GenomeNet

Database: RefSeq
Entry: NC_007269
LinkDB: NC_007269
Original site: NC_007269 
LOCUS       NC_007269            1160104 bp    DNA     linear   CON 18-JUN-2017
DEFINITION  Leishmania major strain Friedlin complete genome, chromosome 28.
ACCESSION   NC_007269 CT005266
VERSION     NC_007269.2
DBLINK      BioProject: PRJNA15564
            BioSample: SAMEA3138173
            Assembly: GCF_000002725.2
KEYWORDS    RefSeq; complete genome.
SOURCE      Leishmania major strain Friedlin
  ORGANISM  Leishmania major strain Friedlin
            Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae;
            Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Rogers,M.B., Hilley,J.D., Dickens,N.J., Wilkes,J., Bates,P.A.,
            Depledge,D.P., Harris,D., Her,Y., Herzyk,P., Imamura,H., Otto,T.D.,
            Sanders,M., Seeger,K., Dujardin,J.C., Berriman,M., Smith,D.F.,
            Hertz-Fowler,C. and Mottram,J.C.
  TITLE     Chromosome and gene copy number variation allow major structural
            change between species and strains of Leishmania
  JOURNAL   Genome Res. 21 (12), 2129-2142 (2011)
   PUBMED   22038252
REFERENCE   2
  AUTHORS   Ivens,A.C., Peacock,C.S., Worthey,E.A., Murphy,L., Aggarwal,G.,
            Berriman,M., Sisk,E., Rajandream,M.A., Adlem,E., Aert,R.,
            Anupama,A., Apostolou,Z., Attipoe,P., Bason,N., Bauser,C., Beck,A.,
            Beverley,S.M., Bianchettin,G., Borzym,K., Bothe,G., Bruschi,C.V.,
            Collins,M., Cadag,E., Ciarloni,L., Clayton,C., Coulson,R.M.,
            Cronin,A., Cruz,A.K., Davies,R.M., De Gaudenzi,J., Dobson,D.E.,
            Duesterhoeft,A., Fazelina,G., Fosker,N., Frasch,A.C., Fraser,A.,
            Fuchs,M., Gabel,C., Goble,A., Goffeau,A., Harris,D.,
            Hertz-Fowler,C., Hilbert,H., Horn,D., Huang,Y., Klages,S.,
            Knights,A., Kube,M., Larke,N., Litvin,L., Lord,A., Louie,T.,
            Marra,M., Masuy,D., Matthews,K., Michaeli,S., Mottram,J.C.,
            Muller-Auer,S., Munden,H., Nelson,S., Norbertczak,H., Oliver,K.,
            O'neil,S., Pentony,M., Pohl,T.M., Price,C., Purnelle,B.,
            Quail,M.A., Rabbinowitsch,E., Reinhardt,R., Rieger,M., Rinta,J.,
            Robben,J., Robertson,L., Ruiz,J.C., Rutter,S., Saunders,D.,
            Schafer,M., Schein,J., Schwartz,D.C., Seeger,K., Seyler,A.,
            Sharp,S., Shin,H., Sivam,D., Squares,R., Squares,S., Tosato,V.,
            Vogt,C., Volckaert,G., Wambutt,R., Warren,T., Wedler,H.,
            Woodward,J., Zhou,S., Zimmermann,W., Smith,D.F., Blackwell,J.M.,
            Stuart,K.D., Barrell,B. and Myler,P.J.
  TITLE     The genome of the kinetoplastid parasite, Leishmania major
  JOURNAL   Science 309 (5733), 436-442 (2005)
   PUBMED   16020728
REFERENCE   3  (bases 1 to 1160104)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 1160104)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR796424.
            On Jun 1, 2012 this sequence version replaced NC_007269.1.
            Data release policy www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1160104
                     /organism="Leishmania major strain Friedlin"
                     /mol_type="genomic DNA"
                     /strain="Friedlin"
                     /db_xref="taxon:347515"
                     /chromosome="28"
     gene            <3429..>5081
                     /locus_tag="LMJF_28_0010"
                     /db_xref="GeneID:5653519"
     mRNA            <3429..>5081
                     /locus_tag="LMJF_28_0010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684227.1"
                     /db_xref="GeneID:5653519"
     CDS             3429..5081
                     /locus_tag="LMJF_28_0010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684279.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653519"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8R9"
                     /translation="MRRVLLCTLRGCLHRGLTLRPESTVDPARYPLGYVPVDGSESID
                     LVYALLKRGHFVAPLARIEVIHKVSVGARALCRSEYPIVSAQDVLTLHLREKEILGRV
                     LIRRDFWTLDDFNDAELNQSFGVQNLYFDNYKWSQVLWRRFQAYVEEYYPVSDHTHLL
                     YSEYVQLVRSFSSFEQGTLVKPALPTSLRLHLPYGALPPSKFTQEPILLLKKWLQNFR
                     GPLMLHKALVLNAGSGVVAFATKVCHVPMVRGVDSRPRFIEACRKDAARSPKLSNVSF
                     QVAEMFPEVTDEMKDAPRKGKYDLVIFYPDEEIVSALWDGENDAFAPTAQGYAGKLEE
                     FFEKVTPHLTENGVIAVCCTNIHALLFPDYPHPIEYEVKINRRFVILDYYDTPARYSG
                     NIRTKFLEPAIECHPELKRKLRSELWILHRTESIGHFGFIHGIPGAKPPSMEKWRTKN
                     MGLERQKALKDHVRLMGGDWGDYKSRLIRMLQEQTDEPEDDVAESIRMTLDPTYPAIL
                     AERARKAVEMREKEREEFHRSVALEYCDCSPREAFRRRNVFS"
     gene            <5696..>6097
                     /locus_tag="LMJF_28_0020"
                     /db_xref="GeneID:5653212"
     mRNA            <5696..>6097
                     /locus_tag="LMJF_28_0020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684228.1"
                     /db_xref="GeneID:5653212"
     CDS             5696..6097
                     /locus_tag="LMJF_28_0020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684280.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653212"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8R8"
                     /translation="MEVIEEFLRLRREGKGEEAYKLLAPGASMGCPWGGMHHGPRVHD
                     LLIDEARFAKKGYLDAVPIEKIDEGTYQRKFQWDRGMAELGNSGYRFLGVLPMWRELY
                     FVRDGKIGLVTSDKMLKRRSLVHALFGTGSA"
     gene            <6643..>7938
                     /locus_tag="LMJF_28_0030"
                     /db_xref="GeneID:5653213"
     mRNA            <6643..>7938
                     /locus_tag="LMJF_28_0030"
                     /product="putative origin recognition complex subunit 1
                     (ORC1)"
                     /transcript_id="XM_001684229.1"
                     /db_xref="GeneID:5653213"
     CDS             6643..7938
                     /locus_tag="LMJF_28_0030"
                     /codon_start=1
                     /product="putative origin recognition complex subunit 1
                     (ORC1)"
                     /protein_id="XP_001684281.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653213"
                     /db_xref="GOA:Q4Q8R7"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8R7"
                     /translation="MKRSRRATQQEDVMRALKEGVQALSVSSALSTKDLVCRGDHARA
                     IQQFLEDEKHHTMQIFGMPGTGKTATVNFALAQLVSRRGTKPTAVFLNGFVVQKSSDI
                     YYTLHHHLTKARLGAVEPCPVAQCASRIEKRFRHGWGGKPPALCVIVVDEVDKILEKH
                     SKGFFKVVDWLTLPYANCKLITISNSMELQLDAKTKSRLGVVNQLVFSSYGTQELREI
                     LVHRVGAIEPKLFADQAVNQLCTQTASHYGDVRRLLQSASAAICGVLMRMRDDAVDVS
                     STDGIITLREIHTVVRQIFHDRFVEFITTMRMPALFITVAVLGKETEALIRKREVDCR
                     IPLERLLAITQQAQRKCMNVLRPINRAAFMEEIELLRQVSLIEVCIGEDRIPIRCVDE
                     LLDAKEEVFVLLLQPYQMVVDSCRLHDAFGATYGAALHL"
     gene            <8368..>11118
                     /locus_tag="LMJF_28_0040"
                     /db_xref="GeneID:5653214"
     mRNA            <8368..>11118
                     /locus_tag="LMJF_28_0040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684230.1"
                     /db_xref="GeneID:5653214"
     CDS             8368..11118
                     /locus_tag="LMJF_28_0040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684282.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653214"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8R6"
                     /translation="MPPPPKGPASGFSAAAKVLFDSAQRVGAVQPLEHSTKEYAQQLK
                     KIQSHSKKRGGSLGGVSYKVAEFLAAQRQPTPPKAPSGPLKERTIAKKVPLIEIPCIP
                     ARTTAEKHPAAERETRPPLVLPPSLRSVLATKTELSTVSAPVSPPPPTHIAAVSAPPA
                     PAPVEEVLITEDKPVFEVRQQLAPQPAPEAVVQTSVVAAVPQDALSPARKAKPVISVP
                     IAAVGAAVVETARDVAVGDSAPDDAAATAAAGLSVDVWEQQRERELERLQKRQEEEEQ
                     RRLTLAREQEHRTLGKEWVMRHTYKVSFEAELTVGDKLLRELFAADSAATALSTFRKM
                     IDAGARASALLPAGLASVAYSIRSAHPAERVDLRRDLLDTVEKAKLPDHVMRKAHLLV
                     SGGTDFLTAFGALKEEEKQRLDSRIILKALQVLVWNERWEEALKLAKESRSNFRSGSE
                     MVDLTLLRASQLLEEGPRKEVVAYASRSLTESGRMGARAKLLIASAERGTYRRTLLRQ
                     LTASSDVDETVYAELILRSDKNQTEGLLAEMAARGLNTEDPAVLGAVAMKALNSDVPA
                     DVFKEIHRQVAMIGLLPIHIRVATRAAALHPTEEVLRQASEVVQMAAPGARGPGLRKL
                     LPILYQQNMVKEIIQLADSTNEAVPVAKLMPRAVAFVNEALLKVGREPLSDVRVSDIG
                     FSRMSEGAAASESSELHEQTASVIADISGLTEKMLLYAKERQWSKALEVVIGLPTVIK
                     AEPSAVTLLYNCALGAAVEHPATVKDMYAVMTNRRVKVNATTVNTVLSSLSKASLWQE
                     AIDFFDTTSLEQRDNNTYLVRFALLGKQNLWKQAIEAYDETRAVIPKLPAAMFSLIIS
                     TTSGHDWHATLRIFQDMLKSYGSGVKDSVVTQVIRCLEKNGKTAEIAKVEKELAKRKK
                     KK"
     gene            <11936..>13402
                     /locus_tag="LMJF_28_0050"
                     /db_xref="GeneID:5653215"
     mRNA            <11936..>13402
                     /locus_tag="LMJF_28_0050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684231.1"
                     /db_xref="GeneID:5653215"
     CDS             11936..13402
                     /locus_tag="LMJF_28_0050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684283.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653215"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8R5"
                     /translation="MRAEESERRCRQLTLLQSRLREIVAEEEEMSNAVSGVIDARWMR
                     FLRECKQRELVAEIEVLRRTFEATLDRKKGFSTTLLEELSVAEEQCRHAFRSHMDVVS
                     SLLQLHAARTKDLEADLDANVAEMQQDFEYERAELELKHMIEMDDLRLILDNMAAEAE
                     MLEKKLQEETSEGHETAAEKMDEAMREMEADLNKVEDGLRGELDSRYKKFMSAAQANM
                     KEYTAKCKEDQETTERIAAQLRKIEKLQSSVSSWRTNIARNAKEWEDRNAAIQAERDA
                     TLSHLKKLKDKMQRWRELQSKALVELVKEANATEEALQATSKRAVRLLRLVELCKPME
                     TEREQVLLHEANISSAAVEAETKRRVAAESSGNAQDDVLRGGDAAPAANEQWLSLDRF
                     WVKHNKVVLDNAALTQERFLLEEENRVLQEVLKQYLDDVSISDQVMRQSNTLLLTQGA
                     NYNVVQAANASDNSVVRGYNVIEGNKFVNDQSRQAISH"
     gene            <14192..>15649
                     /locus_tag="LMJF_28_0060"
                     /db_xref="GeneID:5653207"
     mRNA            <14192..>15649
                     /locus_tag="LMJF_28_0060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684232.1"
                     /db_xref="GeneID:5653207"
     CDS             14192..15649
                     /locus_tag="LMJF_28_0060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684284.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653207"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8R4"
                     /translation="MRRLGRRTLTSLALTSARRWIESQELCTPEAIRELLQRAEKEQE
                     RRELAVDERKVVFTAASSGDHRSRIAAAETFDVAAAGLPRPPNFCYMNVSVDYACMVD
                     APEVVWFNMCKANGFTPSSVKAGCVHMLGGMVCHQRLGGGYIQVILGCIPDLETDSFT
                     FDAVPDKDEIAAAGRAPPAVAFAMLDTGLALQYEQVLSAHLSGLSSSLGRKCPLVGGL
                     YPPVGSVIGGGDPSGKLEDSIFFINDRVYRGSAAAVVLRSKLLKAHAVSVVPSISLGS
                     ASVTDVACEGGVATVRALNNRPATEVVKEVYSLPEVAEKPSKVFLGLRHGDVHVPVSF
                     VGHPDSGELSFMLPPGISLDQNDTVDFLVDDAELDTEMSASLLISMEKRIAPIFVEKD
                     INVAREARRNIVASSTAAFHFSHGGLNTIAKPEVPVVNLGSAGAIFAPSILQRCVGRS
                     CPNAGFFSPGQVATVADLTSIFPRSSTYCFMQGTE"
     gene            <16280..>17830
                     /locus_tag="LMJF_28_0070"
                     /db_xref="GeneID:5653208"
     mRNA            <16280..>17830
                     /locus_tag="LMJF_28_0070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684233.1"
                     /db_xref="GeneID:5653208"
     CDS             16280..17830
                     /locus_tag="LMJF_28_0070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684285.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653208"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8R3"
                     /translation="MHELRRSASSIATELWSPDELYKADPQVDILQPSSRTLEVDSNR
                     FYAFRLSLVLAPFEALERYQAPQGEGTDLLVDDDVFDVTCTEMQWGGRPDVSTMGIIA
                     EQCKTTSWFRFSSTLSRRLFVVDRSAVHVQTLVAALRYSFSHLLFPADAEMCEGTCTV
                     LFEFIVHHWSRLSGFLPLLYFLFELQERAFLAFYKQLGNLVQMRVNSDIAACDALKPK
                     KSGTMFSWFSSKPKEAELGVNDKLEIIDTLKSMLPPAFEKRYMLALVNHEHLRKMQLF
                     CREYVGSLKQEASTYQALAEGFATYPLTSSPVKGWHPTSALEALAKENSVVKKTMTSV
                     QRFALRKSSLASELVLPYLRAISKCEWEIGIIAHSLVAFYEDLVMRAKRVSESTMLLS
                     GEVPLPPGCEASTRPESLENAREVNQRLTLEFVNIKERFEVEVAHAEAAIKTRMRRLC
                     ILCGSVVKAIASCTNAEYYEEYLCSLASPLPDDVTDDCRASHPLKECLGVVEGQEESI
                     YAMDREGA"
     gene            <18969..>24635
                     /locus_tag="LMJF_28_0080"
                     /db_xref="GeneID:5653209"
     mRNA            <18969..>24635
                     /locus_tag="LMJF_28_0080"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684234.1"
                     /db_xref="GeneID:5653209"
     CDS             18969..24635
                     /locus_tag="LMJF_28_0080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684286.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653209"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8R2"
                     /translation="MTLYDVAYRWHPDSAALLELLLRRGAVSGALVLHDEVVSLVITE
                     EEEREDVMERERSSRALLHHGEGTERARIQRQDYERRKLFGKEKRERHKRLDKEASGW
                     MSLMEKEKRCARRIAGDRAARECCAAELQRIGRGFLARSSVHRVLLGRNKMRLLAEKL
                     AETTAIAALHMAEVVKVEENVSPGAKSDGELPILAAPSAAQEVPLRRLPEALLVYLQS
                     MVRTRRARRHYLHVRRMTTILQRAWRRHHARVARRRQQAADVLLSAVRRYQFSKERGT
                     LVENLLLMRIKVMLGEVTRLLTGLVWRENFCSVFRDIVFIQRRRLPPPPVRLSRFRRL
                     QLLAARFERFVLLAQFAASLFLLIYMGYAPRTSASQVHNKVDMALLCVELVLICCLPL
                     CWWRLWDVAVVVTALICAAASCYGGAIVITLFTLKLPFVVRQFVPRHSGTCTYCRTIE
                     YSVVYLLMFVPFAVAGIGSTVRSTAVNHLLLTSGGNWGRVFLSLLSTVSPQHTVLLLV
                     SQGNTSPDIDSLLPLRAQQSRYVLPDGDVLLRLQIPLVQLIVFRAVMCLYWWSGVIVG
                     THNAIRHHYDISDETKLKSNKHRFRNEGKEELFDAHRAATIEALGQQLDGVMWEDDVR
                     AAKEAIEASHYDHNTNIMVHRFVRRVQDTLDSQGGAILSAQAPQRSAPVTKPTTKDAS
                     RWDCRNEDPYSRGTYDIGVVETALGMIERKGLGERFIERQWTGALLRKEMNWVLIGML
                     VMASVKPNLFAMEAAFSAVFAVELALSLYFLRLEFIFSHYVRLMLRVFCVVIGFVPPG
                     IPFVAFRSLRLVEGWSLLFSVPGMVRWGMVYLVASFFTIWMISYVAALQFLAAAELQM
                     RPSICSSKRECLKISLRELILPAFTPEHIDPLSEAPVMAMLVFFTHFCFAPFLLAIML
                     HPLLRLSNFIGRFLRLVVQSLHKDVLDYVENYLEGASWYTHWGLKANISVEVIVRMKM
                     WLNDLRRRRVSAVWGSSPSSVTISNQYTLQKTSMKRYDPVVEKECTALTEIICRGEFA
                     SLEENIAHDRLSGNPVTQFLSLVVVRNVCVHYLNVALTFASIAFLWVADASLDGGSVL
                     IVVSCVVHLLSVAVSIVVIPRDSTAIMTLVSACALLCAVVLVLVPDRRFRTYYCVRFF
                     SLLRIGQLQVFPFCEMKRAVKMYIGSAVKILFPVAVMGGAAYMAELLRAQVFMVRFKP
                     LAWMNINWSSPAEVEALRSNVSYPEFLAATPRSRTSWPNVKETSALFVAYFSEDAYIF
                     YSIYCFWVLPGICISTCLSYLFWVGTNLRDTNRLMVDMIPLLEDPIAMSGFSWYQWLY
                     RYVGNVILLASLVFGCIFSPTTAATSDDLIFFLGFEMAFTFCGLAEAIMSCSFAVHRC
                     ARSSVSWRTCQEDGKHTYVLSGDCVFLLCEVLQLLYYCVAVALCSTLLVERSGCLISP
                     DEYATIFVTIRFVFLLRLLSREFLLPLMRHFFSMSRSVAGIVVYFVACASALADVYAA
                     ETRTRYTPATWCAAFDTILRLAFTSAIPANFERYWQPFNSTAVASAMKNNSTTLDVIT
                     EHYTTSRLAFVLAVIGKAIMASVVGLFVGSVTTTVRTVFLHLLPAKSLLLYRTLCGGL
                     SELLRFGMQNHDDMRPQTRRRIQARKFRRMFIPEGIPSWSVPHLLEELGICRPVRQRR
                     FMYALMRLLEYMPTSEKRQERVREYMHVWDTYRCGGPAHLLFSELPIYPPATASQRRL
                     NPYYPSSSLATMRRDCHIAPLRLVQALAIFELGFPADSSVGSKLWMDFFSVVQKMRGA
                     TLLQSLWRMYREEKAFDTDTSRTSYERTLITHVRRGLRKQKLRSHIRFLSFASFQEAM
                     YYEREVFNPSTGHFDLLNRLRGHFSGLSASPDFWKTVRYAESKLAA"
     gene            <27737..>29587
                     /locus_tag="LMJF_28_0090"
                     /db_xref="GeneID:5653210"
     mRNA            <27737..>29587
                     /locus_tag="LMJF_28_0090"
                     /product="adenylate cyclase-like protein"
                     /transcript_id="XM_001684235.1"
                     /db_xref="GeneID:5653210"
     CDS             27737..29587
                     /locus_tag="LMJF_28_0090"
                     /EC_number="4.6.1.1"
                     /codon_start=1
                     /product="adenylate cyclase-like protein"
                     /protein_id="XP_001684287.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653210"
                     /db_xref="GOA:Q4Q8R1"
                     /db_xref="InterPro:IPR000971"
                     /db_xref="InterPro:IPR001054"
                     /db_xref="InterPro:IPR009050"
                     /db_xref="InterPro:IPR012292"
                     /db_xref="InterPro:IPR029787"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8R1"
                     /translation="MDCWNTRRDSKEFQHEAVEMDSLQANCGAPNEQAFHDTLVSAAY
                     QLRARQRDTNVSISKAEMEGLVVLTRELENFKQMMKRSEFTVEGTWRIVEDGGMVERF
                     GQQLYAELLTRNPRLRVHFHGVDIEEQSKSLLRMVGTAVHFYQKPQLTVDMFTKAGAR
                     HRGYGVNAEVFVEMRNAFMRVFSEFVGTDVFEAVEEEWRKFWKYVLDLLVHGSESAEG
                     ERYGKMYEEKMLKTIQADFKLIMERQNKCDLRGQFVSVMYSKAIEMHEELSKFEALKD
                     LRASARVLQAYIDIINNIHDKKLLDEYMRELGGRHTAYNVTVENLQAFTEPFLFTCRH
                     FFEEEWNIAAESRFLWLFEYMIDGISAGMVSDINSIVNLRAPSNSVTFGLIFTDIEAS
                     TRLWSKDSKSMSLAVKSHHAMIRRLIADYGAYEVKTVGDSFIIATKDVLVAVKLSLAI
                     QLELMRMAPIAPGFAMVDSTEGHGDPQAWDDRTLRVRIGVEHCTDATATYDTIHRRYD
                     YYGASVNRCARIEAAACGGQILLCRESFEYLKSMPEFHNDPCPHFLRHVEIATPPPKV
                     DSRGLDHFVVVSDVGLASFKGIAEPVHLLSLVPRCLAGRQFTEKFTKVSE"
     gene            <30700..>30933
                     /locus_tag="LMJF_28_0100"
                     /db_xref="GeneID:5653211"
     mRNA            <30700..>30933
                     /locus_tag="LMJF_28_0100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684236.1"
                     /db_xref="GeneID:5653211"
     CDS             30700..30933
                     /locus_tag="LMJF_28_0100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684288.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653211"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8R0"
                     /translation="MKQPYRSTWRVYLPGLFVMSMFSVVVYFSRTRSDVVKYGYDFVP
                     IYSEDGKLEGFTHPVLVKAGNEYREMEEERRVR"
     gene            <31856..>32473
                     /locus_tag="LMJF_28_0110"
                     /db_xref="GeneID:5653216"
     mRNA            <31856..>32473
                     /locus_tag="LMJF_28_0110"
                     /product="putative proteasome beta 3 subunit"
                     /transcript_id="XM_001684237.1"
                     /db_xref="GeneID:5653216"
     CDS             31856..32473
                     /locus_tag="LMJF_28_0110"
                     /EC_number="3.4.25.1"
                     /codon_start=1
                     /product="putative proteasome beta 3 subunit"
                     /protein_id="XP_001684289.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653216"
                     /db_xref="GOA:Q4Q8Q9"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8Q9"
                     /translation="MSIMSYSGGSVMAMAGKECFVIISDKRLGEQLKTISTEVPKLHV
                     VNNSIVYGLTGLRTDQQTFANKVQFRTDMYKLREERDITGKAFAAMITSMLYEARFGP
                     WFVEPVIGSIDKSTGEVYLCATDLIGAPCEPEDYVCAGTAAESLHGMCEALWRPGMSP
                     EEVFEIAAQAMLSACDRDSLSGYGAVAMIVTKDKITTRLIKGRKD"
     gene            <33542..>33964
                     /locus_tag="LMJF_28_0120"
                     /db_xref="GeneID:5653217"
     mRNA            <33542..>33964
                     /locus_tag="LMJF_28_0120"
                     /product="putative DNA-direcetd RNA polymerase II,subunit
                     9"
                     /transcript_id="XM_001684238.1"
                     /db_xref="GeneID:5653217"
     CDS             33542..33964
                     /locus_tag="LMJF_28_0120"
                     /codon_start=1
                     /product="putative DNA-direcetd RNA polymerase II,subunit
                     9"
                     /protein_id="XP_001684290.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653217"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8Q8"
                     /translation="MEAEEITQVSIGNATTAPMLFCSRCNNLLYPECDDDNYSMTWRC
                     NYCKTTEQHDDCKLVHVMNLKMKADAIGGMDLVAEFANDPTAQRDPDKPCPKCSKKGV
                     ACFVNPLGQPQEDMTLYFACSDTVCRHVWKGAAVEDQN"
     gene            <34698..>35246
                     /locus_tag="LMJF_28_0130"
                     /db_xref="GeneID:5653218"
     mRNA            <34698..>35246
                     /locus_tag="LMJF_28_0130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684239.1"
                     /db_xref="GeneID:5653218"
     CDS             34698..35246
                     /locus_tag="LMJF_28_0130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684291.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653218"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8Q7"
                     /translation="MHIFRISVPLMCLFYHFIVVIISFVNYIIFVKLQGTSRALRDAY
                     LAFCVIETVAYGACAGPLFVYSYKYGKTSTARLGRLLGGIAVMFLLSSLPMVIIEMAL
                     FLSFDSELRHALDGTVFCLHATAALFGGFTSWFAYMRVVARFLQRWRGPERQIADDSE
                     IPPTKDVRLHLVKRYQWQPETV"
     gene            <36083..>40468
                     /locus_tag="LMJF_28_0140"
                     /db_xref="GeneID:5653219"
     mRNA            <36083..>40468
                     /locus_tag="LMJF_28_0140"
                     /product="putative pantothenate kinase subunit"
                     /transcript_id="XM_001684240.1"
                     /db_xref="GeneID:5653219"
     CDS             36083..40468
                     /locus_tag="LMJF_28_0140"
                     /EC_number="2.7.1.33"
                     /codon_start=1
                     /product="putative pantothenate kinase subunit"
                     /protein_id="XP_001684292.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653219"
                     /db_xref="GOA:Q4Q8Q6"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR004567"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8Q6"
                     /translation="MSASDVGCASARVLSYNFNILPRGSGGYQHERIETFLASVDGYD
                     VVLLQEVYATSYFPYVMQKRLCYQKMLLDGLEAKGFHHYVISRQPSYLTMLRYNVCSD
                     NGLIIASRFPVWHRGSYTFRNHERGEATVSKGCLFAEVEVPAAHGKGSQRIVFFNVHL
                     RPEDNLPSESSQMQQVHRFVEAALAQVREQHADGGGPAALQPKGAEVPFIIAGDFNIH
                     GIDPLNGHPSMRFQEMLNQFQDIGSVRDVIYEETGQNPPTRPPILFFPELSKLERYES
                     TPQRQDYFLATKCIQVEKPRLEKYVVSSRRPYTYLSDHFGIACRVTLALNPSVCFEGR
                     SLVRLNFSSLVEAANHEHSNPSSDARLEAVLIAAFVWWLFSFSFMSLVLCAAFAWLVR
                     WAQNYSASPVLSEPPLLTMEALKEKGEMCFANKALNPLAGVRTLGEMWERSVTRFRTF
                     KCLGATSELGEPEWMTYGTVDIRARELGAGLLEMGFRAGDLIGVACEPCRNIVILEVA
                     CALYGFTTVPLAGKRSTMSALLDRHRIRVAVADRSSVAMLLTCRSTKLEVVMYTSAFV
                     DEDDHATAKDVNIRLIPFEFVEQKGRLCPVAPAKEHVTTDSVFTYTLDNTNSLASDDG
                     SALLPVRHSSVLYDLSLLLMTGVLPSSFKGESMVWFSPMALLFHRVCVLGMLSQGNAI
                     ATVDAAHLQEAFVKFQPTLLVTAPTLFSTSRLQLSRAQHRHSAVYNWLFNRAFQLRSR
                     LIHIKRQDSSLLRFIFFRAFQEQLGGRVRKIILSVSQESTAFSLLEHVSVCYVPLVCE
                     VSYLNCLGVCAIDGMTVPSLQVDLEPISDLSDGVGIGQLVIAKKGEPRRRLEIAAQWK
                     RDGTAKFLGEPLGILWPVAYQYTIAAELGRIFSVSRYINAIFVYCDPLKPIIAVVHPN
                     RDTIEFEWRQSHCCDDPARQLGWTELVAYATSIITADLASIAREEKLHPSQVPEFVHL
                     HPHAFSDHSTFLTPFGKIRRDAVHKYFSSVFERLYSGVATSPLAALSADLPEDVSDVE
                     SSGTKLGSVCDFDLRVPVTIDIGGTFAKIAFIMPPTGGAFPTFPSIIHEASSLSEKLG
                     LRTFQFFADEEAAESELRTRSHSLVGTLRFLKIPSQQVPRFTDYLAGSHAINNFKPQY
                     TTKVRATGGGAFKYASVARNVLGIEFDVVKEMDAVVKGLNLVLRVAPESVFTVDPSTG
                     VHHPHQLVSNGDGFSPFPYLLVNIGSGISLIKCTGADGSHVRVGGSPIGGATFWGLIR
                     TMTNLTSWEEVMEIMRLDGPGDNKNVDLLVGDIYGYNAKDLPAMLSSETVASTFGKLG
                     TERFYDMKRNICTAHFADDDAAGEILSPKGSKSPSVISELPVRNGTKAASAIDIVRSL
                     LNMISSNVTQLAYLHARLHGVPNIFFAGGFVRDNAMIWSLISTTMKYWSSGECHAHFL
                     EHDGYLGALGCAILDPHGDAANEEQ"
     gene            <42463..>44049
                     /locus_tag="LMJF_28_0150"
                     /db_xref="GeneID:5653220"
     mRNA            <42463..>44049
                     /locus_tag="LMJF_28_0150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684241.1"
                     /db_xref="GeneID:5653220"
     CDS             42463..44049
                     /locus_tag="LMJF_28_0150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684293.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653220"
                     /db_xref="GOA:Q4Q8Q5"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8Q5"
                     /translation="MTSESHDVIVAEQASSAWSVLQEEACELRWYVLMVACLLTFGSY
                     YIYDFPGSIGSGRGNTLENHFKAHRKIYTESMNQYLYSVYAWPNTVLSVLGGLLIDKY
                     LGLRRAMILFSILILAGSVLFCIGVHATTYWIMFVGRIVFGLGGESLGVSQSAFVARW
                     FKGHRGMALAFGITISFSRIGSSFNFLFAPAIANKWSVDAAAVSGIVACLISMLACVV
                     LVMADRHAERRGYLSVTEEDESDSTEEDEAMCADVLQMPLAYWLLCVVCVFCYTAVFP
                     FVGVGKNFFQVKYGYTGDAAARCLSLYQITSAVASPVIGLAVDSVGRNTWWLILACSC
                     FAAIHVLFMATMIPGAVLMLLMGCFYTFLVSGLWPSVPWAVPSAVVGVAYGAMTSIQN
                     IGLALFPMLVGAILDYFRESNNNTAELTQDLPPLEAYMWTEALFLVSALIAFLASVAL
                     LVEDRRTGGVLSATSAKRPQIMEDLSRLQNDFEGVVPDLEGVEYDREGLQHQVTEPLT
                     GTTRTDAVPTEAATRAYCVK"
     gene            <45405..>45995
                     /locus_tag="LMJF_28_0160"
                     /db_xref="GeneID:5653221"
     mRNA            <45405..>45995
                     /locus_tag="LMJF_28_0160"
                     /product="putative RNA binding protein"
                     /transcript_id="XM_001684242.1"
                     /db_xref="GeneID:5653221"
     CDS             45405..45995
                     /locus_tag="LMJF_28_0160"
                     /codon_start=1
                     /product="putative RNA binding protein"
                     /protein_id="XP_001684294.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653221"
                     /db_xref="GOA:Q4Q8Q4"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8Q4"
                     /translation="MPGGLTRKERRRWETSRRLELQMSRLNSNAAVAKEMIEESAAQR
                     RGTASDVVDGDAVAAPEPKLRHDPKFKHGTFWRDRKEKKARTLFLGGIPSAFSVKQVK
                     DFISTVIDLDPGAAEYANQVGQSTEVVEEVDMLPVKHHSKVKHMYVTMASIPLAGCAA
                     AVLNGYRVEGRELRCNFAADKAQREEAIRRRNAAQR"
     gene            <48268..>49542
                     /locus_tag="LMJF_28_0170"
                     /db_xref="GeneID:5653222"
     mRNA            <48268..>49542
                     /locus_tag="LMJF_28_0170"
                     /product="putative phopshatase"
                     /transcript_id="XM_001684243.1"
                     /db_xref="GeneID:5653222"
     CDS             48268..49542
                     /locus_tag="LMJF_28_0170"
                     /codon_start=1
                     /product="putative phopshatase"
                     /protein_id="XP_001684295.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653222"
                     /db_xref="GOA:Q4Q8Q3"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR003591"
                     /db_xref="InterPro:IPR020422"
                     /db_xref="InterPro:IPR024950"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8Q3"
                     /translation="MSNCPPASSFCDFGEWKSEEDESEDSCSSDFSSSSSAPCLVCRQ
                     SISFATGTLGKAQRKLSALSLSDTEGELRAEIEQSRLSLECNLSALRLSAVPSDVPLK
                     ILRKISLSENKLVSLPDGLFLNGSFSALVELVLNTNLLTSLPLSLFYLQHLQVLSVNN
                     NSLTSLPFENVMGAERNAAGDPFLPSVRRIGMESNQLQLLPLSLLEWCPSLEELFLAM
                     NEAMLDEPVSYDRLQTIHRLSTKRVVLRVDNRPRFVRQIETQCWAETLPWLQVELNKI
                     YPDKVLDYLFLGSLRTAQTVTVYHDLDICYVLTVGRDLEAVIEPWMQQLVLPVNDFPE
                     QSMVPVFDDAFRFIDEARSHKKGVLIHCFAGLSRSVTIAVAYLMYLKGITRDDALALV
                     RLARPAARPNDGFLRELGAYEEMLRSRCVSRE"
     gene            <50838..>51476
                     /locus_tag="LMJF_28_0180"
                     /db_xref="GeneID:5653223"
     mRNA            <50838..>51476
                     /locus_tag="LMJF_28_0180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684244.1"
                     /db_xref="GeneID:5653223"
     CDS             50838..51476
                     /locus_tag="LMJF_28_0180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684296.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653223"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8Q2"
                     /translation="MSIPPQMFFYAWRAVFYGSVWTAGDFFAQFYAAHKEAAARRASG
                     EKRQSPRPSGAQMFAMLDKERLGQNTLFGLFIGGFIGQYERFLPRIFGTLTRNLTPCL
                     CALGLQQLAVTPLILWSYFNAMTAARGGLSDPSFMNAHSFGAHQRHDIASVERYILHD
                     VMPYPLLVSWGVYTPLFTLAYMGPLRASTFVSSCLFVPWCGLVSHAQGNHLL"
     gene            <53821..>55374
                     /locus_tag="LMJF_28_0190"
                     /db_xref="GeneID:5653224"
     mRNA            <53821..>55374
                     /locus_tag="LMJF_28_0190"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684245.1"
                     /db_xref="GeneID:5653224"
     CDS             53821..55374
                     /locus_tag="LMJF_28_0190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684297.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653224"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8Q1"
                     /translation="MLVIDGEDRPVRMLYDGLSSSEEEHHVSQLMCNDEFHRSSYQRQ
                     VQRWQQEETAYLKHEGWCEHRLILLMQEAFRCSRQNLKRAFSTGAVSLEVYAARLAGL
                     KNSLLQIKKEYRRTLQRTRDRKGDLSSIASKAVTCIASVYPWSSSGFVMGFEENVRFG
                     QLADVMGSGGRRGASLAPPTSQQSANGGLAPCRDMAPMSKVANPGMSLEHLNAAAPPG
                     NDMASCYQGRRIVTPRVPLCPLPPRRQLFRKGTAPDGSLLLSAAHTGASADGVASTMG
                     PLPVENLSRSFFAVSPNCLSPNSPVLVPPVSIAGPFRNDERRFLEKRQLVVQGMSFVS
                     HSLASSIFISSRRATIASATMQKRLDLAKGQVPPPTSYPASCATVVDMQIYLLPPTSF
                     ASSNSFPKANRVKHGSGAVGGSTIGLSRRTSQVMPCSSPFLAPGKGSFHVDPSPNASV
                     ARSPPAYEQAVAVSNKYTPRHLVRLPSCYHSWLPGDRMCCDRMSVHSLFSQMLPVSLE
                     EERHVKELW"
     gene            <61143..>62957
                     /locus_tag="LMJF_28_0200"
                     /db_xref="GeneID:5653225"
     mRNA            <61143..>62957
                     /locus_tag="LMJF_28_0200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684246.1"
                     /db_xref="GeneID:5653225"
     CDS             61143..62957
                     /locus_tag="LMJF_28_0200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684298.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653225"
                     /db_xref="GOA:Q4Q8Q0"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8Q0"
                     /translation="MRWDSIRLPANLQALLAASKERTLAADVSIFEGFGSFHSENVED
                     LMATDEATYRPPAYIPAFAKRILSKSEIARALMAPPDDAANSTLLGGSPGRKRSRCEA
                     MRCGGAVSSLELRKSRAETPPEASARSGAGHSNTDDVTDGDSNLGSDESRFSSFSVVG
                     PWSASAKCQIREMANQAVRPCELGNAFRSEHFNITPAMVFINHGAFGGTLVGAMLIKW
                     LYEEHMEAEVVRFVDRELLPLIVYSIRALSRFLHADPRQVVLLQNATFGLNCAMRIIV
                     KDDVVAFFDTEYLAVYKMMRFRCEEVGASLHEICLNRFLHDPEVMGDNTALTAEICRQ
                     LPANCTTAVLDYVTSTSALCFPVFTHIIPALRQRGVGKIIVDGAHAPLQIELDFKALP
                     PESQPSVFVGNLHKWFSSPKSAGFFWVRSDDVEKMHSVVLSHGAGEGLLSEFIWDGTR
                     DYGTYLSIPAIVDFWEKQGHNRVRDYCSHLLSSAADMLTIAFHSRSVARHAPFMSLVE
                     LPEKLQDSVITATYIQDSLHDIARIEVPVKRIEGRYYLRISAFVYNTPAEYIYLREAV
                     LSVADKWVQSPQRKLLHARRLSSQAAATAATDQLAAVP"
     gene            <65650..>66078
                     /locus_tag="LMJF_28_0210"
                     /db_xref="GeneID:5653226"
     mRNA            <65650..>66078
                     /locus_tag="LMJF_28_0210"
                     /product="histone H2B variant"
                     /transcript_id="XM_001684247.1"
                     /db_xref="GeneID:5653226"
     CDS             65650..66078
                     /locus_tag="LMJF_28_0210"
                     /codon_start=1
                     /product="histone H2B variant"
                     /protein_id="XP_001684299.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653226"
                     /db_xref="GOA:Q4Q8P9"
                     /db_xref="InterPro:IPR000558"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8P9"
                     /translation="MPPTKGGKRPIPLGGKGKGKRSAGKAPKSGNDHKRRHSHKRSQH
                     WDLYIHRALRRFFKRGTLSKAAVRVLSSFIEDMFNRIQTEAVFVAKINKVKTLTAREI
                     QTSARLLLPPELAKHAMSEGTKAVAKYNASRGEAYAQGGI"
     gene            <69153..>70220
                     /locus_tag="LMJF_28_0220"
                     /db_xref="GeneID:5653227"
     mRNA            <69153..>70220
                     /locus_tag="LMJF_28_0220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684248.1"
                     /db_xref="GeneID:5653227"
     CDS             69153..70220
                     /locus_tag="LMJF_28_0220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684300.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653227"
                     /db_xref="GOA:Q4Q8P8"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8P8"
                     /translation="MSAFVAEAPMMLYYQRYDAPGTPSNPTRVSARSVSMKVPPAPTP
                     KPKPKELQYPAVDPSLYMCRRNSSREALGMFRRRHLFCLKFYFSTDFLIGAIPMCITV
                     VLIIANMALVWHQVGWHEYIFTLLMLATTFTSHFLTTSIDPGIYPRLRSGERDPLEGN
                     LQLVFCRECQLRRPPRCAHCYQCNVCVLEHDHHCSVLGGCVGVRNLRWFTLYLLSCCS
                     STMIGVVWLTRYLFYDLFTPDDEETPTGLKALPTPYPTMQGGRRSFAPDEHTGSHLAA
                     ILVLLLDGIVVMLVGAMLCIYVYLTLSSTTRRESMRKQNSLHVLLQPRRVWQNFKKVH
                     SPPPSLLDSDDHADEEVTNLI"
     gene            <71386..>72369
                     /locus_tag="LMJF_28_0230"
                     /db_xref="GeneID:5653228"
     mRNA            <71386..>72369
                     /locus_tag="LMJF_28_0230"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684249.1"
                     /db_xref="GeneID:5653228"
     CDS             71386..72369
                     /locus_tag="LMJF_28_0230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684301.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653228"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8P7"
                     /translation="MAPDGPDTVTEASVLATPQGKAADGHLGCATPQVRGRDETLLTE
                     DATASKLHGEMNATACREEDEDDERLSQSSAESWVELNMAEQGKPSETECAPADVSAS
                     TPVVDVAPPVVPFLGASEDAGDEHSLGVLEAQEEAAPSPPAPQEPSCTQLRATEVEVS
                     ALIPLLMVDEATARVSEIEAAIKEAEPEQLSSYWSDGACNSDDLASMYYDEMQRSQTV
                     NVDPDSMISVSESRVAANRAPMVDSTEALRRRVIQEDFMRTERGSPDVPPEERVAIVE
                     ALFGNFGNEPISAETFCEVMVPYKRHCECLGASYGFHHQGCRFFADFPISL"
     gene            <75035..>76861
                     /locus_tag="LMJF_28_0240"
                     /db_xref="GeneID:5653229"
     mRNA            <75035..>76861
                     /locus_tag="LMJF_28_0240"
                     /product="glycerol-3-phosphate dehydrogenase
                     (FAD-dependent), mitochondrial"
                     /transcript_id="XM_001684250.2"
                     /db_xref="GeneID:5653229"
     CDS             75035..76861
                     /locus_tag="LMJF_28_0240"
                     /EC_number="1.1.5.3"
                     /codon_start=1
                     /product="glycerol-3-phosphate dehydrogenase
                     (FAD-dependent), mitochondrial"
                     /protein_id="XP_001684302.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653229"
                     /db_xref="GOA:Q4Q8P6"
                     /db_xref="InterPro:IPR000447"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8P6"
                     /translation="MAATAVKYAIGAGVAIFGGMVGFSYTNPAWTQRKFDASKCPPLK
                     YESVPTREMCVQALKAHNSVANPLDVLIIGGGCVGAGSALDAVTRGLSVGMVDMGDYA
                     CETSSRSTKLIHGGIRYLQKAVFQADPMQLKLVAEALRERTIMIHQAPHLCHSLPTLV
                     PCYHPIDIGMYWCGAKMYDIMAAFYGGTLEYSGFLFPYEAMKAYPKLRKTDQDNNALL
                     GAVRYYDGQMNDARLCYSVAMTAACYGAATVNYARVKQMEVVKDDKGDELVRTIIEES
