="LMJF_27_1640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721924.1"
                     /db_xref="GeneID:12982754"
     CDS             672831..675575
                     /locus_tag="LMJF_27_1640"
                     /note="previous protein_id=AAZ09913.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721972.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982754"
                     /db_xref="InterPro:IPR004328"
                     /db_xref="InterPro:IPR025304"
                     /db_xref="UniProtKB/TrEMBL:E9ADE3"
                     /translation="MSGSEALNHTPDRFIFVPFRLGEKDVPDWSLCSRYIATYHSSNN
                     TTSVDDAIKSMAAYHNTIVKTCTLHESKRTPNESFIKHTLLRYCRLVGQAQAHLPLHS
                     GHVSKNLKFVWCDSFDESTKYESTNSNSELVSCVYNLAASYVYVAVTQAHTGSMDDVK
                     EAYKHFQNAAGYYEMVTSMLDRLPPDQLTKGDMKRHSLAMLTRLCLAQAHHCAYLKAE
                     ETMKGKHDVLSKMAAEAAKQYEDVLSSFKTSVWLTKKAANAKEVEAHLDANVCIFKAR
                     AHLHLGVKNEEGEMGVAIAHYRKAKAHLLKLPRMTTQSLTVWVNSIVTSANTAEDKAE
                     KANTSVYFARIPKEVPEPEGLPRSLGTATEHPSFVRFVSTRGEDPFFGIVPAHIAKTV
                     STWREKQRNLVNVCTAAAAHARKSTQTKLQTLGVVAAIQAMSGEFEGRGRVPEPLRSS
                     ILKLREENKSPSGATYSVTDILMSNVNTCSEMYQVADSKLKEVSAELEKDKMTDRRYV
                     EAYGEKMWRAVYPASDQTPDYCTISAAISEHEKGLQQWLVTPFNEAKKTLEENMRNIA
                     RLDWPIADLDALMPFVETKEARQQSGKVMELVAKLKELVEAKMRIESEQAAEEKVLHD
                     KLESDDVVFGISSVESTQRSAILEKASKDISDVIEKVNEKVRQERELVPKVEELMEQI
                     GTLQSTDPISAEVQKVSNGLENACSIYQELMKDFASMVQYGSKAVDEIEATLRNAKSY
                     TMSRELQAQEVQSRLDEQIAAKMSQMQDAESQIAESRRRQEILQQQIASLEQQVAQQP
                     AYQYPPSPLLQQPPQPPQQSHQPLYQPPPQQHEYHHMAPAPSAAYQYPPPAMQLPPLQ
                     QEPPLPPSYDQVSTMASVPVVQPPPPPPQQTNAYQYPPPSLQQPVNSGCPSYKPPFTL
                     "
     gene            <678155..>682027
                     /locus_tag="LMJF_27_1650"
                     /db_xref="GeneID:12982755"
     mRNA            <678155..>682027
                     /locus_tag="LMJF_27_1650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721925.1"
                     /db_xref="GeneID:12982755"
     CDS             678155..682027
                     /locus_tag="LMJF_27_1650"
                     /note="previous protein_id=AAZ09914.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721973.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982755"
                     /db_xref="UniProtKB/TrEMBL:E9ADE4"
                     /translation="MSATDPYSLSPQNGVVEATLFQLLFPAHVSPATRAAVGNVIAVK
                     TLNDNSPEGIAGALVVSSPSAFERIRAWETMPHGRAARSFRGTKRTQFDNRDDPALLH
                     TVHAQQRHGVSAAKGPRARHSAPVGPDRSTDASADFSTVPFSLRLREVERRFREQMKV
                     HRGLTAASRQVDIVERSVQLFQAERRTRAFAQALAERQDAIWARVWPGGSLPKTEDTE
                     ATAHRQAAASARVAPMPASRRSDSSATPSASTAISPPPPASPTGFLLKDILDTYSKPR
                     ELREASGGSRSAAAAAPAASKATKMPKGVPLAPAREAQRTVAGVEIFRPEKTPKHYTV
                     IRYVEARSKHAAATHNAVDRQGTSPSSAVAPATAAAVSAASSKDAARGEVKEDSTQAF
                     SSVVSEVHQADEEGGGKASDQSSASVADEAASMNDTYDTDTFDSHVSSGTAVDASISK
                     AKSSVVSSMIPTVEATSSSLTQSITSEEVESGAAGRPLRCNRRDGGKRSGASVADDEG
                     ATPFAETLQAFLDACRSVSAASARLLQSPYIRESSHDAGQGRQHTPNPAKIDAPRSAP
                     KAVGDAASCVTAKAATGADVSPAAWRDALLRQLRNIRRLQRFREHLLRHLKRIDLQRQ
                     THCNATRLLRETQALAKVRRKLLSSSRVGGEASLGSMLRHVKGVSTGTGGRRGPRRGG
                     GRHGYGAPRQQHSLPSWLRTSVVSDADTISDVVLTDMNSSVGEDIISADSGVVEEEMR
                     HGSDQSETFVSDSIVQEEVVSWDGASRHSEVASGGTVLTEVSRSQGGDGDPSYGSDSF
                     EAASNSDAAGRSAWTARSGMVAEVRLDEIEEELANRLAEISSDAISEGSSIPSEVEEL
                     VDLLPSSLIPSEVEDDDASPQGSSAATMGSYIATDMSSSAAGLQGQQRRMYVGAKGST
                     AWYAAAGEGAAGGVSGALTDHKAYIRDSPGSSVYSVPEDADVDTSMPQSTDVRSEGAR
                     DSVPRTSGRVADLDAAASLAAANEKRIRGRASPTPSTKSDGSSSSSEDALTMLEVDMT
                     LTKGRRHHALRCASDVPTFEQLYSPSMPPLDEGPLTGSGNPSTTSSAGSGRSSKPDRR
                     KGGSAHSVGIGWSNTAVSSLHERGAAYLVHYPTARMEAGTQAEMRAVGTHPTAICAAS
                     GMRATYPTDDYVAQGAWKARQLHLLRQLRSPIVDDSEDTAKNSAEATDNPSRAFEQRH
                     RPPKDKADAVLDAAEAAAREEWAQHWGVVESLLQTRFSASSCIGRGEPPSSSRRTGKV
                     LLQRFPSDSTSPTRDASQSSVPVSSASR"
     gene            <682797..>686675
                     /locus_tag="LMJF_27_1660"
                     /db_xref="GeneID:12982756"
     mRNA            <682797..>686675
                     /locus_tag="LMJF_27_1660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721926.1"
                     /db_xref="GeneID:12982756"
     CDS             682797..686675
                     /locus_tag="LMJF_27_1660"
                     /note="previous protein_id=AAZ09915.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721974.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982756"
                     /db_xref="GOA:E9ADE5"
                     /db_xref="InterPro:IPR019393"
                     /db_xref="UniProtKB/TrEMBL:E9ADE5"
                     /translation="MAHRSRATVDPSSDQEERVDFLDDDCGRNALQLAARGSTIVATL
                     QRLAAHIPAEFTAPSRTPYARLIFDFRYFKHQDQIETNIADSAELLVMDKEFYDTHMG
                     LLEKFMALFRGIYGYATELNRYVREIQDGQYVAQTLDTVLESLDGRQLLCELYHLYGV
                     MLLLMDHKIGGLVRERIIVSYVRYRGSGEAHTVEVAELCRATSQGADGGAAIAGSSVE
                     RTPVSPRAAAGSGTGISNYPIDYFERVPVQKGVVARLLACIRSDDIYRMSSHYPNPDH
                     RSAAMALQGGIAFVLLFFCGDVLAQQLPVMKELVEKHFADNWVVHYYGGYTADLSVAW
                     AAFPAARAALRRTLESHSVTYHLQRMRGALARSTERVQAVLEEGMLTENYVLDNVHAS
                     LLPIITESNVVLRWFVLQGVCSASASSPPASPVCGDPDEASLRAAASAAGQAVRASFE
                     NDELLTLLLATAQLERDVYSRFAVVLQEKTARWAGARRQAVSRVQKLSHFFSEDNLLD
                     TSVHDAELERWFAEVGARITNLHMKRQSAKATRRKLQRLVAALENIQEFAQVNQQLQV
                     LQYVRETCADLHQMLHYLNAERRVLGRFATVTDFSYAWELLSARGYLVRELQARIRRQ
                     PVVAAQMQALFAKLSSLLHLPCIRIDEGVAVTAASALGVDVRLERALQFTSTFYSEEV
                     VSFLRSVLQVIPTSIFEVLNKVMYLLTNALRECPSKLQRDEWKRWSQLETREQLCACT
                     ADIARYAAGLLAMEETTVGVVRVNPHQLLEDGIRKELVEHITRELHAGIWFDRSKPST
                     VEDLDKELVQLGARLRGVRNSFEYIQDFVNVHGLKIWMEEFQRIVRFTLQMECNAFWP
                     KKVYPWSSPYQSASITIPHFAPANPKDAYSFLGHLVQHLLYLTDPRESIYFPAYGAWF
                     TRRQLCECVGPRLFSRVADAVDCTGLACLDELLSSIATKDMQLLVQRLAESVASLESA
                     QRGAVQEVWARCMPTSSTPEKDAFLKDYDQLASILEASAAAQEVGVVAMRLGRIALIR
                     QLIAHQLRSDSKQDSSALVACTQAVNTAVVATLNSHLAKDPFEARAAGSSRSCADVSE
                     GLVCGMAPLLSSVGLTDPFATVYEVADGGGGGSPSGDDTAGEFSFGAPPPAPATAGSG
                     AARPVAVPTKLPLPLLVLPLCVVVLLHVQKCTYSARFDSCIPAEKEDDVDPTVLAVGV
                     AILLQQFPLEATRLLLQLLAQVVRVSIIARTPTPKGKGKGAAPPLVCRCADALIMWIE
                     VLQGYLPRYPEREWSHGVPPSVPDRYAQGV"
     gene            <687890..>689281
                     /locus_tag="LMJF_27_1670"
                     /db_xref="GeneID:12982757"
     mRNA            <687890..>689281
                     /locus_tag="LMJF_27_1670"
                     /product="putative molybdopterin synthase
                     sulphurylase-like protein"
                     /transcript_id="XM_003721927.1"
                     /db_xref="GeneID:12982757"
     CDS             687890..689281
                     /locus_tag="LMJF_27_1670"
                     /EC_number="2.8.1.-"
                     /note="previous protein_id=AAZ09916.1"
                     /codon_start=1
                     /product="putative molybdopterin synthase
                     sulphurylase-like protein"
                     /protein_id="XP_003721975.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982757"
                     /db_xref="GOA:E9ADE6"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="InterPro:IPR007901"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR028885"
                     /db_xref="UniProtKB/TrEMBL:E9ADE6"
                     /translation="MNAEATQDTLPHAAFVSSVPTLTKEDVERFGRQMLVEEIGAAHM
                     GQIRQAHVVCVGAGGLGSTILLYLAASGVGRLTIVDFDDVELSNLHRQVIHTTAAIGQ
                     PKALSAKASCLRLFPAACIDAVVEALSPANAERLFATCDVVVDGTDNVAARYLINDAA
                     MRCGKPLVSGSAMGWEGQLSVYGYRGGPCYRCLFPQPPPQETVGSCNDSGVMGPLPGM
                     IGCLQALEVLKVATGVGETLNGRLFLFNGLRFSSRVVKLRGRQPHCAACSAAALADVT
                     PLPQLAAQARPEYVPYSCPITSASSPPGTSCSASEYAAHARGSAAAQRRVTLDVRVRL
                     QYDMAHLAHSVNVPYQSLLQWKRTGTVVTQLADVLDKAMPPPSNTPDRMKDGSAAVSH
                     GDEGSQVVVYVLCRRGINSFKALTLIRAALAEAEARGDEAAVAQLGRYVFRNVSGGLN
                     AYHREVDSAFPYY"
     gene            <693679..>695298
                     /locus_tag="LMJF_27_1680"
                     /db_xref="GeneID:12982758"
     mRNA            <693679..>695298
                     /locus_tag="LMJF_27_1680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721928.1"
                     /db_xref="GeneID:12982758"
     CDS             693679..695298
                     /locus_tag="LMJF_27_1680"
                     /note="previous protein_id=AAZ09917.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721976.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982758"
                     /db_xref="UniProtKB/TrEMBL:E9ADE7"
                     /translation="MSRPYGKKGYAFHNRSGPGSGGGGVGILGNGNNNGSRGGGRAGG
                     GGGGGRFNNHHHGGGNRNNSHSDANNSGSSGGADVMKVLLSLLFEKSYSQIFNEANGL
                     LNLSNTRASPDLEPVQKRVDYNSVAFCKVLAEVLREKFADRIRVLQLDDNSIRQLKVF
                     LTALADADIHRGITAISARNNSINDLSFVSGLKRYDGLNELLLIGNPVTNQKDYSTRL
                     SRDLPRLSMIDGVAVDRALLRLPNPVNSAPPSQQQLSVLHYLEQTMFQSMASRNYDAI
                     TYLYGSQFSALSISRGPEPLPQRVPVSAVLNTGDLEKQLRNQMQADVSKLRSSQDFRN
                     LATDSAGSMRNIAKGPQEIVSKLRSMCGGDKSIAVEIEFNPNFNMVMMDQSYHMRVPV
                     CIVTVHGKMRYLWNPIRPETQQPTFPAGKAPMISTFFDRTLTLTWDGNTNAWSIANDM
                     VLMRPDRAVVHDDGTPSSPLFFANTPSRIEQMRRRLMPGITADVMAVIVNATSSDEEV
                     KQSIMQLLMLPQDQLHAVASDPEAAKRALAM"
     gene            <701679..>703529
                     /locus_tag="LMJF_27_1690"
                     /db_xref="GeneID:12982759"
     mRNA            <701679..>703529
                     /locus_tag="LMJF_27_1690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721929.1"
                     /db_xref="GeneID:12982759"
     CDS             701679..703529
                     /locus_tag="LMJF_27_1690"
                     /note="previous protein_id=AAZ09918.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721977.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982759"
                     /db_xref="GOA:E9ADE8"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:E9ADE8"
                     /translation="MPRPYKKSKGDVGTAKYSRPCKFFLRGSCSNQRCPYLHVRNQTV
                     KRSVSHKEVAAQQGNGTVKVMSTMLKLFFEKQTQLIYNAETGMLNLSQLTSFDDLSTV
                     ASSIDFNTRTFCVALCTCIRELVSPPPTILQLDHNDVKGFHNLGKALEEAGLHASLRA
                     LSLAHNKITSTDIAQALRHFANLAELNLVGNPVTESTDYKLKFKKHLPWLQGLDGVSM
                     AAPPLELPWPRFFDPKHAPIDVMNADHDLSSSVRVYDSRQKALLNFIESAVLRPLEME
                     PASGLLTGVDAVSDVYALNATFTFSLVSNAAAVSTPSRTAGGGASTAQRDVVREIVGF
                     RMRQTESNHNVLLGLKSTTVAIGRTSVCAKLEHVLYPKNFVVSHYIHDSPDVAVLDNK
                     GFGPSAVVGMKQPLSVITLHGVMLWRYRTSGSDADVQHNTLVRDAIVIKRNFSRVITV
                     SSTDPGRWYIVNDMVTLYPFCGGSGDDDELEASNAASGGAGVSTAPSTPENILFRDVH
                     PYDVLFSPATDPKRAVRIARRYRVPAPIVAILCSFVHSDRELGVILMDLTDIPLEVYE
                     QCATVFEMDPLASIFLCRIGNRFSMEPAEGVALLRRCGLDWSAIVQAIGR"
     gene            <706113..>708176
                     /locus_tag="LMJF_27_1700"
                     /db_xref="GeneID:12982760"
     mRNA            <706113..>708176
                     /locus_tag="LMJF_27_1700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721930.1"
                     /db_xref="GeneID:12982760"
     CDS             706113..708176
                     /locus_tag="LMJF_27_1700"
                     /note="previous protein_id=AAZ09919.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721978.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982760"
                     /db_xref="GOA:E9ADE9"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9ADE9"
                     /translation="MTDVGMPSSQSGPRSSHATVLQPSLPPRLVQVRHANPSAESMMD
                     LSINRRPFYDTETPPAQTDADEERGSQEPLAASSGATHHYGGIELSMDGVTLRRPKPW
                     WLRRRMVTQLDSCSLRIPSGSVHCITSLSSTYSRCALAVLAGARAVAHAEGAALTNAY
                     PTTALRYRRQVGYVTSLDGILLEATVFENLPFATQLRFHVDAQRGRELIRKAAADVLL
                     TDYLGIRASLLSPARRHLLALAMELVAEPIVLLLEDPLSFFSLAHLQLFVRMLHRLRH
                     RSPSGTVVWSGSTIPWTLFDDIDSLTLLSTDGRTFYTGHKKDVEAFLQEDLGFLRVPG
                     EAVVDIMAQTEVDTAAVTHASYLFWNSRYHRQLQQDLQAHRARIAMNAFATLPDTTRA
                     PPRYLRVQWLLLAYALRGNVLGRVALVLWAGLFVVILLVCALVALTDGEEKGNMHNVR
                     GALFFLLSCSVQINSIFVKAELRNWRMFQLLTKNLYISVTPYFVATIVRVAAPRLCFA
                     LAGWICAAVIFQKAAVVSLGITMALTSFTHACLGLVAVYWFPRFVYLLLLNHIYYGYC
                     VISGFLVNPTSIPRFFQFLSILRIGYGGLLAAELRSRTFGCDSASSESEMESGRCISS
                     HASAALTPSAPCYTGQQYLYFIGLSDDSWGMSVLILLALSVGITITLGLSMHITSGAT
                     LLSST"
     gene            708959..710493
                     /locus_tag="LMJF_27_1710"
                     /pseudo
                     /db_xref="GeneID:12982761"
     misc_feature    708959..710493
                     /locus_tag="LMJF_27_1710"
                     /pseudo
                     /db_xref="GeneID:12982761"
     gene            712495..713307
                     /locus_tag="LMJF_27_1720"
                     /pseudo
                     /db_xref="GeneID:12982762"
     misc_feature    712495..713307
                     /locus_tag="LMJF_27_1720"
                     /pseudo
                     /db_xref="GeneID:12982762"
     gene            <714509..>715531
                     /locus_tag="LMJF_27_1730"
                     /db_xref="GeneID:12982763"
     mRNA            <714509..>715531
                     /locus_tag="LMJF_27_1730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721931.1"
                     /db_xref="GeneID:12982763"
     CDS             714509..715531
                     /locus_tag="LMJF_27_1730"
                     /note="previous protein_id=AAZ09920.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721979.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982763"
                     /db_xref="UniProtKB/TrEMBL:E9ADF0"
                     /translation="MPLCASIPATVDTDTNTRALYLDDLDKCMKNFSSALASTMNAYQ
                     NLLTAFDQVAQVYGNVAQECGDEVRKPVGEFRDGMRDLKDKGGFETFNHEIHVGTIAV
                     IEPVKSDLKKALKSLKCLRLKQKEYDAVRYDLEQTEKSYAKKNKPLVTSSSYKKTLAK
                     RDKVKTSYDASREAFGEEINALQATTKSVLLQSLNNYLHCTAAFCGQLEATMNGYRTD
                     VDHHGSTTFTNDQMDKLKEKAEAESMARRAKRKSEASNPFQTGYDVTSNNSHRNLPSV
                     DDGLYQKKDSLVDTESVNRYPNAEFAPPMQNGGDDNFTLREQYDDGAPGDADDVNPLV
                     DANNDE"
     gene            complement(<718772..>719071)
                     /locus_tag="LMJF_27_1740"
                     /db_xref="GeneID:12982764"
     mRNA            complement(<718772..>719071)
                     /locus_tag="LMJF_27_1740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721932.1"
                     /db_xref="GeneID:12982764"
     CDS             complement(718772..719071)
                     /locus_tag="LMJF_27_1740"
                     /note="previous protein_id=AAZ09921.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721980.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982764"
                     /db_xref="UniProtKB/TrEMBL:E9ADF1"
                     /translation="MLCVSVAKDGFAIVLTGLDTKRRAPPHQQRLSRNVCFHQTKAKE
                     FVARFHQPCFLAWSHRTIGHPDALQDGARRRQEYKPSHSHPFFRCNEGAHQHMCG"
     gene            complement(<720668..>734032)
                     /locus_tag="LMJF_27_1750"
                     /db_xref="GeneID:12982765"
     mRNA            complement(<720668..>734032)
                     /locus_tag="LMJF_27_1750"
                     /product="putative dynein heavy chain"
                     /transcript_id="XM_003721933.1"
                     /db_xref="GeneID:12982765"
     CDS             complement(720668..734032)
                     /locus_tag="LMJF_27_1750"
                     /note="previous protein_id=AAZ09922.1"
                     /codon_start=1
                     /product="putative dynein heavy chain"
                     /protein_id="XP_003721981.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982765"
                     /db_xref="GOA:E9ADF2"
                     /db_xref="InterPro:IPR004273"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="InterPro:IPR013602"
                     /db_xref="InterPro:IPR024317"
                     /db_xref="InterPro:IPR024743"
                     /db_xref="InterPro:IPR026983"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9ADF2"
                     /translation="MSGLVSVESQLVSTAQRHFHIRCGHVQSRRGDGWLLISFAPLGP
                     DARLELEVQALCNALVRDVTGGRVASVRLTGEDEETQFGKLADKSVSFAKLLRQSGVS
                     LGVGSDPGTDDDNSASVDALPNAPGVAEMVEMLYHDVVAESKQGARAIVQFPSLLCPQ
                     GARCDVALQGTICVKAFSRTALPVVAEVETATPTVAVTANADDDDMDDEAEPLGDAAD
                     GGAQAPHHSRASELEDKAAAVAPKSSVNGKAFRSLDDSMLQNSYSSLKLPEGELAKVW
                     IDTRVWAQALASNAGTSVEAELPAAWRSRTFNLAEAPEALRMVHRTLAQYWNENRAAN
                     RDRVKVTTLSLLSIVSGDLREYLRGQVELYGPDWRAPWRMPVEELSCAVDLCKQWSRT
                     VAQLVRQDWVDWKGHMFHDESFDAFAQRLHTVLRIRETLASMQALGEAIPSTLHPEHI
                     FAEVNAVDMRGAPATVWGSRVAQFEKEFSFAEPALRNRVKQLFQSPASDVQLRLLRKH
                     CALLRHCEVRSAVTREMDGIAAYLVEQLNRVYARFENNGRRATTPLQKLRAAKGCVAE
                     CVMVPEEAAKVFGPTDVLTEKVTAHARELIRKAAQEEAVIMKDWCASVESTAKKMLEL
                     QDAVVVAKVEDAQLQQQRPYLLTCTVHLSLRKFMQEVRNVRAWLNDIEVRQDQERRRG
                     VTGDRGNSAAQDESAAASQLWRLSSSTESTICACEHLCAAALRTQQCVANHNTVIAQI
                     LPCTRRLLVPAIEKSMSQVLYDDTTTRAVAVANYQELEGANLRFQNTIEALSNANRQV
                     RRFHEEFGQHVMALMGVDLTSHMEQWRITVDDLRSRMEDFLARQHLSDHDDWRRHWDG
                     QIYKALEYQYRRGLERLHEEMTEFKVELVLRQGIVHFRPSLEAIREAYYVKLREFVSV
                     PQRFRGLQPKRQDVSTPYEMYPLMPLTNNDRILTVHTKAMELFAKLNRVRKAFRSHIV
                     VGLCGINGSPHLDSIADAWMEKMAGKISQGFRTVEEHRERIGKIEDVMKIDCFAISTV
                     PVRASIEEHLHRLEEALLNGIRRHIQTSLNDIDEFVMGVSNIVERQPTTMDEVGESNK
                     RYKESLGQVSVYEKKLEEVLEQNKELRNHVGTSIDIGATRTRWDHMKDAMASHTKAME
                     AAVSKMRVSLNGLIQRFLKDEQRFADGWKRQKTQLMQAFVGKEATSIRKVLLSLKDQL
                     HDLADLELQAKELESKCEFFGQVKPVFSVLQDAKKDVQATTAMWSLYDAFEEELEKLR
                     AEDWLTFRAHTFQFEDFCKEWRTTLTEMKESRSAAAGDVAGEGKGRKSNKDSGDTLDT
                     ANRAHNPIVAYLLNMITDWANVVPLLKFVRGEGWMTEHWNEMFRLLNIPKETTSTSLT
                     FGLILDHYSDLLAKEGELKHLHARAHGEIQLREALQDMRKWALEAVFNLTAPTESTSK
                     VRLITDWKEIMTQVSDNQALVNSLKDSPFFVHFADEASGWESKLVSLSQSLTLLNSIQ
                     RRWAYLEPIFARGALPHEQARFKRVDKEFVSILREVEADPRVMSLVNQTDVHEKLKGI
                     LEQTERCQKSLIEFLEAKRGKLPRFYFISDEDLLEMLGHSQNPSVIQVHLKKLFMGIH
                     AVTFSSDNTSITHMISADGEEVALRRPVAITGSDVEDWLLALDASMQDTLHELLISCV
                     KQPDATTKDSVLAYPSQILQVAQGVHFAREAEEAIVAQLLNGLLASLRRRLDRLVAMT
                     PELEPLHVLKVKALILDTIHNIEVVELLMKRNVRRVDEWWWRKQLRYSMSTDGTHRCT
                     VHMADTQFDYAYEYQGNAAKLVYTPLTDRCYLVLTKGMDLGYGGNPYGPAGTGKTESV
                     KALGSAMGRQVLVFNCDEGIDFKAMGRIFVGIVKCGAWGCFDEFNRLKIDQLSAISQM
                     IQVIQQALKNKEPSCMLLNSEITVNTNAGIFVTLNPAGKGYGGRTRLPDNLKQLFREV
                     AMSVPDNELITSTVLFSEGFTHARALAKSIVALYRLSGQLMSQQQHYDWGLRPLKAVL
                     RLGGTLLQRWRKENASAAATQTIEEELILQSLNINTISKLTFDDARVFQGLLRDIFPG
                     VASRDVTYKELEGAVASAVKALGLQPIPAQQKKVLQLYEALQQRTGVVLVGPSGSGKS
                     TLLNILRKALQTMQIEVPMHVMNPKAMTRRRLLGYMDADTREWYDGVLTVAARDVVKQ
                     PKEARPWVLCDGDIDPEWIESLNSVLDDNRLLTMPNGVRIQFSANVNFIFETHSLEYA
                     SPATVSRMGVLFFSEKDVQLEAVVESGMAFKSLHTKNVVQPLILKYVFAAVDEAQRLN
                     DFSVATTRMGLLQTCLLHVMLTKNAQDFAYSLVRGLCGCLNAGSAAKLAGWIYTTMGQ
                     KPCSDSRPFDSYWDDTLQRAVEFTADLSTPVTPAELLAGRPPVVQTVEVKRLVSTLQP
                     LLDDGSCKPFFVVGPEGCGKGALLDYVFSTRPTLRTTTINCSAQTDSKHVIQKIEQAC
                     VLANTNAGPMYRPREGERLVIILKSVNLPKADRYGTVELHSFLQQLILYSGFYNQDLE
                     WVGVERVQIVASMNPTPSAGRYPVTPRLLALASIVTVSYPSKTSLVQVYATYWASLLR
                     QTNIGQGKDYEKGTQLAHFMLQVYDKVRRQFEGEEYAHFSFSPRHLTKWVTNVLLYHV
                     DTRTTLPAVLAYEATRIFTDCLPSAEDRRQALRTFSEQLATIGYAMPAKEDRFTTMFV
                     TWFDPENGAAAVAATGEQALPATAAGDDEVGGASAAAATSHRAVLKLVQKRYDDVRNE
                     AERGLLQYSREFKELHVPLIPEILCWVTYVDRVLARPGGHFILVGSTGVGRRNAVLLA
                     AHQQRREVVSLNMTHDYNLKQFRLDLRGFIQRATVQNTPLVLLIEDHNIVDATFLEYV
                     NSLLSSGEVPGLFSQEEMETMFSSMRDEAANDGHMGAIYAYFVERLQRNLRIALIMDH
                     RHELFMIRLHSNPALMSKCELLWMGTWSGDMTKTVCKMYLADEIAALESNPTNKGFHV
                     HREVNAIHESMGVRSTPHDVQVLLNTFRAILARKSSSSKDKMERLDAGLVKLKEAEES
                     VEKVKKDVAEKKKDVERMQKAADKALGEIQSSMEESQEQRDEAATLQEHLKEEQTLIA
                     KSRGQVEEELGSIKPLMEAARDAISTIRSEQLNEIRSLLSPPEAIRAVLEGVLALLGV
                     NDVSWQSMRQFLGERGAKQRILDFDVKNMTPEIRRRVEKLLRDRASFFKAETIQRASV
                     AAAPMAEWVKAMVEYSAIMERISPLTQQLEQLETNQKDGAAKLDHLQRRLKKIDTKVK
                     ELREGFSAKCKEAERLRSKLQAAEEELAKAKDLLDKLNGEKGRWATEAAAIREANATM
                     PKRALVAAAFLTYLGQETEDGRRRFLKMWCDRLGFPDVVEVTHFLRTEGDLLQYKSEG
                     LSADGLSLENAVVMLDTEQTPLVVDPANKAVEWMREHLKRANAVAETISLHDERFTHT
                     LELAIRFGKTLIVTEVADIAPLLYTILRRDLVPAGAKRVVQVGNKTVEWHDNFRIMLF
                     SRQSELRLSPSAAALVTEVNFSVTSLGLEDQLLGVTLQQERPELEKQKVELLKDEESL
                     QLQLSKLEERLLSDLAESQGGLLENAKLIKSLNEVKVQAYNIQQSLARSHELQVELDE
                     KREVYRPFAHHGALLFFIVRDMETLNHMYQYGISDYIALFTQTLKTYQGDDEAGAKVQ
                     ALIASFTKTCFHSVARGLLKKDRIAFGLHVLHGLWPAEYPQDLWGALVGTITNVKAVE
                     DSHLPKWAPPSSRIKYASIVSSAAGQALAEKWHGGDPSRWAAVMNHATPESELGPCAA
                     GSNMDASAAVSDMERLLWINTFRPDRASATSLQIILRKLELASLAPVISLENTILSNG
                     ATAPLLLITSSGADPSMEIQDVATHLVGKERFVQLALGGGQTDNALQQVRRCAVQGDW
                     LLLKNLHLVLDWASVLENELCSMPPPNASFRLLLTTEPHDFFPSVLLRMSNKVTVEAP
                     PGVKQNLLRTYSLWDNAFLAAQSHAGARLLFGLAWFHAVVQERRTYVPQGWSKCYEFS
                     PADLKAATTVLTSVATKPQLDWVTLTGFLETCLYGGRLENAADEKVLQLLIQTYFNEG
                     VLLKEKSPLFSGVTAAHAGDREKMVAVLQASMPDVDPPALLCMCDNADRTVQEDAAHA
                     TRESLRELCKKESTVLTSGEKWRERLRQVMEVWKGSGVAANGVPQTVSSHTRDPEPME
                     VFFISEVNLLTALIKDLSAFFDTLHGVAEGTIIPDAEVRAEATELMSGRMPSRWLDRM
                     SGPQEAKVWLALLWRKYNTTRDLARAPFSTTATYDLSSLLRPQAFFNALRQHTARVTK
                     APLTDLVLVAAVDNAAHGSVIVKVAAKSLVMQGAALTGDGRLAAVQANSPSSVPLSVD
                     VVVSWVPAGKVKHSSESVVIPVYADAERHTSIFPLRVKCAGEAEATKAALNGVACYLV
                     SL"
     gene            complement(<737311..>739026)
                     /locus_tag="LMJF_27_1760"
                     /db_xref="GeneID:12982766"
     mRNA            complement(<737311..>739026)
                     /locus_tag="LMJF_27_1760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721934.1"
                     /db_xref="GeneID:12982766"
     CDS             complement(737311..739026)
                     /locus_tag="LMJF_27_1760"