                     VARKTIEVYSRSIINAGGPFSGEVEKLATSAEKQLDMFPAAGTHIVIDRKYCPREREA
                     MVVPSNDDRVVFAIPWLGGCLLGTTDHKCEVQSNPPTPQADVDFLIENIRPFIGSVPP
                     EAVRSAWTGVRPLAIPKAQKLKGGGTQNIVREHVIAVDPKSHMLNITGGKWTTYRKMA
                     EEAVDELQKTLMKGKADFKPCCTTNLVLVGARNLDKVASTAPLGIPEDVHKHWRSNYG
                     DRYGEVMAVAAKDSKLMARLAKDSPVVEAEVVYAAQGEHCEHVMDFIARRTRIAFVNA
                     EQAEQVVPRVTELMGQVKGWGNSKRNVERAAAYSALASFKGR"
     gene            <81974..>82867
                     /locus_tag="LMJF_28_0250"
                     /db_xref="GeneID:5653230"
     mRNA            <81974..>82867
                     /locus_tag="LMJF_28_0250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684251.1"
                     /db_xref="GeneID:5653230"
     CDS             81974..82867
                     /locus_tag="LMJF_28_0250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684303.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653230"
                     /db_xref="InterPro:IPR019721"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8P5"
                     /translation="MATAAELGTGGVEVTGKPIFVATEHTRYAPSTERELSDQEQLAW
                     KSFQLWRTSLSIERRDHVYRTITNADYTNFNLTRHIMGTPFPVIENTPSIISTAAGVR
                     IYEHGIAAFLGFSYSMWVRSKASLRHTHLHPSTRFFVSFGTFIFADMCFWYRSMFRLS
                     GFLPNDYECRKFGVMESKERLERKRELWAKYTAYKREWCRRFDYHVYGIRPGETFSLF
                     SACWFPAWSTPYGTITDYPLRKNPYFLSATPLRDMYGEYACTMELPKSEYSPLSKARP
                     EVNYTFRGPLVASESNKSSAA"
     gene            <84467..>87655
                     /locus_tag="LMJF_28_0260"
                     /db_xref="GeneID:5653231"
     mRNA            <84467..>87655
                     /locus_tag="LMJF_28_0260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684252.1"
                     /db_xref="GeneID:5653231"
     CDS             84467..87655
                     /locus_tag="LMJF_28_0260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684304.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653231"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8P4"
                     /translation="MHVLCQGYLETYETPEALARDTAWWLGEAACLHAAHTEGKRHTH
                     VPGEAPSAAVERWGELMRHMTEVVESTHHITAAQRQGDAIPALSLSPLQKPDASGEAN
                     LLQFGNDVQNGAWESLEILDSSPHGGGGASAAMHRDEECLRVLEAALRNPTQHRDEEA
                     ELLDSLRYLLKHRPELILQHENFTDLQQAVIDRACLHEESGWTGAALSLFQALPPRAQ
                     LDFTHAAISALRSLGRIGKSAGQSLVRFLHLLLMELPQGWVSLLDYEVTEVFVRVLTD
                     VVVPCGKLFGEVDPRAVWLKEWLARPSLALSLDAVLHSHLCLLDDLAAQLPSPHAACV
                     LLYLLPQLSELTEPQDPSTPPSQQPWPRLFRVLLQLLCGEVGPDAGLYEVGAHALCRC
                     AGSLSPADKESTFEVASKVVLGWAPAVASPAHDAQFVFALRLLTTLLIGASDKTPWCS
                     PCAWKLVDGPLFAQSRALLPTRKGRRSSAHSLFRALILDVSDVVRECWARLLQAQAPK
                     LPITLAAVVNDVCGGGSAFRWTELVWVSTTLAGWTALQPYIRTVKEGVTDPSARWAEL
                     LNAIVEVGGGAFDATSEMWAFSTTSASPSTKKKSRPSGCLRSLTPHSVALLLRWSTCA
                     VARDGLAEAARAASLAFLRGGPHAESRRLRWPLLLPVEAYPQVGWSDLSFGEDAFGVA
                     RAARAGACYQSIHLLLGSTALPADNGGGGSDPSRELLEEIWGQLVDLWLAPAQLTPDS
                     AVAPTNRPPFGEDSLLTLLSAMALCVLVRPSAEFRAWFDPAVAQQRIRQLRRLCEERR
                     GVDPLYFMVRFVTSGKGRKRLPAILLDGFEADLTVDTVCDVDSFTEGEALPTGDIAAA
                     ATEEEAQQLQAMIRRLSSSHSAPPSKAQAPAASPPPHSKALAAVARSLLANRTALRVT
                     RHDVEQCLARRSAEEWASYANTEARVLAVCAQLEQQHSASTALLSGAQVDMVFLVSLC
                     LRSWLGLPTTHSTPARRKLYWTALQCFSEHGIAAYDALVARSIALHVERALRESAAVV
                     KGAVLFPVSRSVPLPSALFAHLLVRPFALAMS"
     gene            <89108..>89755
                     /locus_tag="LMJF_28_0270"
                     /db_xref="GeneID:5653232"
     mRNA            <89108..>89755
                     /locus_tag="LMJF_28_0270"
                     /product="phosphoadenosine phosphosulfate reductase-like
                     protein"
                     /transcript_id="XM_001684253.1"
                     /db_xref="GeneID:5653232"
     CDS             89108..89755
                     /locus_tag="LMJF_28_0270"
                     /codon_start=1
                     /product="phosphoadenosine phosphosulfate reductase-like
                     protein"
                     /protein_id="XP_001684305.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653232"
                     /db_xref="GOA:Q4Q8P3"
                     /db_xref="InterPro:IPR002500"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8P3"
                     /translation="MSPQLIDRVNASENLIQDIFKRYAPSEIGVAFNGGKDSVVMFEL
                     LRRAVTAPVLAQCCIFVVEHNDEFDELRKFRAWYMQEVARGLPLVHQGATQDMRLSLW
                     TLTEKHPLKVVFMGTRKTDPHGRYQKEAVEKTTPGWPDFLRACPLFHWSVNDVWVYTR
                     LMCIPQCSLYESGYSSVGRSADTNRNPCLRRDDGSYRPAWELTCDNAEREGRQTE"
     gene            <91367..>92017
                     /locus_tag="LMJF_28_0280"
                     /db_xref="GeneID:5653233"
     mRNA            <91367..>92017
                     /locus_tag="LMJF_28_0280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684254.1"
                     /db_xref="GeneID:5653233"
     CDS             91367..92017
                     /locus_tag="LMJF_28_0280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684306.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653233"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8P2"
                     /translation="MSGQPFDAMWTAPPPPSYIDTVYMNPQDYVVLATSSGEEALVHR
                     DCLMESPVLRLAFRKRVSLCTEDVFVAFAKEDEPSSTGASSSSINAVDGALASGQPIA
                     AVVEPAAGDEGGRSKENEGDDVPQGAGAVPVETGIENAMAPEPQHPVTLKETLRTDNS
                     VRVLFPRLNGDQLNVLVSYLYFKHRYNRRLSEERPAFEVPTTAALEVMRVAAALEC"
     gene            <92681..>93439
                     /locus_tag="LMJF_28_0290"
                     /db_xref="GeneID:5653234"
     mRNA            <92681..>93439
                     /locus_tag="LMJF_28_0290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684255.1"
                     /db_xref="GeneID:5653234"
     CDS             92681..93439
                     /locus_tag="LMJF_28_0290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684307.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653234"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8P1"
                     /translation="MKRKANPAEAVPLPTCTAVGPEDMVLVACTSGETFLVERNCAIV
                     SGHCRDLLQVWEGAVRRIALQSRDEESTISDGAATEITVVPCMEADSHSRDAVGPLAT
                     DPTVITFMPFMDADDASPLEALCHVPVTLVAEHYQKRLRAAEAISPSKADRPSSKQVP
                     SYGDRKGASVIVAKPISPLAPMESADGTPMYPVVVIPYMTPELMEAALSYAHRKYRID
                     MDGEKSGAEPAAPISVASAEGRWRLIAASVLTGV"
     gene            <94445..>96340
                     /locus_tag="LMJF_28_0300"
                     /db_xref="GeneID:5653235"
     mRNA            <94445..>96340
                     /locus_tag="LMJF_28_0300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684256.1"
                     /db_xref="GeneID:5653235"
     CDS             94445..96340
                     /locus_tag="LMJF_28_0300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684308.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653235"
                     /db_xref="GOA:Q4Q8P0"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR007529"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8P0"
                     /translation="MHDCEDTCSYYLSEARESDGGFQHGGSEDSASDGSNDSDHDGDK
                     DDGGGGDGNDEPRDDPYFRASGDMDEASRVTLSAALLSDLETSHTSPTPHAAQETQSK
                     SSDCCVCGTHAMYTCPGCARRTCSMICVRVHKEDFKCTGMRDVAAKVPLSEFTDRQLQ
                     RDYHFLENCRRAIDNIERCFPRTSWRYNYKALPPPLHALREAARRRGVICQIMSEGMR
                     KRDENTSRLDRKTNTIVWRCEFEFSSADDGAEVTTISTDWGSERHRLGDILKYCWATN
                     PPLLCYHINRRYNRVSKYVGESATKTAKGVEGEVPGETDPTQHDRAAAPLETAVDACS
                     AAAPPTGADVLPTAEVTRVASDEGEGDVPPPTVAAVESEAAASREGRPLRAPAEVLPL
                     RAYEVVLPMPPIEPVTSREAQQQAFVQAFLTREKYVILSKAERLGNNARYFLLNPYDT
                     LNENLRRLFFVSEFPVFVVVHASQLHRFSLVTEEDKEAIRSSFRSKKTYEPRERPPMR
                     KRSEMKPEELERLSRVPCRRFLQCRCPNAEECPYWHCTPNEIPVCRTFLRFGECDKGT
                     RCSFRHDADAVRIARKRQRDGLAEDGNPMRGRGMGRGRGFGRLRDGARGRGGMGGGFY
                     PPRRRTE"
     gene            <97696..>98649
                     /locus_tag="LMJF_28_0310"
                     /db_xref="GeneID:5653236"
     mRNA            <97696..>98649
                     /locus_tag="LMJF_28_0310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684257.1"
                     /db_xref="GeneID:5653236"
     CDS             97696..98649
                     /locus_tag="LMJF_28_0310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684309.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653236"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8N9"
                     /translation="MHAARPRWSHDDDDSVSVVQSTHDYTQRIFKTKPQSARWVRGLT
                     EDGHEDDRTIGLRGRRASMNRWEELDDTPDDVLQGTAHAETWRSHWLFYPNVLAIVYL
                     CLIVARMMKGPHRSYRLDYPTTPWQLELYGRRYGENGVSFLMRVCVPLAVPHAVGAAY
                     TLTLTYIIGVAARNFIALCGVGLSLLSVGALLTQSWLLFACCGLSPHSHQWECDLPFA
                     LHHVCSVIRVLCPLLAVWCVSPVLDQLWGCGYRWRCVLAVPCVMALACLVSSVYDEVP
                     SHPMLDLAHMSVLLAWPLFVKACWRLKRFAAVPNTEKLHEQ"
     gene            <99610..>100638
                     /locus_tag="LMJF_28_0320"
                     /db_xref="GeneID:5653237"
     mRNA            <99610..>100638
                     /locus_tag="LMJF_28_0320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684258.1"
                     /db_xref="GeneID:5653237"
     CDS             99610..100638
                     /locus_tag="LMJF_28_0320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684310.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653237"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8N8"
                     /translation="MSSSMIPLSATAQRVKMLECGPCALRSAMRRANRESWTPPLADV
                     AVDIVAGALTLTSANEVLVPASLVHYVEACRTEAKRTPSGALTQWPWPAWDVALQEQR
                     LVTLVTARDVAPLVSSDCYGGAYRTLCVPVPAGPLVAQLDFGITVDTFYAEVLSGVLD
                     VVGADGRVRWRAWMRSALTCGYEGTHVPPIRVAEYTSQLLRQTGGCESVMWEAAVTGL
                     TPRWLETASKTALAVGVPSGLLALALPEESGCTARLLAKSVEVGITSWATCAVANSPL
                     YPHASPVASPQTVQLFTTGWNDVSAAVAPTCDGDAAVDAAEESLGQCFDFEDAVTERV
                     RAVLHTDA"
     gene            <101953..>104715
                     /locus_tag="LMJF_28_0330"
                     /db_xref="GeneID:5653238"
     mRNA            <101953..>104715
                     /locus_tag="LMJF_28_0330"
                     /product="putative rrp44p homologue"
                     /transcript_id="XM_001684259.1"
                     /db_xref="GeneID:5653238"
     CDS             101953..104715
                     /locus_tag="LMJF_28_0330"
                     /codon_start=1
                     /product="putative rrp44p homologue"
                     /protein_id="XP_001684311.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653238"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR022966"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8N7"
                     /translation="MNAIEDSRVQNIILLTTVMREVQNRNKAMYARLQRLLGDDKKQC
                     FVFANDRHEQTHCMRKREESLNDFNDRAIRVAAQWYARHVVAAFPGMADSSTSSVIVV
                     SHDRAFKQAMDASEEAQRVSNLRCVSLRDYIKLTIASDSDLLEKIQYEEPEGMKESPL
                     TRQLFTPHLGMAAMDAGVHDGSLYKGKLRVSETSCFFGEIRGKFDGHTFQRILIQGRV
                     NMNRAIHDDVVAVQLLPVSSWRGPKGSAPLPESASEEDAITAGFVPTGKVVGLLSSNR
                     RPFCGSLDEGELEQVKANMSDNVSILFQPKNNRIPRIRISTRHVQDLMDKRLSVVIDD
                     WPLYSSFPVGHYVEVLGKIGDRDTEAMVILLEHDVPHYDFSEAVHDCLPKGQWSVTKD
                     EEARRLDLRDLCIVSVDPLGCRDIDDALHCRVVNGNHLEVGVHIADVTHFLHEGTAMD
                     DEAAKRSTSVYLVDRRINMLPQLLTENLCSLVEAEDRYAFSILWEFDENLNVVRDWFG
                     KTIIRSRGALYYGDAQRMIDNPADTSDIAVSLRELMRLSKHFKAQREEDGALFLASQE
                     FKFKVDNEHVNPTDMQVYQTFEANSMIEEWMLYANAAVATKVYESYPQWTLLRRHEPP
                     AEGAFDTLNDALYSKLRVRLDDTTSLTLNKSLDKCEDPQDPYFNKLIRILTTRCLRQA
                     QYFSSGGIPKDEFYHFGLAMPIYTHFTSPIRRYADVLVHRQLAAAIGIESISEQHMNA
                     ERMEAVAENLNYRHEQAQRAGRDSQNLFTGFYLRNFEDGKIPDEEGYVVRVSETHVFV
                     LVPKYGQESRIPREQLETVPRLLDRVKVAIQLKRQGDVMRTKLVFRLIGLMRDGEEGG
                     VLVADDEAYDVIEDSEEASEDAPKASQGASATSVGAGDNDTKAAEPELKRARADGTET
                     APPTSL"
     gene            <105996..>109457
                     /locus_tag="LMJF_28_0340"
                     /db_xref="GeneID:5653239"
     mRNA            <105996..>109457
                     /locus_tag="LMJF_28_0340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684260.1"
                     /db_xref="GeneID:5653239"
     CDS             105996..109457
                     /locus_tag="LMJF_28_0340"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684312.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653239"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8N6"
                     /translation="MSAAVTQLVRRLTVPAVATSLMKEELCLALAAVAQLRPNLSVAT
                     DEGTTASPLSTETLARRSLRVLPRCAPKEVRIIANGASALQWFSAPSLPVTDALARTL
                     YTHTVKWNRSATEAKTAATHKVRLSDILAVVQLAAEAQRYFDTTIFLLATQHAVEVGA
                     QSMSMSTAVAEEFVAVVCGYAGEVDGAAAVERLAARLEASSAAASHSPGLAVLKACVR
                     GRPLKVADRWAVPYARWAQQRRNLLETVRAMGDAAAPTHAADGAARTPIQLLKARYDA
                     WQVALALLTEEEEIADDRLQRTLEAVRVFHIQDPVTLSTLDRAVALRVVSPALPSVVL
                     ANYENCVYAEAQHYPQALTALKQRDADTSAAVTGAREGTSSSPSRPPAEALQRVSVIY
                     RVYKDAVAGAVVSEKDLFQITTVIDTSSADEVAMATYVFARVKEVPTSFLTMLPKQSV
                     SLTAEGVVALVRAGRHDRRGALSIVLPECLRHSAHLQECILSAPTTVLVKLVEALGRP
                     VSRWTAPSDQTRALEEQVVDMVVAHLLPQVEQMPLPALLSVMTIGGCHLAGADDLMQA
                     VCSRVADHLVAAATPPSIALCLEVLAALHSGNSRPERLLDALADAVAAHFAPLLQLTV
                     SADASCLAALLHFATIQVQYGSPEMAAVGTGLLQRVRQGGWDALPPEMLVAAALFALD
                     SSTLVSSATSLELPHAVVAYLVAAQRLSSIMTVDLATALVQLLELIPTVDADNVQAFV
                     TCVLPVASALSPLVVARLLTLRHRSATAASTPLAEVAAEHYNTVSRHVLGLPPDTFTA
                     LCLVAARPGFDTVLANLLVDMLPLMADALSAHQLSQCVFGLGEMADAGQRLSHQVMTE
                     ALSDYAVDNLELFTSARDIAALLHGFAKLQCTKRNLYSVFSTQLLRRPIIATLEFRSI
                     SLLFFAFGSVRFVNKDLMDILCRAFIAHIDSLAAPDVLMSLRGLSRMSLLNAAFYRKV
                     GTKAVELIDEFPLQAQCDLLHAYGAVEEAHPELAATLSRRIAAGVESLPSVSVATDVL
                     TSLWFMGADMTTDEGVETIVDYVVRHASELTGPDIMKLCSITLNQNWKQTQLLRGMAT
                     RAIELQEKEQLEPTTARAVLDTLSSQLVFHQAARVRLSQLARTVSKETVLLSGEEQEQ
                     LNLITSH"
     gene            <111173..>111901
                     /locus_tag="LMJF_28_0350"
                     /db_xref="GeneID:5653240"
     mRNA            <111173..>111901
                     /locus_tag="LMJF_28_0350"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684261.1"
                     /db_xref="GeneID:5653240"
     CDS             111173..111901
                     /locus_tag="LMJF_28_0350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684313.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653240"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8N5"
                     /translation="MTAFTVVYNLLTYTAGGFSVIMNASPVIAIRRLEQSGTVGASTV
                     TFYGAQLYNAVTWTSYGIFSISYPLLIANILGNAVSTYCSLVFLTVARREETSGRTLQ
                     STTYSKSVLTYAFFFVLSAAHLLLSIVLTMSGRPETAKTITGYEGSVASIVMLSAPLL
                     AFKHIVATKNAEVLAPVMVGCAFFNTLFWFVAGLMTNDKFIVVPNFLCFLACCAQVVL
                     LVMYGRKPAAPTEINEAIAPTPFG"
     gene            complement(<112523..>113386)
                     /locus_tag="LMJF_28_0360"
                     /db_xref="GeneID:5653241"
     mRNA            complement(<112523..>113386)
                     /locus_tag="LMJF_28_0360"
                     /product="putative ubiquitin activating enzyme"
                     /transcript_id="XM_001684262.1"
                     /db_xref="GeneID:5653241"
     CDS             complement(112523..113386)
                     /locus_tag="LMJF_28_0360"
                     /EC_number="6.3.2.19"
                     /codon_start=1
                     /product="putative ubiquitin activating enzyme"
                     /protein_id="XP_001684314.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653241"
                     /db_xref="GOA:Q4Q8N4"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8N4"
                     /translation="MRDAEAVRYDRQIRLWGKSAQQQLMHTSVALHGVAGAAAEAAKN
                     LVLAGVRAVAVADDGLVTDADACTNYLMQGEAGGTRGARALGALQRLNPHVSVYDAVT
                     KLDGSSGTRVTMAAVSTEEDAVPHVQAALPCADIVALHVTCGPTVLALFLYRRLPVHS
                     LAEQWRCLVAEPSLLAEKPRGYQRAVLALHVRSKAVSLGFAAAAAKAYEVVSWLQLQQ
                     LTAADVQEVLQTYAHGAGSADCVSDTIAGACIAQHLIRQIGALNQPPGAQSYHWMLCE
                     CGAEVECLVGL"
     gene            complement(<114434..>114811)
                     /locus_tag="LMJF_28_0370"
                     /db_xref="GeneID:5653242"
     mRNA            complement(<114434..>114811)
                     /locus_tag="LMJF_28_0370"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684263.1"
                     /db_xref="GeneID:5653242"
     CDS             complement(114434..114811)
                     /locus_tag="LMJF_28_0370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684315.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653242"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8N3"
                     /translation="MLAAHSRSSAPALTLSQVCRGKYLSPEAMQAFFKHAFCAALPVT
                     HTDLVYSAYSSLLEDAPHDEDALTSDVAVACQRLQQKWTMQAEQWEELLGGRHDLADA
                     QYGLCPRSCTWVNDMLAGDAYDL"
     gene            complement(<115711..>116889)
                     /locus_tag="LMJF_28_0380"
                     /db_xref="GeneID:5653243"
     mRNA            complement(<115711..>116889)
                     /locus_tag="LMJF_28_0380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684264.1"
                     /db_xref="GeneID:5653243"
     CDS             complement(115711..116889)
                     /locus_tag="LMJF_28_0380"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684316.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653243"
                     /db_xref="GOA:Q4Q8N2"
                     /db_xref="InterPro:IPR005097"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8N2"
                     /translation="MASKLDIIVLGATGFTGRLTCRYLARTAELKGRWGIAGRSQAKL
                     AALKAELDINVPTFVVDADQAATVDATCAQTTCVISCMGPFTLVGMPVVDACVRNGTH
                     YIDCTGETPFVRRAIAAYHETAARKGVAIVPCCGFDCVPADLGNYVVHREAGEPVTVV
                     RGYFEGSPAGVSNGTINSIGCVLDSMTGEDMSPLALVSKSDVQPACTPTRYGVWYENG
                     RFTGLFVTASCDEKLVRRTNSLMGSSAAYVEAMQGSFARVMRLTFSTYVVLMAGMIAP
                     LRRWMLGKYFTGTSIGPSDEAMAKSSFRCDFVGKTVSGKRVETTMSAKEDAYTATALF
                     LGECAMSVLKLARKQSLKGGVLTPAYAFGDELVHRCRDAGISINTVIIDCAAEPKKAR
                     "
     gene            complement(<119643..>122432)
                     /locus_tag="LMJF_28_0390"
                     /db_xref="GeneID:5653244"
     mRNA            complement(<119643..>122432)
                     /locus_tag="LMJF_28_0390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684265.1"
                     /db_xref="GeneID:5653244"
     CDS             complement(119643..122432)
                     /locus_tag="LMJF_28_0390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684317.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653244"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8N1"
                     /translation="MSQVPPHDSCRVRRRPRLPSTGPQSIGGSTRPSSRPRTEASENA
                     PPLVSPIVSPPVTPVVTAVRERCSNTPPPVGWQYPSCSRCLVCGQLGCELCSVKVDPA
                     ATKQKLESLRLNTPYERAKLARSTDELRSEESRQRARLAARYESWLEDLRTVELIRRH
                     AVRVVLHEAAYRQQLCMEEQAQRAAYAAAADQHVLLLALQSSEAAARHATLARERERF
                     ASLCRHYAYATQVVRLHQREATTREALRYNESSQWHRLQAQEVECCNLMGEHAAEQHR
                     LCESCWESREELCRQRVAGLESLTALAGAHREMLYQHAQQRCMLLASAEQGKRDVLAE
                     EAATRMRLREEMVEEADYIEERHRIFARQRATLCKAEALQRQGIREAAESGYHTLFLD
                     MRADEDVIYAAEVKRADRRYFHLLLAVETLCNIQRDEDAAFTALMIRERDEAAGRRVW
                     MAQKAEARAALWHRCVHEKESVLGAEESLAREALRKAAVNAEAAVADGIVAKARARAE
                     LCACAESVAETLAREERCARVGLLSQMAAHAELVVRWCETKRLDRLAFADSEAPLRSA
                     ICRQEQDDWQQLCIAFACTCKAVEERAAQEHQARAKATRSALDAIEQVAWEEAQGWKY
                     LCIEEAEQRCRAIDAFHYRCQVELLYEETQRRAFLARDELSDRAAARAKKALFARYAA
                     EAAVTALQTQLCDVMASEDSARACLYEYVGEWYDWVARQQREEELRLIDALERRIQEE
                     LRSRQEYIQEDERLYDPAESLVFARGGAEDGGQRTGGAAAASPKPGHTHDLRGELVLQ
                     TLGNPVCAAPLSAAAVDFLVAVIDRAGRRRDAAQERFAAAERSAREASKKVLQHERLY
                     AAEKEKEEMYQLSSRRETEERERRTHQETLDKNRSQQAIAAEKRRLAEVQAELLQEQK
                     KLDALKGSINKQYNR"
     gene            complement(<123554..>125197)
                     /locus_tag="LMJF_28_0400"
                     /db_xref="GeneID:5653245"
     mRNA            complement(<123554..>125197)
                     /locus_tag="LMJF_28_0400"
                     /product="putative katanin"
                     /transcript_id="XM_001684266.1"
                     /db_xref="GeneID:5653245"
     CDS             complement(123554..125197)
                     /locus_tag="LMJF_28_0400"
                     /codon_start=1
                     /product="putative katanin"
                     /protein_id="XP_001684318.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653245"
                     /db_xref="GOA:Q4Q8N0"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028596"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8N0"
                     /translation="MQASVANEIVKAVHKARNCALYCDYKTALQYYSSIRNEINLHTR
                     SIDDVLCSQWMSLLRELESEAQIIRDTQAELHLFIDPNAAKRREPPDCDENRSSSSAE
                     KAVVPRTGTKKKPRIGTSLANSGGSNISVQNAKLYGDKDRFGPAEGPQILPATRQPAR
                     GAASSYAAVSPPFSSGSSASAVPPRVSRTSSISGVGVGRPVAAAAGVGFRQGAGASSG
                     TGAAARGRVKGKSAATRFVGRAGEEELVQLIEADMHVGKLPVTWDDIAGLEEAKRLLE
                     EAVVYPVLMPDYYQGIRRPWKGVLMYGPPGTGKTMLAKAVASECNTTFFNISPATLTS
                     KWRGDSEKLIRVLFEMARHYAPSTIFIDEIDSLCGQRGGGNEHEASRRAKGTLLAQMD
                     GVGVDTDKIVMVLGATNHPWDIDEAMRRRLEKRIYIPLPDAADRVELFKINTKSIKLG
                     SDVDFVKLSQLLEGRHYSGADITNLVRDAAMMTMRRFMKEADKTTLKENAAEIGRQVA
                     EQPINMSDFLAAMTKVPSSINADNIKKFEAWKKEFELNI"
     gene            complement(<134719..>136686)
                     /locus_tag="LMJF_28_0410"
                     /db_xref="GeneID:5653246"
     mRNA            complement(<134719..>136686)
                     /locus_tag="LMJF_28_0410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684267.2"
                     /db_xref="GeneID:5653246"
     CDS             complement(134719..136686)
                     /locus_tag="LMJF_28_0410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684319.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653246"
                     /db_xref="GOA:Q4Q8M9"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8M9"
                     /translation="MSRHIHATRHGAVKCPLCDTYIVPRGFFASLTKLIERHRDRQPS
                     APEASVPPPHSSPSTSAVASTSSGGAGPLTSIAITHAHCIGLPDFKSYEKADFELPGS
                     AQDYSLTGGLASRAQGRGTSAALVPCGSDNAGGSRTPFRCMECLNLCGTWTKATKHMD
                     KSGHTLPLCVQCLMRLRCFGPQRPIKHEESTGHCGFYGVFYTRRDYLCEVQATRSVYN
                     YSNSYTGLSTLQYKCVCGISFLHPLHLAEHLRRVHHAACIRGEAVCRRCDTRGTLADL
                     IMHLRQGCPPVTPTLQNNGSSATFTDTSVSSLTGSNMRLPSMTSPNCPTASSKDQEDQ
                     GGAGGSGGDNAAVTPPVIEVPGFSGASFLQWRPLLPPMTADDVPLMDESYAMSGDISG
                     FRALASQPASSSSHVAATEVRKASYVVLYQCRECLFLFSSWERMVHHIHATGHCSTYC
                     CKCRCDLPQLVNHPTPHEASGVSRSSTQLPAYGGAATSAPLSVCSTTLNDHLDHLRRC
                     GDIIGFPTSPRSLEVLVDVNAECYQGSLDPSPDLFTGDRVIMAYQCPAEQLGCYEVFL
                     NYGNLVEHLMATGHGSNPRPDDAEGSDNTLATRRLSSCYPMVTYRPKFTVLQLRDHFG
                     FVQCSYCESAVLRGEEELHEALCIMRRRMGH"
     gene            complement(140783..142150)
                     /locus_tag="LMJF_28_0420"
                     /pseudo
                     /db_xref="GeneID:12983024"
     misc_feature    complement(140783..142150)
                     /locus_tag="LMJF_28_0420"
                     /pseudo
                     /db_xref="GeneID:12983024"
     gene            complement(<143040..>144320)
                     /locus_tag="LMJF_28_0430"
                     /db_xref="GeneID:5653248"
     mRNA            complement(<143040..>144320)
                     /locus_tag="LMJF_28_0430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684268.1"
                     /db_xref="GeneID:5653248"
     CDS             complement(143040..144320)
                     /locus_tag="LMJF_28_0430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684320.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653248"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8M8"
                     /translation="MSERCDMKGAKNLRMMVVQSVLLLYCDLSKDCGASSSGKSVLIS
                     SSSGNKPLGQSGAFLGLNIFTKSLDKRDLSSRAIEALRTTSFTDVGDGCQWRIEEDGV
                     TLCIRVDLATVQKRLGASGKSMLLATTGGNKPIGGTGLNCGLNCYHPVDKAFDASKLG
                     AGNAGEDELQVGQTQSMEGGFVVSYTTPTEMHVTYTYRAETMANGHTASLPACLVGDL
                     KVTVFVCAPKAARARTEKTAMRATEDDEKYAASSAPTPFLTQASGANCSGCLSLERGK
                     DSKVRNVTVTCTAVPAEGEEAAVSAGSQTGAYTIDLRFDPTLSFGRSLSGKWLTVAST
                     GGFQRVVDAEDRAVCRFSLYAGRPAPSLSEAEITAAVRAVLAAKPKARLSSLSFKEVL
                     TEVMSMLGLSEATKDAVKPTIKEAVVAFVQAAAT"
     gene            complement(<145102..>147426)
                     /locus_tag="LMJF_28_0440"
                     /db_xref="GeneID:5653249"
     mRNA            complement(<145102..>147426)
                     /locus_tag="LMJF_28_0440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684269.1"
                     /db_xref="GeneID:5653249"
     CDS             complement(145102..147426)
                     /locus_tag="LMJF_28_0440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684321.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653249"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8M7"
                     /translation="MASAAKKKSGVKVQFDAEGTAGAPNVQSPFVSAAHNTVWPYDAA
                     AHNRGGHTIFTAAANAMCGRPNGTYDCDGAWTAERAPHARLQTTEAPLETGLSIGSAP
                     VVSHGATPAHDVLYEEWLGHIAAYRASPLQYPHHIICMTAPAVASRVLSMSDASPKQA
                     FLRVATVLYQLLATYLRRCNKPPEASEHEAGERVPSRVFASLLGSAVYNTNFSEPPLE
                     QKDTTFDWVEPAGQGVNDAAESGVARDGVAATGSAPVNPVTAHMMRMRARQPPAPPRR
                     YDALSVVSCVDAAHINVCVGQHFYKLCVMDKRVGRLRDVASLAADLEALHAHHLSLAH
                     TDVLPGASPATRQDRKDLDTMFANLSCLADAIAFDVRRRLRVSSEVNAYSLDALESGL
                     CTLVLREDDTVSESESAGGHVTPVAQWLHSVCCLETSLAHPEEWTMRLQALVVPLQAG
                     MEWVRSALMQPSDAAFTGDVANAPVPRDASCRKAGVADHGATPRKVHPATRQLSTPVD
                     ARGNVEHLELWLPQKHRVPLKPYAEPVWNRADAQHPVPDVSSCACTLVDFCMCLLRVT
                     TEWKRDGRLPASSEATRWRPNVVIAVQPPCGGAPSLMALDLPAVQHFYEVLASPPLLF
                     AVDTRRRVEAEARAEVAALLNRSWHTTSTVRTPPKDGSAPSRWFEGVETAANGVLSRG
                     DVCLSFAVLPRQAAPLSDVTTRTPAVSRLLSDVAFPSSLLVNCAVQQTAAEVRVRASH
                     SALVDVVVGADTLAAAPVVGEFVAALASCMRDRC"
     gene            complement(<148074..>150902)
                     /locus_tag="LMJF_28_0450"
                     /db_xref="GeneID:5653250"
     mRNA            complement(<148074..>150902)
                     /locus_tag="LMJF_28_0450"
                     /product="putative ribonuclease II-like protein"
                     /transcript_id="XM_001684270.1"
                     /db_xref="GeneID:5653250"
     CDS             complement(148074..150902)
                     /locus_tag="LMJF_28_0450"
                     /codon_start=1
                     /product="putative ribonuclease II-like protein"
                     /protein_id="XP_001684322.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653250"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR022966"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8M6"
                     /translation="MTAITCAYALGSDPELEKRVKEGTVVVGRVNVFRNYNTNLSFVR
                     SSRLPCDVVLNSAELRGPALHSDVVALALLPLAQWQLAPGAASAVPGSSDSNTDDEET
                     GNGPRAMPSTLPDGRHIAQLIAPETPEELIHNASAEVSLAVQMGAPSSYEWPPEKRPL
                     GRVIRILKRCLPRLHVARIADNQVSPGERLQEKYYYRFRPFNQLYPQLTVQGCDIMAA
                     YHANISTSLFSLALEHRENGEILTTPRVPNALLCKVHSFLGDASTMAVASHAICTSCN
                     VSTEPFSEEAEACVPKDFTIPSAAELADMGRRDLRDSEFVLTIDPATARDLDDALSIK
                     PRKDGGYHVGVHIADVSHFVLPRTALDEEAQRRSNSTYLVDRVIPMLPSRLSEEYCSL
                     NPGEDKFAFSGLFEFDRDGHLISEAATEEKCEWFGQSVIRSRCRLAYEQAQQILDGDD
                     TVVLDVAQAASDLGIGEEAARKKVKQSVTNLFTLASKLRQQSLRDGRVVIGSTRLAFR
                     FDRNEVNSPPTSFFVQEQIQANWLVEEFMLLANQRVAQKIVQFIPYGALLRRHKPPHP
                     QKMRRLRTALSHRGLPTGGSSGQELQQVIETIKKDHREDFHTVCELLKYSLMAAEYIA
                     NDPTEKDIRSHFAVAAPWYTHFTSPIRRYCDLMVHRQLRVALELERCMEEAQMEMPHT
                     PHPALETRPGDCIFDPTRAVDVNKLKTRELFYPHSALEHIVTHANGCRLNSRSAGDMS
                     LEYSLCLYLLALQKRAKEDPTLPQQLYTTVTIVKITEGSFLLYSAELASVVEIGFNDT
                     HQRFRYQGLLVTGDLDAKSAAQETRADTQAAAARARDAKAKAHARKKGGKSDMPRRGT
                     ADGGQGQHGFSDRLNTVVAQFSWGPHPETGEEVTEAFDLFTEFVALLEVTSKQGRLSL
                     GMQLLQPWEREAARRVCPKVPTSLVEEE"
     gene            complement(<151642..>152577)
                     /locus_tag="LMJF_28_0460"
                     /db_xref="GeneID:5653251"
     mRNA            complement(<151642..>152577)
                     /locus_tag="LMJF_28_0460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684271.1"
                     /db_xref="GeneID:5653251"
     CDS             complement(151642..152577)
                     /locus_tag="LMJF_28_0460"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684323.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653251"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8M5"
                     /translation="MDLNDFLRNTKTAAQDGSAGVRTLLSGHKRFADTNEASAEASSS
                     GAGASGKRPRRSGTAEGLNIRAAQEALAQERGNTSAQAQQQRAQAELLSEQAAARMVH
                     QVLEYVMQVELGGRHNAAKGGIAPFVPSAAQLAAEKAMWTPAAGYVIHHVVPATLDTS
                     PHTLESLMSVTEKERVPDGVRALRGTLQVFDTERDLVGGVRTGMAPHLRTHVLEVLEK
                     GLHGRAWLRDDAAVATQISALGKPTTPDKGPSSVLLFGDLATASVANSDATSSARDTA
                     SAGDEASKPRSKGFSLAAFLNGNDPTSSSSDGEDP"
     gene            complement(<153942..>156332)
                     /locus_tag="LMJF_28_0470"
                     /db_xref="GeneID:5653252"
     mRNA            complement(<153942..>156332)
                     /locus_tag="LMJF_28_0470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684272.1"
                     /db_xref="GeneID:5653252"
     CDS             complement(153942..156332)
                     /locus_tag="LMJF_28_0470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684324.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653252"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8M4"
                     /translation="MQSCFAACSQVVCVAEDTAVAFYAPKSLRKFRVERLNGSRVCGM
                     YVQSTSSAKAVLHVIDAEATLFEFAIEGGAPSLVRTISIRLPPASPVPSTSAGENEEV
                     SDRRHQGSTSRTVNGEAAATASVVVAAQFHVQQAQLFAVLLTKAGLYEAALGSASPVG
                     ATNAPSAVVVHTFKEAVPHGYLSVGQFTGLVVVAVPHAREFFYSLFTDRLSAHQPHRP
                     SCPPLLPRTVNVQIQSIACSPISTSVAVGGRRGELLICVEVQEAHCFADHWHHTPLTA
                     LAFALDGSAVYTGGRESVLLIWDLVSYSHKKVKVQLGTLQRITPFSSGGAQLLLSCGT
                     STLAVADLLQMRVTTSAEGIEWAAEDVCTGLVVEQWRGSPAVILTGMPNVLRVCDPYT
                     QQSIYSLHVSSQMETIPSPPRHGIQFVGILNDSRSLVTYESFSSTVLPPLLRFWEYDA
                     PRKQHIETQTVYSPHRSAVLALQVEKRGRRVFTLSSEAMKCWAQTAFTAQDTYGTPTG
                     GWHNHSAMATPSQQVQTMALSADGSLCFVADDCLHVYSVQDCRPGVHWPLLQLLPQYT
                     ETQPLRRIVVSPDCRHAVAAGKRHIFFWTLGRCAEEPAVFSVGESCITAFSAFTDTTV
                     VAALEDTSLVELRCCAAGSSKGPQLGEAVRRIANASRFPLRHIAPLHMNGQRLAAVDA
                     VTGFKILQLPTGAPAVAQPSVYEWAGTSDEESSAGAVAEGDKTARLQLQSFFKEMTSI
                     QDSQELMVTANQEGALATAQQTAQADRWLAEVLGEPAYTAPPMSAILSTYLQRRPY"
     gene            complement(<158035..>159921)
                     /locus_tag="LMJF_28_0480"
                     /db_xref="GeneID:5653253"
     mRNA            complement(<158035..>159921)
                     /locus_tag="LMJF_28_0480"
                     /product="carbonic anhydrase-like protein"
                     /transcript_id="XM_001684273.1"
                     /db_xref="GeneID:5653253"
     CDS             complement(158035..159921)
                     /locus_tag="LMJF_28_0480"
                     /codon_start=1
                     /product="carbonic anhydrase-like protein"
                     /protein_id="XP_001684325.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653253"
                     /db_xref="InterPro:IPR001148"
                     /db_xref="InterPro:IPR023561"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8M3"
                     /translation="MKTLPFCATLAIARLVLFVSVAGVVGGLDEQHSYYEGNYGTSGL
                     VFGSPDSSRTSWNYTNLKDWPPLCLTGRRQSPISFANMNPDEVVTNAPLQRLQFSPKC
                     VFPREETQMRIVNEGIVSTVSFEKLGRLPDDMSECTVIDPLNCSRTYHFTSLHFHAMP
                     MHQLRTLRPEVEMHMSFTTNHAKKKRNVLIVAVMLKASAMINTTSVRALQHILVDGSL
                     PKRNAMTTCFLTERLSLLSLIPARESYLLYDGSQTYPPCTENVRWVVMTSPILISPVA
                     LGRLRDAMDALLPNDFHRFGNARPPQALNGRLIYRFDDKSVPAGGNRSQGNFKEARSH
                     KDEGLANRSLGVRAGRVLAGSQAEVDGVYKHYSAVVVSPVSPNPVSVSRNGTTLASPP
                     PSTTSTGSCNGSSDRATAKLGTGAPAPAYVSNANSTCPGTHSYVNESSADHSNATASA
                     SSASRTSAMSSASASSADEKMLSGLHHGSESSAQTPSDGSAPQSTKTSTSTTTTTTKG
                     PSGTKGKQRHDDGASQNTSEAEAGVLDAVKSIVTRAFTSAKAFSMGAFQSSVAYTKAN
                     PVRAVLGLLCIIVLIFLISTCCRGWRRPVYVVGIDPTELQPLNSAKRFDLYGGTGTGT
                     VAVR"
     gene            complement(<161598..>162281)
                     /locus_tag="LMJF_28_0485"
                     /db_xref="GeneID:5653254"
     mRNA            complement(<161598..>162281)
                     /locus_tag="LMJF_28_0485"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684274.1"
                     /db_xref="GeneID:5653254"
     CDS             complement(161598..162281)
                     /locus_tag="LMJF_28_0485"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684326.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0485"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0485"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653254"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8M2"
                     /translation="MRQGIASSAPPSPQVMPCFKPQIIYSNETSERVGRATNATMDAL
                     NAVLHNASSQLAAATATLAPNTSAQPLPIAGRSGRHCVMEDNFTTARTTTNAVLNDSL
                     SRTTGPISRHVPHLSLVHVLAWFLLFATITVTTVTFLNYCLRSKHGSAYSAETGYGDE
                     EMCGKTAVPFSVSSQSVQTEGLSGTPSSSSRLLASRGNLARQQFLESRKSGSNPKCYG
                     ATTSTSPAN"
     gene            complement(<164341..>165909)
                     /locus_tag="LMJF_28_0490"
                     /db_xref="GeneID:5653255"
     mRNA            complement(<164341..>165909)
                     /locus_tag="LMJF_28_0490"
                     /product="putative propionyl-coa carboxylase beta chain"
                     /transcript_id="XM_001684275.1"
                     /db_xref="GeneID:5653255"
     CDS             complement(164341..165909)
                     /locus_tag="LMJF_28_0490"
                     /EC_number="6.4.1.3"
                     /codon_start=1
                     /product="putative propionyl-coa carboxylase beta chain"
                     /protein_id="XP_001684327.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653255"
                     /db_xref="GOA:Q4Q8M1"
                     /db_xref="InterPro:IPR000022"
                     /db_xref="InterPro:IPR011762"
                     /db_xref="InterPro:IPR011763"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8M1"
                     /translation="MRRLGCGLVSAAMGVGGMSSSQLTKEFDRHTHTPTAAEESRHKK
                     KRLTAMERVQLFCDPGTFRERDALVEHGCHNFGMEKRRVPGDGFVTGAGKVFGRPVFL
                     FSHDFTVFGGSLSGSNAAKVVRIMEEAAKIGVPVIGFNDSGGARIQEGVDSLAGYADI
                     FLRNTLFSGVIPQISVIMGPCAGGAVYSPAITDFTFMVDNSSYMFVTGPEVVSVVGGK
                     LVTKDELGGPHVHATKSGVSAGTFPNDIVAMAQLRRLYSYLPLSNRDSAPVVPTADNR
                     YRDVSSLNTVVPVEVKEAYDMRDAIFPVIDQDSFFEIQPQFAKNIICGFARVEGRSVC
                     IIANQPKVQAGVLDIDSSVKAARMVRFADAFNIPIITFVDVPGFLPGVQQEYGGIIRH
                     GAKLLYAYAEATVPKVTIITRKAYGGAYDVMSSKHLRGDGNYAWPRAEIAVMGAAGAC
                     KLLYSKETAEQQAQRIADYEKAFCTPLSAARKGFVDAVIDPSETRMRVCEDLERLSRK
                     QLRNPWKKHGNIPL"
     gene            complement(<173812..>175950)
                     /locus_tag="LMJF_28_0500"
                     /db_xref="GeneID:5653256"
     mRNA            complement(<173812..>175950)
                     /locus_tag="LMJF_28_0500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684276.1"
                     /db_xref="GeneID:5653256"
     CDS             complement(173812..175950)
                     /locus_tag="LMJF_28_0500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684328.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653256"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8M0"
                     /translation="MQMFMDIAAAAEEDNLVSLCPEDDGDVPDMPFFAASNLDDRPIA
                     PAAEDYPLGCEVELRDVEFAKIAQESSHWEPIMEAVFAVPRRRVRVDRHTGDYTFVLC
                     NDIDGFERVGCTLYRACLSEPKVKATRYYSSIRSGLSGLELEDNGEEILSKPAQLGAA
                     TSAAAEANKTVMDTRVAATASAGNNRVASLKSVRSAASVASSADDARRRSFMAYMKKG
                     TAEIGKRNCEAALRYYNRALEEMPEEEARVRSSRSVAYLLAGEKDRALEDANRVVHLV
                     PRESVGYIRTGNVLRSMKKFVDAQKMYATALKYDSSSAVVRNLLEGNSVAMLYEGRTK
                     RYKKMRIAYDDSMKRAIAVVAQSIDANEIVMKEGTSCVFPLSSGIYRIVNGRQRCPMC
                     CHCGRPFVDEAQVTEQIPGLTKQLLNSLHVLVNPVPCDSNCSALYCSEGCKSKAWVEH
                     HWVECTQRGRWRDGVPVVHRLLDQFVTTRSARSFVEDAPCDVSPAPQCVAEDTRPIII
                     AACVRIAVRMMSRMVSSVLPAQEAVQQYRWLPIADVVRGQRREVKELLMTCYSTLSRG
                     FSSEDSDQLTFKVFQEYYEKAKSNSIMICCSVWPKVVERVSSHLDLVTAEDSPAGLHG
                     TEASFDLCLQQIMNAPRQGVPGTYHICISMFELASLMTSNNCTRSEVMRPNVMVRTFA
                     ESAANLRLRTLRPVAKEEVLAMAWPAYGAA"
     gene            complement(<180231..>181388)
                     /locus_tag="LMJF_28_0510"
                     /db_xref="GeneID:5653257"
     mRNA            complement(<180231..>181388)
                     /locus_tag="LMJF_28_0510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684277.1"
                     /db_xref="GeneID:5653257"
     CDS             complement(180231..181388)
                     /locus_tag="LMJF_28_0510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684329.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653257"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8L9"
                     /translation="MEYKGNVLSPVDAEISIRQLRSFSMEEVGTSSWKDQREAMERLN
                     MCTHSNATQKTDDFVKSFLLEHDKLGDVLHELLLMEVWRQRVLPGVLEAVTHNPTATY
                     MYCAYESVLVNLLECICFYEEVVVGFGDDVLELIDYCWRQVARLFSEKNISEVPTAAA
                     KESPLAYLEQQLREQRIQRAMGCISLLWLVTDRLEALPLSAMNSILRKNDIPFGLAEV
                     LLLQPWLRRSAGLVQKFHNGAFVVAPGNESQRVCVPEAHAWFCLHKLLCDAECRRQYQ
                     YTQNKKAALLHVRSLLNETLLDQLPALQDVQRALEELSFMEPPTGTEEKFRSTLIIEQ
                     VPRLMSAIDLPSADWAAQVERMKRLLSDRSEAVSDAMRMSQLFDLMFADHQ"
     gene            complement(<183048..>183953)
                     /gene="LMAIRK"
                     /locus_tag="LMJF_28_0520"
                     /db_xref="GeneID:5653258"
     mRNA            complement(<183048..>183953)
                     /gene="LMAIRK"
                     /locus_tag="LMJF_28_0520"
                     /product="putative protein kinase"
                     /transcript_id="XM_001684278.1"
                     /db_xref="GeneID:5653258"
     CDS             complement(183048..183953)
                     /gene="LMAIRK"
                     /locus_tag="LMJF_28_0520"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001684330.1"
                     /db_xref="GeneID:5653258"
                     /db_xref="GOA:Q9N2N1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q9N2N1"
                     /translation="MTTEVGPDDNVVNNFIITPSSPKSEWTIHDFELLHKLGGGNYGD
                     VYLASVRKSNYVVAIKKLSIKKLAEFDIVNQLRREIEIAFNTRHKYLLRTYAYFFDEH
                     DIYLILEPCSNGMLYSELNRVKLFPPPTAARYVAQLAEALLYLHQHHILHRDIKPENI
                     LLDHHQNIKLADFGWSVHDPLNRRKTSCGTPEYFPPEIVSRQMYDMSADLWCLGIFCF
                     ELLVGHTPFVSKDNDQIYKKIHAMQYTIPDSVPPEAKDLISNLLIREGSKRLALHRVL
                     SHPFLLKYYYVPNGITPPTGKRPRS"
     gene            complement(<184982..>189064)
                     /locus_tag="LMJF_28_0530"
                     /db_xref="GeneID:5653259"
     mRNA            complement(<184982..>189064)
                     /locus_tag="LMJF_28_0530"
                     /product="RAD50 DNA repair-like protein"
                     /transcript_id="XM_001684279.1"
                     /db_xref="GeneID:5653259"
     CDS             complement(184982..189064)
                     /locus_tag="LMJF_28_0530"
                     /codon_start=1
                     /product="RAD50 DNA repair-like protein"
                     /protein_id="XP_001684331.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653259"
                     /db_xref="GOA:Q4Q8L7"
                     /db_xref="InterPro:IPR004584"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8L7"
                     /translation="MTSIEKLQLCGVRSFDPNPTNQQFIQFQKPLTVILGKNGAGKTT
                     IIEALLNACTGAMPPGSGTERGSFVYDPKVVGETEVKAQIRLIFTGKGGKLMQVIRSF
                     QATRSAHRVTFTTLDNTIAFQDLSTGEVISSTYRSSDVDRVVPEMLGVSPAVLEHVIF
                     CHQEECNWPLGPPKDVKRIFDDIFAATRYVLALDRLRDNSKEFRRQLKEHEASLMALR
                     EHREQAKQLEQQIAEKESVVKAIQGRSIGIEPELRGLRQAREALRTVEEQIEALQREV
                     AVTNGRLEERREAVRRMGVPATSQTLEDLLEMRGSFTAQMQQLEEGLVQDTKRYDAAA
                     ARRRAQEEDMYKCRSNVQLLEREAQLHKQNVAQLRELIQHLSHDHILSESNIDERSLQ
                     RLLQKAEDAVAAERQRARTASESVQQRIRDAEDGAQCASRAVDGCKKEIEVREHAVEN
                     VRRRIKEHAAAIAALGGEGCRTQLRQAQVEVEELQQRVAAAEELRKKGGGLHQSQRIL
                     MELEEQNSTVAQLREEMMQQKLLERQQQDLALMRQQIDEARAAVAAALQRDVLPILHE
                     VGVQVPQEAAADSFSLPALTSLRSQASQVRQLKAEELRALQTRALELEKACALQEQKM
                     SYSTDELGQCRRAVDAGTRQCAGLFPDMDAYEEVLLQAKEAAETAAQKRHALEALASC
                     YHDFMVVAKGERMCAVCERPFDSDDSLESFLTRKADRQRTSPETLAAVQAAVNTTREA
                     YQSLEKLQSVVVTVRQNRHRIPVLEAELDALEDKMKQNRAEQREVCAARDAAQHEVHQ
                     LDTMYQHLCMVCTMGERTVALRDTLARKEKDFEAAQAEQQPHETQRKWGSGDGATGRA
                     EPAPCSYEELCEAYAAATERLHKLNRQFTEAQRMERGQAENAAERELQERKAAMLQAE
                     VAVAKLDDLESAARELQEEAAQHRTRVEELKRQAAEAQHSVEAHQQRVLQLRAERQKT
                     EAAERGALDTAEKQLRELQLSLPPVLSYLHNGCARQLEELRMHLRETESAYKASAQEE
                     EGLASRMKEARKTLSDQHRRSADMDRHIDVLQQEASIAADEAHLAEMERTLASLKSDR
                     LHDVEQLLGKEARQASLATLREMITAKITSLEKIRAQQDGNTEAMLLDVNQLKQQLRG
                     DKYQNIEKRYRSTFLKVQTTEISIQDIEKYYSALEKAVQSYHQEKIAQINQIIAELWR
                     RTYRGSDIDTVEIRSETEGTTTTTARRSYNYRVVMKRGNNEMDMRGRCSAGQKVLACI
                     IIRLALSEAFCCDCGILALDEPTTNLDGDNARSLADALRTLIQARRAVKHFQLVVITH
                     DEQFVRALGGQSLEKFYYVHKDREGAFSVIDERTFDQLFA"
     gene            complement(<190086..>190424)
                     /locus_tag="LMJF_28_0540"
                     /db_xref="GeneID:5653260"
     mRNA            complement(<190086..>190424)
                     /locus_tag="LMJF_28_0540"
                     /product="putative ribosomal protein S26"
                     /transcript_id="XM_001684280.1"
                     /db_xref="GeneID:5653260"
     CDS             complement(190086..190424)
                     /locus_tag="LMJF_28_0540"
                     /codon_start=1
                     /product="putative ribosomal protein S26"
                     /protein_id="XP_001684332.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653260"
                     /db_xref="GOA:Q4Q8L6"
                     /db_xref="InterPro:IPR000892"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8L6"
                     /translation="MTTKRRNHGRSKPAHSRGRVKPIHCFNCGRLTPKDKAVGRFVVR
                     RMLDAASARDVAEASPVYGANFPMPRLYMKQRFCIACAIHSRTVRARPVGNRKIRYTK
                     KVPFRPAGKK"
     gene            complement(<192069..>193202)
                     /gene="RAD51"
                     /locus_tag="LMJF_28_0550"
                     /db_xref="GeneID:5653261"
     mRNA            complement(<192069..>193202)
                     /gene="RAD51"
                     /locus_tag="LMJF_28_0550"
                     /product="putative RAD51 protein"
                     /transcript_id="XM_001684281.1"
                     /db_xref="GeneID:5653261"
     CDS             complement(192069..193202)
                     /gene="RAD51"
                     /locus_tag="LMJF_28_0550"
                     /codon_start=1
                     /product="putative RAD51 protein"
                     /protein_id="XP_001684333.1"
                     /db_xref="GeneID:5653261"
                     /db_xref="GOA:O61127"
                     /db_xref="InterPro:IPR003583"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010995"
                     /db_xref="InterPro:IPR011941"
                     /db_xref="InterPro:IPR013632"
                     /db_xref="InterPro:IPR016467"
                     /db_xref="InterPro:IPR020587"
                     /db_xref="InterPro:IPR020588"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:O61127"
                     /translation="MQTRSKAKGRRGRPSARPSEEVEVVESQPQEVLQNEEQEPQQQQ
                     QQQSTDMAEPNASGFRVIQILENYGVASSDIKKLMECGFYTVESAAYAPKKAILAVKG
                     ISENKAEKIMAECAKLVPMGFTSAVAYHEARKEIIMVTTGSREVDKLLGGGIETGSIT
                     ELFGEFRTGKTQLCHTLCVTCQLPISQGGAEGMALYIDTEGTFRPERLVAVAERYKLD
                     PEDVLANVACARAFNTDHQQQLLLQASAMMAENRFALIIVDSATALYRTDYSGRNELA
                     ARQMHLGKFLRSLHNLAEEYGVAVVVTNQVVANVDGSAQMFQADSKKPIGGHIMAHAS
                     TTRLSLRKGRGEQRIIKVYDSPCLAEAEAIFGIYDDGVGDARD"
     gene            complement(<198508..>199368)
                     /locus_tag="LMJF_28_0560"
                     /db_xref="GeneID:5653262"
     mRNA            complement(<198508..>199368)
                     /locus_tag="LMJF_28_0560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684282.1"
                     /db_xref="GeneID:5653262"
     CDS             complement(198508..199368)
                     /locus_tag="LMJF_28_0560"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684334.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653262"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8L4"
                     /translation="MPPDRSTQLGELRRQYPSTSVVTESAQETVLKVDDVLRIAPMTE
                     YALSLYVTLPSSFPKAAPRATMPYCCHNVPITPPNINPSEALAYQWSSTTSTLVEAVR
                     NAFQNAADCWGPVEPPSMRSVTLQLSGETDRLLQDLVTNPNCLDAYCYQLPIVKLMRE
                     ASRHTVSEIERVANENTTLRNEVETLEAQVKDLQRYLDEQVSQLQQLEQNRLLLSVGT
                     PEALIKTLEDDVRRMSSDCMTLGRRALDAYKADKGGFQDLLKQYKAQSKATHMLDLKR
                     LSYRAQCAAS"
     gene            complement(<201489..>203189)
                     /locus_tag="LMJF_28_0570"
                     /db_xref="GeneID:5653263"
     mRNA            complement(<201489..>203189)
                     /locus_tag="LMJF_28_0570"
                     /product="putative major surface protease gp63"
                     /transcript_id="XM_001684283.1"
                     /db_xref="GeneID:5653263"
     CDS             complement(201489..203189)
                     /locus_tag="LMJF_28_0570"
                     /EC_number="3.4.24.36"
                     /codon_start=1
                     /product="putative major surface protease gp63"
                     /protein_id="XP_001684335.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653263"
                     /db_xref="GOA:Q4Q8L3"
                     /db_xref="InterPro:IPR001577"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8L3"
                     /translation="MCRTLLGIAVAFALVCCVVGPGAAQGHPERADSEEPRCGFDELE
                     AHTIGTRVSGISRVELPTGELVVAAAATGALQPIRIAVFTDDISNSSQHCTASGQSRP
                     NFRGSRVTCSAAEVLTRAKKRVLLELLIPSAVQLHQERLNVQRVNGNIVVDSSIQKDR
                     VCGQFSIREEHMKTGVKDADFVLYMSAAPTSGSVIAWALKCQNFDNGRPSVGVVNISP
                     KYIAADPKTVRVIAHEVLHALGFSRSVFQERNMLAMASFRSKGPSPVICSEKVVAKAQ
                     QHYGCKTQAFMELEDTGDIDDASSHWKRRNAKDELMAGFSGVGIYSALTIAAMEDTGY
                     YQGNYAKAEPMAYGHDAGCKLSSDQCVTNSTSQIPGMFCDAPDAPWSCTSDRLGVGRC
                     ILTSHKSNLPTYFQYFSDPRLGGPDPLMDFCPVVEVAEGTMCAATTNALKGSVYGVMS
                     RCVDTPVGFSMDDSAVRQHGICVEVQCDSTKYYIKANGASAFCDCPPGSTYNLSTLSP
                     SFSKGYLVCPSYESVCAIKINASLYEEYSGFLTDHSVAGVLTSVKAVVAVLLVVLFMV
                     "
     gene            complement(<205123..>209862)
                     /locus_tag="LMJF_28_0580"
                     /db_xref="GeneID:5653264"
     mRNA            complement(<205123..>209862)
                     /locus_tag="LMJF_28_0580"
                     /product="putative mitogen-activated protein kinase"
                     /transcript_id="XM_001684284.1"
                     /db_xref="GeneID:5653264"
     CDS             complement(205123..209862)
                     /locus_tag="LMJF_28_0580"
                     /codon_start=1
                     /product="putative mitogen-activated protein kinase"
                     /protein_id="XP_001684336.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653264"
                     /db_xref="GOA:Q4Q8L2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8L2"
                     /translation="MDNYDVLEVIGEGTYGVVFKCRDKRTNRIVAVKQFKNFQTNAYV
                     RVAMLRELRVEQLLKSEPNVTQLLETFKQKNRVYLVMEYIPRSLLDVLEEVQHGLPED
                     SLVVLLFTILLGIRSCHRNGIIHRDVKPENILVRDDGAASLCDFGFCRPLPRQLQPQA
                     PPSSHQLSISSHDIGSSASPMVESGSFGLRPLPPPNNAPQMCNAASVSSENSAMLSEL
                     VLADHQAIMTNYVATRWYRSPEMLLGMSSYTYAVDMWAVGAIMAEAIDGEPLLPGKTE
                     LEQLSLIQTRIGDFPAAYEAAVRKQNGGMLRLRSLNPLAAPPQQLRTKSMQQKSRRAS
                     DVRDAAQKRTESKQSTSSYLTERYGGRIAKAGLNLLHGLLRIDAAERITVEEALGHPY
                     FDSVRGRFDATANGARRVCNSNGACDEAADMRPTTAETAESMLMPLTTAASRQAPLPP
                     LTATGAVDCTSPFLSTSDAAGGGSSPCLVAAAPPLVEVPFSLVDRVGAGADDDGGGPL
                     QMPCGAERSPRVTTVAWGASSSSPGSRAPCGVAGSNSSASDSSSLSLWTASDTSAEVD
                     PPTDVTAAKDHVSFPGLSSVLVSLHPESPKPTETDGHHAAAAACNRAAEGSNSTPRQL
                     APEEDNNDDQPVLRRQAASEGANTRAIQRDASMHSYDCSSTSLFQSRQRQHSPRDARQ
                     LRHRTSSLESGGSVTALRGSDSSRTNTAAQEASGAGGAVSATAASGMDVPASLSVLQS
                     RRTAQRRSGSVVNSRLSSSKISAASACRTASPPSLLAKSYSFKSIPTSRSKALAPAEV
                     QSTSKYDLMQSVPEDHTEKRRRPSGPASSPRCQDSRGSVEKRAAANSKGAHTCSSSSM
                     TFNALRSARGDPGCTGGLGSATKERHSSVGRRIDGHGLHVVPAAPSCVNATTPGSSCR
                     ATAQEPVEVSSLRRRSTAKSRPPQQPGRRTSTPTARAGIANGTLHSPALTKPLFVRSS
                     PEASASLSVSDARVGGGKKRGLSRFVSPNVPREVRPLPAPERVTLLQEIESLGFLVGT
                     PSAVEVLAPVVAAPVSHTPRHAESKTDAGGGARGRNEGDTRASAIARADHLVRASQPP
                     EMLDNDVQPDGHRGGGNSTSLLTLGETRRQCSGTASSRASAAKRGTAASGETSAFVEG
                     AASSELEDHGRQQNLQRPPHPCGSTGGRPPRTDVNSLSGNTSTHSANATTVGSSRAAP
                     SLIFRSARTASSPLKLATIHPSSFAVQGEGELRELSTSGCHAKTSASTGMSFTAPSNS
                     VDSPPTCRLAPALLRHHHPTTAVGACSVQAYASLGPDPVFGSSAFSAHSPLVAKGSAR
                     SPTLSPNPQKRSDADARRVSMESPIVSLSGKRQQRRLSDIPIELSLSEELFADSAACG
                     PRGGRRRHENTTPLSTTPPITMPDDLETVVLMGTPSASRRTDQRPQDEVPCTATWSSA
                     RSGTTAMMSSNMPGNSTPFRGLDGDSDGLSAPFEGKGSAAKTEAVDITARTTRHGVAP
                     SLFAAVPKGVPALNEDDVRSVCETPSLPIRGSLEACGAGNSASTSSRKIPGPSLAPPQ
                     PLLGGASVLSAQQLHAGGGRRKSRLVL"
     gene            complement(<214227..>215732)
                     /locus_tag="LMJF_28_0590"
                     /db_xref="GeneID:5653265"
     mRNA            complement(<214227..>215732)
                     /locus_tag="LMJF_28_0590"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684285.1"
                     /db_xref="GeneID:5653265"
     CDS             complement(214227..215732)
                     /locus_tag="LMJF_28_0590"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684337.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653265"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8L1"
                     /translation="MLEESSSTSTHTTVKHTFKELCDSYVESSMPHRYQVVHQSALQA
                     RRSVNDQTTSVAKGQAPAAAAASPSLTVPPELVREYVRMKEEALAHCHRQNAPMDISA
                     RSTEELEAENVYLRSLVLWLERHLQHLPSFETRPGEVVSTLPSPRPVPRREGSLPTEH
                     RLSLSAVCPEPVAKHAVGQYNSLMLRSGSEASPPPATAQQVSELQEQIDLLREAVRGL
                     SQRASGTEGHSSSPAPADAAAPSLRLRIVSPLPGCATPTCTTDVRTLQQIILHQQQTI
                     RSLEQEMEDVHTAKAQMEQAMMQLREATATIAARKEGCTEDEDVGALGATAHWRSTCQ
                     TEDRISDCVSLADAASYDYAGQDAADTVGHATVPGAAGEGTAAQEMRKIDLEAAVEQA
                     PEKRRAATFGGMRPPLWFDSNTSFADPIRLTGGAAGEDEDVDEPSSGMRTPLPRRTVL
                     LHQRFSSATGDTSSMWGGAGVDESPFTQHTQMSCGTASNRRTSAAVSFASL"
     gene            complement(<216691..>216978)
                     /locus_tag="LMJF_28_0600"
                     /db_xref="GeneID:5653266"
     mRNA            complement(<216691..>216978)
                     /locus_tag="LMJF_28_0600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684286.1"
                     /db_xref="GeneID:5653266"
     CDS             complement(216691..216978)
                     /locus_tag="LMJF_28_0600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684338.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653266"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8L0"
                     /translation="MAQKSLRSKSRHKSAGALRKSVGEAKRKSTFTKAKKTPEAKARA
                     NYISAVEAAMASRVPSDQRSKLSIVKSSGPTGNKKKHIKKPLTRGRKRKGG"
     gene            complement(<218968..>231693)
                     /locus_tag="LMJF_28_0610"
                     /db_xref="GeneID:5653267"
     mRNA            complement(<218968..>231693)
                     /locus_tag="LMJF_28_0610"
                     /product="putative dynein heavy chain"
                     /transcript_id="XM_001684287.1"
                     /db_xref="GeneID:5653267"
     CDS             complement(218968..231693)
                     /locus_tag="LMJF_28_0610"
                     /codon_start=1
                     /product="putative dynein heavy chain"
                     /protein_id="XP_001684339.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653267"
                     /db_xref="GOA:Q4Q8K9"
                     /db_xref="InterPro:IPR004273"
                     /db_xref="InterPro:IPR013602"
                     /db_xref="InterPro:IPR024317"
                     /db_xref="InterPro:IPR024743"
                     /db_xref="InterPro:IPR026983"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8K9"
                     /translation="MMESHHLDTQRSTHAAAFAASESSAAATGNADTGAATALATLPV
                     SSVYKESALRFPTASPSTFEPKVQVPYAYKRGRMPRDVEIERRRRLYDSESVDRLLQV
                     SGLTWEALARRSAQSLPLEIFDDTSYDCRNPSEWMAMAAMTPTQASRFLPAEAVYYCE
                     DRDSFELRPCRVIGWAEDTNTIRLYWGSAPTTARSSYSDGASAAGTSDGGGAGTATYG
                     EAGEPVATLPRIFVRFLAEDPIVYVQRLVSAHTQRRKTTSWILYRLCCDSMLVANLEE
                     LDAGLAERLRHLGTDIPQLSPVEFPDVAQRVERLISEITLEWQRSHNRLLLRDRIRID
                     ESVARMVVNSTHMDPEELLRGPNLAVDRSDMGDPSTVIFVEGDGFVFDEQEQAFTFAT
                     YFTQPEVVQALTGVQRECMKVLEGSLFNLPKERQMPLESFVKCQREHLASASRQLKEE
                     WLPRICETIVSSFQSSGKGWLNTREAKQSVYEMSKLKKFFVTVKFMMEDMLFQLVYSS
                     LHSFAEFFEEVSEFTVTVQDMNNVVNAWPGSDADDCVEKQPLFTIDLMEKDGHFSYSI
                     SFDDFEAAIVDLFNDAIVCTESIPQVERYVMTQYFWSRDGEGPFLDSVKKEEEHVCLL
                     RERVQTAVRASLVPLQTYLNTYDELLPLIRLDQAEFIKKYAEAGHSMDEMKEEIAQHL
                     RAKKNLAERLPLFLTVGNFVVDCQSFSYLMSMKEEELARLVMRLIGKTGKEEAVHVRE
                     AFTRMVNTIEKTPQSPEKLYELYAFMDGMGEQVAELVEHIAEVRQCYSILDGFQFELS
                     DEESRLKWEAIGWPRQLALRSQAVRKQLEQVQEELHSGLQKRQEEFSKRVEQLQRVVA
                     TFSKHTEAAEADKVAAEVKTHNIEIRQCIEEARSINSDQRLFGDKLSDYRNVFELDKE
                     FKPYSDLWLTTYTWQESYRCWHADAFTTLDAAEIESTVTAAFKTMVNLAKTFKDKAAL
                     LKIVEEVKTAVEGFKPWVSFLTSLRHPGMRERHWTGLSQKLGMKLVPGDTLMLLEDCE
                     PLLAHRDTIISYCEVAAKESQIEMTLKDMRAKWETKCFIIEAYKETGTYILKDTSEVV
                     ELLDEHLNVVQQLQFSPFKGYFEESITDWERSLNLISDILEQWLECQRAWRYLEPILN
                     SEDIAMQLPRLSTLFEKVDRTWRRVMGNAHAQPNALEYCIGTNKLLDHLREANRLLEE
                     VQRGLNDYLADKRQTFPRFYFLSDEELLEILSQAKEVRRIDPNIAKLFEGMHRLQWKD
                     NHPDEARAPGAGGEECRDAETADVETITGFYSGEGEYIPAVKSVVPDGNVEEWLKLVE
                     KMMKDSVHEQVKRAFEAYLSTRRSEWVLQWPAQAVIAVAQIYWTQGCEEALATKGEVD
                     GHAKVLDRQLRQLVEVVQSPLTAIQQINMGALITIEVHAKDTVDSMQAAKVSSTQSFE
                     WMKQLRFYFNHSDDLCHICQVDTHFVYGGEYLGNTARLVVTPLTDRIYLTLTGALALC
                     LGGAPAGPAGTGKTETTKDLAKALAKQCVVFNCQEGMTYQSMGRFFKGLAWTGAWACF
                     DEFNRIDVEVLSVVAQQVTELQQACSTKQYRILFEESDILVDPTHAVFITMNPGYAGR
                     TELPDNLKVLFRPVACMVPDYAMIGEIRLFSYGYQKARALAQKMVMTFKLSSEQLSSQ
                     DHYDFGMRAVNTVISAAGLNKQERPDGDEDELLLRALRDSNVPKFLKDDILLFDGIIS
                     DLFPGTALPQSDYGAVVQALTTAITEAHQQPVSAFVQKCLQLYDITMLRHGLMLVGPA
                     GSGKTASFTALQRALTDCAARQAKGNDLGARRIQKVFTHICNPKSVTMDQLYGAYDEN
                     GEWKDGVLCVLFRCAARYGDEGNLIGKHWVMFDGPVDALWIESMNTVLDENKKLCLVS
                     GEIIQMSRDMTMMFEVEDLAVASPATVSRCGMIYLDPATCVPISALIASWIAALPPYL
                     ESQRETLKRLANTYVKELVQLVRSGAVHEYVTSTTSGLVHSFFHMMEGYVKSFEVAKS
                     ASGQLQVSPERLAVMAGAVPPLFFFSVVWSVGATCDEAGRQLFSATVWRLAEANGDTQ
                     WLPLLPTEDTSGSGSAELFLYDYAYQYDPAGVMEEDASVAADGDGGSGAPALSPSAAG
                     KWVNWMREQPALEIPNGTRFDDIIVPTIDSTRQNYVLQHLMAQKVNVAAVGPTGTGKS
                     ISLARLVLGGGMPANFLGLNFTFSAQTKCTVLQNSLMAKFDKRRSHVYGAPAGKHFLI
                     FIDDANLPQPEKYGAQPPVELLRQMLAQGGFYNFTGGIKWSSIIDCSLALAMGPPGGG
                     RSRVSNRFMRYFNYLAFPEMSDMSKRTILQAILVGGLAQSGLADRLANVASAVVDSTL
                     RVFRKCTQVFLPTPAHVHYSFNMRDVMRVFPLLYTADKSVLQSEESIVRLWMHEMQRV
                     FYDRLVDATDKGLFIEYLNAELPSMGVDKSYNEVVKADRLIFADVLSDKGVYEQITDM
                     NALTTRMNELLEAYNDENEVKMNLVLFLDAIEHVCRISRVLRLPNGHCLLLGVGGSGR
                     KSLTRLACSLIAEMEVFTIELSKNFGVKEWHESLAKLLLECGKDEKKRTFLFADTQLA
                     HPTFLEDVAGLLTSGDVPNLFEDQDIELINDKFRGVCLSENLPTTKVSVYARFVKEAR
                     ANLHLVLAFSPIGEAFRSRLRMFPSLIACCTIDWFAEWPSEALLSVAAVQLNAGDVTD
                     VMGAASHADLPGCFQAVHRAAAEVTERFFTETRRRSYVTPTSYLSLLSNFKVMAAAKR
                     RFVREQRGRLEKGLEKLRHTEVQVAELEAQLKAQQPVLVQKKAEIQSMMERLTVDRKE
                     AAVKEADARREEAEASVKAEECAKMRRECADRLAEAEPALAEAVKVLSKIKAAEISEL
                     NKYANPPKGVQYVMEAVALLLTFGNCPKEFYSGPPGGRKVPDWWLCAKSYMRDANRLL
                     DLLVQPPERGGFNREAMDTALMEKVRVYYDNEEFQPEKVRAVSLPCMAMCQWVRAMYK
                     WFFVNREIQPLRERLAATEAELAVVTEALRATQAMLDRVIAAVAALEKEHDDALNAQA
                     ALEAEVERTSLKLQRAARLIDGLGGEKGRWTTLVEQYKEQECYIVGDMVIAAATVAYC
                     GPLTAPYRNDVRRQWKAHLTAANVETSADFDLVSTSGDAVQIQEWQLCGLPTDALSTE
                     NAIILANSRNWPLLIDPQGQANAWVRNIHRNDNLQVCKASNDKFMKTVENAIRLGLPC
                     LIENVGESLDAALEPLLLKNIFLIGSTPHVRIGDSAIPYDRSFKLYLTTKLPNPVYTP
                     EAIVTVSLLNFFITPSGLEEQLLGKTVEKERNDLELEKQRLTRSNAEKNCELKDLQAN
                     ILVLLEQAEGDILEQEELIITLEKSKAKSIEINEELGKAKAMETVIDETRNKYRPHAE
                     RGSLLFFCVSQLSIVDPMYQFSLQWFMNLFLNAVDNAAQAPAAKEVAEDDSGTVEDAV
                     EVRVYNLMDYFTYSFYSNVCRSLFEKHKLTFSFYLCASLVQHSGAMVDAEYRFLLTGP
                     TGSVPADALANPASSWMTDSSWAEVLFLSEHLPSFAGFAEHVRDHVEHYKDLFDSNEA
                     DTFPLAGEWGEKATPMQRLVAMRCFRVDKVALAIQHFIEHYMGSRYIVVPQFDLMDAY
                     KDSDCLTPLIFINSAGSDPMNDLLRFAETMRMSKRLDKVSLGQGQGKKAEELIRSARE
                     KGQWVLLQNCHLASSWMLTLESIVESFTLETVKKEFRLWLTSMPSPSFPVAVLQTAVK
                     MTNEPPMGLRANVMRSYYGFTPEDLEQEEKPAEFKKMVFALCLFHGVIQERRKFGSLG
                     FNIAYEFNDSDRNVCLLQLRKFLSLYDSISYDVLTFLTGEINYGGRVTDDWDRRCLMT
                     LIQHFINPEVLQNGYAFSPSGLYYTPEPGSRKHYLDYLDSWPLNPQPEIFGLHENADI
                     TCAQNTTHSILSTVLALESRGGAGTTSSSREQLLTATATEISTKLPQLFDMAAFTAKY
                     PTKYEESMNTVLVQEAGRYNRLLKFIHTSLAEFLKAVRGEVVMSAELEDVGSSFFVNS
                     VPVSWSALAYPSLKPLSKWVEDLVRRVHFIADWYAHGPPAAFWFGGFFFPQAFLTGTL
                     QNHARKVHQAIDSISFQFSLQDGSLDYKTVPRPDKGALVYGLYLEGARWDSEQHSLAE
                     SRPKELYVEMPIILLDPVVNRTRNTNDYVCPVYKTLTRAGTLSTTGHSTNFVLPIEIP
                     TKVEPAHWIERGTACVVSLNY"
     gene            complement(<233391..>237338)
                     /locus_tag="LMJF_28_0620"
                     /db_xref="GeneID:5653268"
     mRNA            complement(<233391..>237338)
                     /locus_tag="LMJF_28_0620"
                     /product="putative protein kinase"
                     /transcript_id="XM_001684288.1"
                     /db_xref="GeneID:5653268"
     CDS             complement(233391..237338)
                     /locus_tag="LMJF_28_0620"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001684340.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653268"
                     /db_xref="GOA:Q4Q8K8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8K8"
                     /translation="MNNYVLNDEIGQGAFSTIYKGRYRTTTEFYAIASIDKKRRERVV
                     NCVQLLRSMHHSNVIEFHNWYETNNHLWIITEYCTGGDMSTILRSNINLTTQAVQAFG
                     RDVAMGLMYIHSKGVVYNDLQTRNLLMDSAAMLRFHDFSLACLFQDAATRPLVGTPLY
                     MAPELFMADRPLYSMASDLWSFGCVLHELATGKPPFAASDLETLLGDILTSPTPAVPG
                     APESFQTLLCGLLEKDPLKRYAWVDVVRSEFWDEPLPLPSNGFPSQVAWEDYKRSRSG
                     RGASQYNWTDSDVRVAVAHAVGAAKSNASTHNVEERERAAATLNVAKELDFTASAAML
                     LERLPERTQERAAHATGHVATAHGSLVHGCPSTASAASNTFNANGSSSSAVASSRRSR
                     LSESKNNGGDPQRHRVSKGRGATSIRTSGSAAIAYEGGCTAYATNTGAKEDRPTEASL
                     HLFASEALRHLTISDLLPHHTDQHIRPLSNNSRIEYTPEPSYDISTLGFTALTAAEIN
                     SLTGKEHTAFFRSLYLALSTLSSGYDNVLNTMNYVISLCGDAEVARASVNSSVMRLCV
                     KHAGRKDAPAGFRTAAALIMGLLVRTTAFITPEVASSSILPDIMQLFEDETDVPVKRK
                     LIACISEFLFYIAVQQKRQRAMWNVQPATVKRIYASALDSDDDVLKHYAAKMIENMAS
                     TPQKEMTLELFADPVFVEKLLAVFALPSAEGRSEDMRSDAVCAALKLAMVKDELILAV
                     MQCKWLPVTSYATVMQRSTLTHTMQILLTFLNYALVKGLVTLQNPFARLWSQASLDSH
                     SSGGSGSGRRGCALTSSLSVEDAEEVVGNALFVSEDLLARLSEAIEQASVAVYGKTLL
                     FVMLIGCVGGSTICQILNSRIVAFLDRLVRDADLYVKRCGAALSAFLGWFVSEKLASI
                     ARRVSSTSTATHLAAIQQLLSNSAVRSGIDFQKDVFQSLSTCIDKAMHNTIYGTYRDE
                     FNTIADRFVESPEEVLRYEENICLYLATSYAEMLRRKEASGRFTAIRFLTSVMVPISA
                     EVTATRKESSGATSAARQVLNAVAPNVTSLLQETSPIPTNTIRLLVTCGEMAQSKLSG
                     LVSEQLLGHIMDYVNESGDGDGIYYPLSFIHLCLLVSQRVDIFNYVVRQGLCALALET
                     LASAAKSRNEPLVEMCCNLLAVVVRRVAGDPSSRVKAQCASCVQEDSIGSVLLPICAD
                     TASSIALMESAASVIEDFVRLSSAARDDLTSASAIATWAGALSNALLSSARRAVAASL
                     LAALSTSCESASRDVLQELKCDSRLMSVLANAADCTHMRLVASEANRILKKLS"
     gene            complement(<240609..>241268)
                     /locus_tag="LMJF_28_0630"
                     /db_xref="GeneID:5653269"
     mRNA            complement(<240609..>241268)
                     /locus_tag="LMJF_28_0630"
                     /product="ER lumen retaining receptor-like protein"
                     /transcript_id="XM_001684289.1"
                     /db_xref="GeneID:5653269"
     CDS             complement(240609..241268)
                     /locus_tag="LMJF_28_0630"
                     /codon_start=1
                     /product="ER lumen retaining receptor-like protein"
                     /protein_id="XP_001684341.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653269"
                     /db_xref="GOA:Q4Q8K7"
                     /db_xref="InterPro:IPR000133"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8K7"
                     /translation="MALVRVVGDMLHLSAILILLSKMLRQRSAAGISLKSMELFAIVF
                     CTRYIDVLFSFIGIYNTTMKIFFIASTLHICYLMKFKSPWKATYDRENDTFRIRYLIV
                     PCVVLSILFHGTPRRSIVIELCWTFSQYLEAVAILPQIFLLEYTERYDALTSHYLFCL
                     GAYRVVYMIHWAIRYYIYHKVRWISVLSGFVQSLLYVDFFYHYVVQVLRKAKQRYELA
                     K"
     gene            complement(<242708..>242914)
                     /locus_tag="LMJF_28_0640"
                     /db_xref="GeneID:5653270"
     mRNA            complement(<242708..>242914)
                     /locus_tag="LMJF_28_0640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684290.1"
                     /db_xref="GeneID:5653270"
     CDS             complement(242708..242914)
                     /locus_tag="LMJF_28_0640"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684342.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653270"
                     /db_xref="GOA:Q4Q8K6"
                     /db_xref="InterPro:IPR008389"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8K6"
                     /translation="MGLFLGTLIFIIIGAIGALSAPLWAKSQVDLVRVLCAVATFCCW
                     LSWVLIYMAQMNPLLLPTRSIKVE"
     gene            complement(<244097..>245002)
                     /locus_tag="LMJF_28_0650"
                     /db_xref="GeneID:5653271"
     mRNA            complement(<244097..>245002)
                     /locus_tag="LMJF_28_0650"
                     /product="putative protein transport protein Sec13"
                     /transcript_id="XM_001684291.1"
                     /db_xref="GeneID:5653271"
     CDS             complement(244097..245002)
                     /locus_tag="LMJF_28_0650"
                     /codon_start=1
                     /product="putative protein transport protein Sec13"
                     /protein_id="XP_001684343.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653271"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8K5"
                     /translation="MWSPVAVLQCSGEEQAATVTCVAWAPPALYTAALVTCTEATNEV
                     ALWCDVGNDAQYRKIYVYTLATPGWCVAWAPHEYGKLFAVGCADGAVVVFTGGPDGSW
                     DIHSFESHPHGCSGLSFAPFFPPGALLMAPLEEDVGNVPGNAPPIPLAPPRMVTCGGG
                     RFVKLWTHSFAPRPGEEGSSVALGSVWTPIELEAAEASSTPAWREVGWAPNLGLPFTY
                     IAAGSEDGLVAVWVQDGPASNPWQCRLLPPPHGTPGENVTKLSWSLVGTFLLVSYADG
                     TVAMWKETSNHGAWRVVSELENPTL"
     gene            complement(<246314..>247336)
                     /locus_tag="LMJF_28_0660"
                     /db_xref="GeneID:5653272"
     mRNA            complement(<246314..>247336)
                     /locus_tag="LMJF_28_0660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684292.1"
                     /db_xref="GeneID:5653272"
     CDS             complement(246314..247336)
                     /locus_tag="LMJF_28_0660"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684344.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653272"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8K4"
                     /translation="MEPRRWRPLFYNPFTERRRRTEYIPLYRGFFRTMPLHRWCIKDI
                     QKTLGYAAVNPSLFGFPDQPTCVVNTAYFLPSLRSRLRGVWVFGTERGCKSIIVPHSC
                     SGEAFDALDARLIEPLFRWNPGIEYVYLSRHCEPMAQQLLGPLSRCHNLREVTLEGWN
                     DAVAVHRIMMACKHADVLETYSLDDPPRNWRNELSVQALSTLIEMHPKLRAVKSHRLY
                     LGDWYEATRFSRCKHNVALIPFSCDFVIVFYAMFLCVVCIPAYGAYRLVYRLCAGRLS
                     DAYTWFWSVIASALTLSAVVAFDSVGRSCRGSGWAHMQKYFIFAKRRVDIWMGVHRTA
                     LVAGKK"
     gene            complement(<249284..>250366)
                     /locus_tag="LMJF_28_0670"
                     /db_xref="GeneID:5653273"
     mRNA            complement(<249284..>250366)
                     /locus_tag="LMJF_28_0670"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684293.1"
                     /db_xref="GeneID:5653273"
     CDS             complement(249284..250366)
                     /locus_tag="LMJF_28_0670"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684345.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653273"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8K3"
                     /translation="MHNLTANGVFQVASQFNLLEFSSSEISPEHGVRHYAHYPTQGPA
                     CASAWMAGTVYRNYLLHPDFFGGTHAAPFMENADVADRGQRTNRQLNMLDDLVEYLTR
                     ARNSGDATSAADAANSTACSAPALLREHFFTICNGYFVQKRQMASLPARLYRIAAVEG
                     ISMADVEEESVSRLHIGLVEVATVTLLLHDPPVSRVREQRQLTDQAERKVVRRSDVDV
                     AAEVEVHEVTQTYNSALSLPPKDYCTPLEWSGIATLSRIILRGTYEATLLAGVQHTLR
                     DLERQASLADASSPATPPFSLPPIFLANVGGGVFNNDKEWIASGIASAVHRVAALSVP
                     LNVRLVHFCQMDEYYMKYFPSWPVLD"
     gene            complement(<251796..>252497)
                     /locus_tag="LMJF_28_0680"
                     /db_xref="GeneID:5653274"
     mRNA            complement(<251796..>252497)
                     /locus_tag="LMJF_28_0680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684294.1"
                     /db_xref="GeneID:5653274"
     CDS             complement(251796..252497)
                     /locus_tag="LMJF_28_0680"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684346.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653274"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8K2"
                     /translation="MEPYYEPDSEFREPLTDVDAFLDSARYNEAGDLDLLKAYLEKNP
                     SDVDARDEQGRTAVHMAAANGHMPILEMLFQFNPQPNVPNDEGNTALHFAALNNRVAA
                     AEALLAHGWRAAEQNIMGKTALQLIYEKQYNEMETLLMSRDETLDTYVPPTQASVMVD
                     LSAKEGDEDEDNEREEKPTVEAKVAAERKTPPAPMAPAKKIVPSASEAPAPVVPVDAT
                     TSTQMLGSASVDSIE"
     gene            complement(<254990..>255895)
                     /locus_tag="LMJF_28_0690"
                     /db_xref="GeneID:5653275"
     mRNA            complement(<254990..>255895)
                     /locus_tag="LMJF_28_0690"
                     /product="putative serine/threonine protein phosphatase
                     catalytic subunit"
                     /transcript_id="XM_001684295.1"
                     /db_xref="GeneID:5653275"
     CDS             complement(254990..255895)
                     /locus_tag="LMJF_28_0690"
                     /EC_number="3.1.3.16"
                     /codon_start=1
                     /product="putative serine/threonine protein phosphatase
                     catalytic subunit"
                     /protein_id="XP_001684347.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653275"
                     /db_xref="GOA:Q4Q8K1"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8K1"
                     /translation="MSVDTIIEQLLEVRGAKPGKQVQLAENDVKQLAIRTREILLSQP
                     PLLELEAPIKICGDIHGQYYDLIRLFENGGFPPTANYLFLGDYVDRGKQGLETICLVF
                     AFKVKFPENFFILRGNHECASINRIYGFFDECKRRYNIRLWKAFTDTFNCLPVACIID
                     DKIFCCHGGLSPELQTMDQIKKITRPCDVADTGLICDLLWSDPEEGLSGWGENDRGVS
                     FTFGQDIVEKFLNKHQFELICRAHQVVEDGYQFFAKRKLITIFSAPNYCNEFDNSGAV
                     MTVDNELMCSFQILKPSVKKPKFYS"
     gene            complement(<258105..>259532)
                     /locus_tag="LMJF_28_0700"
                     /db_xref="GeneID:5653276"
     mRNA            complement(<258105..>259532)
                     /locus_tag="LMJF_28_0700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684296.1"
                     /db_xref="GeneID:5653276"
     CDS             complement(258105..259532)
                     /locus_tag="LMJF_28_0700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684348.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653276"
                     /db_xref="GOA:Q4Q8K0"
                     /db_xref="InterPro:IPR000210"
                     /db_xref="InterPro:IPR003131"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8K0"
                     /translation="MPVTNGKRPREDSGAPVDEAATRDTARCALEAKDAAATPLDRVV
                     VLNVGGTKITTLRSTLCSSPSLLAQWAENNFQEFPRDLQGHPFLDRDPENFVHILNYL
                     RGYGLPNKADDLVVVAEDAELYQLESLKREIGLDPPSMWRFTPGPGIRDDGVEFSTSD
                     ILDLCGTEPLSTGLAHTIVFRVDKCELVSIGVVAFKEIQNDMQIRRQKNTVCYCNTGE
                     LVRYWSADALYEQGVLYKSQDEITVRVEFAQPGIPLEPPSGAKTMEHLPPPLQPALTL
                     SSTPLPASVASTTALSSSSVVPSRPLPLVIDASVAMANASSGAEPPITSPAFQPGSSA