                     /note="previous protein_id=AAZ09923.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721982.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982766"
                     /db_xref="GOA:E9ADF3"
                     /db_xref="InterPro:IPR006599"
                     /db_xref="InterPro:IPR012945"
                     /db_xref="InterPro:IPR016098"
                     /db_xref="InterPro:IPR017901"
                     /db_xref="UniProtKB/TrEMBL:E9ADF3"
                     /translation="MSRRPSGSFGRSVSGSSQLASTSASGGGDAGNSTAAPQAVFCVN
                     PVFFENCGALLNAPSGLTTASVLKVLQNAGSKTSISLAKWKETAMTVLGLRESTAYAI
                     FDVFFALSGGCIQNTPAYSGGERTSVAQLRQESNRALLQKMGGAVDQGRWPAASTARQ
                     VSLPGLLIFLLCQLFVERKRAGAPNKFTSEAVAEYVRQHLHDFISAVAVTRASRLTMA
                     DAAELGYLLREVVNGVEQPFGASISFLWHFNEKTIDVAVLSQYLRVRIRSNGEIKKVG
                     SGTATVANTFGFNNITIQNLADTVHITPYALLPDMASRLLSSNLTISNCSQTHIYAPS
                     VLPHTLLSSLTNCTVSLGPVSGVLSVQNCHHCSISALCGAVIVSNCTNVTLYVCVNTP
                     PVLIPNESLNGDVRASGTSSNRVNSATSVSSEGGVRFAPYNSFYPAMEQHISSSGISP
                     LLNVWNVGLPNHESILPPSEFQSVPFPLTQFANLSNVTRTNPCPLPAPYRDAMNRRLQ
                     RLRDVNDAIASATGRLREAGRNDLVDELHQRVTSIFRDWLKETGQEHVLADLTHTTAP
                     SKMVV"
     gene            complement(<741820..>746319)
                     /locus_tag="LMJF_27_1770"
                     /db_xref="GeneID:12982767"
     mRNA            complement(<741820..>746319)
                     /locus_tag="LMJF_27_1770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721935.1"
                     /db_xref="GeneID:12982767"
     CDS             complement(741820..746319)
                     /locus_tag="LMJF_27_1770"
                     /note="previous protein_id=AAZ09924.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721983.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982767"
                     /db_xref="GOA:E9ADF4"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="InterPro:IPR019402"
                     /db_xref="InterPro:IPR027317"
                     /db_xref="UniProtKB/TrEMBL:E9ADF4"
                     /translation="MNTYRSSLPRLCVGMCLLASTGCPHTSLACVSLVLVLPRLFASL
                     LLHHTPFYAVRAKPACVYRYSGFLPVPLLFLCSCFVPALLTARILLPLCACLDIHTTT
                     QVEQSMRHVFYIPSSYAALIYALTTGYALFACLYMAGVLHWRDIIVTSCGEDHYEFWP
                     SISATVGEMMPERQTWRVAFTLCVPFRVSASMSLFNVFWQRASRGMEDLYSFRRSWKA
                     FLSSNAFLALLALGTDTWRFIGASVYSVVSAKESLTYHNLGICPYLPFCLVLQAAVTM
                     LVRRNQFNTAIYPTPQDATASYAVKRVCLCVEVVAAVGIVCCYSHYLRTCANGSLSLS
                     SICEWVFSIFNIIFDGSAWFDLKQEGWWLSGPPGFYRKLYARRVHRASGAASTPQVKG
                     AKDGTKDGHAGGDGDVAVTVPVPNGDGDATPECDSGAAVEDTVPLTSPPRTTTGEFFL
                     DRNVILHRFSFCSAPSRLSLWICDVYWAHMFFEMAVHLIQHMYFMPLIAMSLSWEVSS
                     VLVLGAPCLLRISAFRRWATGPCICAQTWLKPSHVPIGLSYRTAPMYILFYALASISH
                     FQQLIRWNPGKKILVVAVGPLLLSLALYTRFLYPSTVTLKRAWAEGDEDSRRMTMTLP
                     LGLVLCMLLRVQHVGVSPLFTNPFYGSIYGILLGLIFTTIIYRRAMMGNTLKEEVPQQ
                     CSAPSATQMSSTTLLMRDLHRGGDAEEIKRFSVSTAGGGRDASHTDRIGQKVADGVDI
                     RGVHFSLSQVDEASESTVPAIATLYTPPSPALLGVLCGCITSIGITFLSCPNYIPRML
                     AVEPFPANLVIAGIFTAGLHYSTDVLPLALVLLRPKGHPDIVRRALYAVVGGSWSRFG
                     VLLALNTTLMLFATRQTNFTYEVPHDGYPVTMDTPRAEVDVKYWEAQETFWGSKHVAF
                     MGGLGFTFCIGVLFPFAMEVTWAHQRDRRFAQIAEAADAEAVISHECSFFMSFEFTWL
                     LCVTSSCVLHALCISYPFVPMAWLVREKSRPLILAHVGTLYLTAWIVARRIRSSRAVA
                     AAITDVAAARKQRSIQMMVIIVIVFFFVWVFIERVTMGGADASFPANKKTAIQFQEEV
                     LHLHKMLIELRRARNIITDPYMKKFETIYYQERFEDAMASMDKNITESKDGVPVDPKL
                     NLTHLSHADRIDVWEAAKAMTFFSGAIWTVHFGLDNYNVDSFSRIVEELRKTEASVIG
                     LLESDSMHLTNGNRDMVEYVSYHLGFRYTDYGPTVLDNTYGCALVTRYPILDVRRYVI
                     PSPLGELACVIHAVLDVYGVPVHTYVGHFGNTEHWADGLLQSQFLGRLVLSNPGPSMW
                     LGYLVTHPGMKERYQEYTDPKAPGKFRDAGLEMYRQHPWTRLWDRGGYEEELPVPTKQ
                     PVKKTNFDIEVKFQYVGYLEEGMQVDSHFRRPPADKPPRHFYYNDTGRYTNAHPRFEF
                     MDRYCQYCLYKTGATADEVVGDAGKLQPYQVRLFDWWRIVDHGVELLSDTEIQVIQLA
                     FEKRR"
     gene            complement(<751863..>753545)
                     /locus_tag="LMJF_27_1780"
                     /db_xref="GeneID:12982768"
     mRNA            complement(<751863..>753545)
                     /locus_tag="LMJF_27_1780"
                     /product="casein kinase I-like protein"
                     /transcript_id="XM_003721936.1"
                     /db_xref="GeneID:12982768"
     CDS             complement(751863..753545)
                     /locus_tag="LMJF_27_1780"
                     /note="previous protein_id=AAZ09925.1"
                     /codon_start=1
                     /product="casein kinase I-like protein"
                     /protein_id="XP_003721984.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982768"
                     /db_xref="GOA:E9ADF5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9ADF5"
                     /translation="MTLTSRTAQAAHAQNDVAAQRPPPPLYPSMNVGASAVHPHQNRP
                     CHAYDSQPAWQNPQLGTAPPAVIAGAPLAPEQQQQQTHQQGRSNQPQSIFGGRFTLLD
                     RLGSGGFGEVYRAEECDQLVPLAVKVERVTDTNALPEQSFLFHEAKVMQEIHKSIQAY
                     MAAQQQHQLLRLQQEKAQSGNGRRANNEAAAAADEVRQEKVGIAKLKYYGQDGMSRVL
                     IMSLHGQSVANVHRHQGRLSLFATVMIADQVLRSLEHVHRAGYVHADLKPDNILLGRE
                     DPEQLYLVDFGLSVHFRDRKGKHRPLVTNHSFVGTPRYASLRTHMGHTLSRRDDIEQL
                     VYVMIYLFRGRLPWSGLRISDPDAKEKRIAQMKAEMTLDSICAGCPEAFRDVLNYARC
                     MEFEEEPQYQFLHVLLCSLRDSCTELSSDPSCVPANGSGGVMPQMLTLNVNCSTRQHP
                     KDQNGGDAAANGGAVGVTAAEAGLVQNTNIVSGVVEQIDGVAENPMMMSSRGTGAPAF
                     FSDAIGQGFLSGNGTDAGPLSPRIDCLNGQPFSPPPLDLQRPCGSPQLRQMR"
     gene            complement(<756758..>759286)
                     /locus_tag="LMJF_27_1790"
                     /db_xref="GeneID:12982769"
     mRNA            complement(<756758..>759286)
                     /locus_tag="LMJF_27_1790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721937.1"
                     /db_xref="GeneID:12982769"
     CDS             complement(756758..759286)
                     /locus_tag="LMJF_27_1790"
                     /note="previous protein_id=AAZ09926.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721985.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982769"
                     /db_xref="UniProtKB/TrEMBL:E9ADF6"
                     /translation="MCEAWCKDGPGSTWPEAPALFFARVADKPPASLLTLCSTCVIAV
                     GGDIHATSQRVLERCHHTPVIRYRTAAYVNAVREYKQLLELMARKVVRSCERMQSIQS
                     SVERQRQGQQRLHAYGAAEEPWRHLNPSVDAARVPLTFLTPSLQEKVLSQLLEALEGL
                     LQRDARAVRLAAAETSLSQESSPLPFSQVMAPRERHVLLEELAHVERQLMSARSSATS
                     AATMPAKPGVSPRSLRERHLYDVPSTSPANTRGRADADDGRVVYSPRSPAQPHRSPPR
                     SSVSPSGSAAEEAAGRLAAVADPRRCLYHHHDRIPGSSHAASVRGHHDASSQAPHPSR
                     SRECSPPELTSPQRSTRGKYNGRVSNAAGRKDGENTVSGSRTRASGGIAVLGIRPPAE
                     TTATVSLPFSSPPRRARSTSGNHYCEVDSASRADDEGGAQDIRLSSPDGTNRCAAAPV
                     VQSRPPLDQDGRRSMWAVIDTAIWEAYRRPPPMEGESQESTTHSSGEARAEDDNGRHR
                     RHGAAAAGTRNPHRDSDLQLWDYFAGQLSTTPQLHAGGGGDSGRRTPPSTSPSPDSHP
                     LACEARGSVPPRRQTDATSQTRVEAVAAGGFDGQLSDLSSDDTAALQRRVLHEQQLRR
                     EAKEAMLASQAQIAALEMTTNDMAEKLLTHRLAVTFRAHLEGMEMLVGRWTRLAQNFC
                     LQKSLLFAEEASAVVRHLLRVRFGVAPLWSPRTQPQQPQSGRHQTSAYIEAPTSHDER
                     GEELWVNREEEEASDSRRDSSFSSKSDEGHRNGAAVVAHHPLRSTGEEKEAHHRHGRH
                     TDHPLTRSSPERQPLQKLPPSITPASPSFSFPTNLQLRPLSLCL"
     gene            complement(<763904..>769090)
                     /locus_tag="LMJF_27_1800"
                     /db_xref="GeneID:12982770"
     mRNA            complement(<763904..>769090)
                     /locus_tag="LMJF_27_1800"
                     /product="protein kinase-like protein"
                     /transcript_id="XM_003721938.1"
                     /db_xref="GeneID:12982770"
     CDS             complement(763904..769090)
                     /locus_tag="LMJF_27_1800"
                     /note="previous protein_id=AAZ09927.1"
                     /codon_start=1
                     /product="protein kinase-like protein"
                     /protein_id="XP_003721986.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982770"
                     /db_xref="GOA:E9ADF7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9ADF7"
                     /translation="MASRGEHIRLDKGALVKNHYEVVTSIGSGNFSKVYRVIDLDLSI
                     KDQRRNPLAMKVIKKEYSSDAKYEKQMLIVLHEHDKSRSARVSKMYECFVWQECPVFI
                     MPLHGPCLRSRRLGVNRGVVTYEKLLEFSYDLLETMAFVHFECHMVHTDLKPENILIA
                     DRNVADNSMGDEWVVCDFGSASLWRKDKLDSDLIATRPYRAPEVLLGNKWHYAADMWS
                     IGCILYEVAVGHRLFESRDDLTHLHMMDRRIGRLPEAFAKHSKYSSKYFNSRGDFLST
                     PDVIRFSKCRLTPIREMFKDDREFLHLLKGLLTYNPDERITAPEALALPIFDRVRVAR
                     KERPRQADAAAEERRQCCHSPGAAVPRDGTSLRLTGRSDHNTLEHIIADAKNGCSSHG
                     RHHHQNHTRDETSGNNMAGSRLEAAPAPWPAAASPAVGFSPQLGSQASAGTPRDAAAM
                     TTTATTSAASPTAEDMNSFAAPSVSAPSATSLGEKRVAEAARVRGRAASMPVVQSCSS
                     HQCGSLLSRTAVVTKGVPHQRSCVNGYHSTSTRSAALVPQLALHRCKASTLAPHHDTA
                     RLPSKSGQRGSGRSGGKLSNRSVSPGSKNRRMTPHKGTSSGSPHGCGSSAAGDGGTQL
                     NALSSLKSPHQSLQLGPGAAKKPNRTPPRSSATPCRLLETRSPVITRSSRMPVKASSA
                     AGPSLGYSICISDIISTPPKQAFRAEALRCSTAAGRSPRNRVTALGSRSHNSVTKVGE
                     AGMATTSRLGPSVAAPKALPLPEVVTGMKTPRQQSLSPDAPLGYQSPLQRGATAVGRN
                     METESLVVRGSPDVDDKLLDAGNATKSRSRKTTGDEGDRGRKQVGSPVATSLAVTGDN
                     NPDKVGGGNDDDDSSLASPNAQLRGSVASPTSENCLSSLYNSDGSPRATDYRSPARCR
                     PPVETSTGDPSMVSSPVMMSRSNARLSISGSEWRGLEAAPGGTLAMATVKREQRIIAA
                     ALATPLPPSQHKPWSSQLSEVFYSPRELSPAARSPSSLTGPRSTTAGSVASPPAVHTV
                     ESGENPHELFSAVPFSRAHRSRANSCSGSFGCTRDAAPASTADSRSHMVPPSTCTKSA
                     VGRSARGLPTARTSVSATTVSTPTTPTHVCQAFSSASQLAVTTSVDRLKSVPQPDVAD
                     VRGTAPPPPPVAASRRAATKPGPTPVAATSVPAPACPSLEESTPVAPRNSMAMPRLPA
                     ALTRSREVSLSQEKGRLANPDTIASPPLSGAAATPSTGAAGAAAVLHSSQHLPYQPTH
                     GLVHPSGSNSHVLSESKTEEAGCTTASQPPGLHMPRRSLLLPGHSPTCSVSSPLPAIA
                     AAALATVTPAFPLPDKAYRAGERHETLTHNSGSVRVKSLNVQHPCASPGLSLRPPPSL
                     SSTNVSFDVAAGAKPFGSTTAKLTNAGTSSRPNSNFNNGGSNKPGTVTSPYPAATSGS
                     SESTSFQAVLRSPRNAAVTGAANANSLRSSTDGVSAGPVRSPHSSASATTSPKTSAKY
                     QRTGSPRGIPPALTTTGSPISAIGGEVMSIATVSLPVQPHYQPPSQVQQQPSTAMAST
                     GAGPSKLSISIAPRHMRSGVVPTRSSIHRQPLGTSVASTPHPKASGSSAAPGSLKANA
                     AGISLPKQSYKTSSGTLNAVSSRGSTANAPVNTIGADALTRPTASQPKHRRDARTLRR
                     IIVPRPSTSSLSQASRAASSSPGAEDSGEQTRDISDNSHISKQHDRDVSLCSSTTPIP
                     LP"
     gene            complement(<772225..>773802)
                     /locus_tag="LMJF_27_1805"
                     /db_xref="GeneID:12982771"
     mRNA            complement(<772225..>773802)
                     /locus_tag="LMJF_27_1805"
                     /product="putative glycosomal phosphoenolpyruvate
                     carboxykinase"
                     /transcript_id="XM_003721939.1"
                     /db_xref="GeneID:12982771"
     CDS             complement(772225..773802)
                     /locus_tag="LMJF_27_1805"
                     /note="previous protein_id=AAZ09928.1"
                     /codon_start=1
                     /product="putative glycosomal phosphoenolpyruvate
                     carboxykinase"
                     /protein_id="XP_003721987.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1805"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1805"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982771"
                     /db_xref="GOA:E9ADF8"
                     /db_xref="InterPro:IPR001272"
                     /db_xref="InterPro:IPR008210"
                     /db_xref="InterPro:IPR013035"
                     /db_xref="InterPro:IPR015994"
                     /db_xref="UniProtKB/TrEMBL:E9ADF8"
                     /translation="MAPIIHRNLTAPELVQWALKLEKDTKLSARGALCVLSYAKTGRS
                     PRDKRVVDTDDVHENVDWGSVNVKLSEESFAKVKKRAMDFLNSRDHLFIVDCFAGHDE
                     RYRLKVRVITARPYHALFMYNMLIRPTRQELESFGEPEYTIYNAGEHSADPSVPGVTS
                     TTSVSLNFKTGEEVILGTEYAGEMKKGILTVMFELMPRQGHLCMHASANVGKKGDVTV
                     FFGLSGTGKTTLSADPNRMLIGDDEHVWTDRGVFNIEGGCYAKAIGLNPKTEEEIYNA
                     VRFGAVAENCTLDKVTHEIDFNDESICKNTRVAYPLEHIPGALTHAVAGHPNNVIFLT
                     NDAFGVMPPVARLTPEQAMFWFIMGYTANVPGVEAGSTPVAKPIFSSCFGGPFLVRHA
                     TFYGEQLAKKMTEHNARVWLLNTGYAGGRADRGAKRMPLKVTRAVIDAIHDGSLDKEQ
                     YCVYPGWGLQIPRGCARVPAQLLDPRKAWKDVKAFNETTKELVAMFQASFQKRFAAKA
                     SEALKSAVPKYVETAHL"
     gene            complement(<776490..>778067)
                     /locus_tag="LMJF_27_1810"
                     /db_xref="GeneID:12982772"
     mRNA            complement(<776490..>778067)
                     /locus_tag="LMJF_27_1810"
                     /product="putative glycosomal phosphoenolpyruvate
                     carboxykinase"
                     /transcript_id="XM_003721940.1"
                     /db_xref="GeneID:12982772"
     CDS             complement(776490..778067)
                     /locus_tag="LMJF_27_1810"
                     /EC_number="4.1.1.-"
                     /note="previous protein_id=AAZ09929.1"
                     /codon_start=1
                     /product="putative glycosomal phosphoenolpyruvate
                     carboxykinase"
                     /protein_id="XP_003721988.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982772"
                     /db_xref="GOA:E9ADF9"
                     /db_xref="InterPro:IPR001272"
                     /db_xref="InterPro:IPR008210"
                     /db_xref="InterPro:IPR013035"
                     /db_xref="InterPro:IPR015994"
                     /db_xref="UniProtKB/TrEMBL:E9ADF9"
                     /translation="MAPIIHRNLTAPELVQWALKLEKDTKLSARGALCVLSYAKTGRS
                     PRDKRVVDTDDVHENVDWGSVNVKLSEESFAKVKKRAMDFLNSRDHLFIVDCFAGHDE
                     RYRLKVRVITTRPYHALFMYNMLIRPTRQELESFGEPEYTIYNAGEHSADPSVPGVTS
                     TTSVSLNFKTGEEVILGTEYAGEMKKGILTVMFELMPRQGHLCMHASANVGKKGDVTV
                     FFGLSGTGKTTLSADPNRMLIGDDEHVWTDRGVFNIEGGCYAKAIGLNPKTEEEIYNA
                     VRFGAVAENCTLDKVTHEIDFNDESICKNTRVAYPLEHIPGALTHAVAGHPNNVIFLT
                     NDAFGVMPPVARLTPEQAMFWFIMGYTANVPGVEAGSTPVAKPIFSSCFGGPFLVRHA
                     TFYGEQLAKKMTEHNARVWLLNTGYAGGRADRGAKRMPLKVTRAVIDAIHDGSLDKEQ
                     YCVYPGWGLQIPRGCARVPAQLLDPRKAWKDVKAFNETTKELVAMFQASFQKRFAAKA
                     SEALKSAVPKYVETAHL"
     gene            complement(<780417..>787190)
                     /locus_tag="LMJF_27_1820"
                     /db_xref="GeneID:12982773"
     mRNA            complement(<780417..>787190)
                     /locus_tag="LMJF_27_1820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721941.1"
                     /db_xref="GeneID:12982773"
     CDS             complement(780417..787190)
                     /locus_tag="LMJF_27_1820"
                     /note="previous protein_id=AAZ09930.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721989.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982773"
                     /db_xref="InterPro:IPR018159"
                     /db_xref="UniProtKB/TrEMBL:E9ADG0"
                     /translation="MPSSHTSLPFPSYGEQPARPPPAGVLSADLARPISVRELAQSRV
                     PAVPPPPPATQTPRSRATTAGFAGFGVPTSSAVYAATSGVSTSQPLPAHADAGDLTSL
                     AHRDIDHLSGRELYNYASHLRESSQQYGGYLSEAYAKRDQYRGEVARLKEELHNRYME
                     IDVLRREQERARDALLKVREDNAQLRQKLAEAEGHARNMQAKISVLSGADPSLAVHFY
                     QSQLALKDAQLRELQQECERAAAASSQRRSSSTTAAEHGRRSANISGEGAAAPHTSPS
                     CDLPSAEELKGGTEAASAALHTALEELQCLNTSLSHRLEDEHTAHKAALAAHAEASAT
                     ATADRAELLDTIAQLRQQCADMQNVEDELVAALTLRAPISKKDYAALQASYDDLTAAL
                     AKAEAQVAALQENEQQHHHSAQQAQEELRRSLTTGLEERQSMQVRNEQMQSLVNHLEK
                     ELKLAERANQLRQEQLDAAISGNQQLAESLHVAQEQLLSATSELQDLRDTRESLESQH
                     RELRQRIEELEQGDEHQRHQHGEAEAESEASQQRQELEAELARLRSQRDVLVGDRDDI
                     VGDVRRLPDERRALLTSPPAHAEEQLQSRSSAVRAPLDVHADDGERQNQEDIAALEAA
                     HRCIEQMKQTIAALQSERVRVEADLKAKVNTLEAELASQSRALAEAEAAAAAQQAHLE
                     EVVMALRDELVATQAQEKMLRASEKAHQERCVEQQRAVEQMQAHVEELKTAARNAASS
                     LSTPPPARPATAAESEQIAMNAALSSLAYQLEDAQHRVEELSAEHARTVEELARATRA
                     VAELEARAAGAEGKREVMHTAAEVAEAELMARVAALTTENAQLKEKLSISRAAVTTFA
                     SRQTDGEGAAASLEERCAAEARRSEAAEAEASALRGTLDRTAAELAEVLQRSEDVQAT
                     LERTVARLAEQESLVGALSAESTRLQDELATAQRSVLLLTGERDALGEEAAGLRGELS
                     AAEDRASDVAAAQQRLQVRLEEAEAAVRSKDVELSTALAALDRTASEMCDAEQRLQVY
                     SEAKEQLAAEHARTVEELARATRAVAELEARAAGAEGKREVMHTAAEVAEAELMARVA
                     ALTTENAQLKEKLSISRAAVTTFASRQTDGEGAAASLEERCAAEARRSEAAEAEASAL
                     RGTLDRTAAELAEVLQRSEDVQATLERTVARLAEQESLVGALSAESTRLQDELATAQR
                     SVLLLTGERDALGEEAAGLRGELSAAEDRASDVAAAQQRLQVRLEEAEAAVRSKDVEL
                     STALAALDRTASEMCDAEQRLQVYSEAKEQLAAEHARTVEELARATRAVAELEARAAG
                     AEGKREVMHTAAEVAEAELMARVAALTTENAQLKEKLSISRAAVTTFASRQTDGEGAA
                     ASLEERCAAEARRSEAAEAEASALRGTLDRTAAELAEVLQRSEDVQATLERTVARLAE
                     EEELVEQLNYDASELSDARAALTEEVTRLQKALAAAVTDKADVLAQLLATQKELDRAA
                     EVQDAQYRDEELLQNALATTTSAFDVQTKQVRLGMAHVVDMSRAFCRVAEVAVQRSAA
                     GVDGAASTGANVQEILSPWARALEWVAAMEQRLETLDMGAMSNSLSRTDGRRERRRRR
                     RGRTTELEGDNAVEMEANSGSHALSSSSLCRVVSINCAEAAFARLMDEQAAATNTIAD
                     LRRTLVDKEVDLTNLRSAMDALASDLISERDRADNLSAAIDDASEKIASAQAEFEEQL
                     RQRTAATTAEVVEARRAEARATAAQLRAEEQLAVVEKDLKEQEGVLRKLQDENHRLTR
                     EADRLLRTSRLEPSSRVRSNVSGSVTPKSLSLSAASAEDAVQRFTTAPSTLEAVEQAQ
                     ILQVSSLQADLLLSRRQARELEGREATLRQACAALEQQVSELRVEAAEAEHLREDMAT
                     LRADYAELEQRYSELERMAIAAGGGTMQELKQLRQQLKVREVELEELKARMRDLVLSK
                     AAPELEAARRQEALRESLSGITTQLAATQAQYGGGTGGSSTVRSRRASLTAAVSNSDL
                     LSLSSSRPSPQDVLTSRIEHLQTLVNDRDVALEKVQAAQLESRAAMDTLEDQLAAKTA
                     ALERAEGLVAEYADSVNNAFTMAAVVGRGNRGAGPTTVPPLSSEMGSPDAAALSASVP
                     PLTPLTPRTRAAVNGQPHAAVAMASPAPRMPNLDEVADDSDGSGEGKQAGSAGPSTDS
                     APPPVTHRRTRASGSWRDGKSCPAHRPSSSTERSAPSSPSNVPGRKSFASASVPATTR
                     KRARSRTNT"
     gene            complement(<788294..>789409)
                     /locus_tag="LMJF_27_1830"
                     /db_xref="GeneID:12982774"
     mRNA            complement(<788294..>789409)
                     /locus_tag="LMJF_27_1830"
                     /product="putative GTP binding protein"
                     /transcript_id="XM_003721942.1"
                     /db_xref="GeneID:12982774"
     CDS             complement(788294..789409)
                     /locus_tag="LMJF_27_1830"
                     /note="previous protein_id=AAZ09931.1"
                     /codon_start=1
                     /product="putative GTP binding protein"
                     /protein_id="XP_003721990.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982774"
                     /db_xref="GOA:E9ADG1"
                     /db_xref="InterPro:IPR004396"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR012676"
                     /db_xref="InterPro:IPR013029"
                     /db_xref="InterPro:IPR023192"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9ADG1"
                     /translation="MLRRSVVLWRRRAAGIVGLPNVGKSTLFNALTCSQIAKTGNFPF
                     CTIDANTSKVPVVDPRLRQLAQFTQAEKVVDVEVDLTDVAGLIAGASKGAGLGNKFLA
                     DIRNCAVLLHTVRCFESSKEGFDTPNPLEDIHVILSELVLSDLEVVEKRMRKLQKMKT
                     QDVEYSFLKRLQQWLEEGKSAADMPAKAKLTVAEKGLLQSYDLLSYKPMIFVLNVDER
                     GVKDGNAFSREVEAAFGAERTCRVSVAIEEQTAQLASREEQLMFLEEYGINGPRGQVL
                     MKHVYALLKLQSFFTVGPKMARGWTVAQGSTARQAAGEIHSDFEKNFVRAKVMAWDTF
                     IGKPNLESAEMQMRTVNDRYVMQDGEVFIVEHNTQRG"
     gene            complement(<790180..>795354)
                     /locus_tag="LMJF_27_1840"
                     /db_xref="GeneID:12982775"
     mRNA            complement(<790180..>795354)
                     /locus_tag="LMJF_27_1840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721943.1"
                     /db_xref="GeneID:12982775"
     CDS             complement(790180..795354)
                     /locus_tag="LMJF_27_1840"
                     /note="previous protein_id=AAZ09932.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721991.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982775"
                     /db_xref="GOA:E9ADG2"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR020422"
                     /db_xref="InterPro:IPR024950"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:E9ADG2"
                     /translation="MGNRVSTAAAPFSLEDLEALARAPSLFDTLPNDAGNSAGSGASV
                     LFRKEIIAEMERQYAECDTSLHALRCVPDRRGTRHHLGSYQATTSPAPSGGAPRATSD
                     QVWGKQSAGVPIPSLGDSMTTNRSGSTHDLLRSPRELHGSRHSDPNEVADSAEAATAA
                     ATAADCSLPNASNDSFPQRHVSSCLGALPESASAETPLSPRSWLFREVSVQPVDLTRR
                     AEVKAAEVYVLVIVQRSTMLGTPPTSTTPATPFVSVTNTRSATPPPSFPSAAAPSGAA
                     RSVATSAAMSANTNTEWPRDMVQLFTPRGLATPFSSNMMRPTLANISHGSGAGYWYSP
                     SATPRTNGSTSGRPTPRSTTAAVAAAAPSSAPGNGSGAGGFQQASSRSASSQATPRAT
                     SFHFSVHLLTGKQADAMAAAAGLFTARAIEKLFLDCAEFDRRLFYNLHAAKVEDVIRA
                     YSMHPTLGVSSGCHDSDSNVDAAGRNRRRSSKASSNVSGGGAASAVITANRMGRDVSD
                     SNSGFGTSNSFLQHPISTLGASRELRRELLAITRPSSVAVPVMRFDKRSSTAAPYTTL
                     PVSSGCHTGTFGGVSDHVTSTAVSSNPAELYSLNAIYRVLNGVRVGTPRWMHTCDVAS
                     PLHSARYSVPGSASGAAAGGSSTSAALFGAGNWCPDPLSSFHPPRRNTHGDGAAAGAT
                     ITSGIMPPIPSLNISSWLQGPQPLHVHRAAPAGTAATGPAGSAHPTATGSTTSRMGRP
                     LRHSWTTHSASPKTPPLLLPTLASGTLSGDCRVDSAIPPDASSAPPATLTSATSATQA
                     LVFSLPLDSLRPAAPAAAVAAKAHSTLRSASAAEGSTNASTLSPQAAAVPKLQPLINA
                     EEKEQREKSLQHTSGPVRAPDLSSVPLNRKDTAQLESCPAESHLHTRHQHHRSDEGGQ
                     DRDKIASCHNVGTENVSTSCYRVAIAPPFGDDAECNEVYNQQERAQRLKASQPEVTQV
                     LPYLFVGGEDAARDRAQLLRKGITHIVNTVSWCIDCFYPHLFRYLTLSLSDAADEPIF
                     SLFAVVNAFIEDAVEKHQGRVFVHCQQGVSRSCTLVIAYVMWKQGLCYDRAYELVRAR
                     RKVCNPNLGFFMNLRLWEAQLSTPLLNSVFAYAPYTSTSPMPFSYQLTAYFDCATSST
                     VPGAVAFRSSLPPSPPSPCSAEGRALGLLSPRDKEAHQQLRSDVLTRAADMSGAPLTL
                     PNTLSLDPRLGYLFLFAPGARAADEASSADAGRSKQKDKQRPRLSRGTDVLSGADPGG
                     DEDFDVVTGCVVMGSQCLNKVYSERALAACRQVLRFSFYHGEARTSVTNAGKTVHFNP
                     MRQVRLLPAVSPASWPRSSFPFRVPTAAVSVEVAQRLLSLHVASQVRIRFVRQSQWDA
                     FFSNVRLGAMLSCYTAEEGRLGASEGVRRHARKEATKGVGASSSGRVSGGQQTSATGH
                     MTLLSNPLLPVNPPASASSSFRAGRHTPRTPRQLHVSSSGNGGSLRGGSEGDQLAGSA
                     AAYSSSTGASASQYRNCADSLPAAAAGPVPEPAASQPQHVSLPSAASSATATVFTPSM
                     GPAGVSLPLRGISDLSLAAAAAGNGDEQTHVAVRMAEGESFAYAYPFTAGTKVAVADL
                     EDLEEDRCYALGFQQRIGTTVYLWHGADAVESSADVVGAFVRHLLSSSEPAVQTATVE