                     MDVASNRPLQQSSSSPMTTPANPTTLPPPQTLGGSGGGTAGTGTATTPTSGPSAAPAS
                     APGVAPASPLLPFAPVVLDPEDPDATVGAIVTFFKGDREVCRARWPAPVPPLQFAVSM
                     QGASAVSILKTTSVSADAVGMENED"
     gene            complement(<260915..>261667)
                     /locus_tag="LMJF_28_0705"
                     /db_xref="GeneID:5653277"
     mRNA            complement(<260915..>261667)
                     /locus_tag="LMJF_28_0705"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684297.1"
                     /db_xref="GeneID:5653277"
     CDS             complement(260915..261667)
                     /locus_tag="LMJF_28_0705"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684349.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0705"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0705"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653277"
                     /db_xref="InterPro:IPR028045"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8J9"
                     /translation="MDPETVLESLAREKGVVLTRLSEINSKYSRSAKVACCGGLMTRL
                     VTESAADSTVLLRDGSGSCYCALHGDITNRYPDVLTTDALLLFTDITVLVISSKVPPM
                     LIACLQNLAGLLLPDKATSAAAAATASRSAAAAGTRPAPARNLLVRGSVPHNDDSARS
                     DTWHSNPLTGRQRGDDAVDTFHDSDGAGDSYMEPRASVGAVLSAQRTLGGQGHDIVPV
                     EKRARTENTTASAAFEVDDEDDAECLELVDGM"
     gene            complement(<262851..>264608)
                     /locus_tag="LMJF_28_0710"
                     /db_xref="GeneID:5653278"
     mRNA            complement(<262851..>264608)
                     /locus_tag="LMJF_28_0710"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684298.1"
                     /db_xref="GeneID:5653278"
     CDS             complement(262851..264608)
                     /locus_tag="LMJF_28_0710"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684350.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653278"
                     /db_xref="GOA:Q4Q8J8"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR015414"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8J8"
                     /translation="MSTMASELEQAQAILASERRSLGLIHRPLRTTLLFLSYSIQGTV
                     HYTEVALSRPLFNTVLLPLMVILCLVSYYIVPSPAAAVFSAFDLNRDGQVTAAEVSSY
                     YTTVLKQRGGGGAEAIAEKILGSRTAVSVDQFSEWWQLTATDGQRYFAAVANGWWREV
                     EYWLADALYWVMLGVLSSIGLGTGMHSGLLFLFPHIYRTCAAVQRCGNANFWTYPTNF
                     FYGPRERLFVCLAPESQPELAASKMSLVEYLVKVVPACMLWGAGTALGEVPPYALSYA
                     AALQGRHEDDLQESAAAYDMISLATNWTLQKVRRYGFWAILLLAAWPNMAYDLCGMAC
                     GQFLMPFSTFFSATLIGKAVIKVNLQAIFFIVLFSGDIIERIMQRLGRSAATLLPSFF
                     QVEAAVEKVLSAVVRARESIAKRAKGGDVSAAALELEGSESLLVQAMNWFVVGSVVWF
                     GKSIIESFARSEQELRDEDTIFELEMALRRRHQSPAPVTASELKEMLAVAQADARCSE
                     GDIAFAAMRYPRLLLAAALGLIAWGLYNHQSRASSLGLTLLLHRYLDNQLSKNAGART
                     GMRRVLRMALVAAVVYLYV"
     gene            complement(<265910..>267592)
                     /locus_tag="LMJF_28_0720"
                     /db_xref="GeneID:5653279"
     mRNA            complement(<265910..>267592)
                     /locus_tag="LMJF_28_0720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684299.1"
                     /db_xref="GeneID:5653279"
     CDS             complement(265910..267592)
                     /locus_tag="LMJF_28_0720"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684351.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653279"
                     /db_xref="InterPro:IPR007146"
                     /db_xref="InterPro:IPR018972"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8J7"
                     /translation="MSRGAKGGKKRSRKEASDNIVEDLDLDIGDAGAYVNDDDVVHNR
                     CSRKATREDGVEEEDMFAVLPSDAHRLDGYGDDENGGYQEEEELAVVTEKGLRKKTTE
                     EDFDVAGVSVAHMSSRRDAAAKKSSLDALDAAPVIEAVERDFAALTTAERLAVLKKES
                     PELLKLLLDLKTYMAEVKTLAQPLHELLYERKVSPSDKNLVSFLETKVQLMLSYCMHV
                     TFYLLLKLEGRKVAGHPVIDHLVEIRVYLEKMWPLEEKLQYSLNRLISGKSTAAAHLN
                     ELRPLQSGEGGAFESSRAMQNTEARERRQQLRHIKEAEELEREEQAAMTRVRTKKASA
                     LNNSNTASSTIAPISYQEDEDQFFSRIAGGADEDGGGDSEVEGEEGLSLMEVLRRRQK
                     KAGDVLGRQRTSKQPSKPAAADSDDGDDEDDLNGMGDVDGDEDEMDLGGADDGDDCSD
                     GDYEAVWEEERARRAAESSRKAAAAAAASARRPAQEEVDRRKVGKKIESHRGLTRARP
                     KDRKNPRVAQRRKYERGMQVQKSQSRSFQPKPEGEYVGVRGMRPGVVRSTKL"
     gene            complement(<268733..>269293)
                     /locus_tag="LMJF_28_0730"
                     /db_xref="GeneID:5653280"
     mRNA            complement(<268733..>269293)
                     /locus_tag="LMJF_28_0730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684300.1"
                     /db_xref="GeneID:5653280"
     CDS             complement(268733..269293)
                     /locus_tag="LMJF_28_0730"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684352.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653280"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8J6"
                     /translation="MMLQHTSLLCRKALQSYPVPPRARNYERRWSSSRTNPYNRMFWR
                     TVLNEDFARPSFWVSDFRHKYLAKHGMDYQGRVPASPAPGMYQGFSDVHKILANHPKP
                     QRESRHLPVMPMTPRVVFEHAQEKRIDYAKKMHRDRRLVEQLRTHEFWGWYMKLQRVR
                     GRWCKEHGVSSRGVYGPAVDAAELWG"
     gene            complement(<270655..>271839)
                     /locus_tag="LMJF_28_0740"
                     /db_xref="GeneID:5653281"
     mRNA            complement(<270655..>271839)
                     /locus_tag="LMJF_28_0740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684301.1"
                     /db_xref="GeneID:5653281"
     CDS             complement(270655..271839)
                     /locus_tag="LMJF_28_0740"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684353.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653281"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8J5"
                     /translation="MEGFAASAYWGATGEVPPREPDDVVSKQPYPFQAEINRKLVLLP
                     KDQTSYPRTLDYTNVGLHLILDDGNSNTGGFNASQLQKLGEGGADGDGLGGTQGQGNT
                     GSRKPRFLTLQTTNQAIPRAFDDGVLDVLRAGQAKEDALKRELDNLEATPYASGVAPD
                     AFCLTSDDYCDFGKMDQSAYRQKDWKEDGDGVYVYKSRYNNVEREGPRRRERTFQTLQ
                     RGRTVDRTQLRRTLEDSHKQALPQGYEPYSAKDWMSTTHREHAAYDVAEARHMNDRDA
                     TVPLRNTHYALSQAQEMTVTQRDARFQTRHDGKWATTYSAGYQDRSAEADVCRKYGAK
                     AVFDIEDGVYTINHEYHHPRGEVRTGETYTPAEMVPGQYTTMYTEPLPAPNSVIGSTR
                     HC"
     gene            complement(<273835..>274050)
                     /locus_tag="LMJF_28_0750"
                     /db_xref="GeneID:5653282"
     mRNA            complement(<273835..>274050)
                     /locus_tag="LMJF_28_0750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684302.1"
                     /db_xref="GeneID:5653282"
     CDS             complement(273835..274050)
                     /locus_tag="LMJF_28_0750"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684354.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653282"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8J4"
                     /translation="MKMISYSVHREEDAFLAKKESNRVLEKELRHEQELRRDTQRQLE
                     ALDEMLQMLHEIREAQSRLGASLGLTL"
     gene            complement(<276113..>278323)
                     /locus_tag="LMJF_28_0760"
                     /db_xref="GeneID:5653283"
     mRNA            complement(<276113..>278323)
                     /locus_tag="LMJF_28_0760"
                     /product="putative DNA repair protein"
                     /transcript_id="XM_001684303.1"
                     /db_xref="GeneID:5653283"
     CDS             complement(276113..278323)
                     /locus_tag="LMJF_28_0760"
                     /codon_start=1
                     /product="putative DNA repair protein"
                     /protein_id="XP_001684355.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653283"
                     /db_xref="GOA:Q4Q8J3"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8J3"
                     /translation="MSTQLLPFQKEGVGWMMQREMSHIGGIMADHLGMGKTVQMIGLC
                     LVSDKVNKGLYSKQIRQRRMLAEGSRLMTVLRQLQRISVVANCSRINRPADDLSLLIT
                     TTADLLKTKQGNYKGVREEINKWLTFAGKFHPSYQKRALDFLDDVERKEFHLINSKEL
                     RTLVVVPAALMLQWKSEIESKVKTSRKITVYLYHGESKLISSTELETFDFVITTYDTL
                     TNSAASAFIPGDDPRTFAFSRKEAGPLFHIQWKRIILDEAHMIRHARTQRWRAVQELQ
                     GLHRWAVTATPLHNSIDDLQNLLHFIGLPRLPVFPGGNAEELLADPLLQRSIAKSLQP
                     AFLRRGPVMMRNGVKEVLVKLPPKTEVVIKQPFSVRESHIYNSILARSRSALATSENK
                     EGVFHIFAMMTRLRQACCHSWISQGRAVQISVCGICKSEASSPVATKCGHAFCHECLL
                     LRFRDAVDGDDIATRIECPACAHTITFSSVFKKTTPNSSQRIAQYKKNEFELSTKLRM
                     VLRSIYDMQKNHPADKMIIFSQFTSFMDVISVALDRYNIAFLRIDGTMSLSNRNAVIR
                     QFQTSEHIKIVLASKTATGVGLNLTAANHVVVVDPWWNPAIEEQAVHRCYRIGQKKPV
                     YVTRFIIADTIEQYCYEICQRKKEFGDAVLRAATAGDSGAKVAASRLRELMSRLKYVG
                     DGEQEDSATKASDDARDGDKGAQQEPSATENEGSHNREFSSLHSHDDESETTVV"
     gene            complement(<279049..>280473)
                     /locus_tag="LMJF_28_0770"
                     /db_xref="GeneID:5653284"
     mRNA            complement(<279049..>280473)
                     /locus_tag="LMJF_28_0770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684304.1"
                     /db_xref="GeneID:5653284"
     CDS             complement(279049..280473)
                     /locus_tag="LMJF_28_0770"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684356.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653284"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8J2"
                     /translation="MALSPESADLNIEKPVILAYHRQADFAAFLVNEYFIKPSKQLEE
                     ARQDDTNGLLPLVSLDCLLQSGDIDKIVGHICEVTHLIDERHVQQRKPFRILEKPLLI
                     PAMLAALLHRILFEKVGVFISSTTFDLWASTALGFPARTSRLWLDACAKVEEALENSS
                     VKQLLCKRSASDTGIHAIKKQADSKGALFSLWCSACSMLCASLATPLLSIEACQEHFS
                     QAVERSISFRKDIESKGSSTLYGKSAPGFNLHAAGEPELCSCLVFHSFFRQLEMLFHR
                     AIDSKVKMNVSAHISFAVFVGCLNVFTYYRYSASKAESMYRLLDTVAQVADGKSLTHQ
                     FDLKSVEVRHLSRYVQRASVLSSDDVFSEISHRRARKESWASPASVLPRFAEMNYSTI
                     CMTRIYPFSMVAATGPELDDMGGCSDSTDVGVHPECEDDENFVEMTTIFLDESGDERC
                     TQYILSAEEAAVKRQVQEKLYGEK"
     gene            <281564..>282136
                     /locus_tag="LMJF_28_0785"
                     /db_xref="GeneID:12983025"
     mRNA            <281564..>282136
                     /locus_tag="LMJF_28_0785"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722022.1"
                     /db_xref="GeneID:12983025"
     CDS             281564..282136
                     /locus_tag="LMJF_28_0785"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722070.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0785"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0785"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12983025"
                     /db_xref="UniProtKB/TrEMBL:E9ADJ8"
                     /translation="MSYMQNSCSTSQDKTDMFVTSLDVFSRRAYFDPCTTHADIDVLP
                     AIPTLAKAQIDKSPVGVAFHNARTLDGGTEQSVTFDESAVSKVKRFSTLSAFTAANSV
                     LDFLKENLGGVVLPDDGVGKDVLFERRRSFFDSLFTIEEDMQTALPCRFSTNEADNVF
                     RSAADERLSSTESYRKRLAALENLRATLDC"
     gene            <282705..>284072
                     /locus_tag="LMJF_28_0780"
                     /db_xref="GeneID:5653285"
     mRNA            <282705..>284072
                     /locus_tag="LMJF_28_0780"
                     /product="RNA polymerase I"
                     /transcript_id="XM_001684305.1"
                     /db_xref="GeneID:5653285"
     CDS             282705..284072
                     /locus_tag="LMJF_28_0780"
                     /EC_number="2.7.7.19"
                     /codon_start=1
                     /product="RNA polymerase I"
                     /protein_id="XP_001684357.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653285"
                     /db_xref="GOA:Q4Q8J1"
                     /db_xref="InterPro:IPR002058"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8J1"
                     /translation="MGYDMSIYIFGGLVTTGLFEVGGDVDFVGILDVEPGFAEAGEIL
                     RRSSSELRRLGLRSRAYPKARVPVIKTDRVSRSLPGSPFHSLSCDGIFQFSRQVNAAE
                     AESFRNRVETNYHATSVEWNSSYQFATVQFATTSSLIYGLANLKAHNEVEIPLRLPVD
                     VRYGPEVYRFPFDFCLSSTGLRSSHVLGEALAQYPFSRHLLLVLKKWGRASGIINSID
                     GLLASYALTVMVVHFLSLVKAIPKVTAAKLNEGPKALSHNPQYRPLEDVRPDAMAEVG
                     YLLATFLEYFGCTFDYQQSVVCTTNMALTKVSMGWDRDNNAIGKPPFFHFAIKDPYGL
                     DNVARNLDLESTVYVQKAHDLAVKMVMEEFNDPTFLVSALTKDPLKPPRVVRSLSDRG
                     IHSECIPSDQLEARHVLNKLQFQQRKRSMEDFGERAVKNKKNQSTASDVTKNVLGWIR
                     NDGVL"
     gene            <284515..>286404
                     /locus_tag="LMJF_28_0790"
                     /db_xref="GeneID:5653286"
     mRNA            <284515..>286404
                     /locus_tag="LMJF_28_0790"
                     /product="putative dual-specificity protein phosphatase"
                     /transcript_id="XM_001684306.1"
                     /db_xref="GeneID:5653286"
     CDS             284515..286404
                     /locus_tag="LMJF_28_0790"
                     /codon_start=1
                     /product="putative dual-specificity protein phosphatase"
                     /protein_id="XP_001684358.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653286"
                     /db_xref="GOA:Q4Q8J0"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR020422"
                     /db_xref="InterPro:IPR024950"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8J0"
                     /translation="MESILASLQWESETLPLPGSHSTVPDDDFPPWKCISEVIPGLYL
                     TCASEVADKRKCAAMGIALVINVCGEDDVTKYRVFEKDESAAYAFRRLDSQESFVCEL
                     SSYCRFAVNTPKAQRKVFVVTIPAEDAPTYRIDQHFVECAVLMEIVLRSRKGYETVSD
                     EDYTTVPAVAVHCMAGVSRSASIVVAYFIKKYGLSQDDAISLIRCTRPVVQPNPGFQR
                     QLSMWVALRSHRIVDEWTAKVLAVEIKTKSNLVELASTMLPTILRVKKCENERRYFGS
                     LIKNAAPSEAELHAVYRELRSVVAADADSEVYTDIPNYFGYVAEVVCSIDCAAPAVLQ
                     YATDFRNSLVCNDAFYYRVVKDVARSGFEKDTFDTVRGFCSLFEAIYVKHLCARDSGH
                     PAALNPSAGDTGLPSACALSFPFLFLVAPYAEGFVQFSDWNALVNEFATTGDALSATE
                     LRRLKNETVRMFLQFFFQSSRAAEGSAATESYTKLGFLQNDVEVVTFRAVESDLKTGG
                     GFIASLESFVAVSQSVDEHVAFLLLCKTLSGILAFRLLLEAAEQFLSQTYGERLGESV
                     SLADELLPLHVISAAALSLESAYTAVHCKPCKAGDFFRGELSSLLETGVLNPAGVVSL
                     FQAAP"
     gene            <287077..>287541
                     /locus_tag="LMJF_28_0800"
                     /db_xref="GeneID:5653287"
     mRNA            <287077..>287541
                     /locus_tag="LMJF_28_0800"
                     /product="calmodulin-like protein"
                     /transcript_id="XM_001684307.1"
                     /db_xref="GeneID:5653287"
     CDS             287077..287541
                     /locus_tag="LMJF_28_0800"
                     /codon_start=1
                     /product="calmodulin-like protein"
                     /protein_id="XP_001684359.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653287"
                     /db_xref="GOA:Q4Q8I9"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8I9"
                     /translation="MPAGFNDACSAFFRKHFDMFDRDKIGRARNEDFATLIRACGAAP
                     LEASIGDLLAIADPSHRGSFSFDDFCAALKKAFAVSISPQEVREAFQGFDPDKRGLIS
                     PHELRYFLTTLGDVLSSEEMNEFVEEMRSEMDIEGNLVVADSIYKMTPEMFR"
     gene            <288536..>288985
                     /locus_tag="LMJF_28_0810"
                     /db_xref="GeneID:5653288"
     mRNA            <288536..>288985
                     /locus_tag="LMJF_28_0810"
                     /product="putative RNA polymerase B subunit RPB8"
                     /transcript_id="XM_001684308.1"
                     /db_xref="GeneID:5653288"
     CDS             288536..288985
                     /locus_tag="LMJF_28_0810"
                     /EC_number="2.7.7.6"
                     /codon_start=1
                     /product="putative RNA polymerase B subunit RPB8"
                     /protein_id="XP_001684360.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653288"
                     /db_xref="GOA:Q4Q8I8"
                     /db_xref="InterPro:IPR005570"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8I8"
                     /translation="MSANPVILEDTFTVNGVNTEGTVYLRVSRIRCVNQDGSLTITTD
                     INSEEFPVSTNDRLTIVLANSLELGGKTGSKYYDHSVYHRETRLNDCDYAMHGRVYGH
                     EVVENGLEVNVHISCGGLLVNIVGKPQGLRDVHYNSDVYILIKRVKN"
     gene            <289784..>291298
                     /locus_tag="LMJF_28_0820"
                     /db_xref="GeneID:5653289"
     mRNA            <289784..>291298
                     /locus_tag="LMJF_28_0820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684309.1"
                     /db_xref="GeneID:5653289"
     CDS             289784..291298
                     /locus_tag="LMJF_28_0820"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684361.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653289"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8I7"
                     /translation="MQMRSSCATGALLNAVIAQHSSSSTNATARLYTSNFGKAKADAE
                     PLDAEQPSDHSDRASKGPLSSSAPSQPPQRYRRRSSDPQTPRERADFRRDYKYAKHRP
                     LPDAPWRQLKTKTYLDDAERLYGRKETWHTVEDATLREKLVAILQDYLRDTLAAARLE
                     AKDARKYAFLCSTAAKHYRAHVSSGAFGLPEGLQEWARGVVAGRASSPSTSKSSTTLS
                     TTPEMEEGDAHAEGVSQGAGASFVPSHTAAADEHHGDSAAASPSQEEHDAARFREERR
                     RRGAEANLANTVAMAGLPDADSRHSPHSAFPFLRQRAVEKETTLDPSLVDWTAKYFSE
                     DDASTFAEPPRLRAGMLEDEEGTVSDREATGDGRQEEGASPLGILGAAKGRRPSGFAP
                     PMLPVAHRSASMHARHRLGRTLRDHENRHRATFDAEGIYYKVRRQSEVEERAPKPQQV
                     RASDLEPLGRQVDVVKVPWSVAAKAKAQGYSSDTLRAKERLIRLTRGEDPETIP"
     gene            <292501..>293262
                     /locus_tag="LMJF_28_0822"
                     /db_xref="GeneID:12983026"
     mRNA            <292501..>293262
                     /locus_tag="LMJF_28_0822"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722023.1"
                     /db_xref="GeneID:12983026"
     CDS             292501..293262
                     /locus_tag="LMJF_28_0822"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722071.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0822"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0822"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12983026"
                     /db_xref="UniProtKB/TrEMBL:E9ADJ9"
                     /translation="MIAWTRRHHARCASLLRYRGEVVHFSADAQTGLVRLVACLCDST
                     AATSSGAGVAAVRDEKVRLWHQDACRAQCVPFSSQQAFVSAAPWSADSTQDEDVLEAT
                     AACMFPCYISCGCPVVVQVSPGPQHNSNASEAEAKSVSSAPSSLHVRRLYVHNPAGSK
                     QGTHDAHTASYYARLPDASFQCWQEHSKVVDGILDVCKGRPDSHLHKRFMGLSSLDVE
                     VLELLNLSKTLGCATGGSGTASVDFTRNTCSEAAL"
     gene            <294475..>294903
                     /locus_tag="LMJF_28_0825"
                     /db_xref="GeneID:5653290"
     mRNA            <294475..>294903
                     /locus_tag="LMJF_28_0825"
                     /product="putative RNA binding protein rbp16"
                     /transcript_id="XM_001684310.1"
                     /db_xref="GeneID:5653290"
     CDS             294475..294903
                     /locus_tag="LMJF_28_0825"
                     /codon_start=1
                     /product="putative RNA binding protein rbp16"
                     /protein_id="XP_001684362.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0825"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0825"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653290"
                     /db_xref="GOA:Q4Q8I6"
                     /db_xref="InterPro:IPR002059"
                     /db_xref="InterPro:IPR011129"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8I6"
                     /translation="MFRVSSVSRIAPSLALLNTGKVVSWMSGRGFGFIEDNADKKQHF
                     VHFSALQTETGGYRALAVDQEVEFEVASQDGRTRAENVTAPGGGKLPSGPRPPEGSPS
                     GRGGFGGGRGRGRGGRNNNRQDRGGDRDGGRQNNNFSDEF"
     gene            <298263..>299861
                     /locus_tag="LMJF_28_0830"
                     /db_xref="GeneID:5653291"
     mRNA            <298263..>299861
                     /locus_tag="LMJF_28_0830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684311.1"
                     /db_xref="GeneID:5653291"
     CDS             298263..299861
                     /locus_tag="LMJF_28_0830"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684363.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653291"
                     /db_xref="GOA:Q4Q8I5"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8I5"
                     /translation="MPLPGALQPWHVHSEKLSRIPMIPVLAIKHPEESYSTSQATVNS
                     TTTFLPSFTSAQTPDDMGKRGGSAAALAEANHLGERYSSSNGSTSVSDDGQCSGETAA
                     VRAPLHYHENSDSCLCPMCKLTLYVSHVYRDQRRASPHVMAARPSPEYVMAPDGSLPL
                     LTPIYKPDGVSVCPVYAAFGFCPFLSGCFLPHDEGSCACARVPRLTSAEEELKRLTQR
                     ARELQCSDVWVCEVCGYSHVDEFCEVALGTEHYFRQCPRCTLMCFFPNITYLVEHILC
                     SVGDDYQLFKTEVDRYRKLLPDLFKIPLTFEAHRVANIVFAWSLLSPVHARDAMNSVV
                     REFPNVESIISVGSGAGYIEHIFNRVMHQVPLREEWAVDRERFPTTSFDDVRCDFYGK
                     RTIPIFAFDALALQRTYSVHVSIGGPISLYSLNCKQSVLLLCWPPFGSREREESSMGF
                     EALEYFTREGGSMLIYIGDTAATGDWRFHMLLKSHYKLLRDYPVRRELRRWCPQEMGF
                     VYGGNDTIGVYRLRETPLSSVGFS"
     gene            <305384..>305917
                     /locus_tag="LMJF_28_0835"
                     /db_xref="GeneID:5653292"
     mRNA            <305384..>305917
                     /locus_tag="LMJF_28_0835"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684312.1"
                     /db_xref="GeneID:5653292"
     CDS             305384..305917
                     /locus_tag="LMJF_28_0835"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684364.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0835"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0835"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653292"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8I4"
                     /translation="MNELEYFVLSTHGKRCDIMRYMQQLRDLDEWIEYHLSHLRSIAA
                     ERVAYQKAQARQKQSVNCGGTRGRGCRGRGRGQASAAAAESTLHAHHVHDVDASPQEE
                     GGGNNGDADTVAGAYAAELHRQFAWHETCVQRRCHEREALAAELAERCSEVQLSMASR
                     LANFAAVADVPVTELSG"
     gene            <306622..>309231
                     /locus_tag="LMJF_28_0840"
                     /db_xref="GeneID:5653293"
     mRNA            <306622..>309231
                     /locus_tag="LMJF_28_0840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684313.1"
                     /db_xref="GeneID:5653293"
     CDS             306622..309231
                     /locus_tag="LMJF_28_0840"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684365.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653293"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8I3"
                     /translation="MRLPEGTSHTVARGTCATFHRAFPSQTCRQAPTPPLSHTATHIS
                     DGSTTASRYGLHTRCRQQRLFTGALFPEALNDQLAAFARRHKLQSDVWVPRKAFDTAL
                     KPYNVYILPRATLCDLTLSSGGGMGDVTAAIGIDRCLVNAEQTSNQHLLEGFVDFMVS
                     CLTPPEQLSTRIQIQSFPPAATAGTQVACRTAAALPLSGRQTQRKNSSEYFSAASGEC
                     TTPLLAAAADSSPSPALLPDPTWDTLAPFRHPLALNGSLLVGTDTTAQLLKWQQESYK
                     WSNYWGRLRGASWRRQSLYSVCDTEVPGRYNPFFCVRYAPHTYTNLIFPLATAVLMRH
                     RAVEHKYVSRLWLTLKQAEELFGTSLLPERANDEPVVYCNHFTAGMEATAFYCADQFV
                     GGNTIFPTARDLDIAAKGVRLPSAKLRAYPLLARLLDQYDEGKTTDGASDDRPGTDQT
                     MPDAGRHAEFFQHRQRCGAIRLHGFWKQEAERNYLQSTRMAGTLARQCLLCDYPRPLF
                     FSHRALLAFDLRLREGEQGIVQTRLPVRVNKLLAWCKGECWFNVSQLREPAVAQELMD
                     HPPVHFLTRQSLQGAVAVNCCRAQLARRCDTAAAAVPSSSPTSSVPARCNFSAEWIPA
                     YVLDMTGWRLREGAQGVPYVSLAAGAAFKSFPLRDNILFSMADVSLHDAAKDWLRRYT
                     PVDQEGYPFLRGLRQAMTLRAFERGYRSHHWLIHRVRKNGDFSSPLLALRGAFKPVCM
                     SASQPLLTTSAFAKAPFVRMGNFEFVNAEEVAWMGRTHPWKGAAARESGAEEPDAPLL
                     QMSGGARFQVKPGVGMSAESLLRHSVRETDNAAALGDTATFDRRDVGEVDDCREVDEE
                     WTSGDLSRLLYVQ"
     gene            <310826..>313735
                     /locus_tag="LMJF_28_0850"
                     /db_xref="GeneID:5653294"
     mRNA            <310826..>313735
                     /locus_tag="LMJF_28_0850"
                     /product="putative minichromosome maintenance (MCM)
                     complex subunit"
                     /transcript_id="XM_001684314.1"
                     /db_xref="GeneID:5653294"
     CDS             310826..313735
                     /locus_tag="LMJF_28_0850"
                     /codon_start=1
                     /product="putative minichromosome maintenance (MCM)
                     complex subunit"
                     /protein_id="XP_001684366.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653294"
                     /db_xref="GOA:Q4Q8I2"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR008045"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8I2"
                     /translation="MRPSRDRDAARRKRRRAPEDEVDATGPHPPRREEVEDDDDADHS
                     SGDEANDEEGEDLYGENFMQDYLQPDEESEVAEDEVGEDNDWIADDDSSVSEISEGGR
                     IAVDELLERRREKEEALAEERRQLQEGIFSDVDDDDDDDASWASEEGAGGLTRIRGAA
                     AGDQGGDIDHGEDAGYGDPNDEAYVRGDLEAMNFNWRQPQGELVEWLAQELPRRVIKN
                     RIYNFYYNYIVNDVSVYEEKVNAMTRENDKSFQLSYDHLSRVYDSVLALWLVDAPDPM
                     IELLEEAANYFTFKVYPQYRKVHSHIFVRICDLPLCDPIRDFRQVHMNVLVRVEGVVI
                     RRSPVYPQMDAVKYDCARCSYIIGPIYQRGDKEQRVSMCPSCHSKGPFRVNMRLTEYR
                     NHQTIVLQEPPGKVPPGRLPRSLEVVLTNDLIDRAKPGEEVDVTGIYRNNFDPLLNSR
                     QGFPVFTTVLHANNVIRRTTELGMLRLPDDERQRIIELSKSPNIRKKLLQSIAPSIHG
                     RDDIKLGLLLAMMGAVPKDIGGDQSHRIRGDINVLMVGDPGCAKSQFLKFVEKTADRT
                     VFTTGRGSTAVGLTASVHKDSVNGDFVLEGGALVIADRGCCLIDEFDKMSDQDRTSIH
                     EAMEQQTISVARGGIVTTLSARCCIIAAANPMGGRYDPSTSFDANVSLTTPILSRFDL
                     LFVVRDEVNVELDERLATFICDSHMRNHPRTQEETRLLQRDRHEELSRLRYALENATT
                     EGEREECEEQLRRLRESLEDSSRFEDDDPDSDKPLPQALLRKYILFAKSHCFPRISNI
                     DPDTIARLYVELRQESKHGGIAITVRHMESVIRLSEAHARVHLREYVTDEDVTAAVSL
                     FLRCFIQTQKYSLRSAMEARFRKFLESDTESLPLIRHRIKVAVQTVRQFERQLSGGVE
                     PTQVRIDVSELDYYTANVSQEALNAFYESAEFRREYRLIRDPVTHAPLQIEHSLA"
     gene            <314479..>315993
                     /locus_tag="LMJF_28_0860"
                     /db_xref="GeneID:5653295"
     mRNA            <314479..>315993
                     /locus_tag="LMJF_28_0860"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684315.1"
                     /db_xref="GeneID:5653295"
     CDS             314479..315993
                     /locus_tag="LMJF_28_0860"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684367.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653295"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8I1"
                     /translation="MSGNSFHAFLRRLFLLLTPVMHAIEVELLPGSAVKCVSACVEHR
                     AADAEQDTDRLSRDQYYYNYASCPIMFPKSLGASDASPMAPASTAMGGLQEADASSLS
                     SRLLLEMEVDTILRGDHSSERGSSPPRSCCDSICCNSAVQQTALRAGIVEPRLAKSNS
                     SKVHSATEVIGESTTPWRDSSENACHAGPGCTLSLRPPPPLSYVTSRSSTCTGTQASA
                     RVASLSAAATAPAASSTKPDDARVGPPRVSTAPQPCLPRGWRAVIQESIARFLTVEEA
                     TASDASRAACSPCTSSSPVREASAATVASSASSPLPRAPAGEEENSEKHCTARLPHKT
                     AATVDLRPRNALIAPLPVNQTRAAASRSRVSKRTFSDSSAARGAAGVGSGQRDGLTTL
                     VAKRDVTPKTDAARLSSPLAEPARTMITSRLSYTEPKTSAPLDTAATMLAEGPLDAVE
                     AHIFNEAVVTVTCATCQQSIDIFALRPAGTELPEVCYCPLCGSPCTWTVCFETV"
     gene            <317024..>318760
                     /locus_tag="LMJF_28_0870"
                     /db_xref="GeneID:5653296"
     mRNA            <317024..>318760
                     /locus_tag="LMJF_28_0870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684316.1"
                     /db_xref="GeneID:5653296"
     CDS             317024..318760
                     /locus_tag="LMJF_28_0870"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684368.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653296"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8I0"
                     /translation="MLLSAVTGRLYGLAKGLAKVYLHNETVDLALEMLLADSIPGAAE
                     AFIGAASADGRALSMDFVVVLGALITLVALSSCLVRFLCWLCIGTLITASSIEKIHVR
                     KKGHQIQSQREPAEHKRRRNKVEGKASVPAEQNLQQASEVLSKMHPKQESGAAKSGGK
                     GKQGAAGKSKESAIAAPPQQQLLQQQEAEFTATSRRTPQDTRATPKSILRGFPEVDIL
                     LTSPGQSYLLIGCRSKRKTSLYPQSDAAAFMERGKELQERHFTDMNAVVTTAVGLEKK
                     AEIYAAQFSMDDTRLVAGERFTDTFVCFLVSGRTNVCLTQLWSMKLPDHRLVSSVPRW
                     SVLGQDSLLSIVDQTAEVEVITCGAAETSTAHKGKFKVGSALAWAVCDDRIALGGSFL
                     REPRLSRVVQRAGGGGITLEPVVVLPNAAKLRVSALAFVAPGAPAFNTRSYMIVFLEN
                     GIGTIYGVQTPSTQNTPQVVSTFADTDYAGHRVDAPLCILTAVRGQAYHEVLRIALLR
                     GPNVTVYEQSGKADGGNFQMVRVADLYDVQEGDTVKHATFLQSGLGLATSGHADGRHV
                     RMFTLPSPGKAA"
     gene            <320363..>320893
                     /locus_tag="LMJF_28_0880"
                     /db_xref="GeneID:5653297"
     mRNA            <320363..>320893
                     /locus_tag="LMJF_28_0880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684317.1"
                     /db_xref="GeneID:5653297"
     CDS             320363..320893
                     /locus_tag="LMJF_28_0880"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684369.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653297"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8H9"
                     /translation="MKAKLNAVPRKARKSISFNANRNKVRFIRVPPRSQNGKFWFTET
                     QRIVKKGLNFEVEPEIMIEVNIECRMQITALARRPLSQLGKAPAANGIAGAAASSSAA
                     SAAKRSYIEVEETVPLFLPDARKRDRWQCIGSVGAGEMSKARVVMPPGSYRMRCNGGD
                     VVQIFAQAWDIERELI"
     gene            <322440..>324839
                     /locus_tag="LMJF_28_0890"
                     /db_xref="GeneID:5653298"
     mRNA            <322440..>324839
                     /locus_tag="LMJF_28_0890"
                     /product="putative ribonucleoside-diphosphate reductase
                     large chain"
                     /transcript_id="XM_001684318.1"
                     /db_xref="GeneID:5653298"
     CDS             322440..324839
                     /locus_tag="LMJF_28_0890"
                     /EC_number="1.17.4.1"
                     /codon_start=1
                     /product="putative ribonucleoside-diphosphate reductase
                     large chain"
                     /protein_id="XP_001684370.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653298"
                     /db_xref="GOA:Q4Q8H8"
                     /db_xref="InterPro:IPR000788"
                     /db_xref="InterPro:IPR005144"
                     /db_xref="InterPro:IPR008926"
                     /db_xref="InterPro:IPR013346"
                     /db_xref="InterPro:IPR013509"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8H8"
                     /translation="MSDSAPMIIKRNGEAQPYDASKIRRRFERVMEGLDRDHLDVDML
                     TENVTRGLTDQIRYDKLDELVAQTAAYSVTKHPDYGRMGGRLCTTSLHKQTNESLLET
                     FRLLHSHVTVQTNRPAPLIADDVWEVMKQHHAELQGMIDYSRDLNFEFFGYKTLERSY
                     LLRIETGRGEMRIVERPQQMFMRVALGIHGADLKNVRETYDLMSKGFFTHATPTLFNA
                     GTPKPQMSSCFLVASKEDSIDGIYDTLKECAVISKAAGGIGLHVHNIRAAGSYIAGTN
                     GTSNGLVPMLRVFNNTARYVDQGGGKRKGAFAVYLEPWHADVFGFLLLKRNTGKDDQR
                     ARDLFYALWIPDLFMRRVKSEGKWTLMDPNTCPGLSDCYGEEFERLYERYESEGRGVK
                     TIQAQEVWFAILESQIETGGPFILYKDACNSKSNQKNLGTIKCSNLCTEIVEYTSSQE
                     TAVCNLASIALPRFVEVEKRELNHQLLYTVTKQITRNLNRVIDRNYYPVETARRSNMR
                     NRPIGLGVQGLADAFILMRLPFVSAEAQRVNAEIFETIYFAAVESSMELAKEEGPYET
                     FAGSPASEGILQFDMWKNARPNSGRWDWASLKEKVMQVGMRNSLLVAPMPTASTSQIL
                     GNNECFEPFTSNIYVRRVLSGEFPVVNKYLVMDLIARGLWNESMRNEIISYNGSILAI
                     NGMPDDLRELYRTVWEIPQRKLIDMARDRGQYIDQSQSLNLFLQSPTSGQITSMLFYS
                     WEAGLKTGVYYLRTKAAADAIKFTVDAKRMKEIQERETSQQTMSSHRASQPEECLNCG
                     S"
     gene            <326785..>327657
                     /locus_tag="LMJF_28_0900"
                     /db_xref="GeneID:5653299"
     mRNA            <326785..>327657
                     /locus_tag="LMJF_28_0900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684319.1"
                     /db_xref="GeneID:5653299"
     CDS             326785..327657
                     /locus_tag="LMJF_28_0900"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684371.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653299"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8H7"
                     /translation="MSRRSHSKPAEAAAGVPPTKTIAQLRMEVDLLENAIKDRKLLFL
                     DLCEQRSASAAADEDATRVTPPEDPLEEARRLASRNALLRDELKVLGAIERQYANDPR
                     VRDKRNEVRLVQMQIAQVEREVDTLQMVKKWRDEGLRAIGRTEEQTRRMRGQQNEMNS
                     HLREEVRQRMEELRELEKTDMEVHTRFVRLQDQVKLSVTDADVQQLRQTLEAQNAEIE
                     NLSSKEATWRKQRASVREEDYRVVAKHSGECAKLAEEEERLQELLRQKESELKRSYYL
                     LKRYGTAPRAPMSD"
     gene            <330108..>334523
                     /locus_tag="LMJF_28_0910"
                     /db_xref="GeneID:5653300"
     mRNA            <330108..>334523
                     /locus_tag="LMJF_28_0910"
                     /product="endonuclease/exonuclease/phosphatase-like
                     protein"
                     /transcript_id="XM_001684320.1"
                     /db_xref="GeneID:5653300"
     CDS             330108..334523
                     /locus_tag="LMJF_28_0910"
                     /codon_start=1
                     /product="endonuclease/exonuclease/phosphatase-like
                     protein"
                     /protein_id="XP_001684372.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653300"
                     /db_xref="GOA:Q4Q8H6"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8H6"
                     /translation="MMPRSDGEAADGSGTVGSTHSSGHQNRVCVAPQNPARSLTIMSS
                     STNVFSLVAATPDVNISDYQPLQAPRTTTVHHVTMSNGSGPPLQRTSASEFSSLAGIR
                     SLRSGANTSAASEDQPLPMLTMLPFSSASSVTKSAGSTGVGVESGTGGSGAATTGAAA
                     TTASIGPGTSSAGRSMTLLERRNNRERSALSLSCLSGLNVEKLQESMREASLVLNSQE
                     TPEPVLQGWSKTVASAALLSDYAMPSVCASPPGARDVPHSTAAHSARQATAKFQGQAP
                     RPPSSSEDSSGPRRSHPISTSESRTIDAIPGALKVISYNILASRLASTDLYPACPPSV
                     LSEEYRLDLIKEELRRVDPDILLLEEISVAAHERTLGPYLRTALGMEGHHVVITDRNG
                     APRCAPLTQQSKAAAAFSPGLAAPFGIPCSAEKRPNSVSMTATLAGAAACNSDASARR
                     GAAGGAANSPGDGDRRSNSPHLPQLAETSWSRRSSRRSSVVAASRFPVSSCGTPAISQ
                     KRGEALPFQHPQPFSMPPQEMSCSLLEDPQVQPKAMTDEESMQRSCSAVEFTQGAAAR
                     VKRQTMGSGAPPAVLRAEKATEEALGHRRVEMDGVSIFYKAARFRELEVMPVLFNRLA
                     AAEKRLTRYEHKKLQVDSHNVALVVVLQDTQVIGVSRIYVVAAVHLIWQRVNAQLWQA
                     HQLLRVMEGLKHKYCKGYVDLVYPSGRGSIACDSAVTLPPSIIDTPLMREGTRRHVQD
                     DVAPQPLLPTPLPLQQPRALSARCQSIVPSRTTTEASDPAGDSDGSRLFNAAATDRMR
                     CRYASVCSGVASSPTSSVTCIIGGDFNAERSGPVMEYLLTGRVPGGAEVMEYWRASKS
                     ESPVPLDRTDERGTGRATARDEVNALRPTPPSPSKVPPPTLCGVLSPARQMMIRISPH
                     NSMHSSLSSIDSPPSVLPRRATKSPPRNSVSDAASAAATVIGTSDGLCPHQPYTPLSK
                     RPFDLYPTRVSDGVLSPHNRADNPLQCRRDLAKGTTVAAPTSPRRSASTPSPQPAEDG
                     LRYNPGSTFPTLLSTSSSLIDTPSCGCDDGRGGGSNLAAVAASSSQHALCSASASPAR
                     CCSSDAQLPLLRPSMSVNRAFTVHAASPASAPQTSPSPTRRNGGSATIPENHRAYTRR
                     RTLPDMSNIESNALEHSRSRSGSESGSVLSTAFPTSCAMRLAVHTRHDTLSVELGEPD
                     WENEESRGRSPMLEDATDGASSAQPSPSHDHHEGVGGAGGVVEKGEVNAKRRHRIQAL
                     KNFAGADGGGSGSNASASSNHGSAMGDHRLSMYGDPVTPASPRARRKRRPAVAASRDG
                     APTPASPQATRHFSSQAAPQSSSAADYDFACSTVSTSPPVSLLCLPTLIANSAYTPSS
                     PPVVLIDDVVHKIRLSDAYAPYCYRHPSYVSAVNPSTNMEGKVLDHILYEDEHVVCGG