                     SLEAGEWTNCSIIFPGDSADAAGVAERADAATEVLADVRVLYVEQGDEPKEFFTLL"
     gene            complement(<797490..>799838)
                     /locus_tag="LMJF_27_1850"
                     /db_xref="GeneID:12982776"
     mRNA            complement(<797490..>799838)
                     /locus_tag="LMJF_27_1850"
                     /product="paraflagellar rod protein-like protein"
                     /transcript_id="XM_003721944.1"
                     /db_xref="GeneID:12982776"
     CDS             complement(797490..799838)
                     /locus_tag="LMJF_27_1850"
                     /note="previous protein_id=AAZ09933.1"
                     /codon_start=1
                     /product="paraflagellar rod protein-like protein"
                     /protein_id="XP_003721992.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982776"
                     /db_xref="GOA:E9ADG3"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR007824"
                     /db_xref="UniProtKB/TrEMBL:E9ADG3"
                     /translation="MAATVSLFERNKRVYLEEESKLQAIVSSDQFLRTFQSWLDQSIS
                     QLDFQYERCEQQLSELQQHVTAPKGAFWNSKAVIEHCNLHMAERRLVRRNIELDGDQL
                     AELPAVIQLVSTLQQTKSHSFITPKQRRFIEECEAELKSVVFEPRDLVFITNALQTKL
                     IDDGNTRGVFGDLTVFQNAIEELSPDIDQCEQLLETSIANGEMGLAEDISKRQLDVYE
                     HILRLITDQYPTISNYYAQSRNSERRRRWAVFRMVDRDITAVIEAKHRQIEACEEDML
                     KIQEQMTNYNSDDAQQRKRYEADRAESDEFLQQNKEKQQSVWNRIFTLFQDLQTCSSE
                     LATLAQQRRKEVERRLEMEEREAGRRSGHESFLQAAAEHAQKLQDTINNAAAARDVAT
                     SLNDFALDGCDNIAAKYDKQQNALGEMLRLVQQHHFKRFSDYYIAASRYLYRKERRLT
                     QMDEEMRANTMHREILSDTLDPHAKEYVEADQRLALQRHEVAEEVMRIRHKLERAERA
                     VTPTLRSLDFAGIAYVHPRVIVEKMNLSRWSTMLDYRTLINSESDGAATVVRETAAIE
                     KLRGDIETQKMSTRNQHRRQQRLCNARSVGDMTSSRTRGSAQHADGAAGIKSTVTGTS
                     PAKSSPLGFVERVHAMIQQDGTRSGGVSGTNTSLSSKGTAGGATTSPHTSRPVAYSTT
                     HVVNSNGSVIHTSAANAAAAVSAAPAAPAPPPTHMEGATFQALFDYRARAPDELTFEA
                     GQQIVCISRAPEEGWFKGVCNQRTGLFPINYVQSVRETPETL"
     gene            complement(<801094..>803688)
                     /locus_tag="LMJF_27_1860"
                     /db_xref="GeneID:12982777"
     mRNA            complement(<801094..>803688)
                     /locus_tag="LMJF_27_1860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721945.1"
                     /db_xref="GeneID:12982777"
     CDS             complement(801094..803688)
                     /locus_tag="LMJF_27_1860"
                     /note="previous protein_id=AAZ09934.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721993.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982777"
                     /db_xref="UniProtKB/TrEMBL:E9ADG4"
                     /translation="MPGRLKAAPSEVAFTRRFILSPHRRQPVHCHARHSPVRTPYPSY
                     AQPSSGVAPGGSSSSHLHQRHHYHDPFIHRSADDSPMKCEATLSVLAPPTPATDAAHA
                     RRVKHGPCSRAHCLHSAADASAQQQQGPPEAQGPPLRSRRWATDRAAVEDRIPEAELA
                     RHHRGPQLSPPSSPLLGSPSRTATPTADIIHFDASSSRPLSPRRPTSRLQRLLRQLEA
                     EAQRTGCTVTDAADGKRDNVELYQALFLQALADGAAWERHARVLEAGAQASAKREAHL
                     KRQLRHLRRSVELLVAYVKGSERVVDVLGRGIACGTGASTQTERAAPDGTPPMSPGAL
                     AAPAAAAETMVDVASSSPWRPASLSAVSELVRGSFGRSSNLVYGISGSDSRQGEDDAA
                     LRKMDGRSRAAVAKGPGDLHELDDFHSESLAPVHEVVEAPRDQPLWDGSWDDVGTGVH
                     ARYEVSAAWGDKDRGAAAQGLRGGGTEAFEMRTPWSRTPPAAIPASGMAHRESTSSPL
                     HRGTAARAAAVLEGGTSLHATLPSPLSSWLGHAATMNAAMETESVTHESTPLDAAAAA
                     PQVAPMSAAQSLLELLRSRDTSTRGTAALGPGLVDTSRGTISKAVSQIAAAHQHDDHG
                     VTVTEATHSHSSSDVAHLNCAVPVRASSFSSASRPPLTPSCSSIPRQSSGPQGEALPS
                     HPASLPSLAPSSPPRPHSHSLATSPPQMSRVSDSGSSSRAPTAIEAAAAAPIAVAELV
                     RTSSPAVLSFSSHQTFTNLAATHERDVSVAAQPDDGLAYSSNDWEFLETANFADGFGA
                     SSSSSPARRLEETRGGHHGLASSDSSNDTNDDKMTDERDELANGDGYTEWRTQLEAHL
                     NHGWVSGM"
     gene            complement(<806164..>808122)
                     /gene="TRYS"
                     /locus_tag="LMJF_27_1870"
                     /db_xref="GeneID:12982778"
     mRNA            complement(<806164..>808122)
                     /gene="TRYS"
                     /locus_tag="LMJF_27_1870"
                     /product="putative trypanothione synthetase"
                     /transcript_id="XM_003721946.1"
                     /db_xref="GeneID:12982778"
     CDS             complement(806164..808122)
                     /gene="TRYS"
                     /locus_tag="LMJF_27_1870"
                     /EC_number="6.3.1.9"
                     /note="previous protein_id=AAZ09935.1"
                     /codon_start=1
                     /product="putative trypanothione synthetase"
                     /protein_id="XP_003721994.1"
                     /db_xref="GeneID:12982778"
                     /db_xref="GOA:Q711P7"
                     /db_xref="InterPro:IPR005494"
                     /db_xref="InterPro:IPR007921"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="PDB:2VOB"
                     /db_xref="PDB:2VPM"
                     /db_xref="PDB:2VPS"
                     /db_xref="UniProtKB/TrEMBL:Q711P7"
                     /translation="MSSLQRASVSFNKPGHIPFGAVQGYAPGGVPAYSNKHDHYFSGE
                     RNIEDNIFFGFKYQCVEFARRWLLVRKGLLLPDVNWACHIFQLKEVRDAATTESFAVL
                     QVRNGTTTKPEADALLVYPSTDANPVGHVGTITEVGDDYVCVADQNYRFHKWESSCAY
                     KLKLDHRDGIWTIIDDIDADEIEIPLGWLTFPGRANRPEGAPPVALHPSLHFKEPPKP
                     YLLRRNFLPTESKANWLDMNNPAERLFVEEFGMDVSRTRLEEKVVSYYESNHEFHLRC
                     VAYGTQLHAIFMEATAQVIESDEKLRLFAIPEEFWPRIRHSWKYQQTYISGRFDFAFN
                     NETGEVKCFEYNADSASTLLECGLIQQKWAESVGLDKQDTRGSGFAVERNLKMAWANS
                     GATGRVHFCVDEEREEQYTALYCMQAAEAVGLEGKLCILFDEFRFDDNGHVVDSDGVR
                     VRNVWKTWMWESAITDYYAAREERGENWKPSPKDKVRLCDLLLGDDWEILYFEPMWKV
                     IPSNKAILPMIYHNHPEHPAILKAEYELTDELRKHGYAKKPIVGRVGSNVIITSGDGV
                     VHAESGGKYGKRNMIYQQLFELKKQDDYYAIIGGWMIGDAFSGTGIREDKSVITGVDS
                     PFAAVRIKTDKLPHPVTLKDIDKMAEDE"
     gene            complement(<808814..>810388)
                     /locus_tag="LMJF_27_1880"
                     /db_xref="GeneID:12983023"
     mRNA            complement(<808814..>810388)
                     /locus_tag="LMJF_27_1880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721947.1"
                     /db_xref="GeneID:12983023"
     CDS             complement(808814..810388)
                     /locus_tag="LMJF_27_1880"
                     /note="previous protein_id=AAZ09936.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721995.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12983023"
                     /db_xref="UniProtKB/TrEMBL:E9ADG6"
                     /translation="MTFNRPRGRDTFSAAFESRLRIVPLTQMSDLYGPIDVSLLTAVN
                     ADDPTSSEGNPLERKKCMAGDARMRKVVEDKQRAEAALREKRDWHVLVVDPIELRMVP
                     APLPFPSPHPAYYRDWVTLEGEQPSFSRVLERRPTAEFGIPMLDAPAGTTGAGTGAAL
                     AADAAADVADGTVANVAAPESLAFFYTSGNRRHLQQNGDTTLLPGAQVRQTTPIIPNS
                     ASTAAQPLLSSLQTIRQHFHTAVCIDPDISHDRFHREEAQVEMISAYRNILYEAFELG
                     HASSSVSSASAAGSLRWTAVTQGTVPFVADVVRVPALCHYSCGRRFLRELGKLNQQAV
                     VKGFHRLSNEAKEALIMNRSFTVEIYVPPMLLEQFERAFLEEPWEVPLSTLNPGRTAL
                     YPGLAPPRSLLEYDGWVGKRPELVEGVATQGKSLLRGAKVGLDGRLIEEREVLASLRV
                     FGAREEQQQMLEGERKTAAEQLGVPLQLTYAPLQAGLLAEVEPHASDALPEKPSGGYT
                     GGDPAAVATSAAESAK"
     gene            complement(<811565..>814126)
                     /locus_tag="LMJF_27_1890"
                     /db_xref="GeneID:12982779"
     mRNA            complement(<811565..>814126)
                     /locus_tag="LMJF_27_1890"
                     /product="putative endo/exonuclease Mre11"
                     /transcript_id="XM_003721948.1"
                     /db_xref="GeneID:12982779"
     CDS             complement(811565..814126)
                     /locus_tag="LMJF_27_1890"
                     /note="previous protein_id=AAZ09937.1"
                     /codon_start=1
                     /product="putative endo/exonuclease Mre11"
                     /protein_id="XP_003721996.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982779"
                     /db_xref="GOA:E9ADG7"
                     /db_xref="InterPro:IPR003701"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR007281"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:E9ADG7"
                     /translation="MSESTFKILLTTDNHLGFAERDPRRGDDSFTTFEEVLRAARTEH
                     DVDAMLLGGDLFHENKPSLGCLVRTCSLFRKYVFGNKAVPFSLLSDPASNFPTHALPM
                     ANFQDPNVNVALPVFAIHGNHDDPVGGTSSLDLLATNGYLNYFGHVTSLEDIILEPVL
                     LRKGSTFIALYGLGNVRDERLHRCFRLKKVQFVYPKPVPGCKWFNILLLHQNRGARGV
                     ASKNGIMEGMLAGFGMDLVIWGNEHEQLMVPQPADGFDVVQPGSTIMTSLSAQECNPK
                     QYGILEVRGTSYRLTPYTLRSVRPVVRRTVELRQDLPDGRTLDAVETFLHSVMSDMIS
                     EAEEHVSHIPDDVLAFHPNLKYPLIRLAVDFTDVTSAPYPQPNFNRFGQQYMDVVANP
                     GELLRPVKPKPERRPGGGALGTALGPGGVAASGLIVPAAPQLNTLDIRVKVADVFNHN
                     TTNACTLLSEAELSAAVYAFAEKGERDAIDERLMELLHTSQKSVWRRLGNGANDSILK
                     PDRVAEEVATHKRHVNERYARAAQLEEAQQQQMDDAKENEDDGVANEREGRGGAASPS
                     LHQAARRRELDAFEMMRVAAPPADLTTSHSGSGSENHFHGHFAQTPVSRLVQHAIQQG
                     NENDVDAAVGAPGQRARRCSGVFVKAGADGDGQDDESEELPDDGLDRMPIDSVIAQAV
                     QQVYPPSKRARSAHVCDVEAISTGDKGSSCGVGGGGPHEASTVHVFDGNDDDGSRVHG
                     ISRRGRARNEAGNAGKAPAPAKKQQRTTSARRGGGGGSAAARQGALSAANAGSLNAAS
                     ATAADAGPTLTFVAHQGVSAVLPPGNRPATATSSGGVGASKGAMVNLLSKWTGGF"
     gene            complement(<815529..>819062)
                     /locus_tag="LMJF_27_1895"
                     /db_xref="GeneID:12982780"
     mRNA            complement(<815529..>819062)
                     /locus_tag="LMJF_27_1895"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721949.1"
                     /db_xref="GeneID:12982780"
     CDS             complement(815529..819062)
                     /locus_tag="LMJF_27_1895"
                     /note="previous protein_id=AAZ09938.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721997.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1895"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1895"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982780"
                     /db_xref="UniProtKB/TrEMBL:E9ADG8"
                     /translation="MSSAGSAAPPPPHTSSFGADVELPMSDWALRLQRELMSPVDPLG
                     GLAHKDYYRDPATGYAPQYAPRDFVHGGSIAYPHMQGSGSAHDSYAAAAARRNWLEHD
                     VESMAFMSQDARATARQLSSDAEREAFTQRHVPADRHRSAFPGNASLAAMDQLRTSGP
                     QSDEKVYQQAILDRYRAAATSSSSSTAPGVSYTAATGLSGGELVDALAEDYAAAVDDG
                     MDEELRIAHGLRAKERFDFKVMQRTSRVPFQGYDMDRFAAQREGRPHGAQQLPPVIPP
                     SSMEEAMKNMRGGAAALLDTEAQAWQTYAQNTTSEEPKLGEALTGDVINSLHARRWSA
                     QHAKEQARKQRFGLGRQGALVQDGGPDRRTLKKHTNDERLLDAVNFASDAYRRTITDE
                     HVDPYVRRSTERGVGHLLTNSFDMARREDRVAHGQQDLTERNTVHYGVPIQQSIDEFV
                     LSHRNARGERPLDYFKPFPDFRAQRLIRMYRDIEGFSLLKQRPEAFEWELFTRYRAHH
                     QQRRELALLHGLEPVANETAAERTARRLALDELCEKTPFDPSKLHLNDDEVEIDAETL
                     RNWFGVYVLPSPTIVESVVRAEGGALNLHLQHAADEMNTADTREHILSSRYMNRLLLF
                     EGFQHRWNRGFTKEVAGKAPEPVIKYAQPQEVLKYFDSDERAMYQQYVQQESDAQLSE
                     WAKVTRGRRYIAEKEQYGEVAGQGYKVPVVDVQHQETGAVLTVSSKLVEKSAAAALAD
                     KKLAGGSSSSTTSSSSMVHFDGQAYFVLPGSKRTVTPLSIRLESGESMEMTDEVFSAY
                     PLEVSASAKYNHALNYGIGEYDYNRGNYIETQDAIWEKATADQEEGWSPATHADGLCP
                     GLPVRARRRLAAAGEDKTGAAITGDFQRGRIVQYYRQPFFNPDPRLVTVAFYADGVVQ
                     EVPLANVMIWQRRYHGPERTVGDESRRYNPAGLRRYIDVADPNNKKLSPSSSAGAGAN
                     GAGDHFLEKYEGRLTNSVAASRYRTTKQITEIDQWNRFDTSRADNHRPLSISHRRDYV
                     RQGYLPRYTPWEWIAIQEADQPIIHETMRTDNIGASYFFSLNRSWRYKARPHGYLRNY
                     ENEVRDMLQFVDGVTPWKQAQKIRTYWEVRQHHPMPQFNRPEVAMHRNSAGLLPSHMW
                     EMDKKTGKVRAVKDSVRDYQTKIPVPKWVQL"
     gene            complement(<821156..>821893)
                     /locus_tag="LMJF_27_1900"
                     /db_xref="GeneID:12982781"
     mRNA            complement(<821156..>821893)
                     /locus_tag="LMJF_27_1900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721950.1"
                     /db_xref="GeneID:12982781"
     CDS             complement(821156..821893)
                     /locus_tag="LMJF_27_1900"
                     /note="previous protein_id=AAZ09939.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721998.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982781"
                     /db_xref="GOA:E9ADG9"
                     /db_xref="InterPro:IPR008564"
                     /db_xref="UniProtKB/TrEMBL:E9ADG9"
                     /translation="MNQDTKPNFYFSSESAVAQGGADFVGERNPNYTATPAGESDGQT
                     IPANTTDHGGYKGVHPIAAFFHVCFKLAAILVFLLGGVFGLKYVLILVVTILLLTADF
                     WTTKNVTGRILVSMRWWNEVQEDGTTQWIFESSPEADQRVNAYDNWFFWVTTGANCMT
                     WVVLLFLNFLSFKYLPITLAGVLLSGANFLGYFKCRRDAQQKVTSFMLSQAAARPQAA
                     GHVASFFMGGGGGTNTNTAHGGGNANQ"
     gene            complement(<822979..>823401)
                     /locus_tag="LMJF_27_1910"
                     /db_xref="GeneID:12982782"
     mRNA            complement(<822979..>823401)
                     /locus_tag="LMJF_27_1910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721951.1"
                     /db_xref="GeneID:12982782"
     CDS             complement(822979..823401)
                     /locus_tag="LMJF_27_1910"
                     /note="previous protein_id=AAZ09940.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721999.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982782"
                     /db_xref="UniProtKB/TrEMBL:E9ADH0"
                     /translation="MAEPITNENLQILLTKLMTDRFCSQESSDLDACIQNFVPQHIDG
                     SYVDQSLQRRGIRRCKPYQEIARKCLEDDKKQTAIFRAAAVAPTCKNEQRALQRCQRA
                     KGRDCEAEALETVYCGMVYLVQRQKERQSSAAAPRLAE"
     gene            complement(<824377..>826395)
                     /locus_tag="LMJF_27_1920"
                     /db_xref="GeneID:12982783"
     mRNA            complement(<824377..>826395)
                     /locus_tag="LMJF_27_1920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721952.1"
                     /db_xref="GeneID:12982783"
     CDS             complement(824377..826395)
                     /locus_tag="LMJF_27_1920"
                     /note="previous protein_id=AAZ09941.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722000.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982783"
                     /db_xref="UniProtKB/TrEMBL:E9ADH1"
                     /translation="MQTYEAGALDTANRHAMPGSSAPLPPPAEHLAAEGIVSATPLPP
                     LPTNAHSLRQPLLLDIAFVGKAYALLQYVALVLLTATVVLLTVFSFNRSHVSHVEDAT
                     ACNRYPFDNVIPPDLAFSLICFLLNGVFAVRYAVRAVRYEKGGLLVVQVVVVALQVCR
                     AAYFLLFVARRCMRVSSESSSPPFPRPLWPSLRAGTRGSIASIFSSGVDTSGIEGAFI
                     VDNPAPAAGSVPQPLFTLTCASIVASVSLFLTASVLSPWVYASFGWRRYAQGIVQVSL
                     SRVRQRLTVLRTCVQLDRVITANGYLATVFLLDSWPDQRTLLLMTLATFAVHYFLIPM
                     LRRSRHWWPLLCAAGVLVTVSAYYAAVIGGALRKDHRLQSVSSSPWHSECYTDRLRKC
                     LYEISAEYPVSIFRDASAVDSDGALRLSYNQHERARRQAPLATVRRHASPFDAAHGAL
                     WRHGSRDARVSSGLTSPFFALAVPSRSALPLRRVNNATDTYLPTYGAYPDYFRIQGCN
                     ATCFLAREEHDNIFFERRIAGCCAEYGQCRLKDDYRTYAVLLLLVLMLCSSAVRVVLL
                     AVAWRRWVEEDDVTIALFVQAHCRCHHLGGYCRQRRYTRQEHGHRHRRAAAAVGGGGP
                     ISQSPRRPHASHAATFSASPPPTQNLPWDVEQYVAWRQRQQRTAESTI"
     gene            complement(<832759..>833823)
                     /locus_tag="LMJF_27_1930"
                     /db_xref="GeneID:12982784"
     mRNA            complement(<832759..>833823)
                     /locus_tag="LMJF_27_1930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721953.1"
                     /db_xref="GeneID:12982784"
     CDS             complement(832759..833823)
                     /locus_tag="LMJF_27_1930"
                     /note="previous protein_id=AAZ09942.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722001.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982784"
                     /db_xref="UniProtKB/TrEMBL:E9ADH2"
                     /translation="MSAHNPKAVAAIPVAVIPPGIRRATLSMEAHERNHLAIGMGGEK
                     YLVVHPTYSLAPHLYRRRLLGAVLQTLLEMAVFLFALLGLCTPCIIVHQRKYFALLGG
                     YGGPMTDPPGRNVPLIACSVLMIVLFGFALIVSVTVACCLRCDQRAHVSEELFNRELL
                     ELYGAQVHEDGRVHSAGGEPSVLKDEGMWGPCCGFEANERSRRSRNTGISCLQCIVVA
                     AGLILEGVVVYNMRWMYATAVASGKTATYENGFFVSVFALVLRIFQLLFYCYMAFHML
                     YMGFRRGMPRCQLIRASGSRAAGILSAHGEGASCDEQRAKADSESGYPSKPRYSAVDR
                     EGDREMEHIPSACTTLNSCS"
     gene            complement(<834736..>835515)
                     /locus_tag="LMJF_27_1945"
                     /db_xref="GeneID:12982785"
     mRNA            complement(<834736..>835515)
                     /locus_tag="LMJF_27_1945"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721954.1"
                     /db_xref="GeneID:12982785"
     CDS             complement(834736..835515)
                     /locus_tag="LMJF_27_1945"
                     /note="previous protein_id=AAZ09944.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722002.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1945"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1945"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982785"
                     /db_xref="UniProtKB/TrEMBL:E9ADH3"
                     /translation="MLFGNEAPFHLKPIPYRGVRKHQAEVLQHPPGYQHPIIPLPPCS
                     ASEVTAVRPSASSTAAHLLRSSAYLSPASSVNSGSTPGTSSCTSSNHHAVGPATASAL
                     HRVAPPNLLQQQQHNPRMRRESGQGGDAFLADAERLDPDMTADAALRQERVCERRKLL
                     AHQQARRERAALREATLQASRNAAFEAECRRLANVAGTARSNREQDDRDPITHQCYTA
                     EAEQLLMDRNSHVHTRYAARQRFLDRQMNSTEYNILTWQLR"
     gene            complement(<837247..>840129)
                     /locus_tag="LMJF_27_1940"
                     /db_xref="GeneID:12982787"
     mRNA            complement(<837247..>840129)
                     /locus_tag="LMJF_27_1940"
                     /product="protein kinase-like protein"
                     /transcript_id="XM_003721955.1"
                     /db_xref="GeneID:12982787"
     CDS             complement(837247..840129)
                     /locus_tag="LMJF_27_1940"
                     /note="previous protein_id=AAZ09943.1"
                     /codon_start=1
                     /product="protein kinase-like protein"
                     /protein_id="XP_003722003.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982787"
                     /db_xref="GOA:E9ADH4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9ADH4"
                     /translation="MQVNSLLERMRKVRQEKAAAAAAAAATATAAAPLAVTNATATVP
                     AANAASRDAPVSSAADADTAGGGGVVSSSFLTGVTVPAPPPVFASPSSARLEYRDNAR
                     DPLCVPFTCDMVVPVLNALLSDHQRGSTSTVAAATSGGLNGAVVPMMMEAVDSIDATG
                     GDARDVSTLSSASAAIPGAGRDSSGKENQPIVVAKAVVRMREVLAALGPPQMPQKTTV
                     ESVPSITTTGTATAASASVSSLRPSSASLFADAAYNTACAVARVDVSGAIRPICRDVN
                     YYTRVGRISQGVYGVVFRAVTTADYERQHRQQSRHRVARPGSAASSAAVPSARVRTYA
                     LKHIKKMWLEDSQVGLPPYLMREIDLLLRLQHPNIMGALELVLLDPTPVPRRLASPPE
                     SCSPSSSSESSSSSSSSESPSTEQHAEEATECDRALRRLRSTTEDTAGQNLAKKAKID
                     NAEEPPPQREEARPATQAQPTGEKGTAQDAAATRPLAAVGAASKAKDVFLVMDYCPYD
                     LGSYMRRYATAAELHGDGGDCKSTRASAQVPYFHITPRNAHPQAAASYVARAKSIVYQ
                     ILRAVAFLHDSRILHRDLKTSNVLLREDGYVKVCDFGLGRLYREGQALTPTVVTLMYR
                     APELHFGVVDYSHKMDVWSVGCIFAELFLRRPLFHASTDSHHLLAVCEVLGIPTEESF
                     PGLYHLPQTKTMMQSLPRWNRTSRLASLFQRGAVLPTVAHGDVPVAAEGALLPESGVD
                     LLASVLQWNPRRRPSAAEALQHPFFKEEPLPCAPAELMRPMPWMDAAAAAGNAMPSSV
                     LVREDRRGQPGSRGSQDGLSTATQMAPSTTGRPSSESVPPAMQHVADIPSGVEATVAA
                     VSSASEGATAASPLARASPDTFPGGSRSVVVSDTVGGRYQQAIATRDYSGSDGDFAEE
                     DEEKQRLQLHTRRSTRDQAEDDDDSDAETERVGRQARLLANQDRDE"
     gene            complement(<841331..>845872)
                     /locus_tag="LMJF_27_1950"
                     /db_xref="GeneID:12982786"
     mRNA            complement(<841331..>845872)
                     /locus_tag="LMJF_27_1950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721956.1"
                     /db_xref="GeneID:12982786"
     CDS             complement(841331..845872)
                     /locus_tag="LMJF_27_1950"
                     /note="previous protein_id=AAZ09945.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722004.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982786"
                     /db_xref="GOA:E9ADH5"
                     /db_xref="InterPro:IPR000850"
                     /db_xref="InterPro:IPR007858"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9ADH5"
                     /translation="MKKVLVLNGDSYVGRHVVRAFHQSYEYEVEITRTRTDERAATTA
                     HATMRATSSDWLWGQMKGLWDSLEESLVAAAAADAADDSSVMLTGGSHRKSMRHAAPA
                     AGAAQLPTSPPRAGLSAEERNTLPADIQFCVSSIVPKHNDNTEEFRTRLLANDVVIAV
                     LQDDTYEAMCATRILAGTHYDVEKTFVLVSSAVTWADTLTSERARARTMRQREREEER
                     NAFLEELLDAEDEEKDDGDALGEGAAAVAEREARRAARRRELEQRLPLSLREPAAGED
                     EAELCELVPNRVFTDDAYAQRVPHPRFQHWHSLEHLVKRSNTETLHTYVVFAGLPYGA
                     GEGSDMLFGLLRSAWHHQVLPQYGAGVNEIPMIHVQDLASILYKVGSAYDVLEERYMF
                     AVDQGHVTQRQLLQAVQARFGGSVQPAVAVSSSVANATAVDLVRLDQLELPPPTSPQE
                     LFAAFGNKPCWGDGGALLTALVLSDIRAEPSTVLTMHAEDDWVALDGFLATLDVTCAQ
                     FRAAHAEAFKPVRALITGPPLSGAETVAALLAQRCRAPCVSRENIVADYKAHVADVRA
                     ALRGLLMRRLQRRRARAQARLVRQAAEEKAAERLAKEEQRRQRREERQQRGDTDDDSG
                     GEEELDEEGPATEEESEVGGAASEVASSASLMSIFLPPITKSGDSGSDDEEEDAMQPQ
                     QQQQQQQPLRPIALAVNEAYIRGPAVGVGGDEEGGAGIDEEQEEDEDDGEEGGSWLAQ
                     LDAQDEVAQSEMQEDRELLPPVPLSAAAGDAALPLLALPRFAARSRGRAFARDVDRQE
                     LRCIAALRQEYLLGLKVLALKVSAEGRLPRPPPTPAVSEDDGGYDYEDGRGGTSDGSD
                     EGSDEGSGQDSDEEGDEEAPSDGTPQASLEGRNDDAEEGEDENDDYESADPGDDTNPL
                     LAIDPADDGSAYLDCALAFMCRWRLRQSDCRCQGYILSDFPQTLAQAVLCFRANEAEL
                     EDAELRRQRVLAPLLARSDDHAAEDPHDADGEDGGALAPIDADFPLPDIANMEEEELL
                     ALERAHRRGRGPAGCSSAVCEVESTDDLTEGVAASGDAETVIEPVDESLFVDHVVVLQ
                     ADPAALRATMDALQTNLDLAAEQQASLTSQSGAAAIGSAGAALAALRASLHAIPYYAQ
                     LEWYMDHHTAASPPTQSLLSWLSAITTTPALGVQHARVIVPLSTSDGAADGEDADGVA
                     VTTMEAPPTTRIAHMHFMPMPVLNTEEVKACWCAASERKAQDGARAAGVGMAARTVAN
                     RTCGDECGSALVDTKLPVALMRLAPLCWTGAAAPQSPLLPSQAPSPSAHTPSPRGSCA
                     TSRRTPPPAASLAALAQDLCTRIAPVRREPAAAATTTATATPAASAETDGVSDTSAKT
                     APPLLVDAAAPASQVDVAAASEPPTDAPLKAAAASVSDAAATAAVEEERQARLAACSE
                     GEASQILHELASLRRLQIVESSPDTAEMLGMPVETYLMTYVMPNVTPVMTDVVRMRPN
                     DPVSTLADALFERRRRVTL"
     gene            complement(<847247..>848542)
                     /locus_tag="LMJF_27_1960"
                     /db_xref="GeneID:12982788"
     mRNA            complement(<847247..>848542)