                     VLRLGERQELPNARVPSDHYMTGSVLIPIQELHRA"
     gene            <339856..>340425
                     /locus_tag="LMJF_28_0920"
                     /db_xref="GeneID:5653301"
     mRNA            <339856..>340425
                     /locus_tag="LMJF_28_0920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684321.1"
                     /db_xref="GeneID:5653301"
     CDS             339856..340425
                     /locus_tag="LMJF_28_0920"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684373.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653301"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8H5"
                     /translation="MFSTNTVLWARALVDRKSPQLWGAPGAPIIRMRGHHVTWKFQSY
                     DMFVEHTHRRRNSDIRLLHYLGKHCPHPQKSLWSPDTPVTQDRHLFMLTTIDVDAFKY
                     WFGVKRCRLSVGPWNILAKSGLLPPSYKQNSKIMPKPIFDKEQLMRYYLANRKDQRQM
                     EREDYLNYKNSMVKSPEERAAERPVAPFL"
     gene            <341650..>342885
                     /locus_tag="LMJF_28_0930"
                     /db_xref="GeneID:5653302"
     mRNA            <341650..>342885
                     /locus_tag="LMJF_28_0930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684322.1"
                     /db_xref="GeneID:5653302"
     CDS             341650..342885
                     /locus_tag="LMJF_28_0930"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684374.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653302"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8H4"
                     /translation="MESPISPAVWKVLFNAALGTLSVATLYSVYHQRYDMESAQRAAF
                     LELRKADSEEARVAKLTELQAACKPEVVRRQPSARMSALKYGAPIVQMAKLQKDGTNV
                     ESVRTAIKVILYIYGPDADGRQKLNSLDGYKTLLATLSEAQRQGEADLMEDVAQALDA
                     LTEVDDSEVVLDTDVPKGSEGTATLARLPATVKMLRILDPEGSVTFLASLTGIFANIC
                     TLAEGAANIGRGVDGHSGMSFFLRLLDHTNRRVVANAVTVVRFLARAQVCQEELIEEE
                     NLTRLADNLHVTGEPVVVNSILTVVLVMAGSKKYGEAFFSGVASSTIPSTLFELWIRS
                     PEKSLRSRAEVLSRLLLRIPQTAPIAAALFERFRAQLEERRRRDEEEYKQQMQQMQQN
                     QMMQRMMMEQMGIDPSMMG"
     gene            <344661..>347582
                     /locus_tag="LMJF_28_0940"
                     /db_xref="GeneID:5653303"
     mRNA            <344661..>347582
                     /locus_tag="LMJF_28_0940"
                     /product="oxidoreductase-like protein"
                     /transcript_id="XM_001684323.1"
                     /db_xref="GeneID:5653303"
     CDS             344661..347582
                     /locus_tag="LMJF_28_0940"
                     /codon_start=1
                     /product="oxidoreductase-like protein"
                     /protein_id="XP_001684375.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653303"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8H3"
                     /translation="MSDQVKPPRRNTAEDETAKDCAAEVPAEDEEEVPLCQHDAYDAT
                     LSLADREAKWGFSFHELQSAVKVVRVLFHNPALYVGDPYLSDSRLYTMITRDRKTKRE
                     NRDVFKAIMNEEKSRRKRYLRQQDIEAVRRTAMKRERDDALSALLLADSEGANDNVAP
                     LLLAERPKAPELNGSDQSEDHGKSSAAGTASASDGGAAGNADTLRLSASEKEVLRLVG
                     AFENLLRLEQALRGERVEGYEGDAAAAAGTAARPGAEASPSVANPPVTGREGDLSAPS
                     TSFSTVKKLRTETDASTAVPAVELDWLVITQLTAQVYRYLPHSYGSQMPPPLFAGAGS
                     TDAVNSPLVVRSYVRGMKCYVAQRAAALVHLANATAPPNTPHSPITFGGAEPAPLRSL
                     LASTHRDVIVRTPLVELQSIHGLRSLIEDGDPGAASSQAMATVDLPLDDLLRALELVL
                     LEGASDERFCPVPATTDGDWVQGEGRARAQQLCIAEQTLHCFIARRVYGSAKVRGCGP
                     SPVLIQRSPPTSSSEEPEGYCIYEDVQRYAVEHHENDAQLKLNKFIGCHICKVRYNRL
                     HPYYYSMCHLCGEYNYNKRLMARDLRGKTVLLTGCRIKIGYAMALSLLRCGATVLGTT
                     RFIHEAVARFQQEIDYDVWKDRLHLFSLDLRDMWVVTQFCAFVRQRYKKLFAIINNAA
                     QTIARTPQYTEHLRNIELNPPAALQASIQDDECAAEWHNFFRRHATVTVGQPLSIEYH
                     PSMQPFLDTNQGACHDDAGKTRNSKGAAPQSGIVASSVSPSADGSAVALHVACNRTLI
                     FDRYDTQAEESDHREKNSWVMNLAEIQGSEAAEVMAINALSPFILNGRLKACLADRDG
                     DAVPSEPRFIINVSAMEGQFYRFKQTTHPHTNMAKAALNMMTRTSADDYAADGIYMNS
                     VDTGWITDESPKLKKDRRAEQFMLCPLDEVDAAARCLDLIFTNSRVYGLFYKDFKVIA
                     W"
     gene            <348553..>348933
                     /locus_tag="LMJF_28_0950"
                     /db_xref="GeneID:5653304"
     mRNA            <348553..>348933
                     /locus_tag="LMJF_28_0950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684324.1"
                     /db_xref="GeneID:5653304"
     CDS             348553..348933
                     /locus_tag="LMJF_28_0950"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684376.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653304"
                     /db_xref="InterPro:IPR005334"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8H2"
                     /translation="MASEYIAAPRESFTLPRQESKFTVSAVEHIIKDACEGMIGPERP
                     YVYEEAQPLIKDLCAEIQQRTVRLGYERYKLVTHATVTEAASQGMRVASRCLWDPETD
                     NYATYTYSNQYMHVTVVVFGVYWE"
     gene            <349958..>350392
                     /locus_tag="LMJF_28_0960"
                     /db_xref="GeneID:5653305"
     mRNA            <349958..>350392
                     /locus_tag="LMJF_28_0960"
                     /product="40S ribosomal protein S14"
                     /transcript_id="XM_001684325.1"
                     /db_xref="GeneID:5653305"
     CDS             349958..350392
                     /locus_tag="LMJF_28_0960"
                     /codon_start=1
                     /product="40S ribosomal protein S14"
                     /protein_id="XP_001684377.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653305"
                     /db_xref="GOA:Q4Q8H1"
                     /db_xref="InterPro:IPR001971"
                     /db_xref="InterPro:IPR018102"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8H1"
                     /translation="MSKKQEVKAYGPNVKKGDLVYGVVHIFASFNDTFVHVTDMSGRE
                     TYVKVTGGMKVKADRDESSPYAAMMAAQDVVARCKECGINALHVKMRAVGGVRTKSPG
                     PGAQAALRALARAGMKIGRIEDVTPIPTDSTRRKGSRRGRRL"
     gene            <351781..>352278
                     /locus_tag="LMJF_28_0970"
                     /db_xref="GeneID:5653306"
     mRNA            <351781..>352278
                     /locus_tag="LMJF_28_0970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684326.1"
                     /db_xref="GeneID:5653306"
     CDS             351781..352278
                     /locus_tag="LMJF_28_0970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684378.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653306"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8H0"
                     /translation="MSANVSFSAGSRTTKAAPSEPAASPSTKSKSHMILPYEVLFNLV
                     GRRVTVLLTKGSQELEGTLQAVDSDKGDMLLSDVVRYTWAPSRSSDEEETAAAAAGNR
                     QCNLGRVSEEEGCSNCVGGGQRRELSRCRQAMLNSAFVALVTPTLFIPEGGHSASPAH
                     EHTIA"
     gene            <353036..>353758
                     /gene="P27"
                     /locus_tag="LMJF_28_0980"
                     /db_xref="GeneID:5653307"
     mRNA            <353036..>353758
                     /gene="P27"
                     /locus_tag="LMJF_28_0980"
                     /product="putative P27 protein"
                     /transcript_id="XM_001684327.1"
                     /db_xref="GeneID:5653307"
     CDS             353036..353758
                     /gene="P27"
                     /locus_tag="LMJF_28_0980"
                     /codon_start=1
                     /product="putative P27 protein"
                     /protein_id="XP_001684379.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653307"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8G9"
                     /translation="MSRCTTKLSGGTARANLVDHGVYVKPMSLNPFLGAVHDGTSTGY
                     FQGYSAKPMHWLYRFRYNMLPQGISCGFFSRNPYGRYVHWLEVSTIEKVRMQLQSAES
                     MPVSVLVSLTVIYSLWFSYRLTFLHPDITLYNLGLWSTKPWVQQQRFNKKIDIDQQVY
                     RWVHRMPELSITDPIREIYKLKIGANEPYLEHVRGMGREKELTLYANERTEGAGNIRP
                     LNIPHEYLSGHNPGPLMSGHGV"
     gene            <359922..>361172
                     /locus_tag="LMJF_28_0990"
                     /db_xref="GeneID:5653308"
     mRNA            <359922..>361172
                     /locus_tag="LMJF_28_0990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684328.1"
                     /db_xref="GeneID:5653308"
     CDS             359922..361172
                     /locus_tag="LMJF_28_0990"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684380.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.0990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.0990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653308"
                     /db_xref="GOA:Q4Q8G8"
                     /db_xref="InterPro:IPR005016"
                     /db_xref="InterPro:IPR029559"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8G8"
                     /translation="MRDDEDEALSRRRFRSADVDDDLSPGLIVRLKYAMYLFVALLLS
                     MMVRGLMSSLLDKIPMLKKGCAMSSKGGVIQAACAAEMLIYRVSFALTFFFGIHLISV
                     SDLTCCIRSRDIAELQRSFFTAKTVLLVVLFIVTFFIPNGFFSVYAYVCLVCSGLYLL
                     MNVVFLVDFSYQWSDDWVERADGNSKWVWYLFAIAVGSFVLAIAVIAASFVIFVPHSD
                     CNANACIITSVTVGAFIYFTLSVYVPHGSIVPSSIVFLYTSCILLFTLRTTDNEHCNR
                     MATRPSSTTYSILQTIFTMLLTCFTLLYSVVAAGGSGASLNIGQSEDGEAENPDESGH
                     LSHYMFFYTIMIFGSMYLAMLGSSWHVSGAGEDSLSKSINLAFWVRLSTVWAAMFVYI
                     WSLVAPYTCCKGRDFGFAVDDDWI"
     gene            <365360..>368179
                     /locus_tag="LMJF_28_1000"
                     /db_xref="GeneID:5653309"
     mRNA            <365360..>368179
                     /locus_tag="LMJF_28_1000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684329.1"
                     /db_xref="GeneID:5653309"
     CDS             365360..368179
                     /locus_tag="LMJF_28_1000"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684381.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653309"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8G7"
                     /translation="MLFGSSSRGRSFGVETTPRLLNAVERTEYAAHIGPALVRNVWIS
                     SFDIPVDVLVDAKISRQAIKVTGFAMEAKLAVLAACMHAERCLDALNIPLFTSEQRQH
                     QRVLQAQAEGRTAPEVTDEPLELSSVYLPLGVFLPAATSAQVIQAAGKTRSFQSLQTS
                     SALTNHGGDGGASTASGAATQDGGARPGKGLLRRPARRWDMVKPRYGAEWFIRVALDE
                     LATLQSTILTHNRPLLDDDDDDELGEIDSVVISANEVQILQPEVVPGGSGAGAAAAAA
                     GSVSNRGYRETQGAHAPSVPKVLAYERILFNIRSRSAHAMVDETEGGAFDLVEDDCES
                     WWHEKETPSSRCLRDPGAVARVSRYLVRLTGHDLDSSIQTRAAEEDTNVWQQHPLKVS
                     VKLKTWYTMWLDIPGIPVRAVGKATTQEGARDLCAMHAELLLQWFGLHVYDTPHEQAM
                     YYDACLRWGRLIAAEPIDPATVDVKAANLPKPLKEWYRSIAKLRARRSERNVVEKLLH
                     LNRMVVHTFRNHLVEVDIIGSPEYKELLSLAGPCLRSFMVAVQHPYESAIFCYVYCKD
                     SQYRSTVYLPLPERYGVRGGYSIASTPESSIILCTLHAVDVLCALDVVPAVCMEQPRW
                     QRMMEVRESLGLIMPSSYLYTKRLERAPSTEAETALGPPPPPPHSRLRSPPAYRDVPM
                     LSATRIPPYQEVWQIMLTDADIFDVAPDLHALNDEAKRVHVRSVFDLSQILFEEFAQY
                     AFGWRIGQRRPGEYLYHYVGPQHYRGAARRIANNFWMELPFDQAVYGRRVALGRCFTR
                     KGAERMVYIHALRIAHALKATPWDTLPLSKLAEELYKNNLAQATSRHQQWKWVCSTLL
                     DCTHVDGADDGPRSDGAAIREAEIMHEFVRPMEAVPAAAATATGSTSPVSADGGHGGP
                     SAIDVRHVLSPHPVMSRDLAIKTLG"
     gene            <369274..>369624
                     /locus_tag="LMJF_28_1010"
                     /db_xref="GeneID:5653310"
     mRNA            <369274..>369624
                     /locus_tag="LMJF_28_1010"
                     /product="putative ribosomal protein S20"
                     /transcript_id="XM_001684330.1"
                     /db_xref="GeneID:5653310"
     CDS             369274..369624
                     /locus_tag="LMJF_28_1010"
                     /codon_start=1
                     /product="putative ribosomal protein S20"
                     /protein_id="XP_001684382.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1010"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653310"
                     /db_xref="GOA:Q4Q8G4"
                     /db_xref="InterPro:IPR001848"
                     /db_xref="InterPro:IPR005729"
                     /db_xref="InterPro:IPR027486"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8G4"
                     /translation="MDYPKKNQAAPAEGQTVRLTITSRNAKAVESVTSQLLTRARDEK
                     VTIHGPVRLPTRTLKITTRKTPCGNGTNTWDTFELKIYKRIIDLHAPTEQVKKITSFT
                     MESGVDVSITILDR"
     gene            <370814..>372697
                     /locus_tag="LMJF_28_1020"
                     /db_xref="GeneID:5653311"
     mRNA            <370814..>372697
                     /locus_tag="LMJF_28_1020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684331.1"
                     /db_xref="GeneID:5653311"
     CDS             370814..372697
                     /locus_tag="LMJF_28_1020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684383.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653311"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8G5"
                     /translation="MDKKTALAQLRQSKFAYERGLERQEAERRAKLHRFLDQHKHASQ
                     WATSLAALVDAVRHGVMPSDAALCRAMCQCGQRGQLQAAKQVYVDLYRRIGRPRPLTA
                     HVAFMAACADAGDFAEAHRQFRALRDRDVAQHAKNASHCPVVNDDLTTEYLRAALCAS
                     LMRWPASGEERPAAAAGAAPIPVTRTQGSSASESFQSRHSPTMAKEEGARPVARRSTH
                     RGRDDGYGGNPRADATKQDADDVSASSPWQVALEEFVALRRNAEVFRKSNELTPLLLE
                     TATQLACVGRQWQLCLSILRGAEAEQALIPPEAYDASIRACYQAQKHAQVVRLMEQLI
                     ATRVPPDERSVRLALVASEEVSAEERARQTFSSSAIDGVGRSGRGWSMALTLFQALER
                     NGFPLYQQSYEAPLRACVNAGRWKEAFQMLDVMRRDHRPVSAPVYAQALASRIEAATA
                     WAEVRRLMRASSLAEGHASIVVLYLAALRACMRLRDWKHFAELNREMRDRDIPETYDK
                     MRLLIEAAYLQEQYHSVLMRFARFENITQYERRRVVDDKRVRLYEEDFALPPALLDMV
                     LAAFEKVKGHADPMVEAAYQAALRHKERMSGGQSLAGAHTAPDEWMYSQKAREARTSP
                     EFH"
     gene            <373797..>374147
                     /locus_tag="LMJF_28_1030"
                     /db_xref="GeneID:5653312"
     mRNA            <373797..>374147
                     /locus_tag="LMJF_28_1030"
                     /product="putative ribosomal protein S20"
                     /transcript_id="XM_001684332.1"
                     /db_xref="GeneID:5653312"
     CDS             373797..374147
                     /locus_tag="LMJF_28_1030"
                     /codon_start=1
                     /product="putative ribosomal protein S20"
                     /protein_id="XP_001684384.1"
                     /db_xref="GeneID:5653312"
                     /db_xref="GOA:Q4Q8G4"
                     /db_xref="InterPro:IPR001848"
                     /db_xref="InterPro:IPR005729"
                     /db_xref="InterPro:IPR027486"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8G4"
                     /translation="MDYPKKNQAAPAEGQTVRLTITSRNAKAVESVTSQLLTRARDEK
                     VTIHGPVRLPTRTLKITTRKTPCGNGTNTWDTFELKIYKRIIDLHAPTEQVKKITSFT
                     MESGVDVSITILDR"
     gene            <375119..>377638
                     /locus_tag="LMJF_28_1040"
                     /db_xref="GeneID:5653313"
     mRNA            <375119..>377638
                     /locus_tag="LMJF_28_1040"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684333.1"
                     /db_xref="GeneID:5653313"
     CDS             375119..377638
                     /locus_tag="LMJF_28_1040"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684385.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653313"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8G3"
                     /translation="MRQRVASAPPALAVTGKGVSESATQSRFAKVSQTAAAGSAAEEK
                     FTEAHKRPLLAKKGVPNGRSSGQQGRAPVRESKSITTTVTTVGLCHGAERQHALHSLQ
                     PSPSTALEVSLVQNLKKQIACLEAQLHVMKQQQDTMTRTHRHSNASNHVESARAADTA
                     AAARLISVELTLPHAERIRHTDAVAPSVNTTESDDVAVARMREIPAAYQTERSVLLHN
                     LESLTKDVEGLQSLVLHLGRERDLMAAEVVDFRAALRETKVENESMAAECAATHRLLE
                     KEQALRRVAEESVRQCTTAASSHRSSLTVADAYSQRDYYKLQAERTAEALTLAKAKTH
                     ALSDALQREYDAAKTLEVQLCGALDRISQMKRREDELARYYQQLSGRFVTVSATLRHV
                     LDVAPKGILKQQRVPSPERAPAGQPQAADMTMDELRDTLDAWHREAAVEAAKAQQRTE
                     TITGDALALLEMATETMTTVTSGLGNGLPANGDEAAATAPTRCAAARAMVGSEESATD
                     DDALPVAQPFEELPRSSSWEAVTPVTHLLPAVPTPTAGAGNAAPSTCSDEKGFKGLVV
                     DAALPVQLYEVSDAAAMPLPPSAAPQKILATLKTPMLNPAAVDHAAEVREVAQSPSDE
                     KSITEHVAFDSAAPLTSEQTAEMTAEKSAAAGTAVGTVVGIAVGAPSFSGDALAVPPA
                     AHVASNPGSVPVISSTPPPQGSEDTRPSHPRPPLTSTATAAPAEPPAPTPEGDAGNEK
                     GVLSPPPVSAVPHPLPPNLVPVPLPSAPLPLPPGAVPVSVPPAPPVPPSLEQQLQLLN
                     ARIDAQEAALTEMVRSRGGLVRSTDTQPSNSGAWCGEDGKC"
     gene            <379466..>380692
                     /locus_tag="LMJF_28_1050"
                     /db_xref="GeneID:5653314"
     mRNA            <379466..>380692
                     /locus_tag="LMJF_28_1050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684334.1"
                     /db_xref="GeneID:5653314"
     CDS             379466..380692
                     /locus_tag="LMJF_28_1050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684386.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653314"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8G2"
                     /translation="MAADGTCTRVSEAPAYASGCHSPSPSTHLRGGTNGGRVLQQGQP
                     GPFTDAYGHADSGPAAKEIEDASSSYAVAIALAALEASRKPLQTLEQISAALTMCAPY
                     LPLRVEVEADLNSSTPIPALGTAAMRAEADLAPTTSTTIPAMTVVPLYLHVLGPLLPC
                     PTAQALRTLEDILLEDCDGSRLPLCALHCADLDLRRLRMGEDSDDACPAIAAAVQRAQ
                     SDAFLDLLLSPTSDAHASCTATASQLLAFVRRIVSTRGAQLTTLHFTRCYVAPHDVGQ
                     SIPLPLATLRWLRFEHCSLTPAHVAALVALARQQDALASSKVGEARGVGGLSSSRRRS
                     FGVLEELQLSGCLTPECISELLDYVEEQQQCSEEGDQEVALRLLCVPSSVVRAARAHP
                     FVQANGSRISVVSAQV"
     gene            <386009..>387226
                     /locus_tag="LMJF_28_1060"
                     /db_xref="GeneID:5653315"
     mRNA            <386009..>387226
                     /locus_tag="LMJF_28_1060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684335.1"
                     /db_xref="GeneID:5653315"
     CDS             386009..387226
                     /locus_tag="LMJF_28_1060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684387.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653315"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8G1"
                     /translation="MFFAGGTFGVESEARDANKRPSGRRHQARDMAELQATVDAGEGV
                     PPAPAEGTRCAAAQRQMATGPSFLDRMYEHNSAVVESAHTTRRRGSAPADHLNIFSWH
                     DTAPASRPPYQGRQVAASGSRATQPVNTTAPVPTAEDRRAEEARKFETSSESAFLRFV
                     DAPKTQFRAEAGNRGARTGAVSGKPATSLPPCSDMMGNLTREQPSKPRGRRGQAATPT
                     GNRSSVPEESGVAGFPGMGQRSIPRGLPHLTRKPAQSNVFPSPTPNFMQQEDLGQRED
                     ARAPPAPKPAPKAKCSPHYYIDDDDYENHRPTNAFETEAYNQQPCQQEIRMYDENEYD
                     DHDQARAGSFNADAQRRAQGAPNPEWLYDSTVGGGAGGLPAKSPSEQRHQYQFDAEKQ
                     QFYEADVRPQLQP"
     gene            <390168..>394148
                     /locus_tag="LMJF_28_1070"
                     /db_xref="GeneID:5653316"
     mRNA            <390168..>394148
                     /locus_tag="LMJF_28_1070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684336.1"
                     /db_xref="GeneID:5653316"
     CDS             390168..394148
                     /locus_tag="LMJF_28_1070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684388.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653316"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8G0"
                     /translation="MEAPGDRVSASVTISKTLSLKTGATPTPVAQPPPVNPGRSSDIR
                     DPPLLPSVSGSDEERRAHLTAELAFEQALYGDIVPTGNGDGGPTGSHSTPSSGSTSNT
                     PTARPTGEATGTSRECREGYAAVATGAAAPVPPNLSPRIPGHLLRGGGAELLKGAPPP
                     EQAARRNEDKSRPGPVTSARTPPVTFASAEAAFERALYGDVMMEPLSGKADALVSSDA
                     SVPEADRDGSASPGAPPLPPAPSASLDTLDSARRYRNGGAAGALVRSADDAAPDGAIE
                     GTPASGISKADTESTPQGREEAGQLVGNAAATEVSDAAEAKGAESVAVEESIPPPTVS
                     MRCAFDLDRLDAPADQFALLDVLFRVEDHHTAVVTHIDPADRVGRCMPLLDRISKREL
                     LFASGWILDLQRAENTNAAPPRTESAADFSGSEVSLPFTHREVVGRSKVLRTLVFRLL
                     HAQHHWWDQVQEVVLLAVKKAAALQTSCAAVVGAAAADDDTPLTPSDEDAESTTESVV
                     MPASGAAAVDCLMRHTTAEDVQAAMTRIFGTDPQQVHFFSAALCEALAKFGDTSGTID
                     GCVDGAFSAFEGPVAAWNAFVLTQRHRTTGVCGPHTRPFSFGEGRPTINISDLAPLQY
                     CDGAASWSDVPSPELLPRATAARHSADVRTTDGDSWVDETHVGRRPTLCTPSVDAAAA
                     DAITTSWGTMSEEEQNTFLFGAESARLSLRVRESGGVYAVFGQNNMPFEMESMLAEAE
                     VAAQQREALRKEETEADAADGGGSYVPAEASPLEVMRNQEAAHVRAYDVDRVVLELMN
                     AEGATVAGLPGGRSTFLSSVAAASDERSGSASRQQRARGRIGTTASTSTMPFQWQLRN
                     NEDVQLAALWQRFVRASTGDLTGNLVYVRRHASSLVHDAVVDIAVQKAFWLLFFARDE
                     VRAVTHPKRTYETLWNLHHQLVALFALPRGDGSPSAPTPRRAAHGREAAQAAHPAFED
                     LSLQSQVSYACFGCTHVPPRRCDSAASPRPSPLVTETAGVVDKPHIHSSVSVPYASPT
                     DLYAALTGTYHGHGVGQLKTGAASSTSAEGAQTSDSEKANFATLSAVQQLSIAFCFPR
                     NRAERDEAALLLPARGSPTVTAAVTTAALEIADTERDPQSKRGESSPDAGSHPASERE
                     PLDNGERTQPGLNVKQRAACASKVRIHGGAAADDDARIRQVHSALEGSVYECLRSLRA
                     TGALAAPLPSRERRCDIIGVALATFSDEQRRTVWRAVQDITAVMIEGDAVESSVGASS
                     LAGEARVPTKAEGKQHRTPSPKAAIADALASPQQRGWGEGGYGICKLAASVNDVRGAR
                     QAPPGQ"
     gene            <396518..>398359
                     /locus_tag="LMJF_28_1080"
                     /db_xref="GeneID:5653317"
     mRNA            <396518..>398359
                     /locus_tag="LMJF_28_1080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684337.1"
                     /db_xref="GeneID:5653317"
     CDS             396518..398359
                     /locus_tag="LMJF_28_1080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684389.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653317"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8F9"
                     /translation="MSRVAIRDRDDVSLRRRREYKQQLMRDVEEKIRFYPPSIKKQVF
                     FPIMTNSTRVALFRGNREYGIRTSTRVFSMLLEQLCKREHRELILEKLTELGLEPPTA
                     EDWEHFTDPVTGDITTGMMYSKWVDSILTTYGRMSFTNSQHLLAAGATTLFAYVIRNY
                     LDRALVPPLEDWSRQFGPVVAEEFVGRPRGQQKVRLALSEALYEVRVWGRTHAQEAVS
                     RLSLQEQADLVKWVEGNIKTHIAEMERKHAFTAKILAVMHSLPEAKAIHNSFWAFKES
                     KRLEHVVKMKGAFFPLHHDVHRQWSQLSKEEKARYSCFGRKRETETACGRKLFIRYCC
                     RDYGFSLTDASQRYASLGDLQKAALEFPFYFPLTPGNAATAAFQRFYWVMCERYGMVR
                     TYSSGIGNRLFKIAMRQKWDALSMEERQQYEEHDRIYAAFPLQPTTSEATASGSGKSS
                     SSESLPASTAPSAATRRSECVTTRWGTPTKGSTASRSQVRAGLQYFVEERPPSLKVDD
                     TAITAEELLMNLREAAYGARSTEAKAKVAATAAHPKATPSVAETGAATANEQLQSGQP
                     KEVADTQDVEVPVAASRGGRVRSKTPGSTHGKGSTRTRQPALQVVVI"
     gene            <401810..>404167
                     /locus_tag="LMJF_28_1090"
                     /db_xref="GeneID:5653318"
     mRNA            <401810..>404167
                     /locus_tag="LMJF_28_1090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684338.1"
                     /db_xref="GeneID:5653318"
     CDS             401810..404167
                     /locus_tag="LMJF_28_1090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684390.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653318"
                     /db_xref="GOA:Q4Q8F8"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8F8"
                     /translation="MLLERQQLVQALQLSYHCSAACATSTVNSYYPDEEKCRATVQGK
                     MTAPFVLAVGMVPKQREYVDSLRDDLAVAFQHFPYLNGTAKPPDKEEQKGCAKAVASG
                     ERGRNGRASSPASIDWAGVRARLLSPKKVPLWYMHTELVFPGDTHDVRIYENAYQSLI
                     VKEGFSYVIGCYASGDGVVPALDYVNARLCGESVQSLAQRIGFDDDVVEALEGLEAEV
                     PTRVYTRVNAFGNNPATSRSSRQDKGHAQQVLKEAGLAYVRSYVTTRADEAVAKVEDG
                     TLLLPVVVKPNSGAGSEFVTLCYTVDDIRVAFSMVEGVRTSQGTDAAQLVVEEYIEGP
                     EYVVNTVSYQGVHVVTDVWESWKYPEPVVTTGLTRSAEEALRAAGIKRQKQRKISILY
                     DRQTLITNLADLPATHSARRIVEYTLKCLDALGLENGCGHSEVRLDTRKAARELRRHE
                     QRRPKTNSPLGKVKDEHLDEGEPILIELNSRMQGDIPRSTDVIGYDQYSLLVYISEAV
                     NVFGAATAASTALPFRVDSSRPQRVGEIPWPPVPRLYRARPSTGLPLATTVLFLATEE
                     ECILNGVALRTLTELGTFQRFTRTIFKPNQPGFVTPLRHTVDLFSSPTSCVMQGPAAA
                     VKADCAAIRSMESAALCSAAKAALFKLTSTIHETERLRENARIIDGRLHAMTEAYRRA
                     SAQAGSATDEVADDGREKDEQGTENDCCSSQHDLEALRRSISSLQSELTWVTNNLAAD
                     DRQVQLLRTEFAKALASQKPAPLYINYQDFSMMKAAGVGNELAVL"
     gene            <406616..>406975
                     /locus_tag="LMJF_28_1095"
                     /db_xref="GeneID:5653319"
     mRNA            <406616..>406975
                     /locus_tag="LMJF_28_1095"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684339.1"
                     /db_xref="GeneID:5653319"
     CDS             406616..406975
                     /locus_tag="LMJF_28_1095"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684391.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1095"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1095"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653319"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8F7"
                     /translation="MHSGAPLTDEDRAPWLRRLQKEVLAPCQGRGTVSVVLACSALRR
                     CYRDVLRGTDHCKNAKAAADTLQHTDVFFPAAQWRREADRGAAAGAPGSLHVDLPSWI
                     ADGDGGGSAAKGAGCYN"
     gene            <408996..>411542
                     /locus_tag="LMJF_28_1100"
                     /db_xref="GeneID:5653320"
     mRNA            <408996..>411542
                     /locus_tag="LMJF_28_1100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684340.1"
                     /db_xref="GeneID:5653320"
     CDS             408996..411542
                     /locus_tag="LMJF_28_1100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684392.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653320"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8F6"
                     /translation="MAAKREFYVDFEVKFGKMVVSLEMPASATVHDLKHRLEEQTHVR
                     LDKQRLLLNLPVLKAKHRDPPHDTVVRLLFPTELVNRCEQHDGPVAQHVKVSAMLLGS
                     AETAPAVNVAATSEISRLVATTVEHDGRWYRCSYARGYLRQTAYVCRTCIDEGRADPQ
                     HALCLACAEFCHGNHEVEEWGVRYYMRCDCCTQKCWRPPADPEAAAEAAAKRRAGLYS
                     SPSVASATASGSEVRAVQMRDIEERTTRKRARSTSPLTPKRSRGSSPVSGIRMATIPP
                     ADMPEVILHHSTAAGAAAASLVGAFRPSQDASRALPSSSAFSPGPSPPLAAADQADAS
                     TRVSNGRAFVGKRVSDSGDEGGDIHGDHGEGEHSDALPSPLPELSRCAFVVDSKTKKA
                     PVESVLPTNRHNRYPRDPFNWCYCKNAYPSDDPECGGIACMLCCSCYWSTHITRLHTY
                     QYRRMPCYGDVLLGDTVVFKCTTCNTHVCVPCRYRCHKDHNVEEALVTPSKDDGTDNS
                     GPEGVRFSCGCRGRCAIAEEVAAEMIDDESTFDPIPDSVATELMNDDVFTGFVCAYCM
                     QEHPWIATEDPLRCYHGQLPPMAPAKKAVLACGIKSAVPHSADMEDSDVFPYHGMLLP
                     VNAFTDATTCSCKLCRSAFDQFAPRATENATEMIMELHDHCDHCGKSVKDQQAFMCRT
                     CEMNLDNTFFICKDCNAMRELLVQNVNRVRALAGPQNDETPPQADERVEGEMGEVTAE
                     GSEFDAAINSVDDEALPEAGGYDHDLSHEFIEDTFENLYALCGMQILQNMDPEMQEYV
                     ASNWDPMVNQVEVANTLSQSLGQIPLQFDEDELREMAVLNQKPNEAQGRK"
     gene            <412689..>414578
                     /locus_tag="LMJF_28_1110"
                     /db_xref="GeneID:5653321"
     mRNA            <412689..>414578
                     /locus_tag="LMJF_28_1110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684341.1"
                     /db_xref="GeneID:5653321"
     CDS             412689..414578
                     /locus_tag="LMJF_28_1110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684393.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653321"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8F5"
                     /translation="MTEHENTPRLELEAALGYSGNLPGSLVAHPDQQHLLYALGACIV
                     IRDANDAESSEFFYGHNDKISCLTVSVSGRYVASGQVTHPGFQADVCIFDFAERRLIH
                     RMLLHKVKVQALAFSLDEQYLASVGGPDDNTVVLWDVKTGRPLCGAPAHHTETKAIAF
                     FNNNSEKLITGGVGSLLVWTVDLEQRKMNSVDINMGNMRRSVQTISIEKTDKYVYCGT
                     TSGDVICAQLQQANVFKMQGPQKKLSGGILSTILTNTGDVLVGSGAGELQLLSKINLT
                     VQNSATVNGGVTALALMGDNYYVGTKTSNLYFVNGGNFMTRLRLTCHSEAVQDVVFPH
                     GFSSVFATCCDTDIRVWNANSCTELLRIEVSNRTCNCLQFSRDGSLIISGWSDGRIRA
                     FGPQSGKLVFSVADAHKVEQGSRSHKVGGKVGVTSVCADNAGHRIITGGSDGLVRVWA
                     IRGATCTLEASMKEHKAAVNAIVISHDDTECVTASDDGSCIVWDLTRYLRRNIMYRQT
                     YFRALEYYVDDSQLITCGSDKCIVYWDSVDCHAIREVCGSRTAELNSLSLSPDGRFFV
                     TGGNDRIVKVWDYDRGECIAVGLAHSCSITKVRVSPDGKKIVSVGDEGAVMVWNIAEL
                     AIEGL"
     gene            <417491..>418255
                     /locus_tag="LMJF_28_1120"
                     /db_xref="GeneID:5653322"
     mRNA            <417491..>418255
                     /locus_tag="LMJF_28_1120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684342.1"
                     /db_xref="GeneID:5653322"
     CDS             417491..418255
                     /locus_tag="LMJF_28_1120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684394.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653322"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8F4"
                     /translation="MIESTRSVGDSSWDSHRQTNRVGGIVIRDVDIHGSLTTKQDDKV
                     NISDASGEVNMHENSYLNEFEYTPTPFNPRRVSRCRLENLVILATLIVMFVLSVFALV
                     TPLFYYRSSTATVRINSVNFWGSGGEGVQQRYNVHTIFCENYATKSDGYLALYILLFL
                     IVCVGFLLSLFPIICGRVLICTYLVHTLLILCWFFLLVAMILGVLMYRGNLCHNTSLK
                     NIGFRYGPAFGLTAALFSLLSITMIFLVLRAIKNPL"
     gene            <421382..>422941
                     /locus_tag="LMJF_28_1130"
                     /db_xref="GeneID:5653323"
     mRNA            <421382..>422941
                     /locus_tag="LMJF_28_1130"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684343.1"
                     /db_xref="GeneID:5653323"
     CDS             421382..422941
                     /locus_tag="LMJF_28_1130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684395.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653323"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8F3"
                     /translation="MASSRNRSPSSPSTESSYESQQDQCQQQESYRTEHLETQARSDS
                     DMQKAARQHRAGSSVHHSESGERSQLLTERYRHRVEKASSVWLSGILNGHSYAPRPKK
                     VDEAELSDTAKEELLKERTYTIPRGYKYYVDGLPPVLSPVPQNGFRTALIIHMIFFGI
                     AFVFTLAAACPIPWYRGRNVDVGGVNYNDRLFSLWIAEGGKYPAIRVYAMKHCLLEKQ
                     FYQSIAVSTILGCVLSFLSFLISGARLSGRTSYGWILLFSFLAFAWTLCGNAMSISMY
                     YSSRCNAPRFSNTASLAAGFVLSLLAWIFQLGGLLAVVLVTKLNVGPVLKQLRVMDTY
                     YMALLCVSLLFLCVANAGTVWKRSFNTRDVSVVRVTYWHTELIMPNGTSLYYSRGHYR
                     CSAYSKRMKASISFLILSSIALFMAAVLAIPAFLARGCRIASIVFSVITLVFLLISWV
                     TAVAVRYRNSCIGAVNGTMYQYYPGVPSGIHNGLTSFPGYGVQEGLVLPIVAWVIVLG
                     ATVLNLRVPWI"
     gene            <429070..>430047
                     /locus_tag="LMJF_28_1140"
                     /db_xref="GeneID:5653324"
     mRNA            <429070..>430047
                     /locus_tag="LMJF_28_1140"
                     /product="putative electron-transfer-flavoprotein,alpha
                     polypeptide"
                     /transcript_id="XM_001684344.1"
                     /db_xref="GeneID:5653324"
     CDS             429070..430047
                     /locus_tag="LMJF_28_1140"
                     /codon_start=1
                     /product="putative electron-transfer-flavoprotein,alpha
                     polypeptide"
                     /protein_id="XP_001684396.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653324"
                     /db_xref="GOA:Q4Q8F2"
                     /db_xref="InterPro:IPR001308"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR014730"
                     /db_xref="InterPro:IPR014731"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8F2"
                     /translation="MLRTTALSLGKALVIAEMVGGKVSPATLSAITGAAKVGPVAILV
                     AGASAKDEAQVLAKIKSVASVLVTVGEQYSHGLPEEYAPLIDAAVRANGYTHVFAGTS
                     AFGKNVIPRAAARQSCMPIPEVTEIVDENTFVRQTYAGNAITTIKSSDKIKYCTLRGT
                     AFERAELDGGSAAVADLAATPAVGKAKFVEDQLSTSDKPDLMTAATVISGGRGMKNGD
                     NFKILEELAAPLNAAVGATRAVVDAGYVPNEMQVGQTGKTVAPNFYLACGISGAIQHV
                     AGMKDSKVIAVVNTDEEAPFFQIADYGIAADLFKVVPALTEKVKAANGK"
     gene            <432697..>434922
                     /locus_tag="LMJF_28_1150"
                     /db_xref="GeneID:5653325"
     mRNA            <432697..>434922
                     /locus_tag="LMJF_28_1150"
                     /product="putative long-chain-fatty-acid-CoA ligase"
                     /transcript_id="XM_001684345.1"
                     /db_xref="GeneID:5653325"
     CDS             432697..434922
                     /locus_tag="LMJF_28_1150"
                     /EC_number="6.2.1.3"
                     /codon_start=1
                     /product="putative long-chain-fatty-acid-CoA ligase"
                     /protein_id="XP_001684397.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653325"
                     /db_xref="GOA:Q4Q8F1"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR025110"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8F1"
                     /translation="MLRAFASPILAKVPYATLFEYNHVLQKVFEAQPSKVALRCELPG
                     MPEVQFTYGQLQRDVVALADAVVRRKEAVAQARGETSLGWLQPSKPAHVRSVFAQGER
                     TPSCDYMKDTGFYTTSLLCGPGYTYAVSLLASWSLNQLVTPMPISQRYKDELMYVLEH
                     SGSRSIVGNTKLLKEKLPAEYEELYVRAEADVDKIPRSASREPKQRNDSDVTSNTFFV
                     DTVYDATLLVRDITAARDIQGTATLETEWLPPAESVCAPMRSAEDLVKRLDEEKATAK
                     ARELDRQAEILQQEHVRRNRAPMQATGGADPAGSDADGESLFCFDSAHLDELNRVYQR
                     WYTMPSARPTKYDDCLMLYTSGTTAKPKGVVHTHASVANMVKVLQNAWQWRDTDSILH
                     VLPWHHVHGLVNILLCAIASNARCVVTTFDDAARVAHRLEQGDITLFMAVPTVYVKLS
                     DAVQRKFSPIEKTGFRRACMESVRLMVCGSAPLPVPTLNQFCELSGHTLLERYGMTEI
                     GMALSQPLHPISDRHPGTVGSPLQTVKTYVHQPETAEAMEQASAKEAEYDEVGGLGIA
                     SESLFDRYWNNATATKKEVRTNAAGMRFFDTGDTVGVRLPAGKPAVYTILGRSSVDII
                     KSRGYKLSALEIEATLLARNDLFYEIAVVGAADAVQGESVVAIVAMQPEAARARGIAF
                     GEGFAWHESAAVTEELKKAALQLLAPYKCPSRYIVVPEIPRNPTGKVNKKDLKKVLGL
                     A"
     gene            <438554..>439159
                     /locus_tag="LMJF_28_1160"
                     /db_xref="GeneID:5653326"
     mRNA            <438554..>439159
                     /locus_tag="LMJF_28_1160"
                     /product="putative vacuolar type h+ ATPase subunit"
                     /transcript_id="XM_001684346.1"
                     /db_xref="GeneID:5653326"
     CDS             438554..439159
                     /locus_tag="LMJF_28_1160"
                     /EC_number="3.6.3.14"
                     /codon_start=1
                     /product="putative vacuolar type h+ ATPase subunit"
                     /protein_id="XP_001684398.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653326"
                     /db_xref="GOA:Q4Q8F0"
                     /db_xref="InterPro:IPR000245"
                     /db_xref="InterPro:IPR002379"
                     /db_xref="InterPro:IPR011555"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8F0"
                     /translation="MPVFGARMVGAGCMLAVAGAAVAYGVDPANMDACIAVMYPQCAG
                     FFGAMGAAAALVFANLGSAYGAAKSGVGVAYLGLTAPEKIMRGIVPVVMAGILGIYGL
                     IIAVIINNNIHTEDTSYSSYAGFLHLGAGLAAGLAALGAGLSIGVVGDTAARAYGKQD
                     QIFVAMVLMLIFSEALGLYGLIIALLMNNQANRYTDLCSAS"
     gene            441913..443704
                     /locus_tag="LMJF_28_1165"
                     /pseudo
                     /db_xref="GeneID:12983027"
     misc_feature    441913..443704
                     /locus_tag="LMJF_28_1165"
                     /pseudo
                     /db_xref="GeneID:12983027"
     gene            <444416..>444715
                     /locus_tag="LMJF_28_1170"
                     /db_xref="GeneID:5653328"