                     /locus_tag="LMJF_27_1960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721957.1"
                     /db_xref="GeneID:12982788"
     CDS             complement(847247..848542)
                     /locus_tag="LMJF_27_1960"
                     /note="previous protein_id=AAZ09946.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722005.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982788"
                     /db_xref="GOA:E9ADH6"
                     /db_xref="InterPro:IPR029302"
                     /db_xref="UniProtKB/TrEMBL:E9ADH6"
                     /translation="MASTGNGGDSKAAASSLSPQKAGMVAPLTSAPPLTASTTSPSRL
                     NSMRTANASASSKNNAPTGPSKKGGTAVKPSPEVGGKAAAGSSEPEPRASVNIDRQSK
                     PNANSVNASNVADSTNAPSGKRPDHGRRGRRQECSSWFDAEKPAKADRPADKELNQNV
                     QIVQDDIPDAEQAHREQAERAQRQKEKLARHISESPTGFQATLPRLNELDVTNSWDKL
                     LRMMRSEFDMSCLTSCLARELDEDVAWNPEMLLVQLTSDMLDAAELQKDGGEAYVPVD
                     ASDIGQMTGGEVARRRKEKRSTTTAGGAAPAAGAAGGTEREPEKGSEKPAAASPTPAF
                     QAAASKALRKQTTTDPAAAAPSSKKARDTDNAASTSTANSSSTRKRSAAGSRSGEASG
                     GGGNNTNASSSTAKGDSADDTKSSKSTSLKAQVSKLFSK"
     gene            complement(<849728..>850063)
                     /locus_tag="LMJF_27_1970"
                     /db_xref="GeneID:12982789"
     mRNA            complement(<849728..>850063)
                     /locus_tag="LMJF_27_1970"
                     /product="putative small nuclear ribonucleoprotein"
                     /transcript_id="XM_003721958.1"
                     /db_xref="GeneID:12982789"
     CDS             complement(849728..850063)
                     /locus_tag="LMJF_27_1970"
                     /note="previous protein_id=AAZ09947.1"
                     /codon_start=1
                     /product="putative small nuclear ribonucleoprotein"
                     /protein_id="XP_003722006.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982789"
                     /db_xref="GOA:E9ADH7"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:E9ADH7"
                     /translation="MGKYTMLHNINKVLCVMLDDGRTVTGKLLVFDKHMNVVLGDAVE
                     ERPQSKKMAEEGVSSKRQLGLILLRGEHVVSVTVMKDSENGGSGAVANFGGAPKLAKA
                     TAVKRKRGA"
     gene            complement(<851294..>854068)
                     /locus_tag="LMJF_27_1980"
                     /db_xref="GeneID:12982790"
     mRNA            complement(<851294..>854068)
                     /locus_tag="LMJF_27_1980"
                     /product="putative FtsJ cell division protein"
                     /transcript_id="XM_003721959.1"
                     /db_xref="GeneID:12982790"
     CDS             complement(851294..854068)
                     /locus_tag="LMJF_27_1980"
                     /note="previous protein_id=AAZ09948.1"
                     /codon_start=1
                     /product="putative FtsJ cell division protein"
                     /protein_id="XP_003722007.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982790"
                     /db_xref="GOA:E9ADH8"
                     /db_xref="InterPro:IPR002877"
                     /db_xref="InterPro:IPR012920"
                     /db_xref="InterPro:IPR015507"
                     /db_xref="InterPro:IPR024576"
                     /db_xref="InterPro:IPR028589"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9ADH8"
                     /translation="MGVKSKKKAKTRLDAYYRLAKDQGYRARSAYKLIQLNRKYDFLA
                     KSRVLVDLCAAPGGWCQVAAQHMAIGSKIVGVDLVPIAPIRGVKTFVGDITDDKTRKM
                     IVTYLKKEPVDCVIHDGAPNVGGVWSRDLFDQNALVLASAKMACSMLKANGWFVTKVF
                     RSPDFHNLLWVFKQLFEKVEATKPQASRMESAEIFVVCAGFKAPKNIDPAFFNPQKVF
                     AEVGQEKIVSASGMLVTPKSNVPTGYEEFATVSHHVASFSDFLNADDPKGFLKTHHEL
                     RFSDDADKEYLTSKSSKKELVYLCGDLQQVGEADLRRMLRWREQLLREKIHRIQVDAA
                     GTEEDGDVDSMAGGNGSDDDDDDDGEGKRDYHFDFDSPEGVTQIARELLEIRKKKAKE
                     LKKKQKKVVDRKLKQIKGLINYDPNMSAEHMTETDGFAYKGTNTDAFDDDGDAAAGGE
                     DGEADELDHFTVEQLGLIPEKELAHIMDKTWIEPEDRGNDPLNPVMSVNLAAQDDWDL
                     GDKKDGDESEAEGDADGVLHSTQLVEGEEHFMDVDNYGNYVPAQRSTRVTLYEAGLEG
                     YEDSNDAEAADETPVSKKKRAKTEKDAAQLDEAGKSSKWERHQLNIEKVLNDTFPKPK
                     DHDRAKNKKQQRTLEEERIIMSAPTEMADPDKRKHVRTRFENKDNDDDSDDSVSELSA
                     ELSDGDLDDYEINRGREDSRRKRKLIPDIGKVTTQELIRQQRKQTLCDNKEVRKQNKR
                     NKNNANSGRNSSGKQDTEFEEIPIAMTDPDIRARTLAIAQKMLDPKARREILDASVNR
                     YVFNDDDDLPDWFVKDEQRNCRVVLPVTAEEIEEQRRRFRELNARPSRKVMEAMGRKR
                     RKAQRMLRSLIDKGKADPRAREKAENLSVRKLMRSQVVKGQGKKRHKYLDRQLMGRMR
                     REKQKLKRRK"
     gene            complement(<855183..>858260)
                     /locus_tag="LMJF_27_1990"
                     /db_xref="GeneID:12982791"
     mRNA            complement(<855183..>858260)
                     /locus_tag="LMJF_27_1990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721960.1"
                     /db_xref="GeneID:12982791"
     CDS             complement(855183..858260)
                     /locus_tag="LMJF_27_1990"
                     /note="previous protein_id=AAZ09949.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722008.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.1990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.1990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982791"
                     /db_xref="GOA:E9ADH9"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:E9ADH9"
                     /translation="MEEDGAVGFLPFCLQRLRGPGRVRRVPPGTAYRSAGALLRRLLR
                     YNEDGEVRVEVVREAAGGVSLGAGCMERRQTAAAVAAASEEVREDQQHQHQHQQQQQV
                     AVTQRSQPKSQDTKSTRTKSQARRERASILAMETERRYVAEQESRLSSLLQALPLLRV
                     VPPQCLLQQAYTEELVPEPVSDVFTPPNIGINFNPSPPASLSAVVAHTDPSQLCSGSS
                     NSDVDGGGRTRGGNAGQRGAVTARDSYVCGANRLGLGFAVLLTPEEAAGLHETPPRRT
                     SAQPASSAATAVGGEVGDGEARTYSLDLLGTVNTTAAPSRAESLLTTVPEGAASMRTA
                     ATSRSTNIVAGKPPVSVEVAAESAQAAAAAAATLNGIVIDNGFGVTIKVGASCDEPNS
                     LRCVAWGGCRPTLLRAVVWRLLSDYAPAAVTRQKAELQRKRRQYEGYTRQYCSALTML
                     SLRESPSTLPSMSPLPRSHGGGGAASAPGLRKAASLSRLPGNGLPPNNGHGLTLSGGV
                     SPTSAVASLSPYERAILQQMLLDLPRHQSPIFHAGRSLAGMARCLFLWSQRHPAVGYV
                     QGMDDVVAVFYHVFLADALRQFARVSAQAATCARASHRQAAMHEGVQRTNGTAAAARL
                     DSGSDDDEGDDRDDRPASASGAELGSMVCDKGTRAVMRLLVSSLSASVQRKSRSSTGA
                     STPTELATPITVTTLSTPATRATTAAALSPYLSEEDLDVLSDTPAALDAILAELPESY
                     LTQVEGDTYWCAGRVLSLLQDNFMPGQPGILRNVRRLEALVRAVDPSLIVFLDGYGLT
                     VMDGCFQWLHCLLARELPLPLLLRLWDCYLAIGIGGDRAPPTTAAASGAHPTPSSLAA
                     AVTAQGSSASDEEIMYFHVCVCCALLRNLRANLLDNSSQTSTPTAPTAPGGRWGAAAL
                     ATVLPIFGSRTTHEEGSGAAAPSAADAAARSGTSSTAEPPIDVVMSTLKHPFEALFPQ
                     YASAKQQHPLDREDKHERCGERARARTLEAAMRWLDILIADAYCIWRKHQTHG"
     gene            complement(<861563..>862156)
                     /locus_tag="LMJF_27_2000"
                     /db_xref="GeneID:12982792"
     mRNA            complement(<861563..>862156)
                     /locus_tag="LMJF_27_2000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721961.1"
                     /db_xref="GeneID:12982792"
     CDS             complement(861563..862156)
                     /locus_tag="LMJF_27_2000"
                     /note="previous protein_id=AAZ09950.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722009.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982792"
                     /db_xref="InterPro:IPR008015"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:E9ADI0"
                     /translation="MTSSSVTPDQVLAFTAPTERFLCPLTANKYGVEFYQFTIRDIEQ
                     NKVLFEVGEAPDGSADGSVTDMLARVAQLSEEEAAAARTIRYRFAPSFLRKTAVGAKL
                     VFGVNGDQPVPKFRMIERHYFRNVLIKSFDFEFGFCIPHSTNTWEAIYDMPSLNPEWE
                     EAIVASPFEMASDSFYFVGNELIMHNKAYYAYDGEEL"
     gene            complement(<863056..>863811)
                     /locus_tag="LMJF_27_2010"
                     /db_xref="GeneID:12982793"
     mRNA            complement(<863056..>863811)
                     /locus_tag="LMJF_27_2010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721962.1"
                     /db_xref="GeneID:12982793"
     CDS             complement(863056..863811)
                     /locus_tag="LMJF_27_2010"
                     /note="previous protein_id=AAZ09951.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722010.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982793"
                     /db_xref="UniProtKB/TrEMBL:E9ADI1"
                     /translation="MPQRSHVPLASPSPLNAPPPLTSRPGPVNYCGAHAEPAAGLNYT
                     HHDDHRSVFRDQASCDPSPSQRALHQQQVHRPRAVSPGPHDGSAPHVSALVARGAVIR
                     ADELETILDEQNYIWQMEEYRFRTERQKRLTALQHRQHELMLESARYDQAVAEVERQL
                     ARERQRLEELRQMMARNATTSCSPIDREHGLQDPPTAMSDAPHVIARNSSAMHHGQAR
                     DHAYSAPHDAPYFPTGASDGLSAMNEEEVIAEV"
     gene            complement(<867867..>869348)
                     /locus_tag="LMJF_27_2020"
                     /db_xref="GeneID:12982794"
     mRNA            complement(<867867..>869348)
                     /locus_tag="LMJF_27_2020"
                     /product="D-lactate dehydrogenase-like protein"
                     /transcript_id="XM_003721963.1"
                     /db_xref="GeneID:12982794"
     CDS             complement(867867..869348)
                     /locus_tag="LMJF_27_2020"
                     /note="previous protein_id=AAZ09952.1"
                     /codon_start=1
                     /product="D-lactate dehydrogenase-like protein"
                     /protein_id="XP_003722011.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982794"
                     /db_xref="GOA:E9ADI2"
                     /db_xref="InterPro:IPR004113"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="InterPro:IPR016164"
                     /db_xref="InterPro:IPR016166"
                     /db_xref="InterPro:IPR016167"
                     /db_xref="InterPro:IPR016169"
                     /db_xref="InterPro:IPR016171"
                     /db_xref="UniProtKB/TrEMBL:E9ADI2"
                     /translation="MTYPLKQAEYNVGTLEERQAKYATCIAELRKVLKNPEKQLVVSE
                     KMLDLYSKDESHHMHVLPAAAVIPSSVEEVVAVVKVCAAHKVPMTPRGAGTGVEGGVI
                     PYAGGVVIDTAGLTSMNFDIDNACVWVGAGVRKLALNRAASERGFLFGPDPASDPSVG
                     GMVSTSGSGMSTLRYGTTRENVIALRVVTPRGDVVQTRQVVRKSSSGLELTQLYIGSE
                     GTLGIVCEVCFRLFPTTKYSAGGYAAFESTGDAVRSVVALRQRGVPQTLLRCELMNKG
                     IVEATNSYCKTALPEMAIVLLEFTGNDQGMSDIKRDYQYVEKIFKEVGKAKVMHYLRS
                     GKEMDDVWTARRTCHFSAMHSRGKTEKVFGTDVCVPISKLTEIIEYTEAEFAKANKKC
                     LICAHISDGNFHLVIPFSNKQEIAELRVLETKMIKRAIELGGTTSGEHGIGVGKVHLV
                     TGEHGQSHIDVQEAIKVALDKDNLMNPGAYYPFQQRLYPTAHL"
     gene            complement(<870625..>871830)
                     /locus_tag="LMJF_27_2030"
                     /db_xref="GeneID:12982795"
     mRNA            complement(<870625..>871830)
                     /locus_tag="LMJF_27_2030"
                     /product="putative branched-chain amino acid
                     aminotransferase"
                     /transcript_id="XM_003721964.1"
                     /db_xref="GeneID:12982795"
     CDS             complement(870625..871830)
                     /locus_tag="LMJF_27_2030"
                     /EC_number="2.6.1.42"
                     /note="previous protein_id=AAZ09953.1"
                     /codon_start=1
                     /product="putative branched-chain amino acid
                     aminotransferase"
                     /protein_id="XP_003722012.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982795"
                     /db_xref="GOA:E9ADI3"
                     /db_xref="InterPro:IPR001544"
                     /db_xref="InterPro:IPR005786"
                     /db_xref="UniProtKB/TrEMBL:E9ADI3"
                     /translation="MLLSRLWHQASAARGSRAPVVSFTAAALTKTLVTDPPPLPPMKG
                     VAFGTLFSPHMVIIDFSDGRWGAPAIVPFANFSLPPQTSCLHYATQCFEGMKVYADIA
                     DITRAARGEKLEKQSLRLFRPDRNVARLRHSMRSLCFPDFDEAEMLKVITEFVRTEKD
                     YVPKEHGYSLYLRPAAIGTADSLGATPSRSVRLFVIASPVGPYYLPPEGQSGAMAIKP
                     VTLLAEDKRKRAWPGGTGGSKLGANYAGPLLVQEEAQALGYNQVLWLGSNDEVQEAGF
                     MNFCTLWKTKEGKTELVTAPLDGTILPGVTRDSILALARSWGEFEVSERPYYMSELVE
                     ALQEGRVMECFGCGTAAIVSSVSMIGYRGKEYSVPLSEPSYARRFLNEITDIQYGKTP
                     SPWSVKVEA"
     gene            complement(<873101..>873784)
                     /locus_tag="LMJF_27_2040"
                     /db_xref="GeneID:12982796"
     mRNA            complement(<873101..>873784)
                     /locus_tag="LMJF_27_2040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721965.1"
                     /db_xref="GeneID:12982796"
     CDS             complement(873101..873784)
                     /locus_tag="LMJF_27_2040"
                     /note="previous protein_id=AAZ09954.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722013.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982796"
                     /db_xref="InterPro:IPR007277"
                     /db_xref="UniProtKB/TrEMBL:E9ADI4"
                     /translation="MSRHGYGYYEDDDKGSWWLQPKRAYRPFGPFRLVSTLMVAVAIG
                     FIAFGLACAVMFVAEVAEEHPSRTKGILRALIIFNFVVHASILIVDQMSWWRSLLSLL
                     VNVLYLRLLRSFPFVSGMNSPLVLATMLAVLLESAMWYWFALRLMYYTSMLLVFGFFL
                     MLWLVPIGLLSSCVIEDDQLPGGGGAGAMHSCLGSASGGGSSARDAMAGGRRRRTILN
                     RLADLINNA"
     gene            complement(<877243..>878409)
                     /locus_tag="LMJF_27_2050"
                     /db_xref="GeneID:12982797"
     mRNA            complement(<877243..>878409)
                     /locus_tag="LMJF_27_2050"
                     /product="putative ribonucleoside-diphosphate reductase
                     small chain"
                     /transcript_id="XM_003721966.1"
                     /db_xref="GeneID:12982797"
     CDS             complement(877243..878409)
                     /locus_tag="LMJF_27_2050"
                     /EC_number="1.17.4.1"
                     /note="previous protein_id=AAZ09955.1"
                     /codon_start=1
                     /product="putative ribonucleoside-diphosphate reductase
                     small chain"
                     /protein_id="XP_003722014.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982797"
                     /db_xref="GOA:E9ADI5"
                     /db_xref="InterPro:IPR000358"
                     /db_xref="InterPro:IPR009078"
                     /db_xref="InterPro:IPR012348"
                     /db_xref="UniProtKB/TrEMBL:E9ADI5"
                     /translation="MSSTEANLQPAAKRPREEDVEAEVARTSTDGAATDAAKTEDLVM
                     KPVAAGAEVLPADKVAEGTNAEEEPLQQENPFRYVLFPIQYHDIWRKYKEQESCIWTV
                     EEIDLGNDMKDWATLNDGERHFIKHVLAFFAGSDGIVIENLAQRFMSDVKVPEARAFY
                     GFQLMMENIHSETYSVLLDTYITDSEEKLRLLHAIQTIPCIQKKAEWAVRWIGSSASF
                     QERLIGFAAVEGIFFSGSFCALFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLYNS
                     HIKHKLPRERVLEIIVDAVNIEREFICDALPVRLIGMNAELMAQYIEFVADRLLVSLG
                     EEKHYRSTQPFDFMEMISLQGKTNFFEKRVGEYQKAGVMSTEGTSKKFSLSEDF"
     gene            complement(<879374..>880522)
                     /locus_tag="LMJF_27_2060"
                     /db_xref="GeneID:12982798"
     mRNA            complement(<879374..>880522)
                     /locus_tag="LMJF_27_2060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721967.1"
                     /db_xref="GeneID:12982798"
     CDS             complement(879374..880522)
                     /locus_tag="LMJF_27_2060"
                     /note="previous protein_id=AAZ09956.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722015.1"
                     /db_xref="GeneID:12982798"
                     /db_xref="UniProtKB/TrEMBL:E9ADI6"
                     /translation="MTQQRGKKAAPSKAAVANASASAPDPPPFFSMGPATFTDAIVIT
                     KVISVVLPLRHLRDRNILHTTLLKKLLHRPYEASAEDLAQQQLSQQETDDGGKHDCGA
                     HSALDNLAAPTSSSSSTPYVIVHIKSAEIHADTARQVNPRGDVQVNVMVTLVAARLQH
                     GICAGVSEASPFTSCMQVRVPTVAVSAAVAARGSTDDAATLLLGDALEAGADNVSQEG
                     VKDEKAEPSGGDTALDASVSATTTAAAAKRSCCTGIPADQQLRVTARCLEDEPIVPGQ
                     AVLLISEPAAMRCMGIRPPRAAPGSFYLTETTQPSAQFSSGEAEGGPEARPKKRARKS
                     RASAGGTGGATPARRIVSIECAIPKREEDGEGGAAAGPRKGPRKRPHT"
     gene            complement(<881582..>884140)
                     /locus_tag="LMJF_27_2070"
                     /db_xref="GeneID:12982799"
     mRNA            complement(<881582..>884140)
                     /locus_tag="LMJF_27_2070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721968.1"
                     /db_xref="GeneID:12982799"
     CDS             complement(881582..884140)
                     /locus_tag="LMJF_27_2070"
                     /note="previous protein_id=AAZ09957.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722016.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982799"
                     /db_xref="UniProtKB/TrEMBL:E9ADI7"
                     /translation="MQSAEALSGGSGTDIGGLNTGSGSRARTGNTRASETDAATEAQR
                     LRSEGARESRAGRGGCGDGRGNASVSGADVSIDLAEVLPPTRSPRPSAKRGTGGGGRS
                     ATARATDVSPLREDVVFSAEHGTEVPSERLAAYAAPLDVPLLTTVEEQKPHDSASDIP
                     AVVVLRHRMGCSMVVLAPHQRASYSRCDLENFVLYKEQKYNAVNVLWRFCILMLLVLS
                     FSVFCLVLCACTTEWLSVQNNDSFLSVGLFFSCRDGFQRTCTSWQSAWLEWIVVDNVT
                     GATLCRASAGFVRRFLGVMWTMGILQLLCEVVALFLGFRIAARPTRSGALVLLFFDLL
                     LSLCMGIVTVVLFDHYTSCVRRTCEGEHVSGDVCNVHYRYGYRLYIGAVSVHGLLLVL
                     ALSMHCYIYNIRVTSRNQLRAERHRISRSARAEDYTVHILNSSITSSVTRDAAGGSCA
                     RSTWDAARTTSQLDGNRSTRQPSIVASVPSSATAIISMDAVAGPPNSRRRGDQDGGED
                     DGANGDALRSVDLTSLQPAAPAPDTFLAGGVDFNVQSAHRGSGFGIDTATTAASTSPT
                     PGSLPLQHGELHVSFLGVPDDTGDDAGFGLLSGSQSRRYRQHPSVSTLSFDDGGARAA
                     ATAAATAAFKASDHNTDSSFVARGRSVGAAVAADGDNAQRPRRDRQRASPGDSSLPRT
                     GRQRSAGPQTEATESSLSSKQKQGLSDKRPAAAVYQQARKRQHKFLRFFNREYDSNYL
                     TAAELGVLIAGATDWVYDDRSDMYYSFDRNMFWDPLTQEYYNCALKSWQESPDQAVEV
                     RDMLDYILESPASSCSRRDSRFNHESNENSLMLMETTTSIATDGDDVNSSGGVH"
     gene            complement(<886292..>886540)
                     /locus_tag="LMJF_27_2080"
                     /db_xref="GeneID:12982800"
     mRNA            complement(<886292..>886540)
                     /locus_tag="LMJF_27_2080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721969.1"
                     /db_xref="GeneID:12982800"
     CDS             complement(886292..886540)
                     /locus_tag="LMJF_27_2080"
                     /note="previous protein_id=AAZ09958.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722017.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982800"
                     /db_xref="UniProtKB/TrEMBL:E9ADI8"
                     /translation="MEPQLTRKEVDVVLAEQELQGQLARVYYNLVLRQRTYRDHLDCI
                     KKIHGMIRDMEGRVAALTPFHASSWSWRSDGSPRGDTT"
     gene            complement(<888156..>888602)
                     /locus_tag="LMJF_27_2090"
                     /db_xref="GeneID:12982801"
     mRNA            complement(<888156..>888602)
                     /locus_tag="LMJF_27_2090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721970.1"
                     /db_xref="GeneID:12982801"
     CDS             complement(888156..888602)
                     /locus_tag="LMJF_27_2090"
                     /note="previous protein_id=AAZ09959.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722018.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982801"
                     /db_xref="UniProtKB/TrEMBL:E9ADI9"
                     /translation="MNPNESNTGHKVLIADLPMMWPSDMRRFEKEGGVWGQQFRQRRR
                     QLTFALTVSAASTLLGSWYVVMRRRNTYFVLFSTFSGFSVLGFCIGMSLAPLWFENVA
                     NNKETSMMRRVWWAKECAKHWDYSQVNRDRWVASYPKAAYPCKKIE"
     gene            complement(<890087..>891406)
                     /locus_tag="LMJF_27_2100"
                     /db_xref="GeneID:12982802"
     mRNA            complement(<890087..>891406)
                     /locus_tag="LMJF_27_2100"
                     /product="putative RNA-binding protein"
                     /transcript_id="XM_003721971.1"
                     /db_xref="GeneID:12982802"
     CDS             complement(890087..891406)
                     /locus_tag="LMJF_27_2100"
                     /note="previous protein_id=AAZ09960.1"
                     /codon_start=1
                     /product="putative RNA-binding protein"
                     /protein_id="XP_003722019.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982802"
                     /db_xref="GOA:E9ADJ0"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9ADJ0"
                     /translation="MSACTVYVTGMPTSATEDDIFDFFTRIGNVAEVHMPSAEHQPAS
                     GAAAAVEVVFDKPEDAVSAVSISGSDFQEDIPIYISAVAPTAAATEKPAGHATTTAAD
                     AGGNTNGNAAAAAASAEPGAGLLMRRSADAERTSKNKVVISSIYPHTTRAQLREVFSP
                     CGAICDFHLIPTRHMAFVGYTTEEACEKALKLDGAMVNGNPVVVRPCPPRDDAPGPAS
                     RRDATRRGNESTTASAPSRRQLDVRVVVHGVPSDVTKEALRAFFSPDCGPLTDVFLKP
                     EIGVAFVAFTSAENAKRAISKSGEMLMGTRVKIEQRLPLICRRCDKEGHVAAQCKERS
                     HGSRRRSNERRRRRRSSSSSSDRDRRRRRRSDSLDRDRRRSDSLDRDRRRSDSLDRDR
                     HRRRHSRSRSPARRHSRSRSPPRRRRHSRSPPRSRSPPRSRSPPRRR"
     gene            complement(<894204..>896522)
                     /locus_tag="LMJF_27_2110"
                     /db_xref="GeneID:12982803"
     mRNA            complement(<894204..>896522)
                     /locus_tag="LMJF_27_2110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721972.1"
                     /db_xref="GeneID:12982803"
     CDS             complement(894204..896522)
                     /locus_tag="LMJF_27_2110"
                     /note="previous protein_id=AAZ09961.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722020.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982803"
                     /db_xref="GOA:E9ADJ1"
                     /db_xref="InterPro:IPR002921"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:E9ADJ1"
                     /translation="MRLVHECEVLAPVAHPMPSTLPTSALSSSSTSAPTTSAAVETGT
                     ASSSIVSGPFSWDSAKAMLVSYLDPDDSANNLRDANAKAVLRGVYALLDTVIARYPTL
                     TPLTLLKRYSTMQDLSNAHQALYAACAASLDDTALLRSISWDEVRLHWKAQTGVTATT
                     CTTPAFAALRPLRVDKSVLDNLKTSVKGAGGKGFFSSPFLRKGAATPMTAQRAASGDN
                     DDVASSTWPLAHYPVQLLLWQAMRYATAVYGEVYRRGSLSSTFSVALLFTIKRSGAEV
                     SKQENDSAVTSLLELPPSALRLSRWASQATEPSYALLVDDVAGRIVVSFRGTLNTFDI
                     MTDLAAVSQPFCGGYAHQGAAEVVNTLFDQRASRYGERVERQRKAATAATAVEAVTDA
                     TPSSPAKRVVGVEEQTSLSATDSETDGIGAPEATKEPVMVALKPYALQPLDTPDGLLD
                     GLEQLAAENPSYSILITGHSLGGGVAVLFATRLRYDEVLPPAVLKRIHVIAFAPMPTL
                     SLPAASCFDQVSCARADGGYGRRDVPQQSAPVGACFPVWSVVNGFDCVPRLQVNTIDR
                     LLRQVVGPQIAASAEVSSAAAPAATDARQQVLRDLRERDIATYGVASGAHAETEMVDM
                     PTAPTKAAATEAPLPCVHDNAMPTAVDDTVEDAAHTSVSEAMIRVCTSVDSGAQGASN
                     LKSLPSKSEDRRHEARDLSHELHHPGRVLLLTSPWDGMTNRLVDVPRGHPVMHELFLM