     mRNA            <444416..>444715
                     /locus_tag="LMJF_28_1170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684347.1"
                     /db_xref="GeneID:5653328"
     CDS             444416..444715
                     /locus_tag="LMJF_28_1170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684399.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653328"
                     /db_xref="GOA:Q4Q8E9"
                     /db_xref="InterPro:IPR000058"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8E9"
                     /translation="MSEPCVFKGCSNMALVALPKCEHCGQRYCTSHMLPERHGCGDAC
                     KNAAQRQATADAAAQQRARRHLGNEEAKRRLDKKLEANEAARRKKLKPAQAPAKK"
     gene            <445529..>446209
                     /locus_tag="LMJF_28_1180"
                     /db_xref="GeneID:5653329"
     mRNA            <445529..>446209
                     /locus_tag="LMJF_28_1180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684348.1"
                     /db_xref="GeneID:5653329"
     CDS             445529..446209
                     /locus_tag="LMJF_28_1180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684400.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653329"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8E8"
                     /translation="MSKKNKSFYENDGSGRDTFVNYAGAYWMNPLPAGTFFKSRGHLT
                     QSSVPTENGTSLVMDDSTPYPGRTLFGKSRYGTTILAAGQVATLDAPADSQSGHSAGM
                     GSTSRSTANPLAGTDADAQEFDGEATALEHISFDVSNPERRLRQPGHSTTGLEGTGGG
                     STYNGVKEPWTAPNAVDSTLLRLAPAYESTCHYHLRTGLFYTEDAAPPHEMTLPDKGV
                     TWGRSRYY"
     gene            <448563..>450089
                     /locus_tag="LMJF_28_1190"
                     /db_xref="GeneID:5653330"
     mRNA            <448563..>450089
                     /locus_tag="LMJF_28_1190"
                     /product="copine i-like protein"
                     /transcript_id="XM_001684349.1"
                     /db_xref="GeneID:5653330"
     CDS             448563..450089
                     /locus_tag="LMJF_28_1190"
                     /codon_start=1
                     /product="copine i-like protein"
                     /protein_id="XP_001684401.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653330"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR010734"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8E7"
                     /translation="MKSMSTTVQLYIKCSHLLDRDTTSKSDPYVTLFETTDGGKVCEG
                     RTEVIKNNLNPEFHTCISVTYFFEIRQIMRVEVWDSDKNKPDDLLGAAEFTLGRLLSS
                     RGSTLTLSLGGKSTATLTASYVGSQRGTIGVTFRGRSLKKMDLFGKSDPYFVLSRLLP
                     SGQRVTVYKSEVVKNTLNPQWRPTRTIDLVELCGGDFVSPCIHFECFDQDPGEDESIG
                     SFVITVGELLAASGKEFELVVEKKGKRKLHGIIAVDRCDYVRSYDFLEYLQAGMALNI
                     AFSIDFTGSNGPPSDPRSLHFYNPYHPNSYIRAMLAVSNVVQEYDSDGMFPVYGFGAV
                     APFTNGTSHFFPLSGNPSNAYLNGMQAVVDTYAGLLPMLQFSGPTNFAPTIRTITDGA
                     RRLRGVYTILLILTDGTITDMQDTIDAIVAADDAPLSIVIIGIGRADFSAMVQLDGDG
                     GVLRDRSNRPARRDLVQFVSFSEFEGKNPARLAAAVLLEIPKQVEVWGRIVHATPGHF
                     "
     gene            <451463..>453439
                     /locus_tag="LMJF_28_1200"
                     /db_xref="GeneID:5653331"
     mRNA            <451463..>453439
                     /locus_tag="LMJF_28_1200"
                     /product="putative glucose-regulated protein 78"
                     /transcript_id="XM_001684350.1"
                     /db_xref="GeneID:5653331"
     CDS             451463..453439
                     /locus_tag="LMJF_28_1200"
                     /codon_start=1
                     /product="putative glucose-regulated protein 78"
                     /protein_id="XP_001684402.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653331"
                     /db_xref="GOA:Q4Q8E6"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8E6"
                     /translation="MTRKDNLTLMAVCLVSAILVVSAAAVPDGSGKVESPCIGVDLGT
                     TYSVAGVWQKGEVHIVTNEMGNRITPSVVAFTDAERLVGDGAKNQLPQNPENTIYAIK
                     RLIGRKYADPTVQNDKKLLSYHIVADKTGKPLVQVTVKGQQKRFTPEEVSAMVLQKMK
                     EISETFLGEKVKNAVVTVPAYFNDAQRQATKDSGKIAGLNVVRIINEPTAAAIAYGLN
                     KAGEKNILVFDLGGGTFDVSLLTIDEGFFEVVATNGDTHLGGEDFDNNMMKFFVDGLK
                     RKQNVDISNDQKALARLRKACEAAKRQLSSHPEARVEVDSLVEGYDFSEKITRAKFEE
                     LNMALFKNTLVPVQKVLEDAKLKKSDIDEIVLVGGSTRIPKVQQLIKDFFSGKEPNKG
                     INPDEAVAYGAAVQAAVLTGESEVGGKVVLVDVIPLSLGIETVGGVMTKLIERNTQIP
                     TKKSQIFSTYQDNQPSVLIQVFEGERGMTKDNRLLGKFDLSGIPPAPRGVPQIEVAFD
                     VDENSILQVTASDKSSGKREEITITNDKGRLSEEEIERMVREAAEFEDEDRKVRERVE
                     AKNSLESIAYSLRNQINDKDKLGDKLDADDKKAIEEAVKDALDFVDENPNADREEFEA
                     ARTKLQSVTNPIIQKVYQGTAGSGAEEADAMDDL"
     gene            <458112..>460478
                     /locus_tag="LMJF_28_1210"
                     /db_xref="GeneID:5653332"
     mRNA            <458112..>460478
                     /locus_tag="LMJF_28_1210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684351.1"
                     /db_xref="GeneID:5653332"
     CDS             458112..460478
                     /locus_tag="LMJF_28_1210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684403.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653332"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8E5"
                     /translation="MQYHVQLALAPSCAASDFDGGDGVSGTASSPSLVASPSSTSAQA
                     NSSPAHHQQSDSGSGVGITVGQGLLSGRRLAVRVAPPLTSSAAPVVHVPASAGGGMRG
                     GASHWHSGDSLCSGAHSSMCASSSHHAASEIPASMTSTTTGRVNTSSAYGKGIVRISE
                     LRRQGVASVESGLRLATLPGGRSVAAATSTHGSDAAHGGASADGDVFYGASTPHAAPS
                     QRRTRQRGSPTAAATTSVSVSSSKRARGDRSGVSTSGGAQRRGRGSSGGSRASAAVAL
                     RSDGQLCDYRWFTARGRRCFVYDGRTYKGSSAHRMWEKVKGAARQRGLLPPQQATAAS
                     RTWDAPRARGRADASVAHSAAAAHITVPRLHQASARARSAAEHVLLPQQTKRRSAAVS
                     PGQVDDLTRTGVLVPSQLRGEWRTLMEELGMMPDDDRDAMTSGREGCLLKAGGGTQPP
                     DGARSTRPPCSPPRRAHLSASSAATEDVVEISDSNSTCDDTDNSGSDTSSSLSSTASP
                     TVVSGKADSGQRNANTVAAGVPLQWPATSYFSDASSEWSSTSSFTTSPARPPSSTSSN
                     SPRRKRAKQERRIKHAVTSTTTTGAPARLRRYHGVQVVEQDGWVYPVDVYASQQQQQQ
                     QREREDEQVRETAPGVASCGATLPAANENRTGVSGGQPSVPCGVHDLHLADLYREAVT
                     TQSNVALAPQLSVPALLAVPLPSSKASAGLSVVSGSGAAVPVRPAAISSAAQGRLLSS
                     AVALQSNVGRGCVSAFLGADDNLDDFNTADLADMFVTGEEIGGLRYDG"
     gene            <461225..>462643
                     /locus_tag="LMJF_28_1220"
                     /db_xref="GeneID:5653333"
     mRNA            <461225..>462643
                     /locus_tag="LMJF_28_1220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684352.1"
                     /db_xref="GeneID:5653333"
     CDS             461225..462643
                     /locus_tag="LMJF_28_1220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684404.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653333"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8E4"
                     /translation="MSIPASAPVGKWLIVRSDRLVLSVDKADHVYVVGRGRQLPSAQL
                     LSHKYASREHLAVVWHPPHLYMIQEGKNPSFLGASCTPVPRLHDAAAAELDGSAPSLW
                     QRAQVKFSATAAAKEATAHQSAGDIITVDVPLCDPLTVTQAPDRHAIGAATVHFPEEL
                     ALPTLTVRFEGTEVTREDATAAATTKTTAEMLAVPSARALGGGDDDDEELSDGERKAS
                     RSSRGRTGGGEGAAAANGSGNPGWRGLLDVALQQQQQQQQQQQDTSGSSPAAQATAAR
                     SERQRSLGAGAPFAQVPFGSASEKAHAPACANPAPHKMGVWEWKNHVEGKDSDLVSWH
                     KYNLVVAALLEKAYQDTSLAKIKIPDSAMFGKPDAKGCTYGVCFAEKALDGAMIQYSL
                     KEPSKFCVIRRTGGPPVDRRRAKKAHVIPSPPSSEDSVSDSEDSSSDDSDAEASATSS
                     SSPRNSSSGSDGRPPKKRRRPY"
     gene            <463794..>465035
                     /locus_tag="LMJF_28_1230"
                     /db_xref="GeneID:5653334"
     mRNA            <463794..>465035
                     /locus_tag="LMJF_28_1230"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684353.1"
                     /db_xref="GeneID:5653334"
     CDS             463794..465035
                     /locus_tag="LMJF_28_1230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684405.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653334"
                     /db_xref="InterPro:IPR011042"
                     /db_xref="InterPro:IPR013658"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8E3"
                     /translation="MAALFQVTARRVRAPAGIAPCQLGESPTWDEEHQALWWIDILGE
                     ALYVGQPAPDNMHDFDHVAVLPLPGHRPGFIVHAAPGDATRTGKPGAHSAAPYHAVWG
                     SQKGLYYTSYSTTLPWRMSEQACRPPKLHGLTPVSHYQIARFPQSLFQLQEGRVYRFN
                     DGKVGPDNSLWCGGIMERTDSFPRRDLRSGSLMRWVAGGPAKALSSASPSVTSNGFSV
                     EVPNVTVSNGIGWSPAGDVLYHVDTPAAVIRAYPYQAVPSADGPAKGLHHEDGTRDAG
                     YVYWALPGSLRERGATLDGLCVDASGAVWVALAGIGEVVRLQDRKVGATVAERIAITG
                     VVKLPEVALCTSCCFGDADLTTLYITTARGTSKEAATSCKQEGAGWIYAANMKGIAKG
                     MPASRLRLPESSLSALQQHHL"
     gene            <466772..>468709
                     /locus_tag="LMJF_28_1240"
                     /db_xref="GeneID:5653335"
     mRNA            <466772..>468709
                     /locus_tag="LMJF_28_1240"
                     /product="putative p450 reductase"
                     /transcript_id="XM_001684354.1"
                     /db_xref="GeneID:5653335"
     CDS             466772..468709
                     /locus_tag="LMJF_28_1240"
                     /codon_start=1
                     /product="putative p450 reductase"
                     /protein_id="XP_001684406.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653335"
                     /db_xref="GOA:Q4Q8E2"
                     /db_xref="InterPro:IPR001094"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR003097"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR023173"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8E2"
                     /translation="MSFLYIVATVLFALAGYFYFQLNRQAAGRYGAVSATNNPNGKKA
                     PGVSDAAASGSNAVAKDQKEVTVLFGSQTGTAEMFAKTLTREGTKLGVPIKVCDLDCY
                     EAYNMEYERLVILICATYGEGEPTDTMKNFHDWMMDECRSPGEELANVKYAVFGLGDR
                     QYKYFCEEGVVMDRRFEELGAQRIFGLGCGDSGNGQLEEQFDEWCKDLWPAVGRALNI
                     TIKENSEEPVEPQCRVKYWEEAEEPLAFPKTASVLEPTQRLPVWVPIVRNEELLRNAE
                     GRSSRAIDFSISGTIISYQAGDHLGILPCNPDELVSQYLQSLGISDEEAGRVFSLQDK
                     KTLKNVLPARVSMRTALKWYIDLTGPPKKSTLRAFAHCCTDPVQKEELLRILRVNQDA
                     QREFAKLCSKLRTMLGFLRKFNSAKVPLSFFLELMPRIAPRYYSIASDILATPTLVGT
                     AVGIVDGGLCTNMLARMQVGDTVPVFVRKSNFHLPMRHKERPVVMIGAGTGVAPFIGF
                     IARRGVWKQKGTELGKSILFFGCRRHDEDHIFEEYCTEALHEGVLSALVSAYSRDQAQ
                     KVYVQHRLRERGAEIWEMLVSGANVYICGDARRMAKDVEAELKRIVEVEGKMSREAAT
                     EYMNAMEKEGRYLKDVWSSAL"
     gene            <470167..>471483
                     /locus_tag="LMJF_28_1250"
                     /db_xref="GeneID:5653336"
     mRNA            <470167..>471483
                     /locus_tag="LMJF_28_1250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684355.1"
                     /db_xref="GeneID:5653336"
     CDS             470167..471483
                     /locus_tag="LMJF_28_1250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684407.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653336"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8E1"
                     /translation="MSFTLMACTDIRGQKVNIELPFEQPPSSMEVLRSTLQHLFRREE
                     EAIKFSMGYTDMRACEPFTINRLQRYDDDSQSWADVTSIDVLQTYDQLYVFRKNSTKA
                     DISTQRELPPPRMSEFFYDPAAPGPFYMPRGSSRVQENGTAAASAPTSGGYGGSASPN
                     QARPSAGSSPYNSGGASGSAPAARPSERYPEASPYPASAPPPTSAAALPTPPPSSSFY
                     YKERTTPERVEYLFSLGCQHNDSAVLTEKAFEHIFRMANVAFPVEVLQDLFAHFATRS
                     DGGVGTETMSQGGFQEFATYFPVLVNIAYQRITNRNREEAIRAVQLDNAKQVKHARRQ
                     LQELEARLEAARKEVQQAEQREARLQEDLYEISMQRDPEYCQGEQKLLDKEVSVFKYR
                     ERLSREERDYERLAIERRKRAVAASARARSHSPQGTYDPNRYGPRD"
     gene            <472647..>476018
                     /locus_tag="LMJF_28_1260"
                     /db_xref="GeneID:5653337"
     mRNA            <472647..>476018
                     /locus_tag="LMJF_28_1260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684356.1"
                     /db_xref="GeneID:5653337"
     CDS             472647..476018
                     /locus_tag="LMJF_28_1260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684408.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653337"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8E0"
                     /translation="MLMVTRTARPHETAAASAKLRSSFYRFGDAGECGESGEESDSVI
                     PPLSGPGSSPKALVPYASNDALPPNPWRQRTTVGDLERAQRTNPRGVAQFRPVLQAAE
                     ETLGSSLSESKPLLEPYLYAQELARTATVDAWHLRRSRYLQRLQNGAATQREVCMADG
                     GPRCRSSRLDTRMSALPRLGSSDDYSSNKRHNRNAAEKGGLDSHRARTSSTTPTTLPL
                     LAPSSPVESPEITKESTFSRTDASASGWRMSSGANDASPLLSGANPNVLAVRCLFQAA
                     RMEAAAAAAGNAGWAAPSFPEPADEIVFSLSAQSTSDSHRQQPRAFLTYKPTGTRLKG
                     RADAMPSDCGDAAGPKADTDTLPKVAAASGAASAAPLGLLGNLFIDDATRAFFGCGDT
                     DRNEEELVDTSHSTVTPPSEHGLPDILRDRMHQRVATFTSSAKHTLDEPPMTAKTHAI
                     LGKARLAINTSTQALLIQAERSERRSRAVASGEAWPAQPASAISQNLVRAMRQLLYAE
                     EYERGLLCQLAQQSSPTRWYSTLLPNGSDGIRFRLLIPPTMTDDVAVHDRLYGAIRRA
                     SQAIAQPRRDAVAAEEARRRAPLPVLDKSSVDHSFCATDDAQLTVERAGAEKTLLFKR
                     WISLHENLSAQLRLFTEEVEQRRRLLGEFLSCKHPFPCMCLSCDLEVLAMSAVQLEPT
                     VKPACWYASVVLGRHKDVLQEELLARYRAERHRLYDLFKVEFSALYTYKKLVSDEAQR
                     FGHMIRYHEFCLCAAASRECERQQLRSEDLPLADVVTPRPSSAISTALTPEQTAPLEV
                     VDKSAAAPPMHAHLLHRGGSRMWQLRQRRLRCCDAFDSPFFSYVLYTEVLTTVAAEEE
                     VRTMRMVSETAERAELKASMMAEKSFACLSESERQARVRISAQRDEAYSALCAGPLVE
                     LQAAHAAELHTAQVAEYAKSCEEARQSFVVTAVAAKMAAEEGEMNWYRHFVFEMRQRS
                     LALLVAGRSAAQATTASREWLGCQQHVSLFHSERRLRDRVALVEETDARVRIMAAAEA
                     SLRHARKREARRLSEEAADMREAVQRVAESVRRAHDVEEAAVRAQLQREERAADPSKR
                     PSAKMRADTVNSFFRMTTEIKEDFDVFLPSLGSDA"
     gene            <477170..>478588
                     /locus_tag="LMJF_28_1270"
                     /db_xref="GeneID:5653338"
     mRNA            <477170..>478588
                     /locus_tag="LMJF_28_1270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684357.2"
                     /db_xref="GeneID:5653338"
     CDS             477170..478588
                     /locus_tag="LMJF_28_1270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684409.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653338"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8D9"
                     /translation="MESKASLPPHYACLGVDPSINSVDLARQYKKLSLQLHPDRAAYR
                     DDAANEMHVQARYQRITEAYAVLSDPEKRRAYDAKHGVNFQSRLARLQTVIGHHNTMA
                     TQRSTTSCKTACLASTSSPTTDEHDAQHLHAASHKDSAERTVGDDDDEDYDPNDVLAP
                     PRGAPHQGRSSDFYSDDSRDAHGEGDYIARLFSLHLRVGAEAAPKTRNGVPVVQYQAI
                     TLTRAYSPPESPYARTWGLVFKKNELVDLDGENLEELARITGLAAVPFPSVVQQINDT
                     MVVPTTDVPRLLSRLYEAESTRGSAVSPATGQTASINTDAPSGQSEKVCEVCEEAPAD
                     SSPSSSTEHLYMVLAYSTVAYDLVGKVHLLGDDDVINRLVPSWCIAPQLSPLMPDATV
                     LCVNNTHVRSAAELRAALRAAVLDGEDEGPMQAVKRARKSRAVVVEFCQLPFLCSGSS
                     LENVSLPLPLTTTTTTTPRLGV"
     gene            <479203..>480564
                     /gene="PAH"
                     /locus_tag="LMJF_28_1280"
                     /db_xref="GeneID:5653339"
     mRNA            <479203..>480564
                     /gene="PAH"
                     /locus_tag="LMJF_28_1280"
                     /product="phenylalanine-4-hydroxylase"
                     /transcript_id="XM_001684358.1"
                     /db_xref="GeneID:5653339"
     CDS             479203..480564
                     /gene="PAH"
                     /locus_tag="LMJF_28_1280"
                     /EC_number="1.14.16.1"
                     /codon_start=1
                     /product="phenylalanine-4-hydroxylase"
                     /protein_id="XP_001684410.1"
                     /db_xref="GeneID:5653339"
                     /db_xref="GOA:Q6WRI4"
                     /db_xref="InterPro:IPR001273"
                     /db_xref="InterPro:IPR018301"
                     /db_xref="InterPro:IPR019773"
                     /db_xref="InterPro:IPR019774"
                     /db_xref="UniProtKB/TrEMBL:Q6WRI4"
                     /translation="MLLRSRLFLEAGMAAAAATLKAQYASPGSNIKGADKKTRCRTSL
                     QVSLSTDKPGELCHLLSVFKPYSINISQVANRPRAYENKAPLRTIFLDVDAYIEDESM
                     KKVMAELHAKFPNVVVTGSWVIPWYPTEPKDLDELDQSTLAAGEELQEDPENPHPGFH
                     DEVYRARRREIVGLAKNYKTGDPIPIVNYTEEENRVWTVVYDHLTRLYPTHACQQYNY
                     VFPLLLENGVLSRTKTPQLRDVSEFLNEATGFTVRPVTGLLTSRDFLNALAFRVFYST
                     QYIRHAAQPLYTPEPDMVHDIIGHLPLLSDPDFANFTQTIGLASLGASDELLDKLAKV
                     YWYSVEFGLCSEGGRRKAYGAGILSSCGELEYALSDKPECVPWDPTMASKTPFPITKY
                     QPLYFVAESFSDAQRKLEAWLSSQEKPLYTVYNSYSRRVQSYPKNTWNMLQEQMKRTN
                     FTF"
     gene            <483253..>484572
                     /locus_tag="LMJF_28_1290"
                     /db_xref="GeneID:5653340"
     mRNA            <483253..>484572
                     /locus_tag="LMJF_28_1290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684359.1"
                     /db_xref="GeneID:5653340"
     CDS             483253..484572
                     /locus_tag="LMJF_28_1290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684411.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653340"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8D7"
                     /translation="MTPRHPTRRLVDVLKQNSRKTLDRHAAQLAAAASSLPAEAIQTR
                     FLRNQFLINPKSLQLLSTEEQLARWHVFGVYKPPFCPMRRAEAADNYHSVSVESFVES
                     ALQAKDIYPVLKRVLKPSEVRVRVLYNLDSFASGPVLISVSDAHRYATSLQTTAMEYD
                     LLVGGHLPVHGTGNHTVIDVAQLFPGASVPLPSSGVGVDAEKASAVVPQAHYEVKENG
                     YYSVHPVSLLHIVIRSPPTSQPPMLERFAREQLGTCVIGDPLVMGELMQLRANPAASS
                     SRISASSTQESSDSAQKCRGAAEDARSGSKRDPAAQAAAMRLAANPHIVPWRGDCDFP
                     RVFMHLREVRIDTSAETPSSASEGAYAQDSPSMLHGATMAFMGSHHSGSASPEQMHAQ
                     QCAQSQEIQVHCRKCFDGLLHKQLNASCKSRRMGLLDGTWTPQTEYL"
     gene            <485204..>486400
                     /locus_tag="LMJF_28_1300"
                     /db_xref="GeneID:5653341"
     mRNA            <485204..>486400
                     /locus_tag="LMJF_28_1300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684360.1"
                     /db_xref="GeneID:5653341"
     CDS             485204..486400
                     /locus_tag="LMJF_28_1300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684412.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653341"
                     /db_xref="GOA:Q4Q8D6"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR018957"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8D6"
                     /translation="MDWKANALRRRPPSSRKQGAQTHTERSAGVRPHTEDVDQATDHE
                     SSDADAIVIPDTAQLMQSKRLQLLADQLERSLRVLNQKLDRMQKRLENAGRGALLPFQ
                     LRRAKQEKEELKREIMATQRTIKRLIFMSTQMKQMMALKNDVLQRTRARLLEEIKTLE
                     AQVHENSEQIRRGYVQRINMLQRYWPWRQLRELGDTAVGKTFEEELARGPRYRNIGIQ
                     NSIQTDYIVQQLHWLQELGNREGVFRGHMRLLEGMVEDLNDITELLETTMTCTVCGML
                     YENPVILWPCGHSFCLPCVECLAIAPSLYRCPTCGSIGSEGFVHNLLLAETVAKWMFK
                     DKGYGDTQAPLNAIRVYLPRFRQDNIQSRILQLKNNLRESAEGAASPRKDHAERESIA
                     ISYRLY"
     gene            <487407..>490109
                     /locus_tag="LMJF_28_1310"
                     /db_xref="GeneID:5653342"
     mRNA            <487407..>490109
                     /locus_tag="LMJF_28_1310"
                     /product="putative ATP-dependent RNA helicase"
                     /transcript_id="XM_001684361.1"
                     /db_xref="GeneID:5653342"
     CDS             487407..490109
                     /locus_tag="LMJF_28_1310"
                     /codon_start=1
                     /product="putative ATP-dependent RNA helicase"
                     /protein_id="XP_001684413.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653342"
                     /db_xref="GOA:Q4Q8D5"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR025313"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8D5"
                     /translation="MRAARDDAEDMRRAKAQAKQQRWQERQERSKDSREEIDKLQLRC
                     ADMHRELKDIAESNEANTSTEHEYSKFTELPISQRTQMGLERGHYTILTPVQKGTLHL
                     ALAGLDVLGAAKTGSGKTLCFVIPVLERLYRERWSSDMGVGALLLSPTRELALQIFKV
                     MQLVGYKHVLSAALLTGGRDVQEERKRLHAISIIVGTPGRVLHHLQDDAELVLDNLQL
                     FCMDEADRLLDMGFREAITSILAYLPPQRQSLLFSATQTTDVQMLAQMSLKNPRYVST
                     QAITAAPTPMTLCQNFVVVELHKKLDALLMFLKRHPNDKIVVFVSTCNQVKFMHLAFS
                     KILKKMRIPSMCLTSKMKQFRREEVFLTFCRCKSAVLFCTDVASRGLDFPLVHWVVQY
                     DCPESAQTYIHRAGRTARAGARGVSLLFLTPRETPMLSYLHHKHVPLREIAIKPDFLT
                     SSQEIFVALVVQGLKYEAQKAFIAYLRSVYFASNKNVFEVAAVDVEAFAKSLGLPVVP
                     DMSELQNLQRSAKNLPWDVVNFIAQRGGSGADKAGSTLTRKEKHLQATDMYRVMEQKQ
                     RFANKKGALHGDGASRGDSSSGDAGSDDDDFLVKKEPAGASGCGASVSAKAGTVIADS
                     NPLHLTVEERLAGLSKNKRRKLIENADIRVRDLRLNQRIIFHDDDDESDEEADAMGNG
                     GRSGAKGNAAHSSRSDDDADEENDTTVAGLLKHAVLRHREQGCRDVDSDNDDADDADF
                     TATLQTRVQANKADDLERAKKMRRLRRLQRQGRVSRKSTVDESGIKTASGGPRPANSD
                     DNADDGSGDYYDEHVDGSDAESTGSISRLLKAARGELYSDDDTDEDGEEEESLCGSSS
                     AARKRTRGNCTYHGIDSSDDNGSEGDADEVASPPPPLKRSRQRR"
     gene            <491576..>493045
                     /locus_tag="LMJF_28_1320"
                     /db_xref="GeneID:5653343"
     mRNA            <491576..>493045
                     /locus_tag="LMJF_28_1320"
                     /product="putative prenyltransferase"
                     /transcript_id="XM_001684362.1"
                     /db_xref="GeneID:5653343"
     CDS             491576..493045
                     /locus_tag="LMJF_28_1320"
                     /EC_number="2.5.1.10"
                     /EC_number="2.5.1.1"
                     /codon_start=1
                     /product="putative prenyltransferase"
                     /protein_id="XP_001684414.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653343"
                     /db_xref="GOA:Q4Q8D4"
                     /db_xref="InterPro:IPR000537"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8D4"
                     /translation="MFRRTPFWPKVTRSWTKSSISAATAHFPDAVRADPASSRTGSTS
                     AKESRSWKLGDDTVKAEALPKHLQLAVRKLQLYGDIVRFTRPVGWQLLLIPCYWGSSL
                     AVTRALVWEGADPVVLCAPFIPLHLCVQFLLGAYLMRSVGCIVNDMWDRKFDRMVERT
                     AQRPLACGAISMAEASVILLLHLAVAGVIALNLSPVALQACVAITPVWLMYPFMKRIT
                     YAPQFFLGLCFNWGIFVGYAAVLGRVDMAVCLPIYGGAVIWTILYDTIYAYQDRRDDL
                     KCGVKSTAIWIGDRKYILNAMVAPIGASMLISGFLASQSLPYYIGIVLCMYHLHSIVD
                     DVNIYDSWSCAQGFTRNVRLGMYVFLAMCLGNLCWAFASEHEAELDRNTDSAPKSSVL
                     SRFLFLDQETHGPAYTKGSFNWADRFMHPAFVQAESAKLAGATEAPPIPAWMRREYFW
                     QNVSAILLFCGVAEDTVAAWSTFSYEWMDHYNMFSKVSP"
     gene            <494169..>495218
                     /locus_tag="LMJF_28_1330"
                     /db_xref="GeneID:5653344"
     mRNA            <494169..>495218
                     /locus_tag="LMJF_28_1330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684363.1"
                     /db_xref="GeneID:5653344"
     CDS             494169..495218
                     /locus_tag="LMJF_28_1330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684415.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653344"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8D3"
                     /translation="MAEHQQSFFAQAVSPLTPEASLKSRAASIKSASPRHAAADEACA
                     SAPPQRRASAAGSGAVSPAPAPPPRIHDKAWLFHTVLLPFVRTTDFRRDGSAQHHRAG
                     DVQEEAAALLARDNVTHVRPPKSTGHASTSAPVDPAPTFLMEPNHLFFEDTPSPSRGG
                     SLADRYSLRTLYTSRCVSLGMRRPFDRLLQQLPSEAGQGAADQLRMLVARDTYIPAKA
                     CQALTVLLPYCTGLEYINLCNAGLRSKSGCMTGVNALLDALICGPAVSGIGAALHTID
                     LSLNKLDDRTGRRLVRLVQRQPHLRVVNVDGTEIRDRMKARIAEALLRNLKECTPPIL
                     LDEANEKQSAAATAA"
     gene            <499759..>500325
                     /locus_tag="LMJF_28_1340"
                     /db_xref="GeneID:5653345"
     mRNA            <499759..>500325
                     /locus_tag="LMJF_28_1340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684364.1"
                     /db_xref="GeneID:5653345"
     CDS             499759..500325
                     /locus_tag="LMJF_28_1340"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684416.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653345"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8D2"
                     /translation="MNWEEMLKLHKESGYRYQVLELIPDGDDTKGIEATSTPTAASSV
                     TGGNLDHVHKIFFSSWNRTLLEKLEQALQQRYGDDLTVTFSAPHNVGITAKGVTKAWA
                     LERLYALMAPLPHETASTATPAQRLKATVAFGDDLNDAAMLSSVGRGFIMGICSPKLP
                     QQCPELEVIQTNAEDAVARKLREVFRLE"
     gene            <501568..>502569
                     /locus_tag="LMJF_28_1350"
                     /db_xref="GeneID:5653346"
     mRNA            <501568..>502569
                     /locus_tag="LMJF_28_1350"
                     /product="haloacid dehalogenase-like hydrolase-like
                     protein"
                     /transcript_id="XM_001684365.1"
                     /db_xref="GeneID:5653346"
     CDS             501568..502569
                     /locus_tag="LMJF_28_1350"
                     /codon_start=1
                     /product="haloacid dehalogenase-like hydrolase-like
                     protein"
                     /protein_id="XP_001684417.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653346"
                     /db_xref="GOA:Q4Q8D1"
                     /db_xref="InterPro:IPR000150"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8D1"
                     /translation="MTGPFRYVITDMDGTLLSPDHFVSDYTRDTLKTLVHEHGVIPIL
                     ATGRSYADVRIIADNLKAYIWCDGTAAPGARAPASPSRAPVIYLITSNGATVHNGVTH
                     EVVFRTSIDPALAEKLLQLLPSDEEVVNTNAYQNDDWVCRIDWPKMMAVSKESGIRFI
                     HVPHPLPSSSCALGSAAASPDAAARGIAIGDYTGISKIFFITDDAARLAALADEVHAI
                     AKAHGGAPVSLTFSMSDCMDIMANGVTKGEALKRLFGAILPSRDGVDVVADALAHAIA
                     FGDGLNDAEMLASVGKGCVMGNANPKLIAQHPELEVILTNAEDGVAKKLRSAFHLPL"
     gene            <505190..>506059
                     /locus_tag="LMJF_28_1360"
                     /db_xref="GeneID:5653347"
     mRNA            <505190..>506059
                     /locus_tag="LMJF_28_1360"
                     /product="haloacid dehalogenase-like hydrolase-like
                     protein"
                     /transcript_id="XM_001684366.1"
                     /db_xref="GeneID:5653347"
     CDS             505190..506059
                     /locus_tag="LMJF_28_1360"
                     /codon_start=1
                     /product="haloacid dehalogenase-like hydrolase-like
                     protein"
                     /protein_id="XP_001684418.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653347"
                     /db_xref="GOA:Q4Q8D0"
                     /db_xref="InterPro:IPR000150"
                     /db_xref="InterPro:IPR006379"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8D0"
                     /translation="MTSPKIKAVFVDMDGTLFNSDHLISPRTAKVIHALEERGVAFVV
                     ATGRPFPDVFGNLAQTELRPDFIITSNGARVHDAQHNILFACDMDAESVCRLFQLSPH
                     LSEDGVVDPSVQARRILCNVNCRDRWLTNECIPEVRAAFHPSFIYERVDPMVQTAKTL
                     EGTHSMWIRGAHADLVCVQKYVDRELSGEIRCAFALPHILDCFRKDVNKGAAMEKVCK
                     HLRIDLRETIAFGDGMNDIRMLTAAGQGFVMANAAEMVKQAAPELPVIQSNNEEGVAW
                     KLEELLAADAFVG"
     gene            <507951..>508805
                     /locus_tag="LMJF_28_1370"
                     /db_xref="GeneID:5653348"
     mRNA            <507951..>508805
                     /locus_tag="LMJF_28_1370"
                     /product="putative haloacid dehalogenase-like hydrolase"
                     /transcript_id="XM_001684367.1"
                     /db_xref="GeneID:5653348"
     CDS             507951..508805
                     /locus_tag="LMJF_28_1370"
                     /codon_start=1
                     /product="putative haloacid dehalogenase-like hydrolase"
                     /protein_id="XP_001684419.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653348"
                     /db_xref="GOA:Q4Q8C9"
                     /db_xref="InterPro:IPR000150"
                     /db_xref="InterPro:IPR006379"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8C9"
                     /translation="MARMPIKAVVTDLDGTLLDPQHCISNYAAEVLKKIKEKGICFIV
                     ATGRPYAEVFNRIRHCHLAPDYIITSNGARIHDGAFNVVREHNLRPELVESLARVRTV
                     KDPATGAELPKKFTTNIYRGAEWLTDKSIPEVSKAFHTDFQCTDLRERFYELQASELG
                     DVHEIWFAGDHDELVLLDNALREKYPGDLCCTFSLPHLLDCVPAGVNKGNGVREAAEM
                     LGLALDEVACFGDGMNDESMLQVTSTSFIMANAQQRLKDAVPHAQIIGSNADDGVAKK
                     LEEMFFSA"
     gene            <510536..>511744
                     /locus_tag="LMJF_28_1380"
                     /db_xref="GeneID:5653349"
     mRNA            <510536..>511744
                     /locus_tag="LMJF_28_1380"
                     /product="haloacid dehalogenase-like hydrolase-like
                     protein"
                     /transcript_id="XM_001684368.1"
                     /db_xref="GeneID:5653349"
     CDS             510536..511744
                     /locus_tag="LMJF_28_1380"
                     /codon_start=1
                     /product="haloacid dehalogenase-like hydrolase-like
                     protein"
                     /protein_id="XP_001684420.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653349"
                     /db_xref="GOA:Q4Q8C8"
                     /db_xref="InterPro:IPR000150"
                     /db_xref="InterPro:IPR006379"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8C8"
                     /translation="MTSPDNTVAANVYARRPKGVRVPAGLNPYKLVACDMDGTLLNSN
                     HSISDYTRTVLSQLLARGVHIVFATGRPFTDVYRIKRRLNIFAATKLIPTPGLQVVTP
                     VEPSPTSRYPSRSPNNSSHSVLPSTSSSTYSGTGPNETEKIVPRCFAITSNGACIYNE
                     ANERIYERTIDPRLVQELYSMFMDDPEVNINVFRGVDEADRQQQGYTNPSDQPDDKAS
                     EEWICRYPSDLEAALYKESRFTFRVVSNLEKAFPVDRVSEIFFLCYNPEKSSLVESDI
                     NKRMKELADEQKLETSVRVAPSATYCLDIVPSDVSKASALQHVLDKLDLTMNDCIAFG
                     DGLNDLELLSSVGKGFIMGNGNPRLKKKLPHLEVIGQNDDDAVARKLSEIFDIRVELG
                     DIGNPLGSST"
     gene            <515145..>516173
                     /locus_tag="LMJF_28_1390"
                     /db_xref="GeneID:5653350"
     mRNA            <515145..>516173
                     /locus_tag="LMJF_28_1390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684369.1"
                     /db_xref="GeneID:5653350"
     CDS             515145..516173
                     /locus_tag="LMJF_28_1390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684421.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653350"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8C7"
                     /translation="MTMQGQGNNVPQRHQQSQLDSDDESYTGSSGSYSERVSEAPPRQ
                     QQSAAVAERRLLPKAEQGSRPRSLQQTPSPVKRGDVQGTQQEEGGETAQKKGRAARGK
                     AKARTMMNAAWEAPVARVRAVTGAVSGRDSQRVTIYVFFCIAWVHLLFVILSSALSQI
                     DVVGGGCYTFWGYKANCDTVSYTRRTVLLQSCRRVRSALQAGSAFSIISVLASAATLV
                     SSWVLCCRLREADRHVRSPSRYANMGEVALAQEPDCNDGIENGRQADAPVYDAGNLKK
                     VIMIVVAFSLACELTCWALIAAIITERYCDEIYLWSTTATYGAGFGLGLTAWFAELIA
                     YIGFVTVV"
     gene            <519608..>521230
                     /locus_tag="LMJF_28_1400"
                     /db_xref="GeneID:5653351"
     mRNA            <519608..>521230
                     /locus_tag="LMJF_28_1400"
                     /product="amastin-like protein"
                     /transcript_id="XM_001684370.1"
                     /db_xref="GeneID:5653351"
     CDS             519608..521230
                     /locus_tag="LMJF_28_1400"
                     /codon_start=1
                     /product="amastin-like protein"
                     /protein_id="XP_001684422.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653351"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8C6"
                     /translation="MSQVVRRKKMFDDVSSFSEEDDVDDEAMMQHNVKSPPVMRSAHH
                     VDAAASYLTALSATAAPQADSDDDSNAFVPKPASSFQQVTKPEGAGRENAGHVTMVAR
                     VSVSLTPKDSPRAASPAEPSAQAQVLVQYPTATMQALQQPESAGAGDLPWSRAVLGSA
                     SAYSAPAAVSQRQSWPEEVETAVNPEHPGADKASLQKGRRRAYTPCVHSSRANERGGS
                     AAATGGEGAIPAQHPEQMETEAGAFATTENRGEVKSTRLSPDESDDEMYEQYTPASMN
                     RATAAHIEYSGEEYATHYGAHTGLRQGSHSAVSKDKDFPFASYIFPRLNPALADYQGA
                     RTAVAAVKQGEVMPPNAVETCCAYLMVADIRVAVYLIVLFVSVALALVSIPTSQLDVV
                     GAACFTYWGYKDNCDNSTYTIPRPLYPTPYIRRHLGVGAAFSIVTLIVLLVNFAAAVI
                     AVCCLTQAPHTISLNSRIVLGTLGCVGALTQLISWAVVARIYNSGHYAAGELAYGAGF
                     GLNLSSWVMHLLGVALVFAAPSHFVNRRQQRG"
     gene            <527573..>528769
                     /locus_tag="LMJF_28_1405"
                     /db_xref="GeneID:12983028"
     mRNA            <527573..>528769
                     /locus_tag="LMJF_28_1405"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722024.1"
                     /db_xref="GeneID:12983028"
     CDS             527573..528769
                     /locus_tag="LMJF_28_1405"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722072.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1405"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1405"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12983028"
                     /db_xref="GOA:E9ADK0"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:E9ADK0"
                     /translation="MQPAQSSSSPAAKVLAARTNSTLTFWPSTNPTTGPRLFTHSPYL
                     TTGNILVSEDLDAVEFEALGGVDGQRSNQGSPITSGPHQGGSSFNASSNSANQLHSPY
                     GYSNAKKNVCRHFINGNCNRGSSCRFYHPGPIHHVITPTRPRTPTQRPLTPLADLAQH
                     NSASAAQSPAHSPHIRPTSVLLFSSPRQSLKLNSGGGSARSNPESFASPLSSPSTSVS
                     AQRSTAFVESPAHVVATAPALSSPSFGPQFSLGNSLGARARCWPGANPLPSLQLPEYL
                     PNGIDDGTAEACSSATGADMGPLSRPHSPASPGPHRLPVYCAGVQLGASSNSGRGERR
                     AALASPHHHRVPGSSFPAASSKTVTSPRRGGVTRNNPYAYSPTRVQPQLSQPMSPLKH
                     MANGPE"
     gene            <532193..>534448
                     /locus_tag="LMJF_28_1410"
                     /db_xref="GeneID:5653352"
     mRNA            <532193..>534448
                     /locus_tag="LMJF_28_1410"
                     /product="putative DNA polymerase kappa"
                     /transcript_id="XM_001684371.1"
                     /db_xref="GeneID:5653352"
     CDS             532193..534448
                     /locus_tag="LMJF_28_1410"
                     /codon_start=1
                     /product="putative DNA polymerase kappa"
                     /protein_id="XP_001684423.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653352"
                     /db_xref="GOA:Q4Q8C5"
                     /db_xref="InterPro:IPR001126"
                     /db_xref="InterPro:IPR017961"
                     /db_xref="InterPro:IPR017963"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8C5"
                     /translation="MSVEHSSSAPTCSPPSDVRTEDGHLLSLIHRRAALTATAVSPES
                     PRTLSPLPPVPTTPVGTPPTTLVLSAAHTPLRGTTTSGSDHEYSSNSSGRVKDCDNGA
                     HSSVPASSGSSSHAAAPHGSAHSFFRPNPASTNVTTAPRVVYFDDRKAGLRSAEKEKT
                     EALIKELSKNSSFYVNEERKAQQRQRQVEGLLVKTRQYEASVRSHPDVFRQLQRDVAD
                     LEAIFESHRSFDSIYVHMDMDMFFAAVEMKKNPQYAEVPLGIGSMSMLSTTNYVARKY
                     GVQSGMPGFIGMRLCPQLVIVPTDFAACRVESAKFKGVVREYDPDAQLLGMDEVMMCL
                     DDYLAHHHVDVTTHAGRFDVAERVIEECRRRIAEATGLTVSAGIAPTPTLAKMASNYK
                     KPNGQFAVRLFSREAVINYLASIPVRQVPGIGKSRESILAGLGIRTLGEVYEQRHRLF