                     KSMLMQHMLDSYSASLGEIHEDPRHASREERS"
     gene            complement(<900383..>901396)
                     /locus_tag="LMJF_27_2120"
                     /db_xref="GeneID:12982804"
     mRNA            complement(<900383..>901396)
                     /locus_tag="LMJF_27_2120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721973.1"
                     /db_xref="GeneID:12982804"
     CDS             complement(900383..901396)
                     /locus_tag="LMJF_27_2120"
                     /note="previous protein_id=AAZ09962.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722021.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982804"
                     /db_xref="GOA:E9ADJ2"
                     /db_xref="InterPro:IPR000535"
                     /db_xref="InterPro:IPR000897"
                     /db_xref="InterPro:IPR008962"
                     /db_xref="UniProtKB/TrEMBL:E9ADJ2"
                     /translation="MPNDTLQVKLSQDSLFFPLPFTNATIDNVVQVKNMLPVVQGDPK
                     ANVISFKILSRVQNRYSVHPPVGFIGAGEHATIIFSFNPEHVKMAKNPEERELPTEAT
                     KDAIHVDFAVVDAPSVQTALAHWVPGSKETKASWEVVADASRFWKQRGQVKENSPITM
                     RYKLRCVFATRNNVPDSLVMCMKEEGGCCKLITDGAAPLPRTRPPMTSSTQPQNTAPP
                     EAPPHRYSESQRTTPTTRSPRSDACCTPCAIGPPGIFTMGPGAAAAASAPSASPPSSA
                     PTQKSKTSAGITCGDITLKSIAEEVLNYKLSYRAVGVLLFLTLLCGLLDQSNLLTWLI
                     AKQ"
     gene            complement(<903343..>908430)
                     /locus_tag="LMJF_27_2130"
                     /db_xref="GeneID:12982805"
     mRNA            complement(<903343..>908430)
                     /locus_tag="LMJF_27_2130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721974.1"
                     /db_xref="GeneID:12982805"
     CDS             complement(903343..908430)
                     /locus_tag="LMJF_27_2130"
                     /note="previous protein_id=AAZ09963.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722022.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982805"
                     /db_xref="UniProtKB/TrEMBL:E9ADJ3"
                     /translation="MVTSALTAVSSASGAGAGTATTESMHMVKEASLHNTWAANFNNT
                     ETLRETVSTSNGAYTAFEEELVRELNELRRAPAAYAAIVEREATIGAPYVQENDLYFC
                     DESAAESAAVELRRHLEEQYCPVQCEVASTASSAVSRAMMQAVSPKTGMQAGQEKRRG
                     KKALDGPPSSPALSTGVGASSTARRRSGRPSPAPQRHTTGLGAPHGGGGPSSRRCTIS
                     SDLPGGGVTVAGVSALRATPVTLRSQGLHELTLSQLRHQFRCQQRYRAALEVALRDMR
                     ASQRQAEAAQQAAWASEAEKALRKGRRLMTTNAFNVNMGASSTPLQHNNTVEPSVPSV
                     VPHNHKKLSHTSTATSAMRTSSSSEDPVSLRRSEDMAQLRSMHEARIRRMEQKLRDVR
                     NACKRSLAAANIVLDAVRALREAQPAPPVQRHRGLSLAAHDTAVMYYGDEERVAALQD
                     LYAVSRATLVGLAEYPGAPTAPLPTLEQLSRRLEQCQVEEAKPKITSVSSSPGRRSRC
                     EDGDEGDVRERSGTEVAPSWVLPLLSEEASLLANVAKNACTTYGYISGEVHGLHLQVI
                     TGSPRSLLLQMILGLLTPVLDLSNHSLPQSSGQATQRVSSPTMANSTNATRCYAGVRI
                     EGHVYAAAGAPTGTRDAAARADLPQFQVASSQQGTGERDRADQVPAAWLSKEEAQLAA
                     PEHKCSNSDTGAITDASHAQRAAAAAAQRLWPLLWTGAYTIGCAWQQVRGWRDVPTFA
                     EACEERQAIQCASSGTLSSREATPPFTGEAHTVICTTLLFASGFEEYEVVRGCQHMSP
                     AAARRVVQSTPVTVFDGGPQSASHGGSIADSVEARRAAVDVHSTLGVTLLTPTMHPMH
                     IHASDPSCRAVCVAVRVPYTSPGFSFTHSSMCAGEDGRVCSGGCRDPSIRIVAQVTRQ
                     CELTPPHPTTCTAEVLTQRSPVDPSVWLVLVDTAATFQRHAAAFTNNDGAVLKADASP
                     GTGATTMSATSAVVPLALHIYAKDMNDAMGEFEHVAFIRMQQYPQPREVNAGAVAIAA
                     SAAPATPAPYVLMEPEWRYLLNGLACVAASPLSTQTVTRLTATSHTAAQASVLTKVAS
                     TTPTATSVGWATLHEPLLGRDGVLLCPLSADLRESERCGDMLEALRIHHETTSSGRDG
                     KAAAAAGRVIRVAVQLPANSNVRWWRRRLMKLRCLQEKLTDEVVAEGDEQTAASTAQS
                     PSAACTHQDRSPESLAGGCNLPAAEPAPPSDDGHADAKATALGASNESGEAATSAASV
                     TPILGSPRSSANPAAMDAEAGAAVEGSSSAAEVASGPPKGKGSEKKVSSDGKREAKRS
                     PTSAAAGGSGARAQGGRRSPSNNAPSGMSKKKAQALHNDSDGAMASSTAAAAAAASTG
                     SSLASAQARCRTLSVCTAPKLPESGALREYESMVQRAAGMTPVASRSGSVQPCLQPSL
                     ISIIGLRELCAQLHTDLQIWEAHLRRVRPILCGERDRIATEIVKKKGKEQLRLQHDHE
                     DVVGELQVIERGVASLSQAAAAATDALRTRERTQMLRRARLVRIADELVAIESSPPRL
                     VPKDTSDKVVAAPLPSTPPRSAAPKVTLRFFKTEGVAAGSGCKAAFAVARPPQHLSSQ
                     RAGVLDCTMREDAPKPSEREAGEVTLVPQPSSARDAASSSSPLQPLEGDGNSAADVYA
                     ATCSIPLTFAGRATLYIDDEVAVTWLV"
     gene            complement(<912572..>915604)
                     /locus_tag="LMJF_27_2140"
                     /db_xref="GeneID:12982806"
     mRNA            complement(<912572..>915604)
                     /locus_tag="LMJF_27_2140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721975.1"
                     /db_xref="GeneID:12982806"
     CDS             complement(912572..915604)
                     /locus_tag="LMJF_27_2140"
                     /note="previous protein_id=AAZ09964.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722023.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982806"
                     /db_xref="GOA:E9ADJ4"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="UniProtKB/TrEMBL:E9ADJ4"
                     /translation="MRVPSKAAAALASKHEEDGVVAAVSPSIPSSLSATSSGRKEMRE
                     EPRWRRVEAAEDVRVQQQRATSVSTSPLTPPLLLQPNREVVSLGNYTPRGVEGSDEGS
                     VSTTVTSNVTDRAGPAGNCKGGTPPSNSSRVLDLTPFAESTEDDRDDRGSKWDHTATF
                     GITTPAILHISTYRTTADITTDRTRNSNPSSSTYSHLGDARQEREKRSPDADTAATPT
                     AGMTPPSSVSLSFDSLSCAMPKVRRSSPELVRCGNGTARQLPRKCLRNANPACADSGR
                     CTGPVARTTTPTTAPSTGLFSSSYAVCFQGHNAMSISDKDGDSSLRLRPRRCRGGSSC
                     GSHEHWTMKPRLSGVNEVLLQSASTSDEPHLFRQALAAFQLWDTLLHLELHSNSAGGT
                     YMVRLARPSPSSATATFTATDSDSRGAVMAVFKPCDEEIGQESNPHANRESDRTETFA
                     PGSGSRREVLAYLLDHGHNAGVPPTLEVASTYWAGAGATTASSDGGGGAATASSSTGT
                     LGAVTEGGDAPANGSLRSSRTGGTDCRGTGAGDGDSIAARVAASTHLRIGSLQLFVPG
                     CEEAADVLPGHFDVDEVHALAIFDIRTLNGDRHGGNVLVCNYRRCRKGRRPVMARRPR
                     CASLANAAESDGAASSPSVPPTAARLSPEVSAITTMAKEDVPHLLPIDHSYICPSGYA
                     DPDYEWLSWPQSKKPFSARNLAYIAALDAVADAELVRSALLAHSSVSTRDLLTLQASA
                     GCNDFGMVERQPDAALTSLTCDDVQRTRAAMLDCATVEAASAALASRHIPRQLFGHGA
                     AAASLDDLTGLSPLPRVPAQKAVAPTTSAVAAPSASGAATAKKSSAIDGGAEAPSAHP
                     HASTWDTAAVELMINFDRGDSLSTEAMHKDASAVRAHAMSTAWSASSSSTPFLEALHF
                     WSREHVSDPVAYDRDAANTAAEVMRCTTRLLQIAALEFHMTAYEIGSLCRRPRVTQAS
                     VLEEVLEQARDEQTWEPVWSRFDDVVRQRLADLSTSGQ"
     gene            complement(<918718..>918879)
                     /locus_tag="LMJF_27_2150"
                     /db_xref="GeneID:12982807"
     mRNA            complement(<918718..>918879)
                     /locus_tag="LMJF_27_2150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721976.1"
                     /db_xref="GeneID:12982807"
     CDS             complement(918718..918879)
                     /locus_tag="LMJF_27_2150"
                     /note="previous protein_id=AAZ09965.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722024.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982807"
                     /db_xref="UniProtKB/TrEMBL:E9ADJ5"
                     /translation="MRWVSYQSNIYKYGLVFMCAASLLALMNDGGSTKESWDWMRQQY
                     DLRQAKKIQ"
     gene            complement(<919714..>920844)
                     /locus_tag="LMJF_27_2160"
                     /db_xref="GeneID:12982808"
     mRNA            complement(<919714..>920844)
                     /locus_tag="LMJF_27_2160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721977.1"
                     /db_xref="GeneID:12982808"
     CDS             complement(919714..920844)
                     /locus_tag="LMJF_27_2160"
                     /note="previous protein_id=AAZ09966.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722025.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982808"
                     /db_xref="UniProtKB/TrEMBL:E9ADJ6"
                     /translation="MRRTLQTANNAMGGGLPIHRDTMRKPRLVTEVGTWLYKKETMQN
                     FSKWCRERQVRAYGNVKMTSTIHFARCLRASKSILPGQAIITSPLSACFNFLTVAKEM
                     YDCPSTAFPLQLNWMNYNERLPFMTSACMYEFAQAGWMTRIASLEESVYTPYVHYLLE
                     DTRGRDGISNGMGKEREEESGVLDHYLSEMATDACEDPEVFLENFFRGLACVHLRSQP
                     IEAVAVEAFVPGTNFFKAKSSEMYVPTLVPLVDAVPQLENGSHNTVLEYYPFTDVATL
                     RAQCEELQIPFFEKGKEEPIVAQATRTARGVAQQINVESELMDPALLEGGGFFALRAL
                     EPLDVGDVLYLRRFPDVWSRAGERMMDAQVMEANRLLSRDDE"
     gene            complement(<922437..>927212)
                     /locus_tag="LMJF_27_2170"
                     /db_xref="GeneID:12982809"
     mRNA            complement(<922437..>927212)
                     /locus_tag="LMJF_27_2170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721978.1"
                     /db_xref="GeneID:12982809"
     CDS             complement(922437..927212)
                     /locus_tag="LMJF_27_2170"
                     /note="previous protein_id=AAZ09967.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722026.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982809"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:E9ADJ7"
                     /translation="MDSRRALVKRYIFGTNHDGKNCLHWLDDGSLVYPVGKTIVLQQP
                     KSCTQRFLEAAYQSTAITAIAMSANKKFMAIAESGPHPQVQIIDTVTRKRRKVLSVTD
                     LDSDRYVALSFSSDGRHLVTQGGAPGWNLHYWNWERSQPLASVSVGQLYLTSAQAQGS
                     TSSGNAASIDNNSILQEGGTQTLDAAARTVARSTLATSRAQPQVVTSIGVCPLDPLLV
                     TVAGIGFFRFYRYTEGLLQLQPSTGVPREQFESFSTHLWVTEHNVVVATHSGRLLLIQ
                     DGRYMSAIGIPPSSPSHLRGLASESLLEGAGAAVPVDVVMCIAPTHQQQQQRAQHHSG
                     FIAGTSQGNVLIFQGDNNAAGVDGVVDALNGEIVAGDTTGYTFVCRLEVPACEAGELQ
                     QQSSPHAPHHASAGQKPAAPALMSITGTAAAAAAPPPTTADAGRSDKGRTGRLFQLRD
                     QMGAKGARAKASTGTAAERRGQSTAGDDENAYKGGVDNAGQALGSDGQRYRVSALALD
                     QAEECLAVLTASGKLYGLNFQQNWAAREAMFHTPNASTMTSASAGGAGGDEAPVLLAQ
                     LPSLLEHNGGDLGRASLAAIPGHVSTRSMFFQSLYPFTHCGRVNGMDCSVRKPLLITS
                     GSDHSIRIWNTQTGQLLMCQFFALEPGAVAIHPDGLMAVVCFPDKVRVMSVLWSSLRE
                     RRTINLRNASDVFFAKGGQLFAIVHHNLVYVEDANTCELQGQLRGHPQRIKDFQWCST
                     TAYPTDNRAVTCSSDGMIMDWNISEMRKQTEHSDRRFQYVAIASDDRSVWAVAAPTPA
                     TALDVSWKVLLREIDRQSLGTVNAGTNKGVAAGGPGARSAAGGMTATSSGGGGGISNI
                     LGNSVGDYEFTETALTRLMVAPHQRVLIAGAEDGSVKAMTFPLQAGIQEAPIAAHALP
                     VTRMALSFDETTLFTASADGSVIMWEIFAEKDKVKPTDAGATGTTGQHHDPASRRNMN
                     CTDEVLVTKQEMEEQRIEIESLQQYIEKLKTDMESEDKRRAHEQGTRTRERAEELQQD
                     AIALAAEYDALQHAKADQEQTFLDAKNETARDAAQKLEEVEMERQREVDTLADECGAL
                     QHRLETTKVAHAAELKALRASLAQARAEDEAHFQDVLSQRTEAVRKLHRQLEHSYETN
                     HAALHQLELDTDSESQSVFQKQQGTLQRARERFLHLKGEGAVMRKNAMRLEREIEVRT
                     NELQLLDGAKAALQSQLTDLTQQVAQLHQDIDERDSVTEKKEKVIYSLKKRNQELEKH
                     KYVLDHQIRELKGQIEPKQREIAELNQETKQQNANLEEQHTSNLTLRQNTEELKKDIA
                     EQQRALQARLRELQGLETYRSRAERDIGELAHQLQDPASLAAAVVRLYEVHVAPRDVK
                     QIAPADPNVKHELQSQLEYLSTSVDALRRKLKSDEQRHKKEVSAMMTENLSLIREIHS
                     LRGEMDHLRARVAADTVSKQQQQYQMQRRAGAGGGGACRGAGRAHDERSGVADAGATD
                     TMGSAVTDAVGRSVQLSSSEVDSTRGGTGTRRRGGTGGSAGQRPVTPQSEIEINSREL
                     RMLRAYIEKLERSLAGLPYSTAVQKESVRLPPVDSLAIT"
     gene            complement(<928336..>929199)
                     /locus_tag="LMJF_27_2180"
                     /db_xref="GeneID:12982810"
     mRNA            complement(<928336..>929199)
                     /locus_tag="LMJF_27_2180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721979.1"
                     /db_xref="GeneID:12982810"
     CDS             complement(928336..929199)
                     /locus_tag="LMJF_27_2180"
                     /note="previous protein_id=AAZ09968.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722027.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982810"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:E9ACT5"
                     /translation="MYASKENAWEGYTDDRFYGAKRFREYWQRMLADRGVRYYMFTVI
                     VLMMAATAKLWQMQNLQREENGLLGPRKKQYRSRLTIVLDVDETIVSYGDKAFRLKAG
                     LVPRPYLAELLDYLTSIDAEVVLWSASSERYMRQVLGIIDPMGVRVSQYLSRGREWFT
                     HDNYYEKNILWLKRPLEDTLIIENRPLSVRNCNGNAILVDDFIRGEYMDTGQDYPAND
                     HALRTIKSIVQDLETSGMSVPEYLANHKVRHREIKEIPCHLAIRQLPDEIARGVFYFV
                     GDKYKTKPNAA"
     gene            complement(<930716..>931204)
                     /locus_tag="LMJF_27_2190"
                     /db_xref="GeneID:12982811"
     mRNA            complement(<930716..>931204)
                     /locus_tag="LMJF_27_2190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721980.1"
                     /db_xref="GeneID:12982811"
     CDS             complement(930716..931204)
                     /locus_tag="LMJF_27_2190"
                     /note="previous protein_id=AAZ09969.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722028.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982811"
                     /db_xref="InterPro:IPR012932"
                     /db_xref="UniProtKB/TrEMBL:E9ACT6"
                     /translation="MIKFNLKLMGLCLFGFLLSSYAYSVEVHAERAKQLGITYNAYCD
                     IGPFSCTKVFSSEFSSVTHFFGLPKTSNALVGMLYYTVEMLCCWHPTLILMISAPSIV
                     ATVCLAFILTVTLHDFCVVCCCTYVVNVTTVYVAYRWWKRSAASKAAVASSSSKKSKK
                     RA"
     gene            complement(<932226..>932945)
                     /locus_tag="LMJF_27_2200"
                     /db_xref="GeneID:12982812"
     mRNA            complement(<932226..>932945)
                     /locus_tag="LMJF_27_2200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721981.1"
                     /db_xref="GeneID:12982812"
     CDS             complement(932226..932945)
                     /locus_tag="LMJF_27_2200"
                     /note="previous protein_id=AAZ09970.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722029.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982812"
                     /db_xref="GOA:E9ACT7"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="UniProtKB/TrEMBL:E9ACT7"
                     /translation="MLGSGKSSGVVNEASNLKANENLTATIEQMNSKAYRENRDTNDV
                     IPTHRRPVTAAVRDNGVPVYDPAAEKHAEKVERGNAAGAEDDDDELMELRRMRLQRMR
                     ANQEKEAEWRSKQHGEYREISQDDFFNIVVREKGGSERVCVHFYHKDFETCKVIDRRL
                     SELSRTLLAVKFVKIDAERSPFLVERLRVTTLPHCLLFLNDVCIDRIVGFEGCATEDG
                     TLDANLLRERIVHALTLEGDE"
     gene            complement(<935843..>936901)
                     /locus_tag="LMJF_27_2210"
                     /db_xref="GeneID:12982813"
     mRNA            complement(<935843..>936901)
                     /locus_tag="LMJF_27_2210"
                     /product="putative dual specificity protein phosphatase"
                     /transcript_id="XM_003721982.1"
                     /db_xref="GeneID:12982813"
     CDS             complement(935843..936901)
                     /locus_tag="LMJF_27_2210"
                     /note="previous protein_id=AAZ09971.1"
                     /codon_start=1
                     /product="putative dual specificity protein phosphatase"
                     /protein_id="XP_003722030.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982813"
                     /db_xref="GOA:E9ACT8"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR020422"
                     /db_xref="InterPro:IPR024950"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:E9ACT8"
                     /translation="MPPKVSKLPPQRRDTAHHLPDDDINLFFRVLRFLSAHPHLATLD
                     TATVRLDGADHSPSTTPSAPVARRGAQCTQTGTSVSVNNRIPTPPVLREPLEEFRMMA
                     TNLPIDQEGLEAARRTVCELLEGICHKLAEPAITKELRQKVLLTDGSELLGNSSSSSG
                     ALGISAVECGTIRSLSSFGLDSLNQMQEIVPGLWCGSYHPATDRELMKRHGITHVCCC
                     IGTPPSFPGDFIYVTLSADDRPDYDMTPHFAHTFEFIENALVTNHGGVLVHCGAGISR
                     APTVVSAYLMRKLRLCSSAAIHLVQQHRPCASPNTGFRQQLYEYGMKIGVREQAPAAR
                     RELASESAWRAANVLRRT"
     gene            complement(<938093..>939133)
                     /locus_tag="LMJF_27_2220"
                     /db_xref="GeneID:12982814"
     mRNA            complement(<938093..>939133)
                     /locus_tag="LMJF_27_2220"
                     /product="putative ribosomal protein L11"
                     /transcript_id="XM_003721983.1"
                     /db_xref="GeneID:12982814"
     CDS             complement(938093..939133)
                     /locus_tag="LMJF_27_2220"
                     /note="previous protein_id=AAZ09972.1"
                     /codon_start=1
                     /product="putative ribosomal protein L11"
                     /protein_id="XP_003722031.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982814"
                     /db_xref="GOA:E9ACT9"
                     /db_xref="InterPro:IPR000911"
                     /db_xref="InterPro:IPR020783"
                     /db_xref="InterPro:IPR020784"
                     /db_xref="UniProtKB/TrEMBL:E9ACT9"
                     /translation="MLRRSAVRYLKARPKTVNIEPGSNRFLDPNVEAKAKDIFAVPEF
                     PNKAVLHNWRFFIKAGKAATGPPVGQEFSKLGLKAMDFAKAFNDRTKPHFKDDIELIV
                     RIQVYFDKSYIFRIEPPPTAWFLLRAIRKKRGETGPVVLRGNYCAYLTLEMCYEIAKM
                     KQMSWGKVEYPPIEVRVRRVVGQARRMGIAIIGIDTVHSSPVKGMTEKQYLEESEKHR
                     KVHMIQYEALKAKELESAPLIERLHRPNMAPLTNTQLEEGLKDANLLNALWKSSHPKS
                     LFTQDTRDREMARRYLNTRGWFKEMTPEEMRVVFLNYRLPKQEDHQRQLNMTNGQAQS
                     QAYWSRDAASPQ"
     gene            complement(<940269..>946652)
                     /locus_tag="LMJF_27_2230"
                     /db_xref="GeneID:12982815"
     mRNA            complement(<940269..>946652)
                     /locus_tag="LMJF_27_2230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721984.1"
                     /db_xref="GeneID:12982815"
     CDS             complement(940269..946652)
                     /locus_tag="LMJF_27_2230"
                     /note="previous protein_id=AAZ09973.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722032.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982815"
                     /db_xref="GOA:E9ACU0"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="UniProtKB/TrEMBL:E9ACU0"
                     /translation="MAMPEQMLRGTPPPPPAKPSSQQEGDLVRLNREVRALGDLLRAY
                     RFSYRPLPMCVPKMTPSVSNTAHSSRGGSRKDKRAPAQLVATSTDAEEAWLLPLQRDV
                     VQCVLRRLQVMELALKRLVARGTSQKGGALGSPAKAVREEVTAFFAEEIRVVAELVAL
                     RGVHERDAQSLTCLVHVLTAAADAGVVVSVATLVEAAAAAVQHSQCGVNEGGASVGTA
                     AWCSCVPWLLHCYSTTHMCVSPSLLTTSVQTPGDGAANWSAASAWMTAAADRVCATQS
                     AELLQLTPTPAEARRGGVMAGSGADTSVQREKAARAHTFGPWQGVLDAEATHTAEAQT
                     YVFEGDGGGNRKAAGETWLRDWCAGCGITDVGGESNSDSTGTWHPYWKLVVSGMVRNC
                     ARAVDAIVELSEGTDEERRSDALSSARPKATRHRSPASSSSTPATLEEIQFYAVGSYV
                     SLRRIASSLQRHHRLMPLLQLHEMVSGFVGPSGAVAGALLPPPQRRRWHENDAPRRRA
                     DGVCSSLSTGAAAAQWRRRLLSGELLQPLFSAPASQGERRRHCPRNRPPPAYLPQRHQ
                     AGAMLWREVALFDAYTLITIGHVSEHAVDGAEVDKNAVLQQLAWLQQECALHLTMLEA
                     SDGEVTERAGTDSESAESGDNIDAESAATKDRGASYSMSLARRSTLLRCLKQRTRAGL
                     IAKLQEGLRLSAKVLARWGTPEQICALYLRYPSMGASWEVGRALLQCGQYSVAVEVLE
                     SLLQASATPREASATYPSAVSSTSPPPLLLPTSAMAVRQLLLEAMEGAAAALVQHSQW
                     CHAVRASGSSPDAAATSIDGSAGEEEVPLPAELRTRLHSLYAHLYSLPIPLPLCLHAV
                     VRGLTSASEDAAIYGIHNDADATSPLSARRHIRSKFSTSADSPSVLPPPSRQPRTSAE
                     ERARMTAVLCTYVLRCHLAENPHKGLLAKTVELWASCVAPYLCRRSCDGAGASPASPS
                     TSLELSLTDQYLRAVTARILCGYPQLPVARLLLSRLVQLMTPPSMAPSGTLGAPSTVD
                     ADNVPAASDVRLALTVVWLLGVLYKLAGMPAARHSTTSHGSRSHANVAMPTSLAYRLC
                     VPVTTTTASTQDTEKSALMSCDAQLLAGCRAWNAGFTERYALDTLRLMPRIALEALER
                     LLRSLARHSAAAAAISPTGSVIATVQRAATLSGRSIGFFHDRVSVILQYRRAEEEQRQ
                     PWQCSACYLWNSRYARACKRCHALSTVLLQCRACGCLTSSADDRDDHGLSCDVCGTVL
                     VPPLSFQNSGEVPQSSSSAADPLLRASTIDAGLAHVRTQDLTTAAGRRFAAAAAAAAA
                     TVTGAGRAANRFTASAAIARVVPLRQWTCMHCRTVNDPQHVFFCRGCGRATTDPEKRE
                     AAASSAGEVDGASNSAAALACEGCRHSPKSIEARMRPWCERCGALYQRVRELHKPSAG
                     GRTLSSLTDSPSHLPASATGTIPPAAAATGQHSPYLWWCAECTAALNPWTRTHCELCG
                     AGRPAAAAVVPGATPGPSLLSEKYNAAAPFIALPWLMQACPSCMAQSRVGMLHCWQCH
                     ALLTWPLEVQRAVSDGWRRWVTQVARIVVDVRATESQTEDGAACSSAGADAPLHVPCA
                     TQWLCLHDGCMHVNVVHSAAADAYGDSGATPAPLCHTCTACAFAPRRPAKVLSLFHDH
                     FAWSEAAARLSPTNAAAVVEALLLPPSSPLPGDVTMRHSELSGAVNAASEVLSAVRSE
                     ETAATAPQSHERWLRRSWLSGVATTSVCTSCGASGASGVAAPSTPLPVRLRPLFMVNV
                     CASCGCCAWGRSSCAYDIPGTPHVGAGDGVRQQPSSSPARRQAREGAMAQPPLLPGEH
                     AMALRLLLKALAHAVQEGVAFELPPSKRVTSTSSCTDGGKASTAASSPVSVTGPRRRL
                     DWAWLSRFVLSGVRLITSSASEALPHRDDSRGDSCALRYQHCLHERLPWRGCDLASPQ
                     QACSAEPRVAVLESCGHGTGTVHSAIVDVRQVLDGVCALAEHRVRGSLSCSRSPRRQH
                     RGKGDHAHQEHASAPALPPCLQDAWTRRLILAALELIDVVNASTVCDEIGFATLRRLC
                     LLLRPDEAEHINTETKWAYLQDMKLSRSHVLRGCVQCEQCLTTHGPDQPCAAP"
     gene            complement(<949616..>951286)
                     /locus_tag="LMJF_27_2240"
                     /db_xref="GeneID:12982816"
     mRNA            complement(<949616..>951286)
                     /locus_tag="LMJF_27_2240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721985.1"
                     /db_xref="GeneID:12982816"
     CDS             complement(949616..951286)
                     /locus_tag="LMJF_27_2240"
                     /note="previous protein_id=AAZ09974.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722033.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982816"
                     /db_xref="UniProtKB/TrEMBL:E9ACU1"
                     /translation="MEGRWPPTLVTSPVHVYTSEVARGSSHPCWSAIPPGQLNAYDTA
                     TQVELAFYYTAACLSNVVSLMASASDTTPPTTIPLDHIVPADVCVHRCQVDMCDVVYA
                     GSTMEQADATLSRVFHLEQQQQPQTRCCTRPIIFLRYTDGVFVPRVCLSDISAAATAL
                     LEEMRAARTRTFAPRPTGAELQPTSFFPATLHTITGQTSIVATAAAEGAAACEELPWS
                     RAPSSVGWRYPPTAVPRAGLLRMTIGDVKAATLATIAWQRLADLTEERQAQLAADLNR
                     EAAADPLERAGEARCAALRAQLTAAREQLTLSTLELEALREQVEQRQRRLQRQEEAQA
                     KLQSYQAYTVSPEVGEQSRATAREEEAQRARLRAQLARSRQRRARELCLVYTVELSSQ
                     YANEACARAADAKDHINKCSLPIMFAGRAEADTASHLVASTAEDMQEEAIALGHAGHL
                     LVVLSILYSCSLPYPIVLASGQSRVLQSPNISAEQVLAAPYTLTDARKYPLSCHKVAD
                     RPLMMAGVHLLLRDGIVLAKAMGKPERRVLACSDRLGALLDLLLHDVE"
     gene            complement(<952897..>953637)
                     /locus_tag="LMJF_27_2250"
                     /db_xref="GeneID:12982817"
     mRNA            complement(<952897..>953637)
                     /locus_tag="LMJF_27_2250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721986.1"
                     /db_xref="GeneID:12982817"
     CDS             complement(952897..953637)
                     /locus_tag="LMJF_27_2250"
                     /note="previous protein_id=AAZ09975.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722034.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982817"
                     /db_xref="GOA:E9ACU2"