                     YILTRKTYEFLLASSIGIGGMYDSRETAPSSSAGATTGKTVAAMDGASNEDDWGRKSV
                     GHERTFYKLMNRMALQAIAYKNLRRSQETLVEEGLLCSQVVLKLKHHSFHVKQHSKSL
                     NVYTDDHEVLRRALDELLLPVMDDFAEFRLLGVRLEKLRRRPQSDGAGGAATLTVKSA
                     AEAESTPLTLNHFFTRQLANSAYSGRRRQQQQPFTQRKRPRGTGDGGAEDSSDADLDN
                     SDDEDVAVLIVSSESQLTDVEEVKGSVMSSTAPSPLSHRSTGAAERPKEMRDEEVVGD
                     DSADDNVFIVE"
     gene            <536901..>538697
                     /locus_tag="LMJF_28_1420"
                     /db_xref="GeneID:5653353"
     mRNA            <536901..>538697
                     /locus_tag="LMJF_28_1420"
                     /product="putative DNA polymerase kappa"
                     /transcript_id="XM_001684372.1"
                     /db_xref="GeneID:5653353"
     CDS             536901..538697
                     /locus_tag="LMJF_28_1420"
                     /EC_number="2.7.7.7"
                     /codon_start=1
                     /product="putative DNA polymerase kappa"
                     /protein_id="XP_001684424.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653353"
                     /db_xref="GOA:Q4Q8C4"
                     /db_xref="InterPro:IPR001126"
                     /db_xref="InterPro:IPR017961"
                     /db_xref="InterPro:IPR017963"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8C4"
                     /translation="MSPAPRGRYSDSHTEEIAADCAALEDHGRDAPQDSHHPQNHAGM
                     NGAQHYDHRSAGKLNFDASKAGLQQVDKDYVEHVIQEASKGSAFYQKEQRLEETRRRK
                     AEELLEKAKTFDSISAAEKQRIKAMVDTMVDELEATRDLRRRYIHIDMDMFYAAVEEK
                     KTPSLRGKPFGVGSQQMLSTTNYIARQYGVRSGMPGFIGKKLCPELIIVPNDFPAYQR
                     EAARVHSIASRYDAQFVSVGLDELTMDVTKYLQEFPAVSASDIAHDFRDEVFLKTQLT
                     SSGGIGPTSILAKIASNVNKPNGQHEITLLTREEVINYVRDIPLRKIPGIGYAQEMTL
                     GALHIHTCGGLLEHKYLLAYLFREKTLAHYLSVGLGLAETFSLRKHQARQSVGKETSF
                     SEPLPSPEAFTRLFRKLLEQCHVRCVRDHLQPRKMTLVLKYRTYDTEQFSVTLPSHTN
                     DLKVWLEASQKLLEPHLLHYAELRLIGVRLQRFTDIDDDHAGLNSTRDALTGALTEPL
                     QVNDDLDMDADDADRDAEKSGIAAKQSDPYGESPAQPTAAHKRRIPVSKFLTDPNIPK
                     ARPAEPAAVPAKAAKPARRRTKPSKRKLHKKK"
     gene            <541449..>542330
                     /locus_tag="LMJF_28_1430"
                     /db_xref="GeneID:5653354"
     mRNA            <541449..>542330
                     /locus_tag="LMJF_28_1430"
                     /product="putative DNA polymerase kappa"
                     /transcript_id="XM_001684373.1"
                     /db_xref="GeneID:5653354"
     CDS             541449..542330
                     /locus_tag="LMJF_28_1430"
                     /EC_number="2.7.7.7"
                     /codon_start=1
                     /product="putative DNA polymerase kappa"
                     /protein_id="XP_001684425.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653354"
                     /db_xref="GOA:Q4Q8C3"
                     /db_xref="InterPro:IPR001126"
                     /db_xref="InterPro:IPR017963"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8C3"
                     /translation="MFYAAVEEKLDPSLRERPFAVGSYAMLTPSNYIARAYGVRSGMP
                     GFIAKKLCPSLWIRPPHFDLYRREAAEVRVMGALYDPHYVAVGLDELTMDVTDYLRAH
                     QDRSAQDVCAEFRRRVEAATQLTCSGGIAHTAAFAKLASNVNKPNGQHILTLRTREEV
                     LAHVRDMPVRDVPGIGFATEQRLHALGVVTCKDFLARKAELCYLFREKTFAFLPLGGP
                     RTRAHPRRSLQRGARSRRGTAERGGGNEAQLCGTFEITSSSCIGQSIALCAQGGRSRS
                     PCAEVDWEVCHPGARCA"
     gene            <544465..>546642
                     /locus_tag="LMJF_28_1440"
                     /db_xref="GeneID:5653355"
     mRNA            <544465..>546642
                     /locus_tag="LMJF_28_1440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684374.1"
                     /db_xref="GeneID:5653355"
     CDS             544465..546642
                     /locus_tag="LMJF_28_1440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684426.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653355"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8C2"
                     /translation="MFRTARAGHTVALSLPHRRAALSNSRRACGLHRTAGFRKSVKRE
                     EAPSAANAVEDTASQPLTVYHPQADLGAVNVKADLSSLFYDTSVTDITLSKRKLTKDD
                     DDGSFVFGQVPRGSMRKEQILKYVDMDELARASELLEVPDAYTYPLHQMETISEAIVH
                     TMQSRMLMFKYASLDDFYTMKRHIGTDEDVMRATLPGNSIYFQFVHSGSAADADGPAA
                     SSSLPREHAGQQEVKAVRDAVEQILRRYVCRILEPFPNELAIDVTHYATYLPLLNVSR
                     RNVGQVLKDIEDYMAKRPVAKEGIAGPPAKSEIDPLTPDELATEIARIIRREVLTRRL
                     QRDSGCGAQEPATTGAQEVPSSTDAASTASIRVCIGVATSPVLAKVACDAEVLAVVAK
                     LRGQQAATLTSGKGGGRSGVPLVSIRSFHRHIRSMKASRDFMASFPVSRVPIFTPAFV
                     DLLKHTFGIVACGDFYEKRYLLYYCMSRDTARACYTAAFGRMYFEAELIESLVAPENL
                     THSIAPLEFLASNRISIVNEERTDYHVTMRSVILGQLRKKLPNNGCKITQVPFGRLST
                     EDAIHRTAEAAMRSLHRDLYTKGLTYSGVRVTLPRCNLDPVMERLEGETTEEAAVAVL
                     HRVLRKLLPHRHRIDEVLDGAKAGRYVTLGVFGISLIPMVPPIMISEAVRLEKLYFTA
                     KKFFLSHQNRMMKRKEMLTAGGAEKKSSPGKRKPGTVDSVVYV"
     gene            <548206..>550437
                     /locus_tag="LMJF_28_1450"
                     /db_xref="GeneID:5653356"
     mRNA            <548206..>550437
                     /locus_tag="LMJF_28_1450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684375.1"
                     /db_xref="GeneID:5653356"
     CDS             548206..550437
                     /locus_tag="LMJF_28_1450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684427.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653356"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8C1"
                     /translation="MLDRDCLRPPPYPSPSPSPLVDTAPREVRVSAAEAQTSGAAAPT
                     QEGIHKGCMRGNASSKGMRITDRGDARRCALAHAQGDSTTNAAHVRRLSVLFVRSGLS
                     EDRRDEASIAAPGSAAPGGADVVDVDAFSSTDANGEEDMGRVAVVPAHTPRVGHLSLR
                     DAVVLSYRGASDDYVMHHRTVAASCGHGVPPSPVDELLSVATEDSRVLLRRSGLTTEP
                     RTSDVPAVHMWRGCNDDDDEEVQQGESRASMRQSRGGDQFLVWDDCARSLSGVPPAHL
                     SSAIPTTVSSACWKQESSVLLEHARGTLHRVRPRCGTFSATVSSPSPTQQRPLGSSSA
                     CGRCQADFVALSMNSLSLVQSREYGADLAAVHHTAFACEMSANAICMDDWGPHSTVVG
                     FSDGTLRVVDWRMPARGSSLHADNAAADNEETHVALCTHVPQPLWMRHGGRLAAAAAS
                     VAGVLSCCAFEDSFRVVCGLGDASGAVVMADLRRPESGTRLGRRRTRAEQQAAQHLFA
                     EAGGQSPTGRAVTDIQRDPSCFGRIGLVDVTGRATLTTVAALEVSSGGSAAVPSKRCR
                     TKDRAGVPSYLGTTAAARPRLPLPPSPWSVLERLGSLSQTASRSAVLTTILHSIHGDP
                     QRPVIYTVNAQGGSFRTPFPAHPRPRCAFSDDGRHFAHIATKSALTATLRCAGARSGA
                     LGGGPSFSPPPGISATHVQFVPSTASGQAALTPSPLIAVSCVDGLLCFDTGDGHTLAM
                     PIT"
     gene            <551135..>553450
                     /locus_tag="LMJF_28_1460"
                     /db_xref="GeneID:5653357"
     mRNA            <551135..>553450
                     /locus_tag="LMJF_28_1460"
                     /product="putative ATPase"
                     /transcript_id="XM_001684376.1"
                     /db_xref="GeneID:5653357"
     CDS             551135..553450
                     /locus_tag="LMJF_28_1460"
                     /codon_start=1
                     /product="putative ATPase"
                     /protein_id="XP_001684428.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653357"
                     /db_xref="GOA:Q4Q8C0"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8C0"
                     /translation="MASNSHSSDAAASSAPTRSPLEQVHLLLVSLLRWWPYAPHERIP
                     SILLCGPTSNGKSRLVHRVADAANACTDTAMEEVVRVSEKEQGQAVPRGVSADGTAAP
                     TPTSALFHEQHRTHVVTVIPPIAKAVAVHNAYDGTTGLRRLLRRTVYDACVEYRRESA
                     TNSRSANGKPTTTTPPTEIAVLLVLDHMECYLQREDAYIHDSSSSGTADSMTRQSCGV
                     GEPSRDGTSAQSMNTLYPALFADLYTVLRSSPPLFSQHECATLHLARLVSVALFTGGL
                     DEVPPVVRHRYVDYAVALPTPTEAVRRAFFLPYATTCAAGQAPPPLSLPMVDALALRT
                     GGVSYGGLQEVLCLALDYCAVSPSRLSLSPSSASGAVECDEQVASAAAQAILQAYISS
                     GSVTALEYRCSAGFVDVQATRWDDIAGMAHVKETLKRLITNPIRHRDTYRRFRVRPST
                     GVLLHGPPGTGKTMLAKAMATELNASFVYIDLPKLVQAEVGESERRLQEYFDVARERS
                     PSLVFMDEVQAAFGLRYANAAEVHRRRPRSSAADGGGRDEGASTASTATAHDARLVSH
                     LLRLLDAAQQDEEHFVLFVGATNVLHLLDPLLLRAGRLDTLLEVPPPDAAARKSLVRR
                     VVYGEWAHWLCERESDTPLVSADGDSVAAAGPIDATQLENLRTALVEAFVRRSDGLSG
                     AEVRNFTSVFGLQLARAVSRNLEATQDAVVNEALDCTTTTQGPRTGQRKGQLCLRRAI
                     TAFLATSGETEAGLSCDALALLDDAHKKCAV"
     gene            <554476..>555339
                     /locus_tag="LMJF_28_1470"
                     /db_xref="GeneID:5653358"
     mRNA            <554476..>555339
                     /locus_tag="LMJF_28_1470"
                     /product="Qa-SNARE protein"
                     /transcript_id="XM_001684377.1"
                     /db_xref="GeneID:5653358"
     CDS             554476..555339
                     /locus_tag="LMJF_28_1470"
                     /codon_start=1
                     /product="Qa-SNARE protein"
                     /protein_id="XP_001684429.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653358"
                     /db_xref="GOA:Q4Q8B9"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8B9"
                     /translation="MAELQQKHTENMQTVDEARSKALRGEIDELSRETGNAAKAAKEK
                     LDAMSKNTAKLKSVPDSVQANSAIIRIEENQYTHLVLKLTMAMAEYQRQQSANEAYYK
                     AQTQRQIKIKYTNPDGSAIDDSTAAQLAEQVMENDTSSYIFQQSKEVLASIIETRNDI
                     YRIEQSMRDLNQLFNDLAFLVNEQGELMDVILANVQQSTRYVAKGRAALKKARRYQKK
                     SRKKLICVLVCGMTIVALFVVVGVLAATIKIPRATPSPPAGVRGQGRGQVSDSHAGAA
                     KAPPVRQFTVL"
     gene            <557554..>558354
                     /locus_tag="LMJF_28_1480"
                     /db_xref="GeneID:5653359"
     mRNA            <557554..>558354
                     /locus_tag="LMJF_28_1480"
                     /product="Qa-SNARE protein"
                     /transcript_id="XM_001684378.1"
                     /db_xref="GeneID:5653359"
     CDS             557554..558354
                     /locus_tag="LMJF_28_1480"
                     /codon_start=1
                     /product="Qa-SNARE protein"
                     /protein_id="XP_001684430.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653359"
                     /db_xref="GOA:Q4Q8B8"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8B8"
                     /translation="MAELQQKHTENMQTVDEARSKALRGEIDELSRETGNAAKAAKEK
                     LDAMSKNTAKLKSVPDSVQANSAIIRIEENQYTHLVLKLTMAMAEYQRQQSANEAYYK
                     AQTQRQIKIKYTNPDGSAIDDSTAAQLAEQVMENDTSSYIFQQSKEVLASIIETRNDI
                     YRIEQSMRDLNQLFNDLAFLVNEQGELMDVILANVQQSTRYVAKGRAALKKARRYQKK
                     SRKKLRCSVLRKEYVEKTAVAYSPWQEASVQVHRHCCPEGEKWAAWED"
     gene            <559265..>559681
                     /locus_tag="LMJF_28_1490"
                     /db_xref="GeneID:5653360"
     mRNA            <559265..>559681
                     /locus_tag="LMJF_28_1490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684379.1"
                     /db_xref="GeneID:5653360"
     CDS             559265..559681
                     /locus_tag="LMJF_28_1490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684431.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653360"
                     /db_xref="InterPro:IPR006696"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8B7"
                     /translation="MSANIRTALSGTNVPMMAAGLSGGLGVVLGALGSHAFLELMDTN
                     QFKAYNIANQYHLVHSVAMLVVAAIAPRVAEPAATHFRRAYALFACGTLILASSRYIY
                     STVHKPHFLSKLPIMGGAMLAAGWVCVALGGSVTKH"
     gene            <561977..>562375
                     /locus_tag="LMJF_28_1500"
                     /db_xref="GeneID:5653361"
     mRNA            <561977..>562375
                     /locus_tag="LMJF_28_1500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684380.1"
                     /db_xref="GeneID:5653361"
     CDS             561977..562375
                     /locus_tag="LMJF_28_1500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684432.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653361"
                     /db_xref="InterPro:IPR006696"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8B6"
                     /translation="MMSLKSAHVPTILVGCVGLSSFAMDALGTRLQTKMGMRQRRSWL
                     TANQYHMVHTVALAAIAWMMTLAKESPEASSRLNKGFYLVLAGALGFAGSIYSLCLRI
                     CPKFMGPLTPTSGLVLVLGWTNVALAGLYW"
     gene            <564599..>564982
                     /locus_tag="LMJF_28_1510"
                     /db_xref="GeneID:5653362"
     mRNA            <564599..>564982
                     /locus_tag="LMJF_28_1510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684381.1"
                     /db_xref="GeneID:5653362"
     CDS             564599..564982
                     /locus_tag="LMJF_28_1510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684433.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653362"
                     /db_xref="InterPro:IPR006696"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8B5"
                     /translation="MVSIPLLYSGVLGFTGVVAGAVGSHALKAKTAEERNAFIIGSQY
                     QLMHSIAALGAIGLSQAVRSWNPVAAKRLQIAASMFLLGTTLFSGTVYARVFGAPKSM
                     GQLAPAGGYILMGGWACLIAAAVAL"
     gene            <565564..>566046
                     /locus_tag="LMJF_28_1515"
                     /db_xref="GeneID:5653363"
     mRNA            <565564..>566046
                     /locus_tag="LMJF_28_1515"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684382.1"
                     /db_xref="GeneID:5653363"
     CDS             565564..566046
                     /locus_tag="LMJF_28_1515"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684434.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1515"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1515"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653363"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8B4"
                     /translation="MAPKAQPDRMAGGPSSSSKSTTDPMLQGAYEQDESNDLEGSTEE
                     IAAFEARLQQQQQQHGRSNSAATRNISRAPTSGAPRRSSASVINSAHRPHPSSSAARS
                     AAASHRTADRGASEEEHAARTQRGEDIEDVRRLEDRFRGGDDDDSDEETVARRRKMGL
                     "
     gene            <567102..>569027
                     /locus_tag="LMJF_28_1520"
                     /db_xref="GeneID:5653364"
     mRNA            <567102..>569027
                     /locus_tag="LMJF_28_1520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684383.1"
                     /db_xref="GeneID:5653364"
     CDS             567102..569027
                     /locus_tag="LMJF_28_1520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684435.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653364"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8B3"
                     /translation="MADNEVDVILQNYFAAIAEKDSDALKLYEDNKRMRRLVEQTLKA
                     REELEAQHCTTQLLVTSLQNDLREKQHIIETQDKAIAVWRDGIAELRSALERPSEVDH
                     GLSDVVDDVRRMSAELRSLRQGMQYAQWCCNEWEGYLKESLVASEARERRALESSAAH
                     SLQALCEAAAEVRRVWMQAAAQEAATGSTIARWEAWHATAQQERESAAEKHAQALHRA
                     ELEVLHHARRAEAAHKKADEMVQRMAAHEQEERVAHEWRALEAKTQVGLVDLLVRRCT
                     AAEEKWCDAVREVRTVAHRLQRTMEELSRLSEVHEQTLVEQEQNRLRVSKLAKKVEQL
                     KEQQSEMEALQQRCSSQQEELQALRDKYVAIADKERNLRYQLSTSTENAAAKLLSVEE
                     SLQAAERRATVLEERLRTTQEARAAQKDIAALRRQVEQHHATDAVLKVTQQQLRETEK
                     HAFNFKEALEVLKAEHQAQLQAERDRHAAEIVALAEANEDALQSQTAEARARVVEAEE
                     RMQRAQETAMREKEALQRELQAWTAEVDTLKSELARGLQRAEAEKTAREVLEQQNRSE
                     ASVVRSMVELSFDDARRGLQVAELQGRLKSVQQRNRLLEEACRRSAGVIAQLREALYR
                     EQMTLRALRLKDDSLSA"
     gene            <569747..>570916
                     /locus_tag="LMJF_28_1530"
                     /db_xref="GeneID:5653365"
     mRNA            <569747..>570916
                     /locus_tag="LMJF_28_1530"
                     /product="putative ATP dependent DEAD-box helicase"
                     /transcript_id="XM_001684384.1"
                     /db_xref="GeneID:5653365"
     CDS             569747..570916
                     /locus_tag="LMJF_28_1530"
                     /codon_start=1
                     /product="putative ATP dependent DEAD-box helicase"
                     /protein_id="XP_001684436.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653365"
                     /db_xref="GOA:Q4Q8B2"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8B2"
                     /translation="METEQVDNIQANVLAIPTFEAMGLKEDLLKGMYSFGYKQPTAIQ
                     KRFIMPFLKGRDVIAQASSGTGKTSAFCVCLLQACDPHTRETQALILSPTRELAVQTQ
                     DLCNNIGHHMGLTAYACIGGKSTEEDIRRLESGVHIVSGTPGRVFDMIRRKSLRVNGL
                     KTLVLDEADEMLGKGFKAQIHDIYRMVPPLQIILVSATLPADVLEMTEKFMTEPTSIL
                     VKRDEITVDSVKQYFVSVDEEKNKFDVLMELYDSLTIAHAVVFCNTRKKVEQLAKKMT
                     REKFAVSAMHGDMPQAERDEIMRQFRNGHSRVLITTDLWARGIDVERVSLVLSYDLPL
                     AREQYIHRIGRTGRMGRTGLAITFVRHDELRLLRDIEQFYATQIEELPANIGEQM"
     gene            <573809..>576379
                     /locus_tag="LMJF_28_1540"
                     /db_xref="GeneID:5653366"
     mRNA            <573809..>576379
                     /locus_tag="LMJF_28_1540"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684385.1"
                     /db_xref="GeneID:5653366"
     CDS             573809..576379
                     /locus_tag="LMJF_28_1540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684437.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653366"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8B1"
                     /translation="MVSTEQKKPSSPTLSKLTLESTAPQPTLTSLQNANSNSTMEVTD
                     AISVSSGTTITVATGASARSCSPYVSPYAVGLDSVGAPHDVEPDDLVTALASSARNQG
                     DLSPSESMMGGSHVAEGPPVHPPRALPKRKYPKLLTQLAREIRWMHKNLRHGHNSNVT
                     PRVSCIYGASPSPSSLSSGSTCIGEDSEDLLFTTSLRSSIRRSSSLQSAMMSHGGSSP
                     THRTRGAASSTKLCRRTPESGEVEQVQPAALPEVTPDPYAPPSCQYVLRDLAFVAPGG
                     DVFGSARNSSSASSVMCAASGGRVDRAAAAFGTTYVAESAFSLGKDSSMKGHGDSPSA
                     VDFGRDDTSDVEAVSNVAAGPSDRGGLTVDCARLPSGIHEGAQTGSDAAASGDSYQVF
                     LSSVVDLQCRLHNLEQQTARLRALYAQERRARLRFKGKGQHLSWTRTVEAANTIHFWR
                     QKVSILRLFESQYLSVLKSFQHELQLVDPKAEKAQQLRRSPASAAAEPGATAGVMQAR
                     RTFLSSLQVIAVQEQHLTKLGEHMEACWKANAVLREDLRHLEQCEVRVPHDTFATAGM
                     DVEHFIASLPPRTSVCGLHSVLSHASVHSLDSLGSTETPMLLTAQNFSFMSSGGDGDD
                     NIGNAASTDSRATGAHGSGSNGSSHSGHHPTSPSPCGANASPFISKRLKYVIRSVALD
                     HEECGGDSLSSRIASSYIGSSMPATNSQTRRRSERHVTFALEPEVLDARPRFSAYSRT
                     VELLEQICLDKQSPWNALSLLQSALEERRGQLAQLRGQWDGALTGEAPTLTSSVTPKP
                     CTITTSSGGGAVCHSRDKTTVPSPKSFPSATTSTLMTKGKSSRYSKVKPKACTTCSAM
                     "
     gene            <580440..>581159
                     /locus_tag="LMJF_28_1550"
                     /db_xref="GeneID:5653367"
     mRNA            <580440..>581159
                     /locus_tag="LMJF_28_1550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684386.1"
                     /db_xref="GeneID:5653367"
     CDS             580440..581159
                     /locus_tag="LMJF_28_1550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684438.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653367"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8B0"
                     /translation="MDSLFGRSQAKVKLDDVAYDKSAPRYSGKIFGMPADNVIFYSKV
                     AASTFVMLAVVYVFFKGYVLLSRFSLQTVARLGFMSGFACCLICYTVVLSLVRRYRIN
                     AETVYNQSIALVMHNEKVVQHLGTHPRTGDFRTYNATGGFKLPLMRRIRSGSYELSDL
                     LGLKQRRLQMLLTLKNPSSGNEGLVSCDVRKESTGFLTSTNVYKSLSITLYSENKTTE
                     PETIILIGKPEDVVYRSFILR"
     gene            <582613..>584298
                     /locus_tag="LMJF_28_1560"
                     /db_xref="GeneID:5653368"
     mRNA            <582613..>584298
                     /locus_tag="LMJF_28_1560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684387.1"
                     /db_xref="GeneID:5653368"
     CDS             582613..584298
                     /locus_tag="LMJF_28_1560"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684439.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653368"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8A9"
                     /translation="MDIPLRLRLAYANYLGEVYCDRKPVRCDAQPPSRHSPYTGKGAE
                     SDGRHWLSSLVASVGSNQSGETLLHADPEANATLLSPRVATVVMETRTPPSLPNADPQ
                     PQCVSEKREATDPSAAPSLQPCDDIRDGPQLPHTETLVDETQPESPHTPSASFSRTAP
                     SPPANALEPHAPEVTRVEAAVQASVAVEMEADAAARAREVRVSEELAGTHEALLADVT
                     AALERRLRECVWKTVTLDNAQQQLTCAFHPPSSASPASSSRPPHLLSSTPLTAAAFRA
                     SVAAPPRAQLAKQAAPARADASTCMATEQDAARSELADAPTEAPAARAAAAKVAAPLP
                     WLSANRTDASLSDDAKKEIALHLYSLRRQVQQLRDQLEAHESTHYRHVNALRAAQKQR
                     QGRLPLPLRVEIVKAYEDDPVPYRKGPWREADFSAARRGGPGRSAGGMEEDAAGAESY
                     ASDDFTEVTSAALTVVSTDDGRASDGARGDDGRGSSVSSTEELFRQRQAAALRARNQQ
                     AGARSAAANAASSSRNRLSDSSTDYSSSSTDTSSTSTLTTTTTTSTDNDSDSD"
     gene            <586390..>587430
                     /locus_tag="LMJF_28_1570"
                     /db_xref="GeneID:5653369"
     mRNA            <586390..>587430
                     /locus_tag="LMJF_28_1570"
                     /product="putative hydrolase, alpha/beta fold family"
                     /transcript_id="XM_001684388.1"
                     /db_xref="GeneID:5653369"
     CDS             586390..587430
                     /locus_tag="LMJF_28_1570"
                     /codon_start=1
                     /product="putative hydrolase, alpha/beta fold family"
                     /protein_id="XP_001684440.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653369"
                     /db_xref="GOA:Q4Q8A8"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8A8"
                     /translation="MSTTLPLSSEVVETSVPPTRKSNTSPALSSQARDILGDFEDKFI
                     EVGTCASTGKRVTICYNTFGDPSNPCLLLVQGLGNSLLGYSLRFVQLFVDQGYYVIRY
                     DNRDAGLSTQFDDFDPPALIRLSLPQWMSIRERQPYVLNDIMEDGMGLLTALNIRQAH
                     VFGMSMGGMIVQLMAIRYPERVLSLNVLFSHAGGADVVNPSLLQYARFLVKPRSNSAE
                     DRATHMAWFIDYLSQGAYKNNLEKVKKYILSTYERNGVGNDRGMQRQAAAAMRAPSRA
                     KGLRKVICPTLILHGTKDPVIPVANGYRLADLVPNAKLVIFPRLGHDLPVELMKPIAD
                     EVLLNMSLVKPS"
     gene            complement(<595610..>596857)
                     /locus_tag="LMJF_28_1580"
                     /db_xref="GeneID:5653370"
     mRNA            complement(<595610..>596857)
                     /locus_tag="LMJF_28_1580"
                     /product="phosphonopyruvate decarboxylase-like protein"
                     /transcript_id="XM_001684389.1"
                     /db_xref="GeneID:5653370"
     CDS             complement(595610..596857)
                     /locus_tag="LMJF_28_1580"
                     /EC_number="4.1.1.-"
                     /codon_start=1
                     /product="phosphonopyruvate decarboxylase-like protein"
                     /protein_id="XP_001684441.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653370"
                     /db_xref="GOA:Q4Q8A7"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8A7"
                     /translation="MLRCCRRALEGNKQLSPEYLVRSLKKHGTSAFFGMPDYYLCPLT
                     SYLTDKTAAGEYVMATNCGNAMAMAAGYYLSTLRTPCVFMQNSGIGDSMNPLLTLFHQ
                     DAYRMPCLVLMSWRGKVDTADEQAKPGLVAQGRLTEHCLAAIGIPYAIMGNSLDVAMS
                     WDVTMDKAYHHLASEKTPFAVLLEPGTLAPYMQRRPDADALPTAPLDHDAVANQVCRQ
                     FNATDAFVCSCGSVQESLRRARATISGDTAAQDLLLADSPGHAAGVATGIALSRPSLQ
                     VVCIEGDGAALVHLNAMATNGGLKAMKNVTTGAGLLQNFKHIVVNDGCYSMEGGQITA
                     AFDASLTGVAKACGYFAVREEPVIELGDLVASLAELRQCDGPAFVEVVVSKTRTSSAD
                     GRVRRNLQAEKLRFSEFLNQPNA"
     gene            complement(<598396..>599676)
                     /locus_tag="LMJF_28_1590"
                     /db_xref="GeneID:5653371"
     mRNA            complement(<598396..>599676)
                     /locus_tag="LMJF_28_1590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684390.1"
                     /db_xref="GeneID:5653371"
     CDS             complement(598396..599676)
                     /locus_tag="LMJF_28_1590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684442.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653371"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8A6"
                     /translation="MESLQMRWVECPLLDAANLVLHSPSSSEDDDDDDPIDLLNRREG
                     HCSAVVYPATPIDMSAASSRDSWVLVCGGYSNGSVSATPLVARTSLLPALQWVRLPPV
                     DALECDGATLTTVVSAVGVDAMPATATAASASSCVCATAAPVAYLFGGLGADMNRRNT
                     LYTVALHVDADATPVMVQVDEVHCTGTPPEARVRHGAGGHAGRLYIFGGETDTQEQSS
                     DLYVCDVQAGVWRVLASPSSLPSPAPRLLSLSLPFVAPTTFVLYGGAHFVNGDLRSFS
                     DVWRFDLATEAWSVVVPPQPDDGTPGEEEWRADVPQRVLPRSNGHAGGVFALRLSDSA
                     TYVCAAFLGGKNVSEGDDAVKFVCFHLQANTMEARVRHATPAAVSGKLPHWRYTPTVV
                     NTEKGLLLLAGQCRHPQTPSAFLLTVSIGSAEGG"
     gene            complement(<600306..>603689)
                     /locus_tag="LMJF_28_1600"
                     /db_xref="GeneID:5653372"
     mRNA            complement(<600306..>603689)
                     /locus_tag="LMJF_28_1600"
                     /product="helicase-like protein"
                     /transcript_id="XM_001684391.1"
                     /db_xref="GeneID:5653372"
     CDS             complement(600306..603689)
                     /locus_tag="LMJF_28_1600"
                     /codon_start=1
                     /product="helicase-like protein"
                     /protein_id="XP_001684443.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653372"
                     /db_xref="GOA:Q4Q8A5"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR006554"
                     /db_xref="InterPro:IPR006555"
                     /db_xref="InterPro:IPR010614"
                     /db_xref="InterPro:IPR014013"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8A5"
                     /translation="MPEGTSASLLAASPLGSSSAAAAASPPPSSPPLANSATLALPFT
                     PYPVQQEMIGTIAAVLHSASPHVVPVAAVEVPTGCGKTMALLSSVLRYQQELKRKSPK
                     ELDAYLRQRRPLWHQRRPSGAKRKAPPKERGCQRGPQQRGAARLAPVAGGGIDTDEGD
                     TDDECADGWSVPPSFFRHFRVNSHRKIRAELDVAGSQELRRRFLPPPCTVYYVTRTHA
                     QLRQAVRELRRLHGATSSIRMNILGSRERYCIHPKVIASKANHTLPVQGNNLGEVCDK
                     LVSLGLCEMVDKYDELSCSAIAGPVGHQRGQIWDMEDLVLEGTSRHMCPYYAARDLVF
                     YADVNFCTYPYLLDPLIRHETKMEAALKNNAVVVFDEAHNVAAVCQDALSLECPRDVL
                     ALILSELQPLVSNQVPLARQPVSAASSTAGVAQGDFATMQYPRELHLGAFTLVEIFSF
                     LCALFQSLSVFFDVAMEAAGDRGRRGEKRHRGDEKGGGDEHNGRDCGAAYMQGTQLEH
                     HLRRDMEAHVAAYRQRTAVQRHFAAPAPVLASLDLFQRAYGVVMALGVTFNPFLFSVF
                     GLSMLKRWLLLLRFLLQKPQSFAVALRPAPSWDGPAPSGSDTERSFFGACSAAAVVAE
                     TRPATGGDSGAVCTHAVVAQWTIGLQCLDGSLAFSHLLKTVHRVVLASGTLSPFPQLA
                     RDLGVEASLWRTVEGLHVVPPTQYSLTALTALPVSSSSTHNGTTTQPSLLPLRCTYAS
                     LSNPVFLKTVARAVVQLTQTLRESSGGGVLLFVPNYAVLTALAKLTREVLLVAQREQQ
                     HQSLHVAAPTQLFLEPRKAEALTEVLCQFQNCTQAPRCGTALLFSVYRGKASEGLNFT
                     DDMARLVLCLGLPLQPLKSWKVIAQRAYSGPDWYTTDAVRAVNQALGRCLRHVKDYGA
                     VVLLDERYAQPEYQERLSKWCRATLQTESSLPQLCAGLRTSFTQWRRAFGALAMSPSP
                     LPTPSAAADRAVHRDDMEGVAHQDAASLARIRLGTEQLPFTRVLRAPSAVWRPHRTVG
                     PASDATASDSSPQRSGAARLACTAPGAGACARQSATASAGLLHSPLACTAVKLLYETA
                     AATGDVSRQALQDAIQSLAKNFFDSSGSGEEEEEEDAFE"
     gene            complement(<605349..>606437)
                     /locus_tag="LMJF_28_1610"
                     /db_xref="GeneID:5653373"
     mRNA            complement(<605349..>606437)
                     /locus_tag="LMJF_28_1610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684392.1"
                     /db_xref="GeneID:5653373"
     CDS             complement(605349..606437)
                     /locus_tag="LMJF_28_1610"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684444.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653373"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8A4"
                     /translation="MCVCVCREFCRTSSLPPLFLSFFFIRRECAMQDMYAPRYNGKSP
                     QQWERGSAVSPAPMSTPAQPYRTPKDDAPEYDPLLWSNTDTSYIATLATHAMKYQPPS
                     TSQQGGPQQRGTAASKPPLKVFLSSSWRATPQEGAATQHPKFHSVYHRGPTTWPGRLL
                     RFFAPQLYARWQGNVSTADVRQLCTKELISLMQLALSAGEVDQSAMLARELSRRKLAL
                     QMKLSPQQAVAPGAEVMIHGSPSPPNPDSFPTCPTPHPLASASGSFNDGGAGLPTVYL
                     SGTHGPSLGAASWQRDQSTADYDSDRFANRTGLSSLNMPSVWASDLPPEPFEYASPPT
                     LATAVGVRRSSLHELGSSGSWTQNTQWR"
     gene            complement(<607019..>609565)
                     /locus_tag="LMJF_28_1620"
                     /db_xref="GeneID:5653374"
     mRNA            complement(<607019..>609565)
                     /locus_tag="LMJF_28_1620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684393.1"
                     /db_xref="GeneID:5653374"
     CDS             complement(607019..609565)
                     /locus_tag="LMJF_28_1620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684445.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653374"
                     /db_xref="GOA:Q4Q8A3"
                     /db_xref="InterPro:IPR001656"
                     /db_xref="InterPro:IPR011760"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8A3"
                     /translation="MGGFVTPHMQGFNGLFRQQWQDFHVTEMAVEDGSSPKTCEEAAL
                     VVADKDGAHQAVKHLGSCGGRPLSRDFKFSTPPLLSLLIKQEGDAGVPGRCKDRRTAG
                     CRREEAPDAAAQASSEETSFFQVDVRARVQQLQEEAVAAKDRQAAVEALRREERRHWP
                     RLPPAGAHGFTAGEADADVMPSSGASHDSSSCGRTSALCDDGASTDAAPYACESERPR
                     CVSGGCVKSERDVLDRSTDGGRCHYLQCTLHKQHMAHGNALAHIAQILRIHPRSISVA
                     GIKDYIGDTVQRVRLENVSPAAALEANRHFRRKGLHMKLSDFSYETRPLMPGDLFGNH
                     FRIVLRDVSVPRAVLADAIAAFGENGFPNYYGCQRFSWFGGKQDAAFALLRHNWLAFA
                     FLFLNYTDKDRSLRELLQRPKKYPHPTQDEYRRRVVRRLRQIAVEPTDLDAAPFLSCP
                     PLSAVLTHTDGQPFNKVEELICAQLRDAYFDLHVQSRRLTAQRLSSFLWNQALTLRLH
                     HVGGARVLDGDMVAPAAIRQLSTSVEDRRDWFHTFGDRVTAENRHRYTIEDVVHPGFS
                     FDGIALPQNIVGAYYQQICDKYGLDWMAQHSRSGLKDFREPPRPIVRKPLELSYEYDE
                     SACVLTLRFTLERGCYANVALSELMKSARCLGAETVTVLPLPEALWNGLGEVDPGYVT
                     TLQDIYEGYEDGVGFVNDEARVEVANGSETKVWDHQGPLFIPEAQDPFRKAHRWGSQH
                     LLRNSERREREAEDMKRLLFESSLATQLKEGEVDTYAGHTVPLPPNASAKRVYAKVMQ
                     RKRRYTGSPRMVPRMRRSTTPTSHRTGSSGPTNSLPSFQSLNKNSWNFTW"
     gene            complement(<611723..>613600)
                     /locus_tag="LMJF_28_1630"
                     /db_xref="GeneID:5653375"
     mRNA            complement(<611723..>613600)
                     /locus_tag="LMJF_28_1630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684394.1"
                     /db_xref="GeneID:5653375"
     CDS             complement(611723..613600)
                     /locus_tag="LMJF_28_1630"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684446.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653375"
                     /db_xref="InterPro:IPR021777"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8A2"
                     /translation="MHISNTTFLEMTSSASSAMVEITVQDPATHHERPFLCALGPLRT
                     HMRYFEPLIQRQINEAKVSPPPESSSSLAVAFTLRARCEHATFQWLINWISGKAPQIT
                     NSNVVSICLSSSFLQMQELSDNALMYLSAHLKEIVSSSFDLTNLPTHLVLRLSHMVRD
                     VDLAAALLRLHEERSANHPNRAFVASLLQHYVCHKVGVADGADVSSQTDAAAKASSDI
                     NGGAWPPAGLPATHSGQLTLPLTCGLRWCRLCATLFDEGELDRLGRTSQLSGPECPAQ
                     SGPTSHTGDKAHHASIAGRRWCVGPRGEVFTTHAAARHATPVILEAPPALKGSEVSAS
                     TLAAEAASPFTAELERWAWRIIGAIRYVGCRRCFHLVSLLDVSKHRCSELPKKFSFPD
                     NVAEDVKYLFLWFDYCAEHNVYEREGGLTPMRYSGPAHVLAEEVVEVPTFNSTPEPVS
                     RGAAATTASAAESRNGVRATGLEGTGALAVGSSGGSSSTALASPHSSDICLWATMPFY
                     VKEAMSENVVDIDILNYVERQHRFGSEAQQHRASAAQNYSAMRLSISPVVAGTARGHA
                     GGPLASSSSSPRPLSSIGGPSSGGTASRFRANNSVGARGSRSRADTHTSPYGSLSSTH
                     R"
     gene            complement(<618755..>622864)
                     /locus_tag="LMJF_28_1640"
                     /db_xref="GeneID:5653376"
     mRNA            complement(<618755..>622864)
                     /locus_tag="LMJF_28_1640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684395.1"
                     /db_xref="GeneID:5653376"
     CDS             complement(618755..622864)
                     /locus_tag="LMJF_28_1640"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684447.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653376"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8A1"
                     /translation="MGGAPSRETLVRHIVRDPRVRGSTAPIFGHSASPGANNAGKPPT
                     DVPTVTSHQPEIILIPLIPDYFPSSASPLFQQLLHVRREANVAYYYRDARSMATEHTV
                     LRDQIGSDKDIYNWYMSLSEQRLLETDNELIVLSRAGRVVSPVPCAVAFVYEASATAA
                     VAASVAAAGGAVTSTTDTPSLGSSIRRGKKKNGGNGRLHRHGKVSGAGASNGYMTIEN
                     TARLPHCNLRVRIFGFVGDTRFCPPSMHHSQAARLPMCLTIFLSKSAGGNYRAQVTLL
                     AAHTYITQMQAIGILRPLDEASLVGGGVVQRVAARAGVKANAAGRLPAATGAGSAAAA
                     YRDPYVDPYGADLPAAADPYAIAGDDDSSDVEGKHHLPLHMTSLVPQDGLKTHLEGLG
                     TMITSAAADVAKETVLRRPIEIVVHRADVPALCYLREIRARMDQSSACATPAVSEKKS
                     KAPTLLSCAKPIATAATMTSSSRGASNEGGCGGDICAAPANSNASLRKSCSPNESRAA
                     KTTDASSSISAVATHPGGDAAEVGSESLRYQIRTVIRADELRGSVAADSIGRVLLWAS
                     RFYTGHFEQLVGGEAAKLRQELAQRNLTESSLDGTLLLTDEEPRPPRVTPKAGDVWIP
                     SNEAYVEAHDTEHEGDGWVKVAAGTVLRYVTSASSDSLNPAPDAFWRVSPNEFAEDIL
                     LTLCRQACQASRRAPPTDSHWLLNGKTGVPEGLGMGLLIWRELCAGQVVFYGTTPEFL
                     KKWIQSGADVEQAYRNYVKRSHSSKEATSAAETEFGGATAARDDDAVAGAQSLSMTVA
                     ATTAASSGLHSSYEGNFLSNPSDASDGPDKSGRSDGRRDKGSDPSSMELYSAHTGFVS
                     TSVQAKAILSPTLPTESGSHVDDGAKPKRVRTDDQPRTPSASTPAVAVSRLAQPHNVS
                     GTPSNDAREGRVAPAQQRLQVDLPVASSTSIAVWTHSSSTVGTPNSHTGASLASASMG
                     SRTSSASLSYRQPSQRRSPAAAATTCWIGVPESAPADNADVPTVNVVVRQRRSVRATP
                     SCSATVGTTPLRAAQMSDSSHHFYTSRGVPSTPSVSTQPSVVGTASGASAEYSAQATG
                     SAAIQPCGSTPVRIPGRWGSSEDGSHRQGWHSSASAEQGQYLRAAGELLSHSCTSNNA
                     TGLVDARRPPPQRSATMAIRPGYGTGNIASTPRLAATPAKWSTSSAAQPSSMRGASIT
                     FASGSASLAHVRHASLLHSIRYTEPFQPASSARSSSTLTAELLWSSFCSNPSLIYRKG
                     SLCPPQSDTVGGDVGSMHALQHTPVLQSSADPVRRGCGAVSPAGMPAVVTALMAGTPR
                     PGGEAMTVPSSGHSSAAHTPRQGDLVNSAKSSVGSGKYRWDWRGVSWPA"
     gene            complement(<625355..>627910)
                     /locus_tag="LMJF_28_1650"
                     /db_xref="GeneID:5653377"
     mRNA            complement(<625355..>627910)
                     /locus_tag="LMJF_28_1650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684396.1"
                     /db_xref="GeneID:5653377"
     CDS             complement(625355..627910)
                     /locus_tag="LMJF_28_1650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684448.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653377"
                     /db_xref="GOA:Q4Q8A0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8A0"
                     /translation="MIRKKVLSIGNNSATLLVQDTEAGGALRVLRRMNVAGWATEEVG
                     AAVRMYEDLQKCRLRGFVPIHTVLIQSSFLSVVASYASEGDVTTLIEEEEYSSLEEAS
                     VLRWLCACALAIRQLHLHNLFFPGLTGDRLFLDHHTGGTANLLLGVPLPLPVYYSQLQ
                     ERKKSGVRVALDYPPEVLAAAAAHPNGSGEAANHRARSGSGYHPTLSDVWCLGRLGVV
                     LLTAKGTNMARRSGTARQLLSRMMTDEPATRPSMESVVQSLVALAGNVSLGQPPWPSH
                     LSTAHSTTSVQFASANSAPAVPSRQSHIAASGSAGGSAATVVQSAAAENRSAGGGAPK
                     AHCTTKGASHGRASSPLPSSTTSSTPPDVPYTRVHNSQRHSAGTPATVEHSSPPPPIS
                     APTLHLGHPGRLTHAPDDSWYRRAGEKFELLQRMNASPPKQHAFIGGGEAPQGSSRGE
                     HGHHRLRGSTSNHLNTKSPSPRRNSRGGLIDHNTRVLDDIFAEQGELLRKAGIWRLSP
                     QRRVDDTKQFQRETLRQLRLETAARQQEMRKHFTEWQRQNNQRLTDADNVDVIDQDGI