                     /db_xref="InterPro:IPR005304"
                     /db_xref="InterPro:IPR029028"
                     /db_xref="UniProtKB/TrEMBL:E9ACU2"
                     /translation="MGLVDAYDRAATTEIANESLKDVRPDIVHQCLLALFDSDLAYQH
                     RLRVYMSLFVRQGKVIEVSPALRPPRTYARFRGLMSALLRDGRICSTDGQVLMRLMPG
                     SVAPIIPHGAEVVGLTNSLSSPVVTATQLAQQAVAAPVDDSLQGGIKHVTAFYCISCT
                     DDCNLDGIDYITKSVCLSAYPMTAHVQCARVCEGHTRVEPASSVSGSAAGMGVGGGQA
                     KTDRCSAPEPPKRRGEVFPANQAEDNKL"
     gene            complement(<954719..>958147)
                     /locus_tag="LMJF_27_2260"
                     /db_xref="GeneID:12982818"
     mRNA            complement(<954719..>958147)
                     /locus_tag="LMJF_27_2260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721987.1"
                     /db_xref="GeneID:12982818"
     CDS             complement(954719..958147)
                     /locus_tag="LMJF_27_2260"
                     /note="previous protein_id=AAZ09976.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722035.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982818"
                     /db_xref="UniProtKB/TrEMBL:E9ACU3"
                     /translation="MSGGARGQLQTMSPSATRLVDVDEAVRILRAACQRRASADALAP
                     LVQSAQHLASNCTPALFSSVLEACDATTAVEAAPKKLTMLNAAWKLLLTIATQEGVEP
                     AYYSAAVTHMVEQLRCGVLTHDWSDTKRVRLAAFFASHVVSTVRAHPQLLLLRTPDAT
                     AVIGQLVRLYFAVCVTVATSTLDTEAVSLLYDNIVVRLHAVFDCLGNAAAASTASVHS
                     SEPEAEAACSAEEADGNGAASSVARGAATSGPSAALPPQQRCESPSSVVEELLTHCVS
                     TAVAREVEEAADGGVTVRMALATAALSLYLHVVRGALEATSPSASGTGAGSAKQEGDP
                     GQREAEEDEAATAEATPAQASSWRRLTPRGTQELVMKSLMWWTHCTAEEGQAHTSVTR
                     ASLLRVEVLTWAAALPPDVFCSEASDASSAVPPMSLRALWTDRLATVWQQWLFSVRDA
                     PQQSNEPSRAGAAGSLRASESHGVEAMVAAAELDTSGSRDGKTESHVVVAKSTHFASL
                     LLSSVAGTLHSSSAALMVLEAWAELFRRAEEAVTDVASAARSPGIPSTTEDAATIVHL
                     LLRVLADLRCGASSLVEGLLRLQRHDFRDGRCKAGSEQPADFGSAHAMAAIPLQWICA
                     AVALLAYGEEMLGLHSPRAAATAGVECVGEVDGAAGARVIAHLTAVMRAHITPQLCAS
                     KVSEMATITETSAVTDATTQMRELLISVRQHASTAGTGRTSAPAKLARRAQPALLLLG
                     VPRAWRALAVAVAQQRPNAPADAGGADAAERCAMELKTVLLSLAPLLASLTHILQSLE
                     CESDLSKASEGSELPSGLPYARVARWVAARLLDEVAVVPLTDSPEDAVLVACVRRWTD
                     LAFASGPCTVSEGSAAVRTDDPVALADAAAALLHVLECTTLPLEKLHLSEHATHSLME
                     LLQGDDGSISGEVDKVGGDDDADGRCPSWPALWRREAVQWCEMEKWLLARRRAMEEGE
                     QAEELASAPTLAEALHAAPLHMDATAPPSSNEDLRRGLLYCEAVLRHLQARDLVFLND
                     TENPSKCRKTENGDDAQADVAAVVQSVERIQELGRAFLLRAGNASGPATSGSTAAVDG
                     APLPPPLPAASLKASAPPGSEEETCRDVPVITPTDTESVGCRRVPLPAQVIDVE"
     gene            complement(<960095..>962089)
                     /locus_tag="LMJF_27_2270"
                     /db_xref="GeneID:12982819"
     mRNA            complement(<960095..>962089)
                     /locus_tag="LMJF_27_2270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721988.1"
                     /db_xref="GeneID:12982819"
     CDS             complement(960095..962089)
                     /locus_tag="LMJF_27_2270"
                     /note="previous protein_id=AAZ09977.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722036.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982819"
                     /db_xref="UniProtKB/TrEMBL:E9ACU4"
                     /translation="MRCRHAAARPRGTFAATEGASPLPATELCVHECSTGTAAVVESP
                     PWHECGESSGCGADGKLYNELFQLEETVQKRSGALQTTPVDVLSKSSSVIGSGALQTN
                     LPTGELLLQKEEFLERLVQRVRMSCAGVPPEHSASTCNAEQDAEPGAVRHRETSPLPR
                     RLSPPGVELADGTGVRSSDAGHRSMGRSRLRSPSLMSASSTVKGSTLATAAEPAQAEA
                     DALAGRRARAAARAMHQRSRVTSPDPRPPSTDLYATGGALRSSLQYGRCSGVSRGRRS
                     LSAERPDHSDACAPLDTEMQETEEVVNSFWGRAAAASTGTPGAAACRSLSGIRSDSVH
                     NQLSHPQWNPHPVQAARPVWNQRQPQRKQRPVVSVPGSKPPSSARRCASRIPETSASA
                     QGLRGARSEERDATGASHRRAERALRRTESLSMQLKQEQTTAPRRAAGQSPGGTVAFP
                     LSPPSARTLFQIHDAHSVAKTTSPLGKEQETALQSQCDAALARATQAERQCNILSHAL
                     EQLLVDHAAEKAAWEVRHAALEQRLASITEWISGIDAEASLDAAPHEVSIARTPETAT
                     SDTTTPQMATKRNEMGGEALLAAAKNTAWEEDVDIVDLTNNSGAYSADSSPLPGAPGA
                     TPTPGRHDNANADGGGASTCQVHLPPSPPLILHMHAATTQ"
     gene            complement(<963859..>964251)
                     /locus_tag="LMJF_27_2280"
                     /db_xref="GeneID:12982820"
     mRNA            complement(<963859..>964251)
                     /locus_tag="LMJF_27_2280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721989.1"
                     /db_xref="GeneID:12982820"
     CDS             complement(963859..964251)
                     /locus_tag="LMJF_27_2280"
                     /note="previous protein_id=AAZ09978.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722037.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982820"
                     /db_xref="GOA:E9ACU5"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR024774"
                     /db_xref="UniProtKB/TrEMBL:E9ACU5"
                     /translation="MDLRMSVETLRAGDWFYKWTSKGDSVHRRWFWIDTKSYLLVWSN
                     YETYSPHFCGSVRLDDICQVTSRDLFSVDEGAFPKTYYVLLIETRKRVLQLATELKDK
                     CDTWFEALNNVMGFIHRNDMARGALIPD"
     gene            complement(<967725..>969884)
                     /locus_tag="LMJF_27_2290"
                     /db_xref="GeneID:12982821"
     mRNA            complement(<967725..>969884)
                     /locus_tag="LMJF_27_2290"
                     /product="putative acyl-CoA oxidase"
                     /transcript_id="XM_003721990.1"
                     /db_xref="GeneID:12982821"
     CDS             complement(967725..969884)
                     /locus_tag="LMJF_27_2290"
                     /note="previous protein_id=AAZ09979.1"
                     /codon_start=1
                     /product="putative acyl-CoA oxidase"
                     /protein_id="XP_003722038.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982821"
                     /db_xref="GOA:E9ACU6"
                     /db_xref="InterPro:IPR002655"
                     /db_xref="InterPro:IPR006091"
                     /db_xref="InterPro:IPR009075"
                     /db_xref="InterPro:IPR009100"
                     /db_xref="UniProtKB/TrEMBL:E9ACU6"
                     /translation="MPARLSAHLAPRRHFARRTEPRLFEVNPTRESYVIEAAFEEPTF
                     RFICEGVDVDFKEDVREALAKVLPPSPSNFTQREEGTALQLPQILQTLRSLCRQQLVS
                     FAQVRSTPRRLASYYEALAAANPVLAVLAAEHYTFAGLVATHAKKSVRDAVLAGVDSA
                     ATIGCIAEQELIAEGTPLNTEARYDAHERCFVLRGTGKFGVVAAACAQWAVVSATLTL
                     NKKEHNGTHLFLVQLREGDMLNASGQLRRGISVRPITGENTTMAGCGVAVLHFEDVRI
                     PSDHLLNPYCITSESKVGYVAGQESQEPATEVLRTRRRIATGAIYIGVTKKLLADVVT
                     YTADKYVVGPDYRRNYPFLGLQHIQSPLVSMVAKSYVYLVAWQRLLPVFTDPSGSPSY
                     EDHMRLAGTVYFLQENLLDLQTFADKTMGLHGSFASTGKYAAVTLVHLRQEGLDTSAL
                     IREVAFRSVTKNIGTTHWGWWLTSLLQPVFPALNRFLKNPLYSPRIADLGRHLIFFSH
                     KHYSLKKRLRQSRELERRKGGSEHEWYDWVVFRHRTVVHCGEAFMEVYYLDVMMKETE
                     RCSDPRGRKILRDIAWIYALTRQMDRLDFLLSSKMLSPGKAETLASHIDNIVTVLAPQ
                     CVHLVEAMQVPEFARAPCRSATHMEAYWTIPGTNTHIERGDRLTLRDAANASSSKGRR
                     GAESAKAAQEAIRESPEEFDLFHGLADEPSYARRKAP"
     gene            complement(<971197..>973299)
                     /locus_tag="LMJF_27_2300"
                     /db_xref="GeneID:12982822"
     mRNA            complement(<971197..>973299)
                     /locus_tag="LMJF_27_2300"
                     /product="transcription elongation regulator-like protein"
                     /transcript_id="XM_003721991.1"
                     /db_xref="GeneID:12982822"
     CDS             complement(971197..973299)
                     /locus_tag="LMJF_27_2300"
                     /note="previous protein_id=AAZ09980.1"
                     /codon_start=1
                     /product="transcription elongation regulator-like protein"
                     /protein_id="XP_003722039.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982822"
                     /db_xref="InterPro:IPR005100"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR022581"
                     /db_xref="UniProtKB/TrEMBL:E9ACU7"
                     /translation="MAEEVNYDELADLLASDAPVVSEAAEAVVGEQESDKPRKHKKHR
                     KHRKHKRDKKRPRGEEGNAGSSDDERVKSKYVLDAAESGDSDSEDELSETDFVDEDEE
                     VEGIHYGDYPQRYLFHEGDEKKTVEEMARYYEEADRHYRMHGDHEDELLTRSDLSSRR
                     LASQFLPREDDPKVFAVKCRPRMSRVLVTRIVNKCYAYRVGRNYERKKVDLGIISVFA
                     LDHVKEYIYVEASRKRFVENVLNGLDGVFRFNIAVVDPKELLQTMETRPSTQKVRVGD
                     YVRLRQRFYRGDLAQVTALHPDGVHITCKVVPREDFVQKPFNKATKRLEPRFFTPRQA
                     VGVREMENSYIWGDLHFDREGYLLKTVSTRMVISGAQLEQPSTEELARFYNDQREKVE
                     RALKAAEAAAQVPHISIGDSVRVTTGQLRNTIGVVENVFTNTNTAVLTCTVPGRVQPI
                     KVQVELSACTKHFSEGAHVVVERGEHAGESGTVVKSWGSIVLLFPDRAAVGAELKVEA
                     NDCHQSKLGSVSVHSKGVWQVFDLVSITEPNCVGCIVRLNRNDVDVLTENNDVRTLSY
                     AQVNAVGRDTRQTTDCRENTLSRGAEVHIQKHPWTPIGLEGQTGRIEHIFHRTIFVRC
                     RASPLHANIVALKAECVLLIGGRKTTRRAAPTQEAATGTSAGQYAAAAVRLSAGQSRD
                     SEQWDESSMMDINASAVV"
     gene            complement(<974138..>974686)
                     /locus_tag="LMJF_27_2305"
                     /db_xref="GeneID:12982823"
     mRNA            complement(<974138..>974686)
                     /locus_tag="LMJF_27_2305"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721992.1"
                     /db_xref="GeneID:12982823"
     CDS             complement(974138..974686)
                     /locus_tag="LMJF_27_2305"
                     /note="previous protein_id=AAZ09981.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722040.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2305"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2305"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982823"
                     /db_xref="InterPro:IPR003409"
                     /db_xref="UniProtKB/TrEMBL:E9ACU8"
                     /translation="MPPKRKEDQGEVLADTFRYSDGSLYEGKYGIKHDANAEAVSAGS
                     ATSSLSTAAKKHGAAGGAAAAATAASSSAPATLNAYMHGYGILADSSSARYEGEWRNG
                     LMEGTGVLSLPSGGRYTGEFARNEFHGTGRYMWADGSYYEGEWCRNQMHGLGVYVDCT
                     GKRWHGTFTNGNAAQLVAKVEL"
     gene            complement(<975269..>976012)
                     /locus_tag="LMJF_27_2310"
                     /db_xref="GeneID:12982824"
     mRNA            complement(<975269..>976012)
                     /locus_tag="LMJF_27_2310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721993.1"
                     /db_xref="GeneID:12982824"
     CDS             complement(975269..976012)
                     /locus_tag="LMJF_27_2310"
                     /note="previous protein_id=AAZ09982.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722041.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982824"
                     /db_xref="UniProtKB/TrEMBL:E9ACU9"
                     /translation="MDQGVVSEWNVVGTFRKRPVPQGLIVDFTSDVSHCNSLDNTDAP
                     ILLYEVKGGENQQQSHVPRYMARKIAIPPPSLRKMKVVSFAPPRPADAVGRCEEDLFF
                     VDCPEPPSVPSHDRDRVHRQQPLVIGTILPLPLQLAFLMPSAVFLADIALLVVSLTTY
                     TPEKALIAACCVLVLVTDIGALILLFKRGIYSVTIAVHLLLWPNVVLLFLQPFVSLLL
                     MVHFLLTTVMVLYCLRVRASTYMTFCTLR"
     gene            complement(<976885..>977829)
                     /locus_tag="LMJF_27_2320"
                     /db_xref="GeneID:12982825"
     mRNA            complement(<976885..>977829)
                     /locus_tag="LMJF_27_2320"
                     /product="protein phosphatase-like protein"
                     /transcript_id="XM_003721994.1"
                     /db_xref="GeneID:12982825"
     CDS             complement(976885..977829)
                     /locus_tag="LMJF_27_2320"
                     /note="previous protein_id=AAZ09983.1"
                     /codon_start=1
                     /product="protein phosphatase-like protein"
                     /protein_id="XP_003722042.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982825"
                     /db_xref="GOA:E9ACV0"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:E9ACV0"
                     /translation="MPLKGLNALKGNTQTVLISPVRDKYSILMEDDKIRAGASSMQGW
                     RSTMEDAHAVYLSLPNMPGNIRDEDCAIAAVFDGHCGSKFAQSCAANIRDWLTSTDAF
                     KKGNFEKALKDAYCTGDVALHKAMPNELSGCTGNCVLIIQNHLYCANTGDSRAVLCRN
                     GEAIALSEDHKPTNPAERERIMKAGGFVQAGRVNGILSLSRAFGDYAFKDMSLRPEQM
                     AITVTPDVFHTELTPHDEFVIVACDGIWDMMTNEKAVEFVRNEVADHGDISLACERLM
                     NACLASTPTSYGTDNMTIIILQFKSLFLKKVESKFSAE"
     gene            complement(<978405..>979583)
                     /locus_tag="LMJF_27_2330"
                     /db_xref="GeneID:12982826"
     mRNA            complement(<978405..>979583)
                     /locus_tag="LMJF_27_2330"
                     /product="putative GTP binding protein"
                     /transcript_id="XM_003721995.1"
                     /db_xref="GeneID:12982826"
     CDS             complement(978405..979583)
                     /locus_tag="LMJF_27_2330"
                     /note="previous protein_id=AAZ09984.1"
                     /codon_start=1
                     /product="putative GTP binding protein"
                     /protein_id="XP_003722043.1"
                     /db_xref="GeneID:12982826"
                     /db_xref="GOA:E9ACV1"
                     /db_xref="InterPro:IPR004396"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR012676"
                     /db_xref="InterPro:IPR013029"
                     /db_xref="InterPro:IPR023192"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9ACV1"
                     /translation="MPPKKQEKVESKTVLLGRPGSNLKVGIVGLPNVGKSTFFNVLSK
                     KGVPAENRPFCTIDPNTADINIPDDRFDKLVRIHKPASIVPAQVHICDIAGLVRGASN
                     GEGLGNNFLSHISSCDGIIHMVRVFEEVEITHVEGDLDPIRDLEIILSELVMKDLQCV
                     NSLIDKLTPIVNRGLDKSKKGDLETLHKVKGVLEEGKQVRCCQWNGKEIDFLNTIQLL
                     TAKPAMFLVNMSEDDYIRQRNKWLKKLKDWIDEHTGEPMIPFSAELETAFVAMSPDEV
                     DKYCEEKKTRSQIHKIVKTAYSIINFIHYFTAGADEVKCWTIQRGTKAPQAAGKIHTD
                     MEKGFICAEVIEWADFDRLESEAACRDEGKQHQQGRNYEVQDGDIIFFKFNAAKGGKK
                     "
     gene            complement(<979966..>980448)
                     /locus_tag="LMJF_27_2335"
                     /db_xref="GeneID:12982827"
     mRNA            complement(<979966..>980448)
                     /locus_tag="LMJF_27_2335"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721996.1"
                     /db_xref="GeneID:12982827"
     CDS             complement(979966..980448)
                     /locus_tag="LMJF_27_2335"
                     /note="previous protein_id=AAZ09985.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722044.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2335"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2335"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982827"
                     /db_xref="UniProtKB/TrEMBL:E9ACV2"
                     /translation="MSQSNHDWGDMVLPGVYMIHRSTGSRMTSGTVPPDRAVNLELVH
                     LEIEETEDYIELLQKSNNEIAAYLKEQRESRSAEEEGGVAASMIELSDGGVEEEDDDA
                     VFREALEENGLVIARKKRELEQLRALISGQRCGCSCAHTQHHDPQPIGAPRNETRIIL
                     "
     gene            complement(<980761..>982011)
                     /locus_tag="LMJF_27_2337"
                     /db_xref="GeneID:12982828"
     mRNA            complement(<980761..>982011)
                     /locus_tag="LMJF_27_2337"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721997.1"
                     /db_xref="GeneID:12982828"
     CDS             complement(980761..982011)
                     /locus_tag="LMJF_27_2337"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722045.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2337"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2337"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982828"
                     /db_xref="UniProtKB/TrEMBL:E9ACV3"
                     /translation="MDTDLLLTLSSFCRVRMQARPVFFTESRTFVDDVDTFIKYWQRS
                     RSEQTATLLAFLKVVAYASVEAETRREQLIGSWLLCSLLLERKADVGKLYWQCERMRR
                     ILPLSLRVNRFGVDDRDSKVLSSLSLPPEAARPHNKGMTPTSSLSNSVKDLRREIRAV
                     EAAVAYSATLQGERDLQTPELDFVLPECAESKDVVIFCTQMIQKRKCFRSCCVRRLDD
                     CCHAKHLEACLTESGVQVVFVQQGINKQLKETFRRRKVLFLERLGRRTVDASEETLRW
                     TVFENFSDWFFFIRAKPSQASWRCWATTTQHQFGLTLKLRIRNRSKNARGSTGSIQSS
                     SYGAVKKPVLREVNSKILGTEGFGTGGDIEAFLLRNSFIAALLCGCADGGGNEGGENV
                     VCVMNYETSLRTLDTVCQLCRVLM"
     gene            989640..991843
                     /locus_tag="LMJF_27_rRNA_01"
                     /db_xref="GeneID:12982829"
     rRNA            989640..991843
                     /locus_tag="LMJF_27_rRNA_01"
                     /product="18S ribosomal RNA (SSU) RNA"
                     /transcript_id="XR_002460808.1"
                     /db_xref="GeneID:12982829"
     gene            991987..992269
                     /locus_tag="LMJF_27_rRNA_07"
                     /db_xref="GeneID:12982855"
     rRNA            991987..992269
                     /locus_tag="LMJF_27_rRNA_07"
                     /product="5.8S ribosomal RNA (M3) RNA"
                     /transcript_id="XR_002460814.1"
                     /db_xref="GeneID:12982855"
     gene            <992934..>994713
                     /locus_tag="LMJF_27_rRNA_13"
                     /db_xref="GeneID:12982861"
     rRNA            <992934..>994713
                     /locus_tag="LMJF_27_rRNA_13"
                     /product="28S ribosomal RNA (LSU-alpha)"
                     /transcript_id="XR_002460820.1"
                     /db_xref="GeneID:12982861"
     gene            <994802..>995014
                     /locus_tag="LMJF_27_rRNA_19"
                     /db_xref="GeneID:12982867"
     rRNA            <994802..>995014
                     /locus_tag="LMJF_27_rRNA_19"
                     /product="28S ribosomal RNA (LSU-gamma, M1)"
                     /transcript_id="XR_002460826.1"
                     /db_xref="GeneID:12982867"
     gene            <995339..>996863
                     /locus_tag="LMJF_27_rRNA_25"
                     /db_xref="GeneID:12982873"
     rRNA            <995339..>996863
                     /locus_tag="LMJF_27_rRNA_25"
                     /product="28S ribosomal RNA (LSU-beta)"
                     /transcript_id="XR_002460832.1"
                     /db_xref="GeneID:12982873"
     gene            <996917..>997077
                     /locus_tag="LMJF_27_rRNA_31"
                     /db_xref="GeneID:12982879"
     rRNA            <996917..>997077
                     /locus_tag="LMJF_27_rRNA_31"
                     /product="28S ribosomal RNA (LSU-delta, M2)"
                     /transcript_id="XR_002460838.1"
                     /db_xref="GeneID:12982879"
     gene            <997622..>997694
                     /locus_tag="LMJF_27_rRNA_37"
                     /db_xref="GeneID:12982885"
     rRNA            <997622..>997694
                     /locus_tag="LMJF_27_rRNA_37"
                     /product="28S ribosomal RNA (LSU-zeta, M6)"
                     /transcript_id="XR_002460844.1"
                     /db_xref="GeneID:12982885"
     gene            <997946..>998074
                     /locus_tag="LMJF_27_rRNA_43"
                     /db_xref="GeneID:12982891"
     rRNA            <997946..>998074
                     /locus_tag="LMJF_27_rRNA_43"
                     /product="28S ribosomal RNA (LSU-epsilon, M4)"
                     /transcript_id="XR_002460850.1"
                     /db_xref="GeneID:12982891"
     gene            <998467..>998595
                     /locus_tag="LMJF_27_rRNA_44"
                     /db_xref="GeneID:12982897"
     rRNA            <998467..>998595
                     /locus_tag="LMJF_27_rRNA_44"
                     /product="28S ribosomal RNA (LSU-epsilon, M4)"
                     /transcript_id="XR_002460851.1"
                     /db_xref="GeneID:12982897"
     gene            1001540..1003743
                     /locus_tag="LMJF_27_rRNA_02"
                     /db_xref="GeneID:12982898"
     rRNA            1001540..1003743
                     /locus_tag="LMJF_27_rRNA_02"
                     /product="18S ribosomal RNA (SSU) RNA"
                     /transcript_id="XR_002460809.1"
                     /db_xref="GeneID:12982898"
     gene            1003887..1004169
                     /locus_tag="LMJF_27_rRNA_08"
                     /db_xref="GeneID:12982856"
     rRNA            1003887..1004169
                     /locus_tag="LMJF_27_rRNA_08"
                     /product="5.8S ribosomal RNA (M3) RNA"
                     /transcript_id="XR_002460815.1"
                     /db_xref="GeneID:12982856"
     gene            <1004837..>1006616
                     /locus_tag="LMJF_27_rRNA_14"
                     /db_xref="GeneID:12982862"
     rRNA            <1004837..>1006616
                     /locus_tag="LMJF_27_rRNA_14"
                     /product="28S ribosomal RNA (LSU-alpha)"
                     /transcript_id="XR_002460821.1"
                     /db_xref="GeneID:12982862"
     gene            <1006705..>1006917
                     /locus_tag="LMJF_27_rRNA_20"
                     /db_xref="GeneID:12982868"
     rRNA            <1006705..>1006917
                     /locus_tag="LMJF_27_rRNA_20"
                     /product="28S ribosomal RNA (LSU-gamma, M1)"
                     /transcript_id="XR_002460827.1"
                     /db_xref="GeneID:12982868"
     gene            <1007242..>1008766
                     /locus_tag="LMJF_27_rRNA_26"
                     /db_xref="GeneID:12982874"
     rRNA            <1007242..>1008766
                     /locus_tag="LMJF_27_rRNA_26"
                     /product="28S ribosomal RNA (LSU-beta)"
                     /transcript_id="XR_002460833.1"
                     /db_xref="GeneID:12982874"
     gene            <1008798..>1008980
                     /locus_tag="LMJF_27_rRNA_32"
                     /db_xref="GeneID:12982880"
     rRNA            <1008798..>1008980
                     /locus_tag="LMJF_27_rRNA_32"
                     /product="28S ribosomal RNA (LSU-delta, M2)"
                     /transcript_id="XR_002460839.1"
                     /db_xref="GeneID:12982880"
     gene            <1009525..>1009597
                     /locus_tag="LMJF_27_rRNA_38"
                     /db_xref="GeneID:12982886"
     rRNA            <1009525..>1009597
                     /locus_tag="LMJF_27_rRNA_38"
                     /product="28S ribosomal RNA (LSU-zeta, M6)"
                     /transcript_id="XR_002460845.1"
                     /db_xref="GeneID:12982886"
     gene            <1009849..>1009977
                     /locus_tag="LMJF_27_rRNA_45"
                     /db_xref="GeneID:12982892"
     rRNA            <1009849..>1009977
                     /locus_tag="LMJF_27_rRNA_45"
                     /product="28S ribosomal RNA (LSU-epsilon, M4)"
                     /transcript_id="XR_002460852.1"
                     /db_xref="GeneID:12982892"
     gene            <1010372..>1010500
                     /locus_tag="LMJF_27_rRNA_46"
                     /db_xref="GeneID:12982899"
     rRNA            <1010372..>1010500
                     /locus_tag="LMJF_27_rRNA_46"
                     /product="28S ribosomal RNA (LSU-epsilon, M4)"
                     /transcript_id="XR_002460853.1"
                     /db_xref="GeneID:12982899"
     gene            1013571..1015774
                     /locus_tag="LMJF_27_rRNA_03"
                     /db_xref="GeneID:12982900"
     rRNA            1013571..1015774
                     /locus_tag="LMJF_27_rRNA_03"
                     /product="18S ribosomal RNA (SSU) RNA"
                     /transcript_id="XR_002460810.1"
                     /db_xref="GeneID:12982900"
     gene            1015918..1016200
                     /locus_tag="LMJF_27_rRNA_09"
                     /db_xref="GeneID:12982857"
     rRNA            1015918..1016200
                     /locus_tag="LMJF_27_rRNA_09"
                     /product="5.8S ribosomal RNA (M3) RNA"
                     /transcript_id="XR_002460816.1"
                     /db_xref="GeneID:12982857"
     gene            <1016866..>1018645
                     /locus_tag="LMJF_27_rRNA_15"
                     /db_xref="GeneID:12982863"
     rRNA            <1016866..>1018645
                     /locus_tag="LMJF_27_rRNA_15"
                     /product="28S ribosomal RNA (LSU-alpha)2"
                     /transcript_id="XR_002460822.1"
                     /db_xref="GeneID:12982863"
     gene            <1018734..>1018946
                     /locus_tag="LMJF_27_rRNA_21"
                     /db_xref="GeneID:12982869"
     rRNA            <1018734..>1018946
                     /locus_tag="LMJF_27_rRNA_21"
                     /product="28S ribosomal RNA (LSU-gamma, M1)"
                     /transcript_id="XR_002460828.1"
                     /db_xref="GeneID:12982869"
     gene            <1019275..>1020799
                     /locus_tag="LMJF_27_rRNA_27"
                     /db_xref="GeneID:12982875"
     rRNA            <1019275..>1020799
                     /locus_tag="LMJF_27_rRNA_27"
                     /product="28S ribosomal RNA (LSU-beta)"
                     /transcript_id="XR_002460834.1"
                     /db_xref="GeneID:12982875"
     gene            <1020831..>1021013
                     /locus_tag="LMJF_27_rRNA_33"
                     /db_xref="GeneID:12982881"
     rRNA            <1020831..>1021013
                     /locus_tag="LMJF_27_rRNA_33"
                     /product="28S ribosomal RNA (LSU-delta, M2)"
                     /transcript_id="XR_002460840.1"
                     /db_xref="GeneID:12982881"
     gene            <1021558..>1021630
                     /locus_tag="LMJF_27_rRNA_39"
                     /db_xref="GeneID:12982887"
     rRNA            <1021558..>1021630
                     /locus_tag="LMJF_27_rRNA_39"
                     /product="28S ribosomal RNA (LSU-zeta, M6)"
                     /transcript_id="XR_002460846.1"
                     /db_xref="GeneID:12982887"
     gene            <1021882..>1022010
                     /locus_tag="LMJF_27_rRNA_47"
                     /db_xref="GeneID:12982893"
     rRNA            <1021882..>1022010
                     /locus_tag="LMJF_27_rRNA_47"
                     /product="28S ribosomal RNA (LSU-epsilon, M4)"
                     /transcript_id="XR_002460854.1"
                     /db_xref="GeneID:12982893"
     gene            <1022404..>1022523
                     /locus_tag="LMJF_27_rRNA_48"
                     /db_xref="GeneID:12982901"
     rRNA            <1022404..>1022523
                     /locus_tag="LMJF_27_rRNA_48"
                     /product="28S ribosomal RNA (LSU-epsilon, M4)"
                     /transcript_id="XR_002460855.1"
                     /db_xref="GeneID:12982901"
     gene            <1022926..>1023054
                     /locus_tag="LMJF_27_rRNA_49"
                     /db_xref="GeneID:12982902"
     rRNA            <1022926..>1023054
                     /locus_tag="LMJF_27_rRNA_49"
                     /product="28S ribosomal RNA (LSU-epsilon, M4)"
                     /transcript_id="XR_002460856.1"
                     /db_xref="GeneID:12982902"
     gene            1028204..1030407
                     /locus_tag="LMJF_27_rRNA_04"
                     /db_xref="GeneID:12982903"
     rRNA            1028204..1030407
                     /locus_tag="LMJF_27_rRNA_04"
                     /product="18S ribosomal RNA (SSU) RNA"
                     /transcript_id="XR_002460811.1"
                     /db_xref="GeneID:12982903"
     gene            1030551..1030833
                     /locus_tag="LMJF_27_rRNA_10"
                     /db_xref="GeneID:12982858"
     rRNA            1030551..1030833
                     /locus_tag="LMJF_27_rRNA_10"
                     /product="5.8S ribosomal RNA (M3) RNA"
                     /transcript_id="XR_002460817.1"
                     /db_xref="GeneID:12982858"
     gene            <1031501..>1033280
                     /locus_tag="LMJF_27_rRNA_16"
                     /db_xref="GeneID:12982864"
     rRNA            <1031501..>1033280
                     /locus_tag="LMJF_27_rRNA_16"
                     /product="28S ribosomal RNA (LSU-alpha)"
                     /transcript_id="XR_002460823.1"
                     /db_xref="GeneID:12982864"
     gene            <1033369..>1033581
                     /locus_tag="LMJF_27_rRNA_22"
                     /db_xref="GeneID:12982870"
     rRNA            <1033369..>1033581
                     /locus_tag="LMJF_27_rRNA_22"
                     /product="28S ribosomal RNA (LSU-gamma, M1)"
                     /transcript_id="XR_002460829.1"
                     /db_xref="GeneID:12982870"
     gene            <1033908..>1035432
                     /locus_tag="LMJF_27_rRNA_28"
                     /db_xref="GeneID:12982876"
     rRNA            <1033908..>1035432
                     /locus_tag="LMJF_27_rRNA_28"
                     /product="28S ribosomal RNA (LSU-beta)"
                     /transcript_id="XR_002460835.1"
                     /db_xref="GeneID:12982876"
     gene            <1035464..>1035646
                     /locus_tag="LMJF_27_rRNA_34"
                     /db_xref="GeneID:12982882"
     rRNA            <1035464..>1035646
                     /locus_tag="LMJF_27_rRNA_34"
                     /product="28S ribosomal RNA (LSU-delta, M2)"
                     /transcript_id="XR_002460841.1"
                     /db_xref="GeneID:12982882"
     gene            <1036187..>1036259
                     /locus_tag="LMJF_27_rRNA_40"
                     /db_xref="GeneID:12982888"
     rRNA            <1036187..>1036259
                     /locus_tag="LMJF_27_rRNA_40"
                     /product="28S ribosomal RNA (LSU-zeta, M6)"
                     /transcript_id="XR_002460847.1"
                     /db_xref="GeneID:12982888"
     gene            <1036511..>1036639
                     /locus_tag="LMJF_27_rRNA_50"
                     /db_xref="GeneID:12982894"
     rRNA            <1036511..>1036639
                     /locus_tag="LMJF_27_rRNA_50"
                     /product="28S ribosomal RNA (LSU-epsilon, M4)"
                     /transcript_id="XR_002460857.1"
                     /db_xref="GeneID:12982894"
     gene            1041219..1043422
                     /locus_tag="LMJF_27_rRNA_05"
                     /db_xref="GeneID:12982904"
     rRNA            1041219..1043422
                     /locus_tag="LMJF_27_rRNA_05"
                     /product="18S ribosomal RNA (SSU) RNA"
                     /transcript_id="XR_002460812.1"
                     /db_xref="GeneID:12982904"
     gene            1043566..1043848
                     /locus_tag="LMJF_27_rRNA_11"
                     /db_xref="GeneID:12982859"
     rRNA            1043566..1043848
                     /locus_tag="LMJF_27_rRNA_11"
                     /product="5.8S ribosomal RNA (M3) RNA"
                     /transcript_id="XR_002460818.1"
                     /db_xref="GeneID:12982859"
     gene            <1044516..>1046295
                     /locus_tag="LMJF_27_rRNA_17"
                     /db_xref="GeneID:12982865"
     rRNA            <1044516..>1046295
                     /locus_tag="LMJF_27_rRNA_17"
                     /product="28S ribosomal RNA (LSU-alpha)"
                     /transcript_id="XR_002460824.1"
                     /db_xref="GeneID:12982865"
     gene            <1046384..>1046596
                     /locus_tag="LMJF_27_rRNA_23"
                     /db_xref="GeneID:12982871"
     rRNA            <1046384..>1046596
                     /locus_tag="LMJF_27_rRNA_23"
                     /product="28S ribosomal RNA (LSU-gamma, M1)"
                     /transcript_id="XR_002460830.1"
                     /db_xref="GeneID:12982871"
     gene            <1046923..>1048447
                     /locus_tag="LMJF_27_rRNA_29"
                     /db_xref="GeneID:12982877"
     rRNA            <1046923..>1048447
                     /locus_tag="LMJF_27_rRNA_29"
                     /product="28S ribosomal RNA (LSU-beta)"
                     /transcript_id="XR_002460836.1"
                     /db_xref="GeneID:12982877"
     gene            <1048479..>1048661
                     /locus_tag="LMJF_27_rRNA_35"
                     /db_xref="GeneID:12982883"
     rRNA            <1048479..>1048661
                     /locus_tag="LMJF_27_rRNA_35"
                     /product="28S ribosomal RNA (LSU-delta, M2)"
                     /transcript_id="XR_002460842.1"
                     /db_xref="GeneID:12982883"
     gene            <1049202..>1049274
                     /locus_tag="LMJF_27_rRNA_41"
                     /db_xref="GeneID:12982889"
     rRNA            <1049202..>1049274
                     /locus_tag="LMJF_27_rRNA_41"
                     /product="28S ribosomal RNA (LSU-zeta, M6)"
                     /transcript_id="XR_002460848.1"
                     /db_xref="GeneID:12982889"
     gene            <1049526..>1049654
                     /locus_tag="LMJF_27_rRNA_51"
                     /db_xref="GeneID:12982895"
     rRNA            <1049526..>1049654
                     /locus_tag="LMJF_27_rRNA_51"
                     /product="28S ribosomal RNA (LSU-epsilon, M4)"
                     /transcript_id="XR_002460858.1"
                     /db_xref="GeneID:12982895"
     gene            1052349..1054552
                     /locus_tag="LMJF_27_rRNA_06"
                     /db_xref="GeneID:12982905"
     rRNA            1052349..1054552
                     /locus_tag="LMJF_27_rRNA_06"
                     /product="18S ribosomal RNA (SSU) RNA"
                     /transcript_id="XR_002460813.1"
                     /db_xref="GeneID:12982905"
     gene            1054696..1054978
                     /locus_tag="LMJF_27_rRNA_12"
                     /db_xref="GeneID:12982860"
     rRNA            1054696..1054978
                     /locus_tag="LMJF_27_rRNA_12"
                     /product="5.8S ribosomal RNA (M3) RNA"
                     /transcript_id="XR_002460819.1"
                     /db_xref="GeneID:12982860"
     gene            <1055646..>1057425
                     /locus_tag="LMJF_27_rRNA_18"
                     /db_xref="GeneID:12982866"
     rRNA            <1055646..>1057425
                     /locus_tag="LMJF_27_rRNA_18"
                     /product="28S ribosomal RNA (LSU-alpha)"
                     /transcript_id="XR_002460825.1"
                     /db_xref="GeneID:12982866"
     gene            <1057514..>1057726
                     /locus_tag="LMJF_27_rRNA_24"
                     /db_xref="GeneID:12982872"
     rRNA            <1057514..>1057726
                     /locus_tag="LMJF_27_rRNA_24"
                     /product="28S ribosomal RNA (LSU-gamma, M1)"
                     /transcript_id="XR_002460831.1"
                     /db_xref="GeneID:12982872"
     gene            <1058053..>1059577
                     /locus_tag="LMJF_27_rRNA_30"
                     /db_xref="GeneID:12982878"
     rRNA            <1058053..>1059577
                     /locus_tag="LMJF_27_rRNA_30"
                     /product="28S ribosomal RNA (LSU-beta)"
                     /transcript_id="XR_002460837.1"
                     /db_xref="GeneID:12982878"
     gene            <1059609..>1059791
                     /locus_tag="LMJF_27_rRNA_36"
                     /db_xref="GeneID:12982884"
     rRNA            <1059609..>1059791
                     /locus_tag="LMJF_27_rRNA_36"
                     /product="28S ribosomal RNA (LSU-delta, M2)"
                     /transcript_id="XR_002460843.1"
                     /db_xref="GeneID:12982884"
     gene            <1060334..>1060406
                     /locus_tag="LMJF_27_rRNA_42"
                     /db_xref="GeneID:12982890"
     rRNA            <1060334..>1060406
                     /locus_tag="LMJF_27_rRNA_42"
                     /product="28S ribosomal RNA (LSU-zeta, M6)"
                     /transcript_id="XR_002460849.1"
                     /db_xref="GeneID:12982890"
     gene            <1060658..>1060786
                     /locus_tag="LMJF_27_rRNA_52"
                     /db_xref="GeneID:12982896"
     rRNA            <1060658..>1060786
                     /locus_tag="LMJF_27_rRNA_52"
                     /product="28S ribosomal RNA (LSU-epsilon, M4)"
                     /transcript_id="XR_002460859.1"
                     /db_xref="GeneID:12982896"
     gene            <1062087..>1063556
                     /locus_tag="LMJF_27_2340"
                     /db_xref="GeneID:12982906"
     mRNA            <1062087..>1063556
                     /locus_tag="LMJF_27_2340"
                     /product="sucrose hydrolase-like protein"
                     /transcript_id="XM_003721998.1"
                     /db_xref="GeneID:12982906"
     CDS             1062087..1063556
                     /locus_tag="LMJF_27_2340"
                     /note="previous protein_id=AAZ09986.1"
                     /codon_start=1
                     /product="sucrose hydrolase-like protein"
                     /protein_id="XP_003722046.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982906"
                     /db_xref="GOA:E9ACV4"
                     /db_xref="InterPro:IPR001362"
                     /db_xref="InterPro:IPR006232"
                     /db_xref="InterPro:IPR013148"
                     /db_xref="InterPro:IPR013189"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR023296"
                     /db_xref="UniProtKB/TrEMBL:E9ACV4"
                     /translation="MSHEQRIEEANNAVLAIRKSVDKEFYPHYHIAPFARSMSAPCGM
                     IYFKGLYHVFYQHQPFAEALGPMHWGHSTSEDMVYWRHHPIALAPGEDWDRDGCFSGS
                     SVVYDDRLYVFYTGHHWLTDIADDSQIYQVQCLAISENGFNFEKRGIVVKPPAGFSHF
                     RDPYVWFQDGRWWMVCGGRDSKDQGQLLLYSTDDLEDWDDSTFMILSKSEDRNVYMWE
                     HPCFFPLQRHQMLMFSPQGMQPEDYMFRNRYQTGLLIGLWKPNAIFSVTSTFKKLDLG
                     HDFYGAQTFLTRDGRRVFIGWLDMWDANMPTKQHHWTGMLSLPRVLLVEEASGRIRTP
                     PIKELESIRGNHKYLPRQTVRNNSQVPLLFDCTSYEVCVLFDMEASTAEKYGLWLGRG
                     LEIYVDEQSKRLVVNRHYPNYGISGYRSYALPAQALLLVHAYFDMSSVEVFVNEGEAV
                     LSTRIYPAREDRALSLFAANGTAHITRGDIWALNQSVMQ"
     gene            <1064365..>1065027
                     /locus_tag="LMJF_27_2350"
                     /db_xref="GeneID:12982830"
     mRNA            <1064365..>1065027
                     /locus_tag="LMJF_27_2350"
                     /product="putative vesicle-associated membrane protein"
                     /transcript_id="XM_003721999.1"
                     /db_xref="GeneID:12982830"
     CDS             1064365..1065027
                     /locus_tag="LMJF_27_2350"
                     /note="previous protein_id=AAZ09987.1"
                     /codon_start=1
                     /product="putative vesicle-associated membrane protein"
                     /protein_id="XP_003722047.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982830"
                     /db_xref="GOA:E9ACV5"
                     /db_xref="InterPro:IPR001388"
                     /db_xref="InterPro:IPR010908"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="UniProtKB/TrEMBL:E9ACV5"
                     /translation="MPISSSLVAFERVIIAEDSVSPSVAPALQKMLSLLPRHDAKVSY
                     QLEQDVFHFFIENDIVYACITSGHYENRIVFGFLLHIKDAFKASFAGRADRYPRHADL
                     TPENCHGFSSTLASSRKMFNESPQEDKVCRIKEQLSATREVMLQNLDSIIERGDRIDT
                     LCDRTELLRDEAQGFHYNARSLKHAVLMHQINIIIGAVILLAILVLIIAFSVCGIDFK
                     KC"
     gene            <1065438..>1066595
                     /locus_tag="LMJF_27_2360"
                     /db_xref="GeneID:12982831"
     mRNA            <1065438..>1066595
                     /locus_tag="LMJF_27_2360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722000.1"
                     /db_xref="GeneID:12982831"
     CDS             1065438..1066595
                     /locus_tag="LMJF_27_2360"
                     /note="previous protein_id=AAZ09988.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722048.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982831"
                     /db_xref="UniProtKB/TrEMBL:E9ACV6"
                     /translation="MPSAATLSIDARKWTETIKAAGADCLCSAVSAKNVTHVLSTATV
                     RAPQKQLCAAVSDFVPAMLENTHGVSILTALVRYGTTATVEQIASKLTPAEEGVWSFT
                     AAPKKEMTKCLSHLLERLVYREDCTGESHNALLGRLKAVKKKSLMTSSFTLPATARLA
                     LVDDAFAAGLLSSGEAQKALGRSCQHAATAASAEEFCRTLLERPKDNAASDFVWKALA
                     ASMKADAKAHPREAILALLAAHGPVQLVNRMADAMAQWSTVRELCTLDSYAHIIAHLL
                     ERCDDERAGNRLVAAVITQEADVTERMGARKAAQQHLLAALAAKSSYAQTLERRLGTS
                     QTKRLAAAKVRFANATQSKATTTQQAILEKLKKLHSTTKSSLVAGTKRARE"
     gene            <1067099..>1067560
                     /locus_tag="LMJF_27_2370"
                     /db_xref="GeneID:12982832"
     mRNA            <1067099..>1067560
                     /locus_tag="LMJF_27_2370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722001.1"
                     /db_xref="GeneID:12982832"
     CDS             1067099..1067560
                     /locus_tag="LMJF_27_2370"
                     /note="previous protein_id=AAZ09989.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722049.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982832"
                     /db_xref="UniProtKB/TrEMBL:E9ACV7"
                     /translation="MKRLQPVCPAAMVPGCGAAMQYSRRWNLLEHRTKGSPYMKHLDL
                     YARRDPQLAPYLLREVDIEYKRKCRKVSFLVWVVIFTVSVAWQTRMQGEALHYMRLYA
                     SYVRAEQDAKDEDNIKRRKAFVGVMNVVKDAFDRDQRWTAADEAKALKELR"
     gene            <1067780..>1068250
                     /locus_tag="LMJF_27_2380"
                     /db_xref="GeneID:12982833"
     mRNA            <1067780..>1068250
                     /locus_tag="LMJF_27_2380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722002.1"
                     /db_xref="GeneID:12982833"
     CDS             1067780..1068250
                     /locus_tag="LMJF_27_2380"
                     /note="previous protein_id=AAZ09990.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722050.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982833"
                     /db_xref="UniProtKB/TrEMBL:E9ACV8"
                     /translation="MSSHVIGALPCPRSSSLLTAACWVHVILFLQVSLSLSLVAAHTM
                     LYTITLALLTFASAFMVADTVANIWQLLNSARVALISYGVWMAALTLTVLGTDWLTTL
                     GFVHALIFVACWWLVRDGDNPAHSSPSRDDYVRFPVMVYVPAFVVLYSLQGWLQ"
     gene            <1068872..>1070341
                     /locus_tag="LMJF_27_2390"
                     /db_xref="GeneID:12982834"
     mRNA            <1068872..>1070341
                     /locus_tag="LMJF_27_2390"
                     /product="putative TPR-repeat protein"
                     /transcript_id="XM_003722003.1"
                     /db_xref="GeneID:12982834"
     CDS             1068872..1070341
                     /locus_tag="LMJF_27_2390"
                     /note="previous protein_id=AAZ09991.1"
                     /codon_start=1
                     /product="putative TPR-repeat protein"
                     /protein_id="XP_003722051.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982834"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR025986"
                     /db_xref="UniProtKB/TrEMBL:E9ACV9"
                     /translation="MDRSVAESIRQQSDDLRDELKELEQWEDAMQAREMAKAQRKVPL
                     PTSVAAAEPPIRGTVPSLKEAIRQQQQQARATGTSGDTAAEAIADPIQQAKDKGNVLF
                     QSGHLQEAVAAYTVGIDLDPASATTHVLYANRAMCYLKLGQWTAAEKDATTCVHMNTG
                     YAKAYYRRAVARKQLGKLREARADLEAVLALAPKDVSAQQEMESVTKALQAKRAAESQ
                     ATTTATTTKKKRIVIEEVDSEGDEAAAEAPATSASKLSTEEEELHQACIEEDMRRLAA
                     ARKANEEQVRQEAQREAAAQAKRQRRHERVEIIEEAEHSPAEKKKMAPSPATSSPVVE
                     QTPPLSTSSPPSSSSPSPTSAATRPRARPPIAKESLTAPKSFSEFERRFRELVQQPDL
                     RDHYVRLLDPATMAKLFGSNMSPEMLLGILQAIKTFNATTALQYAKGLCQVSRVEDVA
                     LFFDAQEKAVVQDVLDLLRSAPGTPAKDIQQIERKLKPL"
     gene            <1071304..>1072494
                     /locus_tag="LMJF_27_2400"
                     /db_xref="GeneID:12982835"
     mRNA            <1071304..>1072494
                     /locus_tag="LMJF_27_2400"
                     /product="putative heat shock protein DNAJ"
                     /transcript_id="XM_003722004.1"
                     /db_xref="GeneID:12982835"
     CDS             1071304..1072494
                     /locus_tag="LMJF_27_2400"
                     /note="previous protein_id=AAZ09992.1"
                     /codon_start=1
                     /product="putative heat shock protein DNAJ"
                     /protein_id="XP_003722052.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982835"
                     /db_xref="GOA:E9ACW0"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR012724"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:E9ACW0"
                     /translation="MVKETGYYNALGLSPDASEDEIKRAYRKLALKYHPDKNTEPGAQ
                     EKFKEVSVAYECLSDPDKRKRYDQFGKDAVEMQGGGVDPSDIFASFFGGGSRPRGEPK
                     PKDIVHELPVPLEAFYCGKTIKLAITRDRLCTQCSGTGSKVAGVSATCKDCGGRGVRM
                     MTRQLQPGFIQQIQTACPVCKGKGTNLREEDKCVSCRGQQIIKDKKVFEVMVEKGMHR
                     GDSVTFSGEGDQIPGVKLSGDIIIILDQKPHQTFIRKGDHLFLEQTISLAEALTGFSL
                     NITQLDGRELAISSTAGTIIDPANMYSVSREGMPVAHTGGMERGDLIIRFQVVFPKTL
                     RQGCVPELRKMLGYPQQPPAKDGAEQYTLQESHIDLEKEARRNAYDDDGDQPRVQTAG
                     CAQQ"
     gene            <1074805..>1075923
                     /locus_tag="LMJF_27_2410"
                     /db_xref="GeneID:12982836"
     mRNA            <1074805..>1075923
                     /locus_tag="LMJF_27_2410"
                     /product="aldo-keto reductase-like protein"
                     /transcript_id="XM_003722005.1"
                     /db_xref="GeneID:12982836"
     CDS             1074805..1075923
                     /locus_tag="LMJF_27_2410"
                     /note="previous protein_id=AAZ09993.1"
                     /codon_start=1
                     /product="aldo-keto reductase-like protein"
                     /protein_id="XP_003722053.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982836"
                     /db_xref="GOA:E9ACW1"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:E9ACW1"
                     /translation="MSANVLAYRPLAGPVIAITHRIAMRDSHTIPQLGFGTYRLPVSE
                     ATDAVAFALSCGYRHVDCAKAYGNEAAVGEALAQALRTRCTRREDLFVTSKLWPTDQH
                     PDHVEAACRATLAALQLDYLDLYLIHWPVCMRHTPHWTSDEDRYPRHRDGTPAIDTSV
                     TLLDTWTAMNRLVDRGLVKSIGLANCTTAHVNDLVKAVAEAKLAHLPVLNQVEHHPGI
                     VDGDLIGCLGSHDMLMAAYCPLGMPTCSTPPGFQSLLDDPVLRSLSAFSGFSPARLLL
                     NWSVDRHNVVIVKSASREHIRSNAKAARFALDDRTRLVLDNYHLLVRNFRVMNPTHFS
                     VDGATPFFAAEDARLQREIDAYRSTRTGTTTAPPSPRS"
     gene            <1076399..>1077241
                     /locus_tag="LMJF_27_2420"
                     /db_xref="GeneID:12982837"
     mRNA            <1076399..>1077241
                     /locus_tag="LMJF_27_2420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722006.1"
                     /db_xref="GeneID:12982837"
     CDS             1076399..1077241
                     /locus_tag="LMJF_27_2420"
                     /note="previous protein_id=AAZ09994.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722054.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982837"
                     /db_xref="InterPro:IPR010776"
                     /db_xref="UniProtKB/TrEMBL:E9ACW2"
                     /translation="MKTCKTGIQKVRDVSEATVLVLDWFERRNKPATPQSLADALGSR
                     VAKSLLQKILEQLHAEEKLHVKDMKKIRFYYRRVLPLSDADGATTTKQHSEPEDDPAA
                     TTGERGNAVNVPEVCGGAETCAESPADAHAALLHAVAISAVQLSERSLRLTRWRGWPS
                     STERADKYADLAREVCELRNSLERLQSRHAGESAEAHGGGSWTSRVRRAVCRYRRARR
                     HWVQRKDWAMCLLEATAGDAHTPLQAAALLGCTTDAEAGVSFEDTAVALPAPLMRELN
                     LSQR"
     gene            <1077845..>1079527
                     /locus_tag="LMJF_27_2430"
                     /db_xref="GeneID:12982838"
     mRNA            <1077845..>1079527
                     /locus_tag="LMJF_27_2430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722007.1"
                     /db_xref="GeneID:12982838"
     CDS             1077845..1079527
                     /locus_tag="LMJF_27_2430"
                     /note="previous protein_id=AAZ09995.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722055.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982838"
                     /db_xref="UniProtKB/TrEMBL:E9ACW3"
                     /translation="MMSEASTSVDGEEAMPLPERFQQLRHSLHGHWGTSAEADLLRAM
                     QQLHTRLVARSAQTHRRVEELSQRATAAQVSLANALNALKLLSQQQFVQHRIATEDLQ
                     QRQRTVAGSSSEEADDGSSDGTVSPNRALATSLPTHTTKEAAVRRRMHDYVEMCKELL
                     AEEGVRVPLCPGDVAELAAESPYAHRRLCGLIGTPAFLYDADIGCRRGADVMSAAAVK
                     QRQSPQSQPACLPAAMPPAAVTGVPSAPAKPLSPPSAAAKASVPPPHATTTGAVAPPA
                     RAPRAQSSVVPPPTAAKVAPAKKERHQALFSSSSSSASSSASPSAAVTPAAKSSPPLT
                     KRGAAAPARRPKSAPAKKGARNLFDSLSSSVRSNSVSSARAEAAKRAAYSPTSSDLSS
                     SDDSRPPPAAARKVSNPSPPPLAATTASPPRTPSASSHSSQGSSASSGTPASPATATP
                     APPATPPPAPPPPSSAAPAAYTPPSASPPPPPPPPPAAPSAPAAVLPPPPPVFLFDTV
                     SAMGAPASLPQAAAIQFSAPQSATPSFHTAAGPQPPRRGGKVLSTSSDDDAE"
     gene            <1079832..>1080713
                     /gene="KAR1"
                     /locus_tag="LMJF_27_2440"
                     /db_xref="GeneID:12982839"
     mRNA            <1079832..>1080713
                     /gene="KAR1"
                     /locus_tag="LMJF_27_2440"
                     /product="putative 3-oxoacyl-ACP reductase"
                     /transcript_id="XM_003722008.1"
                     /db_xref="GeneID:12982839"
     CDS             1079832..1080713
                     /gene="KAR1"
                     /locus_tag="LMJF_27_2440"
                     /EC_number="1.1.1.100"
                     /note="previous protein_id=AAZ09996.1"
                     /codon_start=1
                     /product="putative 3-oxoacyl-ACP reductase"
                     /protein_id="XP_003722056.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982839"
                     /db_xref="GOA:E9ACW4"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:E9ACW4"
                     /translation="MRAPNAHPHSPCALYSLPLLLTASFLQLQRHQWDARDRDTHAQI
                     SVSLKPHNMVWNVRGKVGVITGASCALGREIMERLASQHQMKLACVSRKPLATPLPAG
                     CAAFVADVSRGDDCDALMKSVQRELGAVSLLINCAGVTLNKVHVMCTDNDYAAVMDTN
                     LKGALQVTRAALRHGGLLKLQDGAVLHIGSVAGVVGNEGQVLYSASKAALSGAVKSWA
                     LEYGPRNIRFNVVAPGLIDGEGMATTLTEGQKQRWRDDCPLKRLATTSEVADMAVAVA
                     LCCYMNGQTIAVDGGLS"
     gene            <1081236..>1082579
                     /locus_tag="LMJF_27_2450"
                     /db_xref="GeneID:12982960"
     mRNA            <1081236..>1082579
                     /locus_tag="LMJF_27_2450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722009.1"
                     /db_xref="GeneID:12982960"
     CDS             1081236..1082579
                     /locus_tag="LMJF_27_2450"
                     /note="previous protein_id=AAZ09997.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722057.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982960"
                     /db_xref="UniProtKB/TrEMBL:E9ACW5"
                     /translation="MQALPQVLDDRRQRLQVHENTVVQDAAQKMNVTVQQLYACTADI
                     RQCSDVIEGSVLVLGVHTAHTLLTHLSRSLKSIEAVMDAWRTTAAAYQEHFTQCRQLM
                     ASMDQAYSGMKERRKTAETELRALRAERDRKEQAYDAAVLYVQRVLAEHTQWQEAHSY
                     NTQRWPMTDTCEEALAVLHAVRAGSSAGNSDRRSRKDGDIGREEVPLPLKDDTSGSVG
                     EVSRSFYASFVSPLPLPALCEWSPVVSSSKANSSEASGDVARRWCTTMGGRLSATQPS
                     LHFAYVPPAEEVQLLREVLAMGTGSSSLMKDIQSAQARLDERRTRVRRVCTRSLDSLH
                     AMRQEMRILRTHLQHLLDSQTPFMSMTEELLSRVRTHMEVEVARRVAAITAPTAMTST
                     TVLSPTGGSQGGISSTPRLNSSSVSYVAIPSSGLSEVAESGGDTASEGWAWMADA"
     gene            <1083309..>1084208
                     /locus_tag="LMJF_27_2460"
                     /db_xref="GeneID:12982840"
     mRNA            <1083309..>1084208
                     /locus_tag="LMJF_27_2460"
                     /product="putative protein kinase"
                     /transcript_id="XM_003722010.1"
                     /db_xref="GeneID:12982840"
     CDS             1083309..1084208
                     /locus_tag="LMJF_27_2460"
                     /EC_number="2.7.11.1"
                     /note="previous protein_id=AAZ09998.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_003722058.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982840"
                     /db_xref="GOA:E9ACW6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9ACW6"
                     /translation="MSLDTDYEVERYAFVAGCRVKVCRCTHRSTGSKRAVKVYHTAAM
                     DSRRAAMAVEEGMLAKSLPAAPQLVRVFDVYVEVERVSIVMEYMEHGSLYQRITTCGP
                     LAETEARDVARHILTGLALLHANNVMHRDIKPENVFVRTTTSSSTGLGGAAAKTASAA
                     TTVVAIGDFGFATRRIPHDEFVGSPQYSAPELALIALQQRYSHAGTALPLTARPLYSE
                     KCDVWSAGVVVFVTLTGLLPFDGATPEDVFTAVIRNVVPFNKVSPGRMSPSARAFIEA
                     LLTPNPSKRPSAKEALRHAWLTG"
     gene            <1084915..>1086600
                     /locus_tag="LMJF_27_2470"
                     /db_xref="GeneID:12982841"
     mRNA            <1084915..>1086600
                     /locus_tag="LMJF_27_2470"
                     /product="putative protein kinase"
                     /transcript_id="XM_003722011.1"
                     /db_xref="GeneID:12982841"
     CDS             1084915..1086600
                     /locus_tag="LMJF_27_2470"
                     /EC_number="2.7.11.1"
                     /note="previous protein_id=AAZ09999.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_003722059.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982841"
                     /db_xref="GOA:E9ACW7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9ACW7"
                     /translation="MGRTAEAIAPSKGHFRHHYSLSDEIGKGAYAVVFRCIHRETKAV
                     YAVKIVDKRKAGPKDIDDITHEIDVMGRIGYHPNVVQMMEYFSTERRFYIVLDLLAGG
                     MLFNRIVELQHYSESNASVLVRNVLSGLAHIHSRGVIHRDLKPENLLLRYAASPSTSP
                     NSNLTDVCLADFGLAGYVPSTTCCGSPSYIAPEVISVGYYRTRKEPYDSKCDIWSIGV
                     VTYILLSGKMPFHGNSFRETFELVVGNRWSFSSDTWASVTPTAKDFIEACLTYDPVER
                     PTALELLQHPWLANEQPHVHLGRSLESLRSLTKTKVKAAVRVFCWTQSLLGPLDWTPP
                     FMRFLRHSDKFSTVLTHQSQTDPQQVHTVDFGKALNHEKPGWRIQDCCTCPSEQVCRH
                     IQNVHEYLFVGKRSMEVYPFIDELRMMHEEAEDRLTADQRDAEARKRLDQVNYLIEAA
                     CVFSDELAKVPAGELKPNLMLDGSRNTLFRALGGSRSVTKTWHGPDKKDVAHRVVEKM
                     RAQKLASPATGKSTKAAAMPRSSTPTPKASSKPSSTSKRIKTAPNAGTPSRCS"
     gene            <1088295..>1089836
                     /locus_tag="LMJF_27_2480"
                     /db_xref="GeneID:12982842"
     mRNA            <1088295..>1089836
                     /locus_tag="LMJF_27_2480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722012.1"
                     /db_xref="GeneID:12982842"
     CDS             1088295..1089836
                     /locus_tag="LMJF_27_2480"
                     /note="previous protein_id=AAZ10000.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722060.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982842"
                     /db_xref="GOA:E9ACW8"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR003613"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR013915"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:E9ACW8"
                     /translation="MLRCNISQRVPTHPVVSVKSGLVFERSLVEKYVDEHGRCPVTGD
                     PLRKEDLITAQGAAPDASIASSGSLGAASVPTLLERLQVEWEGVALEQFSLRQQVTQL
                     QLELAHALQQYDAACRVIARLSKELDSLRGGKAVAAEETDKGPAVVVVPAPVLRRMDA
                     AEAAERQARKQRKAAAGSTAATPSQLTEEAQWVATPSSSASASSARSAVRVAAAADAS
                     SSGVFVSAVTGDHAIVRYSPDGFSEEARGIGHTATVHTLASQPGDILLSAAEDLTVRV
                     WSTKGAALTVMHTLRYASGVVAMSQRTVGGAYMLCGAGDGVLTLSDLESGAHVVATAP
                     LTLDTTSGALTCVELHPYASLAAVAFQPTELQLWDAREMRADTFISHVRGTAPRTHIC
                     SASFSADCVSLAAGLTDGSVYVWDLRQVLAPVAVLPPSADAVPATVRYAPDGRSLVVG
                     GHGVTLYDCARLSASSTAVEAVATAGLKASAVCDVCWTTSGTDVLCGSVDGVVRLYST
                     AAGAT"
     gene            <1090430..>1091869
                     /locus_tag="LMJF_27_2490"
                     /db_xref="GeneID:12982843"
     mRNA            <1090430..>1091869
                     /locus_tag="LMJF_27_2490"
                     /product="tubulin-tyrosine ligase-like protein"
                     /transcript_id="XM_003722013.1"
                     /db_xref="GeneID:12982843"
     CDS             1090430..1091869
                     /locus_tag="LMJF_27_2490"
                     /note="previous protein_id=AAZ10001.1"
                     /codon_start=1
                     /product="tubulin-tyrosine ligase-like protein"
                     /protein_id="XP_003722061.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982843"
                     /db_xref="GOA:E9ACW9"
                     /db_xref="InterPro:IPR004344"
                     /db_xref="UniProtKB/TrEMBL:E9ACW9"
                     /translation="MRMRPFTASTAATPTAAGAAPASSMSSPAPLRKARESATGSAGS
                     YFLGSSTFSVYEEMARQLREEGWRRKTEAAIATADFILGDRFRIPYTLLRVERMARSS
                     WFGGTRWVNYFEGSHRLTLKAAMVQLMKEVDTHWATWLPESYAVGGDQLKKADERRAL
                     LEALAAAGDDDAVWIVKPSSGAKGRHILLLRASAVPEWLERLPESSKSMYVVQRYVDR
                     PLLLSNGRKFDIRVWALLVSPYSIYAYTQVSCRTASEPYDLSDITNTHVHLTNHCLQK
                     DAAHFGEYEEENEMWLPQLQSYLTSIGKPADLLETRVLPAIKELLVRTLLAVMPEMAV
                     PATEAYKCFQLFGYDMILTEEADVRLLEINGSPGVAERFLTPLVRSMRELLGAGPKDG
                     TGSTTTTRNCDNTSHEGFSENGSSSNSGCASPTSASSSCPGRRRTSHAFSAATSATGA
                     TRNWRLEDEGFVLLWRRGDAVPPGLVDVC"
     gene            <1092499..>1092912
                     /locus_tag="LMJF_27_2500"
                     /db_xref="GeneID:12982844"
     mRNA            <1092499..>1092912
                     /locus_tag="LMJF_27_2500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722014.1"
                     /db_xref="GeneID:12982844"
     CDS             1092499..1092912
                     /locus_tag="LMJF_27_2500"
                     /note="previous protein_id=AAZ10002.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722062.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982844"
                     /db_xref="UniProtKB/TrEMBL:E9ACX0"
                     /translation="MPTKRVVSKRPAEVPLHPSDADAPSSTQHTADTAVASASATLTA
                     AAAEVAAPKVIMSKAQRRKLKKPPVIVTAEMKERAREETRELRKHLRILKSNGARRKV
                     AKLREKRPREHNMNEEAVNAFDTDFRPHKKGRRLE"
     gene            1093720..1106619
                     /locus_tag="LMJF_27_2590"
                     /pseudo
                     /db_xref="GeneID:12982845"
     misc_feature    1093720..1106619
                     /locus_tag="LMJF_27_2590"
                     /pseudo
                     /db_xref="GeneID:12982845"
     gene            <1110070..>1111884
                     /locus_tag="LMJF_27_2600"
                     /db_xref="GeneID:12982846"
     mRNA            <1110070..>1111884
                     /locus_tag="LMJF_27_2600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722015.1"
                     /db_xref="GeneID:12982846"
     CDS             1110070..1111884
                     /locus_tag="LMJF_27_2600"
                     /note="previous protein_id=AAZ10003.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722063.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982846"
                     /db_xref="UniProtKB/TrEMBL:E9ACX1"
                     /translation="MPFFCVGDAATCPSEVCEELAAKPITAHHQLIISTVTHQLGPLA
                     GAICRTLIQSGPMSLKDISDAVHRDEEVRAVAAAAANRASATGEKTTAVPPTHQVGSS
                     FHVNLGDIASVNDVIHEVAVKELVTRLVVHRLIHADPATHLYEIRYGSAILLRVLFPL
                     LLHCARQQYGEAAKCVLLVVYQLGVVPPRAAVQVALSRTPSITRDAIEYAVVRMVEDG
                     WLVPVLNLPTTAPGAATAANAARLADLAPSHPGSNADLWNATTPYSVGLEAALHYLFN
                     DAIEQAVAERYADGRLALTLVRALRRRVAPNSGYTEAVASFQELAAELPMTAGVRRDR
                     SGELRMGTDNVPSSSVEAVQRCLQRLCQPIVFYSCDAAAPMTSAAGISPSFTTMPSTR
                     ALLVKPHSQSNFYAIDHVTAVHLLQEAVCERVVYSRYGVLGVRIMKLLLQHHFLEERT
                     LAEQSIATYVKVREVLHQMFKDGFLLQQEVPRTSALVERSAKASVYLWGLSWSATLLP
                     VVRERLAKTLTIAWAKLREAQQQASAVAKHAAGGRPTPAAGSSINSSAAHAEEIEAQW
                     KYGMSRNIQQALQAQRAVTGLQSCVMSLMRLLLIVDFF"
     gene            <1113174..>1114079
                     /locus_tag="LMJF_27_2610"
                     /db_xref="GeneID:12982847"
     mRNA            <1113174..>1114079
                     /locus_tag="LMJF_27_2610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722016.1"
                     /db_xref="GeneID:12982847"
     CDS             1113174..1114079
                     /locus_tag="LMJF_27_2610"
                     /note="previous protein_id=AAZ10004.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722064.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982847"
                     /db_xref="UniProtKB/TrEMBL:E9ACX2"
                     /translation="MQSTLQQLQHDLAFHAKRRIEAEREAGGHLASAPRPRPSSDSES
                     VTPLRAETTAAQQRRVADPDVLSEAARIQRARAAAADEGLSDDQSVEDYGVDCEVPRL
                     TSDSCLADEVAAIAVCMAKIKESAKVMYDTEAAAPSTSTAPWWSSALHMRDMKASAAR
                     LDYHARTALSWSHRSREQLLLKAVMLNNVSVSTRTQLLDQQQHWQEFQTRLRDGQETV
                     MHLQADIARYQARVQAEMARRAALQEELRLCSQERGLVDPGEHNPLKAELALLLEERE
                     WPSDTLKKDASVVLDWLRSVSTTLE"
     gene            <1114786..>1117599
                     /locus_tag="LMJF_27_2620"
                     /db_xref="GeneID:12982848"
     mRNA            <1114786..>1117599
                     /locus_tag="LMJF_27_2620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722017.1"
                     /db_xref="GeneID:12982848"
     CDS             1114786..1117599
                     /locus_tag="LMJF_27_2620"
                     /note="previous protein_id=AAZ10005.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722065.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982848"
                     /db_xref="UniProtKB/TrEMBL:E9ACX3"
                     /translation="MSVSSPLDGGGAGGTVVQSSATHRGASAPANTTAATAEPHTPLF
                     TAAENAELQAIEAECNTFHEYERQYQEVLMTLEGDDVLDKFRAEYEGLHSSLLRSHEG
                     EGRLLRKCTDLQSDIDACAEKAVAAAEMTLGDRDTIANLKSETERTSHRLTEVREKEA
                     QLKETIATLKREIAVQQAKAQDPIEMPEQEAALQSLRRLHETLQREEEQLTQQLRSTS
                     LDMAATQRRIATLVSSNSGNAAELRLVREAIVQSEEEVQRVLQSKSMKEQELQAVRDT
                     IARRIAYYTSQQHTLEALVEDHERNGQELRDVRQEEARLTDEYQGVCHQLQNVNTALQ
                     ECNEEHDLWQRRVYERAAELQAQQAAVASVHRRYVKAQKVVEALQRRNAVTEVQKSEQ
                     VEKQLDVAAQLKSEEAALALAKRAAHTAAQTAVSVRGEVNILQQQITGEAAEQHRNAA
                     WLAEKRGQLRALESVLTSFEEHIQQTHRELYVVTQEAEFSEARAKKQAFACAHLLSSI
                     ENKEAELAHYEGSLTEVEARIKQQQVLLESMVAERNTYTSHYNQLKQGLSEQQHRFSL
                     LLAKVQSMRSSIQKRGKDVKLEVAHIQLLRQQRKELEAHVTDYQRRAHTRQRCADALG
                     QEIQQLRAVLSDAADETARQQRRCHDVVHEKDRLDRQVTDRATELHALYEQARTQQSL
                     LQHHERLYNDQARQLEHLQYQTLQFAQQLEQLRMFVARLPELRVLLNNATRELQREKV
                     RVQALLDAAYHPVNVHPYHEVASAEPETYALLQRVQKLQRVLVQRRNQLEEKEAAIQS
                     VEQRYMKAKATVAHQPGPEIAEQLTAYQENLVKKGQHMRQMQEALEFFRSQTDQFKAR
                     HDVLRERLAEMGKTYAAGRAEDERRSRAGALTGATSATPRPDSPSVTAEPVVYRGFVA
                     PPRATMNTAATSALLLAPPPMRE"
     gene            <1119384..>1121837
                     /locus_tag="LMJF_27_2630"
                     /db_xref="GeneID:12982849"
     mRNA            <1119384..>1121837
                     /locus_tag="LMJF_27_2630"
                     /product="putative serine peptidase"
                     /transcript_id="XM_003722018.1"
                     /db_xref="GeneID:12982849"
     CDS             1119384..1121837
                     /locus_tag="LMJF_27_2630"
                     /note="previous protein_id=AAZ10006.1"
                     /codon_start=1
                     /product="putative serine peptidase"
                     /protein_id="XP_003722066.1"
                     /db_xref="GeneID:12982849"
                     /db_xref="GOA:E9ACE5"
                     /db_xref="InterPro:IPR001270"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR018368"
                     /db_xref="InterPro:IPR019489"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9ACE5"
                     /translation="MLRRCLAQASTALRCGSTAALAAPFAPFGCGATRTAAVDAVACS
                     RLASSTAAYPTLRTSCRWQSTGVTPWKSSGNSGGGGNGGQQQGRTWVNPNAVPPGEFL
                     KKYARDLTEEARTGRLDPIVGREEVIRRTIQVVSRRTKNNPVLIGEPGVGKTAIVEGL
                     AQRIVKGEVPESIKDRQVYALDMGTLVAGAKFRGEFEERLKGVLKDTIESHGKVILFI
                     DELHTLVGAGSSGDGSMDAANLLKPSLARGELHCIGATTLDEYRQHIEKDAALARRFQ
                     SVLVTEPTVEETISILRGIKEKYEAHHGCLIKDEALVYAAVNSHRYLSERRLPDKAID
                     LIDEAASRLRLQQESKPEALDLIERELIRLKIEAEAVKKDKDEVGKEKLENLYEQISQ
                     KQKEYDALEERWKKEKNLFQTIKQRTEELDVLRHHLEQAMNSGDFAKAGEIQHSQIPN
                     LLKQIEKDKHLASSKNFMVHDSVTSKDIAEVIARATGIPVAQLMTSEREKLIHMDAEL
                     KKTIMGQDAAIESITNVVRISRAGLHSHKRPLGSFLFLGPTGVGKTEVCKSLAKFLFD
                     DESFICRIDMSEYMERHSVHRLIGAPPGYVGYEEGGELTESVRRRPYQIVLFDEFEKA
                     HPSVSNILLQVLDEGHLTDSHGRRVDFKNTIIILTSNIGADVIARLPEGKPSISAMPA
                     VMEQVRQRLAPEFINRLDDIIMFNRLSREDIRSIVEILFAQVQKMLTEHNITLEESTE
                     VYDWLSVNGYSAVYGARPLKRLVQSELLNQLALMLLDGRVREGEHVRLSVQDGHVVVV
                     ANHALSPEKGPTDERLLDQ"
     gene            <1122981..>1123223
                     /locus_tag="LMJF_27_2640"
                     /db_xref="GeneID:12982850"
     mRNA            <1122981..>1123223
                     /locus_tag="LMJF_27_2640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722019.1"
                     /db_xref="GeneID:12982850"
     CDS             1122981..1123223
                     /locus_tag="LMJF_27_2640"
                     /note="previous protein_id=AAZ10007.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722067.1"
                     /db_xref="GeneID:12982850"
                     /db_xref="UniProtKB/TrEMBL:E9ACE6"
                     /translation="MSLIFSTTSPPPVEIAVDDSRWDALAAECQKCSESLYKCKQETE
                     RIVQSMDAVLFCAALEATPPSVCGARLLSSAPPPLC"
     gene            <1124410..>1124796
                     /locus_tag="LMJF_27_2650"
                     /db_xref="GeneID:12982851"
     mRNA            <1124410..>1124796
                     /locus_tag="LMJF_27_2650"
                     /product="dehydrogenase/oxidoreductase-like protein"
                     /transcript_id="XM_003722020.1"
                     /db_xref="GeneID:12982851"
     CDS             1124410..1124796
                     /locus_tag="LMJF_27_2650"
                     /note="previous protein_id=AAZ10008.1"
                     /codon_start=1
                     /product="dehydrogenase/oxidoreductase-like protein"
                     /protein_id="XP_003722068.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.27.2650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.27.2650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982851"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:E9ACX6"
                     /translation="MDALRDTAMQPACCASEDAVPLMCKSVALELIPSNIFVNVKRLG
                     TGDTPMDEHLMLLTHQHPENLGEVLPIGRLQHPHVITEPVSFFDSDRTSCMLGADASI
                     DGNSTVKSHVQAAHRNAKAAYRREGG"
     gene            <1125916..>1127952
                     /locus_tag="LMJF_27_2660"
                     /db_xref="GeneID:12982852"
     mRNA            <1125916..>1127952
                     /locus_tag="LMJF_27_2660"
                     /product="putative peptidyl dipeptidase"
                     /transcript_id="XM_003722021.1"
                     /db_xref="GeneID:12982852"
     CDS             1125916..1127952
                     /locus_tag="LMJF_27_2660"
                     /note="previous protein_id=AAZ10009.1"
                     /codon_start=1
                     /product="putative peptidyl dipeptidase"
                     /protein_id="XP_003722069.1"
                     /db_xref="GeneID:12982852"
                     /db_xref="GOA:E9ACE8"
                     /db_xref="InterPro:IPR001567"
                     /db_xref="InterPro:IPR024077"
                     /db_xref="InterPro:IPR024079"
                     /db_xref="InterPro:IPR024080"
                     /db_xref="UniProtKB/TrEMBL:E9ACE8"
                     /translation="MSANPLLQQSPLQYQHPPFDQITMEHYAPAFEQGMAEQMAEIEA
                     IKSNPDAPTLENTVVALERSGAQLKRARLVFQNLCSAHTNPEMQNLEQAYAPKFSVHT
                     DKIYLDGALYNRIKAVWDERASLAGEDLRLVEHYEREFRKAGAGLHDADKEKLKQVNE
                     RLATLESDFAKKVMGTRKTASLVVDNVAELEGLSEDEIATAQMEAESLGHPGKYALII
                     VNTTQQPLLASLRSRETRRRLFEASVQRAARGDENDTSAIIVEIAQLRLKKAKLLGRK
                     CFAEWQLQNQMADPASAEALLRDMGNAAASKAKKEAADIKQMIREEGGDFELAPWDWR
                     YYAERVRKQRYDLDENETKPYFELNNVLERGVFYTAAKLYGVTMRRRTDLPVYHPDVL
                     SFEMFDCTGESLAIFCLDPYARASKRGGAWMTFYVRQSSLLGQKPVVYNVLNIVKPAE
                     GKPTLLSRSDVTTLFHEFGHGLHGMLSNLKYSTLSGTSVARDFLEFPSQINEHWAMYD
                     AVLKNYALHYETKEPIPQALVDRMKAAETYGAGFHTIEVVKAAYLDLCWHLVAEETAF
                     LPPAQMEEAAMRSFGVGMTEVPPRYHSGYFMHTFSGGYASNYYVYQWARVLDCDGFEW
                     FLENGGLTRENGDHLRACVLSVGNSVDANVAYEKFAGRKANMKAFLRINGLLDE"
CONTIG      join(FR796423.1:1..1130424)
//
DBGET integrated database retrieval system