                     VIVAPRPAPPHEFLAVATAAPAAEREEMDTGVEPQRSRTQLTENTQSDASPCQTPLPA
                     SPPPPNSASRPATPRTKTPAGGSTPAAAVNAYSTRYSGNMPQPSHTSLSTQEAYGARG
                     AGFSALPLCGATSPRLPPPPPPNLVQPCPPPTSDSSGQVTSPSHESDECPTHSADGGG
                     RPALKSSTDVGTLSAVEWTIDGIRSTLRMLLRNRNLYGETMQEVALFISQPEEARLAA
                     RANEIFMKRLRKLLRDDALFFGAVPLCAQLAALEGLGHTLRDSSSGRPSRQRH"
     gene            complement(<628717..>630957)
                     /locus_tag="LMJF_28_1660"
                     /db_xref="GeneID:5653378"
     mRNA            complement(<628717..>630957)
                     /locus_tag="LMJF_28_1660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684397.1"
                     /db_xref="GeneID:5653378"
     CDS             complement(628717..630957)
                     /locus_tag="LMJF_28_1660"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684449.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653378"
                     /db_xref="UniProtKB/TrEMBL:Q4Q899"
                     /translation="MQCALRHCSTKLPSSGQLQQCPTSSASVCDNDVVTYAPWEVRAM
                     VLPLLPTEVVFTEHRAATRKGTRELWNRPADVQQQLPRTLRQFLEREYRSKDRPHGSQ
                     PSVGTPQYGEQSALTQYMLCHFPEEVVLLPSGHLALRVAHAPVTPCEASTSGVGAAPT
                     SINIPLARTDAALPSTGSTATPLDGSKAAGSFPAAPAQQASASNTVPPPPQHSLGSSV
                     SKPHALRCTAATHADRTAPPPPPTPQGNSWRYSSGGKAATVAGGGLVAPRARFSGAGV
                     SNASPGPADAAPAEASEPEAGTPVPLRSTLQVMEALVPYIPTFYVSIEAIEPTLPREI
                     QRLYTETTFRFYLKRFRHYIDMRPSHNSLEIRLRPDFDHPQRGYADARFAVGSFSGVY
                     GMQSGAQPLRRPPRNSEANLIGLVAPQVPKEYTALADVLQDIAPIISRHPAFDPRLGV
                     TGLLGKYPEYFQISQGKLRARPYRVAPNSLDDRDASTSPLPSIFARVLAVVTEAAAGK
                     DYGAAEEKASAAVSTGRLYSLLTEAEKTQVKTQCRSFPTFLRMHGKEIVVSTDKMKVY
                     RFFPEYEACVDTLMDERLRMNSLRPDDPVLKIPTEIAPELNADWAVRELYDALPLMQC
                     AELDEVLSLVPTAVRDALPRDLAAVQAVLDSYPEYFATWPYPDDPSVIVVQRAKVEQP
                     NLEKADIVQMVLPLIPQGGTTLASLRTRVPLVLQRHFSRHGTVATLSAMTDVFAISGD
                     RIVRLV"
     gene            complement(<633345..>637316)
                     /locus_tag="LMJF_28_1670"
                     /db_xref="GeneID:5653379"
     mRNA            complement(<633345..>637316)
                     /locus_tag="LMJF_28_1670"
                     /product="zinc finger protein kinase-like"
                     /transcript_id="XM_001684398.1"
                     /db_xref="GeneID:5653379"
     CDS             complement(633345..637316)
                     /locus_tag="LMJF_28_1670"
                     /EC_number="2.7.1.-"
                     /codon_start=1
                     /product="zinc finger protein kinase-like"
                     /protein_id="XP_001684450.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653379"
                     /db_xref="GOA:Q4Q898"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR024311"
                     /db_xref="UniProtKB/TrEMBL:Q4Q898"
                     /translation="MFYSLFRRRYTARSVPATSGRHASGESSATAAPAGANDLRDGNA
                     GPRPLTPRGAAATTAPPHPNSSAASPVAHGGDRRVFEGEERLLGHLHVPRQYPLDPEK
                     DADALVLLAQQYFITSVVITHYRVKESYVEYVIECVRGHDAWRVYRRYQQFKALDHDL
                     KQICSSRHGSSHGAYGVVPVLPGSHWMDVTNQSPELVEQRRRYLEIYLQQLLVPRNLF
                     YVARTQLYDFLHDGEVPTQLKLTGIQPLLGLVSTRTDFLNDEGDDDAVLRELQETQSR
                     QQKQYLGAAERAATAVSGIAADAALALPRATGSFPAAAIDCASHAGASAVASSPEAPS
                     SGRVEARSLEATAATTRTTSSAPSSPATFAANRALSKTLATRGVCTGTQTAGAAVVDE
                     VGDDGEAKGAEGRSNCVDNTSKVRLAKKSAHSLVGEAAFTAADPMQTGFSDERLPPAS
                     ANCAQCNAEFTSFLYPRRCFFCLVQFCSACLQQLPVLESALSPGRALTTTTGCSDPVH
                     FLVQEAAPFSTHAKAAGSTVPACLQCAENYSRRLDRCSTAPGGGAYMGMQSTLGTPAQ
                     QGPPVPSGRPLQSSPVAGLSPATSTRSCVGEESSPAVVHQRVANPASPIPHLSLSSPG
                     DALPSRSGTPSPVGFQDFQLLTVIGRGTFGKVLKVQMRATRKVYAMKIMNKATVYRRC
                     MTSYMKEEKAILTSLHPSPYIVRCHYAFQTEYYLVFLLDYLPGGELYDYIYPKLCLSP
                     GAARIYAAELVLALECLHRQDVVHRDLKPENVVLTADGHICLTDFGLARRAFSRSRRR
                     SFVGSPEYVAPETIQGQVQTAAVDWWSFGVMLYEMLAGSTPFHARNNNTVYNNVLHKE
                     LALPVLRADDGAGAAAASASQPGVAEGAPTFRGFSPEAVSLLTGLLARDPSMRLQDAN
                     VIKRHPFFQGLNWEDLRRRRVPAPCIPGDMRDNDVRHFKREFVSEWASVPPLTNMTRA
                     SIEALTKCFDNFPLSRTAAPAGSAVVDNANTMSTSSATGTPLLASQSLQQVHGDTRTS
                     SLSLTLLPSEHATDGQKLREPVRYFHSMAAAQRSFHGTWRVVSIEVHAVDDGRVIFPW
                     GGDVSGVLVYTTGGRFSLQLTSSARRPVGPVQRVTQLSKEDLCDTYCSYVASFGRFHL
                     FPSSMDDGCGVVRHFSEGNLCPNLMLATTVFQYCMHTEPLHPSATKGESAYKDSGKHA
                     GTASSTAAAATSARRSSTTDVQDGSRGRPSGNSGRVSEGGSLGGSEDEEGEAGRGSSK
                     TAVVGDADHRHDRDAAGATAQLPPSPPSLERRIVLRLSTRPQRALEQDFLAFTSLVFE
                     KVS"
     gene            complement(<639805..>645753)
                     /locus_tag="LMJF_28_1690"
                     /db_xref="GeneID:5653380"
     mRNA            complement(<639805..>645753)
                     /locus_tag="LMJF_28_1690"
                     /product="sulfate transporter-like protein"
                     /transcript_id="XM_001684399.1"
                     /db_xref="GeneID:5653380"
     CDS             complement(639805..645753)
                     /locus_tag="LMJF_28_1690"
                     /codon_start=1
                     /product="sulfate transporter-like protein"
                     /protein_id="XP_001684451.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653380"
                     /db_xref="GOA:Q4Q897"
                     /db_xref="InterPro:IPR000560"
                     /db_xref="InterPro:IPR002645"
                     /db_xref="InterPro:IPR011547"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:Q4Q897"
                     /translation="MTYVYRFVPVSRWYRLLTPKIILSDSIAGFIVGVMIVPTCLSWS
                     SLAGLPFSCGLIAALVASFSYGTFGQCASLSIGPVAEITTLLISIPGIPVAERKDTFQ
                     SLGLQVGILSMVLSFVDCGTVIKTIFAKAVGDGYTCAAALLAISAQLKVMFNVVPEDK
                     GYGNFINTLITLGTQMSAKSLYCFVIFMVYCTYLIQIKKVALPLWIPHQLIVVVVSTL
                     VTWGFRLDELLDLAIVRDIPAVLSWPRFPPMDNLIGLGPYTLTITVIIFVQMYVVAQR
                     VMPNIDPNTELFAGGITNLLVNLMSGMPVSNSFSCSSVLIEQKVHTPLTAYATGAVVL
                     ITILFLTRLGVFYYLPKQALAAIVVSSVWRLVNFSGPVQLWRYSRKDAGVWVLTFLLT
                     LIGGITIGVLSGIAFSLILVVLRIARPRAVSVGFNMQTFRYGDIRKDPELLVYPNILM
                     WRFDAPLYFINIGYFQERLIAAIAAEVRPIDVVIVTCGKVVDIDAAALASLPFILDYT
                     SKSDPTRPRRIILTDIHGRLEKVLLASAALPIYVPEEYDRISIEQITASGKFPVVFKK
                     LEEAIAFGQRCISERYGNVDTAPYPNVSFLTDVVMEAARLPAGDGCVPSFLSLLEAEN
                     ATPAAAAAPLSSNSLHIVVTAPGEASPESSRAEDGRGKAARAEASISSPRLPRNSAAA
                     SADLPRPNVDDDNDDGDDGDDGAPPQQQQDSLVRHLATLKKLSTYSPDRELIGVLGVI
                     RHGEVTPKQKKKLLFSDPTLLRLAFQGRDVRRTKRSVDELAEFFAVVERLLLGTPASN
                     MSSAGSADMLDASFLGTTSPLTGRISVSTAESWARVLSIVRSRPDGLKIQVKARVTST
                     SGTASFAESERTSPQRHVHYGGSGWWKVGGSAPSRHSSGSGSADDDWGEPAVGLLVVK
                     WGGVLTKSGILQAHVMGEKLFARFYAAGDLPLRRLVQFTRHPLVTASDENRVVNTALV
                     VANALTQTSGATLHRCDIVLNDGLTKTLGPVAKRLLQEEYRYFESLLHIESAAAARHF
                     FHIPGFRQLLSIPPRDSLRGWVVSEHDDGHADSDGNDNGTVHMFSQTVSKNSANDKAP
                     PGMSSRPLLPSCCRSKRSACEGNPRSTQFRGAQDVTHGSRAFLMPEQQQQQQNYNCHR
                     QDQFCTPYQVLQELEELMTILSTLEFPLYLAKVPLSNHETLQELQRRYEAMLKNFEGA
                     KRRIRSSYKHSLHMMSSGASQTPALPGARALRPAGPAGLDEDPEQQILLEAMEETGGS
                     SDEDGFDAQLAGDTELDPDLPPWRDPSAAGGLLATAKSSYLTMPTSSNGRAAEPQHGR
                     DNHSRCPAPAQQRTTSGSGNGHQTQPRLLHTGSGPLHTPSGHDRGRVSNGRDPSGAAT
                     CFDVSDVSKLRDYGSYDVAYNLPLVLQLHASVQEPAAAFQLRRFARALQRFSEITEYL
                     SRIGQNVLVGINSSKRFIIGSLVSDGLLRRLHSDFQDLAIADEERGTQELLLKAQAQY
                     MAENGGVEQDVRYMISLCSRLPCWQKKKGSRADEHGGSAWRTDIWARETPQEREFRLR
                     VPFISLPRQEARTCAAAADFERCTRLYFTSYLHVEGVLQCLFESVTVEGFSRPSKEEM
                     EATHQLYMRHLIFKIFRRRNVSYTDAEVAAAMRRLHLLFRSDVDYDKQQRELRLGLAA
                     IYHAMYYVSMEVYLSLGDADEAQATIVEDLPLFHLRRAGDSDEDGDTPTAAGTAANTA
                     AGGGNSEDGEELVETMAATGAPSAAGGGTGLTAVDPSSPLMLSFAPSGRTSCVSSDPA
                     SYFTAAGGRNAAAFLAASGGKSAETFAGFARSPLYVQHLVHVSNEPNTTATSVADGSG
                     SAALVTSPLSPSDAPGQAAAGSAAESDSGEDGTRNHMHRRVTNASTLALAPPPQREPK
                     TRSRSMTAVPTNAKDPVKEATVLMTPEAGRRTAMVQEMKHRVSNVTPMRRIHEGLSLN
                     DFVLLMKEVESAVRSQTASSSSAH"
     gene            complement(<648692..>650086)
                     /locus_tag="LMJF_28_1700"
                     /db_xref="GeneID:5653381"
     mRNA            complement(<648692..>650086)
                     /locus_tag="LMJF_28_1700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684400.2"
                     /db_xref="GeneID:5653381"
     CDS             complement(648692..650086)
                     /locus_tag="LMJF_28_1700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684452.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653381"
                     /db_xref="UniProtKB/TrEMBL:Q4Q896"
                     /translation="MLPSQPRPSLTGLPPGAALVKTALAVPPTAMPRKHSTTTEMSPL
                     HSLSASKAAANPKPPPPLPSVPANSWYAQPFVERPGTPMSAFHRSHRGKIIFSPRPVP
                     VEEAELLALRGQEPRTLTVCEVGKDLLYGMAYLYAVPLAIEHQWRGRVAYLQQVRRRQ
                     APIPDIVLRSVQGRTALQRQHQAQEGRTASVQLSSSSPTSPAPAASALAPVEYSNTMR
                     FERGETTVYDRPADDFLIGIKLFVNEELVEDHYPDVHALPQCTATITAKEAAQLWSCV
                     PFVLVGYLNQALLDPISLFHTLSLSFVEHLLRVKLPGRGPAGSAGDCTKATSTLPSSS
                     AAAPSRPTKAALLELPLRVEVVYGCRAEAFYCTDFISRGRCVLRMTEASKPSLKSYEE
                     KLRALVKARHTAPQLIPRPTSGLPPPRACAGCGYPLQFRCSFCGAEVCGSSVCASSAV
                     IGYPRACTRHALQR"
     gene            complement(<652010..>658531)
                     /locus_tag="LMJF_28_1710"
                     /db_xref="GeneID:5653382"
     mRNA            complement(<652010..>658531)
                     /locus_tag="LMJF_28_1710"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684401.1"
                     /db_xref="GeneID:5653382"
     CDS             complement(652010..658531)
                     /locus_tag="LMJF_28_1710"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684453.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653382"
                     /db_xref="UniProtKB/TrEMBL:Q4Q895"
                     /translation="MSERGTKVTASPSARCRGGYPAAGEVAAAEAGYAVAKAESLVAE
                     AAELMASAAPPRRKLRDESERAAQVLAQEHLKILLLVGRRANAVADIEDLVEVADAVR
                     EKTRQERLNLLPMPGPHATSDVATAPSAGRASPHHQDRGSGHATDRATSVSLLDLAAV
                     RFQVHKLSNDLLCNGSTKLDATQLRRLVYELDDHVDSVEEVLEVEAGGAASTDAETQP
                     LRGTAGAAAAAEPLPRRSLRQRLHRAKKEQKDLLEASSNLLHMAWLTESVDAELLTDM
                     QHPQPTETRENRSTGAGTVAGEQAHGGIPLTANEDTAAALMRYTRCQPIPGGALNRSP
                     TTSAAITATRESGKAEPDPHERHRASLETTVSEPSMVPFSLTDLTGGTKMGCISTATP
                     TPAAGGQQQWGKGLKDTGAVLSTSTAPSHRLNLLRFMSEVLAQYELEHVDAAKLRKNR
                     PLSAPSMRLHHQAASPSAERDCQQEIDGAKEVEAGLNVACSQPIEVTAGDDGARRSAD
                     GRLSWARRPPSSTPGAIAATDGGAQSLQTDSLCEKHWHSSEATHHRQNWRGSSTSHDE
                     KVLLGAQLRNLRTGLLHDLHELCTTHNYVRLIETRRRELTEGVGKGDAEYAAEMEHKL
                     AGHRLQLEAAKRAREEAARREMEAAVLAQVWGQEGNRPRTGSDKRSVTSGGSQRTVST
                     EGYSKQLSSAAALRSASPSSGALQSDKRPSATTLLHGATVQSGPTAEEAVVAAPVETE
                     LLREYLADKGLVFTVVGVKRSPHNFAGEGASAAEAHAGAAATHPKKKGGCRATLGEAK
                     GSNRYLYYELRVEKPLSAPPLESPGFDGATGDATPALASGSSMAAVVQVTTPRLMNLR
                     MTVEAGAAVEEVAKGQLVTMRVTSGAPARRLLTLTPAKPCKAISYAQAFMFGAMDAAR
                     GREQRRRSSHDMWEASSTASAAFVLPTGDQSRRSGSRSSSLDSRKIRPAKRTPLTTGS
                     AACGGGGASRRSKKGVAGTDSKEHTGVKGPGNASRSPGGQSLEKAHTPSASGPVTTAD
                     IETAKRTPRRGMLASPTSLAGAGAADATATALTEASPTNSNRVSKTALSGAAAVMLQP
                     SNASLKASQRSLSNPRQLPHSPPLSFVPRPADEWGVPHAHTEMEAAEKNAVILTVLQT
                     GDEGDAVGAAQALTLMTEEEVLAARAWSAKSKSECGGAGASVSEQGRASVNDSDTLSL
                     MEGWELCGAAAFAREGAEGQRMMESPSAADAGVSSVVDAIATAILRQAMMDGADSEFN
                     VDARGGSARSGGFRAGVDGEGLTDPARLATEKEMAASHVLHSPAPVEEEHGGSASRAG
                     SHVPPLFPATEIDAPQLSSFPPKRQAQHGGDNEAATGRVSGGRFMPEASASRAHLVSE
                     SARPPSAKPRTMPPPLLITSQSRPLHSLEAGSHDGGLIRFDFPDDGAAGAPATPPLPL
                     LSPAKPHPPHKASRKAMPAHRSATEAPAGAAGTARTSPVPPHCIDPDNDRAEQEAFVP
                     PPVVVVERTPGSAKPYMLLPREAAASLLGPPLRDMARGRPVSSGTGRRAGLDSDPRGG
                     AAAFHKTMDAAPVASLSPLAAAHSVLPTTGAAAAAAADTETLLHVQKFLQTIRGGSPR
                     HGATGVGGVDPAANKRSPQTTKGAAALALRTELDQLQEDARELFMMDPVRYDTVISEL
                     MEQAARALLQGSAHAAAPSPAAKEKGGPVAGAAPAFPHSSPLPALRGGESQAGGGADS
                     LTDTAAAATAASFTHERPFCTSGSVPSMFARFEASEADGDGRGRGSDLSLRAPQMNLS
                     STITTKRGSRVNSAGGGASVVSLLSSHDTFASTRSRVSQAAVVSPGDGDDDVGKQRHS
                     IASYPPQPRAQRRPTHTLVMRDGAIDEAAKHHRTSCADAAAEVERILFEQMKAQLLLR
                     AIIAKMKELWHTKQQHAEAKNRERLAKYRQRLIKRGLAAAWPLEHQRVLHLQKLIHLL
                     DRQVGRVHGWLPHYSDSNVLMAAPSLAPPPRSTGGAMLPAASTGTQAPLVLWCRQRSQ
                     TTLDAAQDVDGVSEAHVCPRYLHYLPQRRLFRYMRLAKERRVLPLRLVRADIHRSHNR
                     HLLLGYDRIALEDEGEDQGSSYKGRGSDGWPKRKLPRSRRGQPHDRAVPFQESRYEDM
                     KTRGERERYLRRLQRTAAFQSVSKMYSPRTRQEADFPPLFH"
     gene            complement(<660707..>661654)
                     /locus_tag="LMJF_28_1720"
                     /db_xref="GeneID:5653383"
     mRNA            complement(<660707..>661654)
                     /locus_tag="LMJF_28_1720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684402.1"
                     /db_xref="GeneID:5653383"
     CDS             complement(660707..661654)
                     /locus_tag="LMJF_28_1720"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684454.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653383"
                     /db_xref="UniProtKB/TrEMBL:Q4Q894"
                     /translation="MTPPFVEIVAFENAIDGPPGRTRQHLHQQQQGRVPFGGGREGQG
                     AIGPETRGTSPYTVSHSTSTETLMTTSAAVEPGAGLAAAADSISECLHGFPSRVHTGA
                     KTPHPVTGSHRFFDGASVGSAGGADMSLHQQPASSSPSQFPSQPEPVDSLASVLGPGG
                     LYVRFHITYGGAMHLSLNIAVQHEIRLGAVALRVSLPMMFCIANLDLDCYICVNMKHN
                     MCEVWLEPGPLSPSVVNRLSITAIVGGDDDDGGSSTDFYSHFGGSSISDGDGVEEESG
                     VYVNEHEVSQFVLHELRSILRETLVAPHSVRIPVSFGGS"
     gene            complement(<664252..>667170)
                     /locus_tag="LMJF_28_1730"
                     /db_xref="GeneID:5653384"
     mRNA            complement(<664252..>667170)
                     /locus_tag="LMJF_28_1730"
                     /product="putative proteasome regulatory non-ATP-ase
                     subunit 2"
                     /transcript_id="XM_001684403.1"
                     /db_xref="GeneID:5653384"
     CDS             complement(664252..667170)
                     /locus_tag="LMJF_28_1730"
                     /codon_start=1
                     /product="putative proteasome regulatory non-ATP-ase
                     subunit 2"
                     /protein_id="XP_001684455.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653384"
                     /db_xref="GOA:Q4Q893"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016642"
                     /db_xref="UniProtKB/TrEMBL:Q4Q893"
                     /translation="MVQGLSSAKAVLALLSEAENLVVLFALKRLSSLMDTFWHEVSAK
                     LPLIEELAASEKLADETRRLASLVASQVYFHLGDYSNSVKHALAAGTAFDATTRSLFT
                     DTILSRCIDTYVAYQETPESERAELPPKLEELFVSLTKSWVMENETMADLKEMVGFTV
                     RAFRLDFLEKVLRQALSRTHSAEILNFTFYVANVLLQDITFRRKVLRLLADLYTDGLS
                     TIDYYSLAHCLLFLGDVEATSNLICGLWRGGSRMVAFQLAFDLFEYGNQEYLSGVVAH
                     LDKQLGVAEQALEVQPAPSTSDAAGDASGAPAAAAVPESAEQKLLSVLSGQVTTNLNV
                     KYLYSRCVADVYVLAHIKKMTDPRSSVIHNATVVANAFMYSGTTMDGFLRDNMKWLGA
                     AQHWAKFTAVASTGAIHRGHTEEAMRVLEQYLPKGPSVPTLPYQEAGALYALGLIYSP
                     LGATRDRRTIQYLEENLQKFSTNVQMVHGASLGIGLTAMGLQDEGLYDALFTCVTGMD
                     AVAAEGASVGVGMLMLGSGNDIVLQSLKNVAYEENQKEKVIRGVCMAMALINLGREDE
                     ALPLAEELLESGDPWVRLGGCFVLGLAYAGTENAKTIEKLLSVTVKDMSDDVRRTAVT
                     MVGFLTFKDPNLCLDLIRVLVDSYSPHVRYGVAMALAVSAAGTGNAAVIDVLWDMLED
                     IVDYVRQGAAMALAMVMVQLTEKENPRVKDFRLLLEKKIEDRNEGRCSKFGYVLASGL
                     LDAGGRNCTFALHKQRHRLDKAVVGVFMFLQYWYWYPYLLMITLAMQPTCIIGLNESL
                     ELPEYTFKSNAPPSTYAVPKSVLQEKRVKTSEVQAVVLSTTRKEEELRQRRHQGPGSS
                     GLTAGASATGAPGGDGGVAEAGSKRGGNKDGGGACGEAAEQEPAFEILHNPARVTAHQ
                     FSVISHDVDVRYVPLKPKPMGICLLRDTKPEMGAEVLVAPVVLSDRDEAPVPEPFSYP
                     "
     gene            complement(<668380..>670143)
                     /locus_tag="LMJF_28_1740"
                     /db_xref="GeneID:5653385"
     mRNA            complement(<668380..>670143)
                     /locus_tag="LMJF_28_1740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684404.1"
                     /db_xref="GeneID:5653385"
     CDS             complement(668380..670143)
                     /locus_tag="LMJF_28_1740"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684456.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653385"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR023267"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4Q892"
                     /translation="MDVYRQAAEIVGIVREGNGTAKALCLRKDMQKKKQTYAVVCETL
                     RHYELLEDVLEVAEFFKYYPQANHEFAMCMAYDVVLGKGVNTHNDSTARAVSHSASYL
                     REAYWQVRKHHVIPPRSSEKLDDEVAADTEGGARGKRRSGDSVSSSPSLQLPRYARVN
                     TLKISVEELVSRLRRSAEVRKRARDAKDNDGDAAASSHPQQQNGDKRATRRASSRPHR
                     PLPEFTQDPVVPHLLVFPPGTDLHAHPAVRSGQLILQDRASCLPAAVLLDAVPVEVIE
                     GDTAGSSKGRKKAKGGTALGKEKGRGNETDAAARRPLEYVVDACAAPGNKTTQLAALG
                     APHIKIMATERDERRADLLSKRVASLGAADYVNVVSMDFFQLSSDDRAATEGILLDPS
                     CSASGVMTRVDVALQHHHHHHHEQQRKGKARQADRRVSLLQGSRRGSHHEDADRNAAE
                     EGQLDDGDREETANSGAINPAAQGNEFSMKEERVEKLARLQRKLLAHSLLSFDNCRTV
                     VYSTCSVHEEENEEVVRQVLDDERVKARGWRLSNIMPNTWKTRGAEREGEEHPLRFTI
                     RCDPATEATNGFYVARFDRVC"
     gene            complement(<671090..>673912)
                     /locus_tag="LMJF_28_1750"
                     /db_xref="GeneID:5653386"
     mRNA            complement(<671090..>673912)
                     /locus_tag="LMJF_28_1750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684405.1"
                     /db_xref="GeneID:5653386"
     CDS             complement(671090..673912)
                     /locus_tag="LMJF_28_1750"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684457.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653386"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4Q891"
                     /translation="MGSDTAFLALANTAIEAEIRAYFPYTALYRRLCRGGSERAIDYL
                     YREFSPVLVDTADDGTPATAALVVGVAASSPGLSQTQRKRRRASLVEELQQSLKEFAA
                     GTARLVQARLEAAAPSGKESEVCDSAAVTVPPTTGGAGAEPYTVTCRRCTTNVTCAYP
                     CWVLDGYVVLWAESVLEVECVATKAAVAASLLASPVVAAHTQGNSSVKGSLALRRPRD
                     AIDSRAFQAANTLHFSSRRLLFSSHRPLGLRPLLQRLTGALDGSAEDATAPPAPLMAT
                     TRAKETRSRKQRGRSHSDSTHPCASTGPPPPATRMLRLHSMSIVNSDAVSNMRPASFA
                     LQSVVQPGWQTALECYPRHMVHFGLLVYAAWHASSRTWESVLSHGGTCRDGSAAAENG
                     HTVMLPSRSSRSDAALQNTSGERGAWHTPESTTEPTSLSPTPEVGGEMRPASLVKLLP
                     HTSHDAVLILGLGGNVLGQCLDALLPAAVPLHIVEVEPAVLQACCEHGQFPAIDVVDD
                     WRGERDAAPSCNALKRASAPHKKDVSPCRSEEMLETAPAASLVCPAAMQWAAGLIHCK
                     SATPAAFRAMRQQAPMLLERLAAPPSAVPSSATKRATCAPSLPRGSGTAVEAPLQAQQ
                     DRGEYVCFLQDAYAYLRTSASSPTTLTAAQGAVARHRASHSANGAAHPVAPSSPPQET
                     CPRLSAQSRTLSSKQEKESSSAVEDATPLLQYSMIFLDCYDPDRERMMHEGTLVELCA
                     RRLRPGGVLVVNAHVLPSVENLRRDFLGCGFSTVQALRVAGHTQTVVVCVAQDKVADG
                     APAATERLASRAACAPMLTEKRGRFTVRQMQLLATALNGYLHVAGSSSSSVTGGGDAA
                     GRDKVSPAAATSTTADASSLSCTSPPSPPVMPAFWFDAAWLKSCRRVVVPPTKMPSGC
                     RARPASTTPSQACSIDVDLRVWEHYF"
     gene            complement(<675312..>680105)
                     /locus_tag="LMJF_28_1760"
                     /db_xref="GeneID:5653387"
     mRNA            complement(<675312..>680105)
                     /locus_tag="LMJF_28_1760"
                     /product="putative protein kinase"
                     /transcript_id="XM_001684406.1"
                     /db_xref="GeneID:5653387"
     CDS             complement(675312..680105)
                     /locus_tag="LMJF_28_1760"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001684458.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653387"
                     /db_xref="GOA:Q4Q890"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q4Q890"
                     /translation="MMDNAGEQLRIVDSTLKRTTPRNCLWYSLVCEGDGFCVLQRPYV
                     AFTLRERLVARPVWTAQEKLCIVYQLLEAVAHLHETYGLTHGDIKPNNVLVQSTGVLL
                     LSDMALFKPCQMPLDSPLLFDYYYDTDENRACFVAPEKFSDQPLPTPPPESKTRGSAT
                     YNVSNVNFDGHTASMDVFSTACVVLFLYKEEDPLTLSQVLSLRHLANAEAREAFVAPV
                     LRDANVPAALHPLLLPMLCATAEERPSARELVNRGLQQRIFPASLPYLYESVLPRLLT
                     TAPDTRLVLLHNQLEAVLQRCEVLDMTPEGSGGTSSTAEIEVAASAEAVGADAADLAA
                     VVSPSRQLAVSLLLPLLLQTLHSTCTSDEAAYRGLLCLRRCASYCSFTCLVDAVLPHV
                     LFYVNNDAHVYGPSTRLMALRLLSSISEVIARHLTLGSPQRLGGAVTTSRDAAAAKPG
                     DTGEGSAVPEEQWALMEHLVLPCLYGVLRQAEQESTAVLVEVASRLPRLLLLARYITE
                     RRQLLYGADAVMTQSTTVESRSGTQGHRARQTGEAAHEQQSRHDPLHGQPHRQASRHL
                     SPNKGGEEGDRVKAVAAPSSTSMSPSPLPPPRSSSDALYSSPTEVAILCEQSVSGGTR
                     ARLVPAARHTEAGKSANEVSDADGENAGDLHGASAAGTQQYLTQLHCLLTNGWGMLQI
                     LYNHPCVAVVVEVMQQSSSTVAAFLGEERVTEDLIPLLTTALAAPLRVQRLLYSQAIL
                     LHALLQRPSTKTLRLFVDEGLRHTDDVCLNRTLHSLAVVVRSRRLPLEETMALVHQTL
                     PMLVESRLWLREAACGVVEAAAQTYSASDIALHLEYAVRPLLMLPVPLAHLRHYAATV
                     IRAELTMPFMSLGGTAGPTSCSYVSSAPLRERASVTGSACLLGEDIFEDDEPMNQLLE
                     NGTGGGDGRRGRPGQWRGFEYGGGNGGTFPNVLPEVVAVTDSDASAPPPALLHGLPLP
                     EALSSSVPGSRTSHEASIAEPAVTAQHIRSATDMCAVADDGGDSDGMALVYRPAAREV
                     ARVQLEGHSLSLHLPASSAALPVQGCQLPTPPHRRDVSPLPATLPPPSGVSRCSLKGG
                     DGRVLHGRVTPPSLTSSAAAASTAVPSSSSASCSALRPTAAALSSVSAHMGAIYAAAP
                     SPSANGIVISAGARGEAFVWQVAASHTSTARARELCLVERVAAATSKAGVHTYTACQW
                     ISVPGQRRDFTLASVPASASCSLVAFASTDGAVRVLDVEQNAWVSSTVVGGALEGGLT
                     GLALQDRASLLVTTAAGGLHVVDTRCRGWGRADDEESAVGSTASVWHTRLNPLDGAPS
                     CVCPLYTGDRACAAAVGTYGGAVCLYDLRYQLCAQRVVLVDDEAGLLSASALASVRLS
                     ITTACVDPLSTLCQSCRPSSWEPETAAGPSLLLGTTGGTVYRLLLQSASYWPAFQCCR
                     NGGGAIRTMLTQPTHGCVFTGSEDGYIRSWSTDRPETSHTLVCALYRSPTYTVVRTGA
                     AERALAANLVRGDAVAPPGSNGSKGLASLTVREGSDIRHGGCALPRHAPDAILALCAV
                     RMTTTSLASWGPSNSGSGGGGEPCYLLSGSRDGTLTLWDNDPERL"
     gene            complement(<683419..>684309)
                     /locus_tag="LMJF_28_1770"
                     /db_xref="GeneID:5653388"
     mRNA            complement(<683419..>684309)
                     /locus_tag="LMJF_28_1770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684407.1"
                     /db_xref="GeneID:5653388"
     CDS             complement(683419..684309)
                     /locus_tag="LMJF_28_1770"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684459.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653388"
                     /db_xref="GOA:Q4Q889"
                     /db_xref="InterPro:IPR001164"
                     /db_xref="UniProtKB/TrEMBL:Q4Q889"
                     /translation="MGTHVSKVKSVNMDAWAESTMLVAESIGNARGRLLYEYNMPPSA
                     RVTNTTETAVAERVIRSKYERKLYYHPCFAQLVAQFMETPLEGVSSSGTTTLASSPGS
                     NAPLCLGGEPGHTQPQDAVLEELWGAPVSSLNSNQPSQEATQGTTGARTNVAELFSAY
                     PTHSAGMDYAAAGGGALSPPTAWGQTAGSLSSVPPVSANADSGWFESQFGGAASSVLG
                     PTSGGAHSGAPLPNTLQSAPSPPTAHDNTDDLFTGGSASVGCSKDEILSLFRTAPVAG
                     AYGETSSVSTANTGGHPMAW"
     gene            complement(<685771..>688371)
                     /locus_tag="LMJF_28_1780"
                     /db_xref="GeneID:5653389"
     mRNA            complement(<685771..>688371)
                     /locus_tag="LMJF_28_1780"
                     /product="putative DNA topoisomerase III"
                     /transcript_id="XM_001684408.1"
                     /db_xref="GeneID:5653389"
     CDS             complement(685771..688371)
                     /locus_tag="LMJF_28_1780"
                     /EC_number="5.99.1.2"
                     /codon_start=1
                     /product="putative DNA topoisomerase III"
                     /protein_id="XP_001684460.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653389"
                     /db_xref="GOA:Q4Q888"
                     /db_xref="InterPro:IPR000380"
                     /db_xref="InterPro:IPR003601"
                     /db_xref="InterPro:IPR003602"
                     /db_xref="InterPro:IPR006171"
                     /db_xref="InterPro:IPR013497"
                     /db_xref="InterPro:IPR013824"
                     /db_xref="InterPro:IPR013826"
                     /db_xref="InterPro:IPR023405"
                     /db_xref="UniProtKB/TrEMBL:Q4Q888"
                     /translation="MGRNVLMVAEKPSLAESIATILSNGSCSRRTRALPVYEYPGNFM
                     GSPAYFKVTSTTGHVFSCDFTSQHQNWDRTDEEQLFTAPITWKDTSGKVTHHLEHEAQ
                     GCDTLVLWLDCDREGENICFEVMQVVRREIYSHHNIFRAHFSAITAEEIFQAFRNLGK
                     PNKNISDAVTCRQELDLKVGVAFTRFQTKYFQGKYGDLDASVISYGPCQTPTLGFCVQ
                     RHDEILNFKPENFWRLVPVASRGGALLQFEWDRGRLFDETMARLILQRITKNGKVATV
                     VNVSVSNDTRPRPTGLNTVDLMKIASRALGIGPHYVMSIAENLYIRGYISYPRTESTA
                     YPSSFNLAGTLAQQKNHSMWGAYVTTLLQQGHARPKAGKDAGDHPPITPMRSASPGEL
                     SGDEWRIFEYITRHFIASVSPDCRLIKTKITIELGGELFSISGKVVEDPGFTEIMPHA
                     RVEDDRMPTGVHKGDSFQLSDVRLQAGQTQPPSYLTESDLIGLMEKNGIGTDASISTH
                     VNNIVERGYCSVQAGRVMKPSKLGIVLIHGIKAIDPELVLPLVRSRVEEYVTHIAEGR
                     AQLDDVLSYSLDLFFAKFKFFKEHIDVFDALMGASFSAISAAGKPITRCGNCMRYLKH
                     LDTRPQRLYCPYCEVTFALPQGGAIKPYSSFTCPIDNFELVICHIEGGKSFPICPHCY
                     NNPPFEDMRPAIQHHDRGYGGGAATTMAPSTRHMACDECRHPTCEHSLATNYVCDCVD
                     GSCAGSMAFVPRTAGQWKVCCNKCPMMIKLPPTAQRVYVTSEECSECAANCLDIMFPE
                     GKSVLPNRKDRIVACIFCHPGLSPLCEEVRGRIGNFRRIGGAAAGGRGGRGGRGRGRG
                     RGRGNREDRR"
     gene            complement(<689373..>691148)
                     /locus_tag="LMJF_28_1790"
                     /db_xref="GeneID:5653390"
     mRNA            complement(<689373..>691148)
                     /locus_tag="LMJF_28_1790"
                     /product="ATPase-like protein"
                     /transcript_id="XM_001684409.1"
                     /db_xref="GeneID:5653390"
     CDS             complement(689373..691148)
                     /locus_tag="LMJF_28_1790"
                     /codon_start=1
                     /product="ATPase-like protein"
                     /protein_id="XP_001684461.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653390"
                     /db_xref="GOA:Q4Q887"
                     /db_xref="InterPro:IPR001270"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q887"
                     /translation="MMHRPSSSSPLPPEGESTRYLVVIEVRTTADTAAWPELSCLVRS
                     YVRVQASRRLAADHLPPFLPGATISLADAPPLLRDDVASVRVCDVSFPTGCSWTNMEQ
                     VHFCMRLYRLHGETLRMPLSSAASAPAAQASLPAWCTADSMHSGGDEGDSASSFTVTP
                     LPHVSLEGQWESLYYGESEAASIAFKRDIVSYVDTAMRFSRAGVSPNFVTWNRLVLFH
                     GPPGTGKTSLCRALAQKLSIRLASSVYARACLLEINAHSLFSRWFSESGKRVLQLFEQ
                     VHRIADDKECLVCCVMDEVESLAAARTSAMKGNEPSDSIRVVNALLTQMDRLQDCENI
                     VVLATTNLTAAIDAALLDRADKRVYVGPPGVQARFLMLYASVQELVDKRLVAAPQAGT
                     SVLPDELNGLSLADERFQEEGQAAHGGNVGAHRSLGSHLLVGGSSTADAAHTWNEELT
                     ALHDVSSRFHKPLQQMMPTSTSLGTVPAPQAVHPQSPSHCLSGTAYTISELLHHIAEV
                     CVGLNGRTLKKLPFLAYGACMCNSHSGGCGGSESAWQGDQSGGVDAPLPLRDYLEALL
                     KAAEEAAAVAVLDANSGSQSRLLTP"
     gene            complement(<692346..>700052)
                     /locus_tag="LMJF_28_1800"
                     /db_xref="GeneID:5653391"
     mRNA            complement(<692346..>700052)
                     /locus_tag="LMJF_28_1800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684410.1"
                     /db_xref="GeneID:5653391"
     CDS             complement(692346..700052)
                     /locus_tag="LMJF_28_1800"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684462.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653391"
                     /db_xref="UniProtKB/TrEMBL:Q4Q886"
                     /translation="MRHVHSSGHHGGSTSSAAPSSACGASAHGRRGFSPMRRSGAVSA
                     SATHARTAEEEVSTTWSRSAGRRGDDRRKRDCQSGIDTSATGQPSRPASCDPGTSPAR
                     APPPPTTYTNTGAPSCAALRRLVKSHHTFRKNSEVLRKSDTIAAAFELWCAEAVAHSR
                     LVEHLAPALGGDSQAVATVRLLLTGASNKAATAGSGAAAATSATMSAAETLAVLEVPL
                     SVVDWLNEPIVVPDLGAGTIMEFVHKVLSPSHVDKAPANNCDGAGAGELLSASAGDSP
                     AAPYRYGRLEAVEVWYDAWGRQQHYREAAAGLSSSSTEPAAPSLKASMALWHRRHRAV
                     QDVLLSHLTEGSRPSALDALPVCPAACDSVDTRDATPVECGPVAAASASGAPVQPDGD
                     AAARPDQLVEGATRELLLYLIEFLQTLSAFKAAREEAKMHAEYHALLENAVAVQSGPA
                     QAAADAAAQGTYTHLCLVARRFRASPRVELHPPLAASDSPDKPLSGDCGVDAALRTAA
                     QQYLRSISKVDKVAPHSNPSSSKLEGSTGDAGTQETTGAPSSSLALAERVGAAPSYSV
                     AVLDICIGVVLRCLLFYLPALSASDRVHVLQQLSAPWLTLEPEESARVAYWSAFFGVA
                     DVLSNACAPKRRERIGALPSAMGGLSNADCSTSSASFTVDHSTLSTLQGVVQQLRSLC
                     WPTALDRHSSIVQHALCLLPTASEASPSPSSAAASVSDQRRQQRRPPTETLPAGSARG
                     TASSSTVAAAPPHSAQPRPPAWSDVVAVVRGSESRQRLGYELLFLFLGVLQCGKASAF
                     LAPVNATAAAAAADASAGKPALPHHRPSDRRRLNTVCIYALDVDRFIAERMSALRPAG
                     DAWPLLRTQASCSAARAASPPGSRPAPTEVLAEQTAHPYGLSRVALCTFSDSLLESWP
                     TLSPQRTQILMVALQRAVAAPAALALRSLLPTLHSSARAGCEFSGTRSSATPSHAVQL
                     AARRAEWRAVAPVMSLYTTHACPSLWSTMWAYISSQMKSLLRQVEEVMRTAHASAGDA
                     RGSDVAAHGEWRWSNDEVEACYKQLEELATMCAWLVAMVPSVCGKWPAGAGAATSEPA
                     QASAPEHTERVRAGFERCVKGLLAVWTQTGASADAAEQLLNLFPRHPRATPTPVDCTP
                     VRAADNGAVDDTAQGAKAPPLAPEETAAGEAVTLLAELAGAAQTHVWTRTLYGAVELW
                     IKKTRYIQAQSRGIMETVQLMPPAEASTSALAAMTAAAPGRAADDRSRAGETVTNGGS
                     AASVPTAPPGVDLALLAWWRSMAEEDIGLPSARVYLAQVYTELLRIVSARAALASSTP
                     LPERAHMGRPLDSERDSVLGGASNRTGAVESGGEPTSSLRGDTPVSGAAAKAIFSAAE
                     VVVIVRVLSSIAARGVATVTLGRLTERASGRGALGKTSSAGSAENAVGVESASGNGDS
                     IIDSLRRAAVYATVAGSGVPTTTTPDSTASTDAGARGLSTAADGDESGNPTSVGVAEE
                     ATAHDRGNAAALSAQKAVQRIEEALLSSLTAHSAALPATTMVEATWLRLLPLSTLQKL
                     LDHRESSAITSAGPDAPPQGLPSGAPPCKAANSGPLSTQPTVRADLATTAATSSPPRF
                     VSAAVGASSSAPHLDGSLRESPSPWVRKLHDAVLTSCHSRHIGICLVSSLYSVLAASQ
                     KCDDSTQPLSAATSCDGSRGAVSAATLSCGGTSEAASSCVEDCDAARDGPSLATSRLR
                     CFLARLRTSCAEAVVLFHRSRRQHADLTAASGEGDASSGGGAGANDANAFRVGLTASP
                     WAAVAEVNGDSKGEAEAGISHTATPHQQHGQRFCNVLVVTSELHERLTTYAEMLTRAA
                     VRCSGAEQGADQNTLRTSRKVKPERMRHLLRLLYASLLDAVSDFVPYGEHGNAVEVMQ
                     MLGVITRRMPWQQCAQASLAQVLPVKKDGQFGYHTSGETGCEAEPLTKRGGGVAEAGA
                     AARLSAPRDGDEKGVSIDPLLVCFREQVTRLMPYVDAEVLRCTKARLPLLLNLALIGG
                     AKSSVEYVLRSVPVSTRGSMQCREGPCAAAAAEATRSRSIVALSPVSRSAAKVSASES
                     ASRVTTTEAEPGRLGLSTLPLWSQAPLESLLHRVAMDRLMASRHALYLCTLTVNAPEF
                     SAVLLPLTHYLRDARARISWAMLEVVFKAIAVSAVSFQRHHQAEMLLRSDFLVPLSSS
                     LSPGSDQTSGSTTASPADRASAAAAAERPRRGGGGGDASQRGGIALPRSSTDCAALRV
                     GEMRYPHRNGSEALAPLFRTAAVPSAVCNAPSQLRHAWGDLARRLLHEEDDVAVSDVS
                     LWVSALYCGAMVNCAGTQLFEQLLACLVFGITTPATSAATTTTRIATLDVVGWTLVLE
                     ACGTASDHHYRQAYQSLLRDELVAFLERAEASVHSDEGGVSASSASSASYPSRLTTAA
                     AESGRAELDDALPLAGACRCRLLEGIPQLFVEDAAFWRRVKNCVESWCAAIARDHAEV
                     ASESPSAPRRSTSAVRRSWVTQLQQSFNWAAQCAGHSPLVFSDNTCTTEAANADAHAV
                     TEWMRMQLEALGASAASVTTTPEAPTNVSP"
     gene            complement(<703205..>703636)
                     /locus_tag="LMJF_28_1810"
                     /db_xref="GeneID:5653392"
     mRNA            complement(<703205..>703636)
                     /locus_tag="LMJF_28_1810"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684411.1"
                     /db_xref="GeneID:5653392"
     CDS             complement(703205..703636)
                     /locus_tag="LMJF_28_1810"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684463.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653392"
                     /db_xref="UniProtKB/TrEMBL:Q4Q885"
                     /translation="MRAPVKVTTVADASAERAATSCFLVNARRFYLAPSRICMDEASS
                     TAGQQQQQTPTPGAPAGASSASANGSESALDVAMRVNKMKKAHQSGGGNKKEVEQEAW
                     HALNSLTEDQINNAEGKAVSLLLNAWAYFAKFWAKGKDGPL"
     gene            complement(<705727..>707130)
                     /gene="RPA1"
                     /locus_tag="LMJF_28_1820"
                     /db_xref="GeneID:5653393"
     mRNA            complement(<705727..>707130)
                     /gene="RPA1"
                     /locus_tag="LMJF_28_1820"
                     /product="putative replication factor A, 51kDa subunit"
                     /transcript_id="XM_001684412.1"
                     /db_xref="GeneID:5653393"
     CDS             complement(705727..707130)
                     /gene="RPA1"
                     /locus_tag="LMJF_28_1820"
                     /codon_start=1
                     /product="putative replication factor A, 51kDa subunit"
                     /protein_id="XP_001684464.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653393"
                     /db_xref="GOA:Q4Q884"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR004591"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR013955"
                     /db_xref="UniProtKB/TrEMBL:Q4Q884"
                     /translation="MQQPGSHQIQPIDSLTPFLGGKWWIRARVTDKTDIRTWNKPTSQ
                     GKLFSFTLIDESAAIRATVFNDAVDTFEPLIVNGQVYYFSGGQVKNANRRFSNVNNDY
                     ELTFDRSSEIMLARQDTSTAALPMQRYNFVPIELLKQREVGSLVDVLGVVLKVDEVSS
                     ITQKSTGRELMKRNVKMGDMTAAVEVTFWNDEAKAWCYPVGTVVALRQLKVGSFDGVT
                     LSSTYQTKIDINPTDLPDVKKLATWYVATGGANVTSLSSQGLGAASGAGGESDRGRKY
                     LDEIQSEGIGRGLKPEYVDVRCVPIYFKQDAQWYDACPTCNKKVTEEGAQGDRFRCEK
                     CDKTVTPTQRYLVSIQVTDNVSQAWLTLFNEAGIEFFGMEAAELKRRAQEDPLYIAKL
                     AQGRMNRPVVMRLRVKEEMSSNSMTGEESDRLRMSVVRISEFMPIAGTSEETRRRLAQ
                     NLRTECDEILRLIEAYV"
     gene            complement(<708482..>711250)
                     /locus_tag="LMJF_28_1830"
                     /db_xref="GeneID:5653394"
     mRNA            complement(<708482..>711250)
                     /locus_tag="LMJF_28_1830"
                     /product="DNA repair protein-like protein"
                     /transcript_id="XM_001684413.1"
                     /db_xref="GeneID:5653394"
     CDS             complement(708482..711250)
                     /locus_tag="LMJF_28_1830"
                     /codon_start=1
                     /product="DNA repair protein-like protein"
                     /protein_id="XP_001684465.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653394"
                     /db_xref="GOA:Q4Q883"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q883"
                     /translation="MASRDTAGHRELVRFLEALQLVKFDTLPCAAVPTTMRARAELRP
                     FQLQALYWLLSREQPPLLRARAAPRDTGSLILTKEATRTLDSGAVNRGDEEDGVTYTG
                     GSGAGGGSGRGRGEVFGKGDDFGAGSSCTTLSASRALTAKVRPPSTGVATRTAVGGAE
                     DDTSMSMRGQEMTCTVRGGVFADYMGLGKTRTLIALCETTRVPRIDRVTGSLVESAAT
                     LIVCPTSLLTQWVREIHHCVQRPAAAPLRILVYYGARKRHLSLFQVAQSYDYVLTTYQ
                     TLCQKQPPAFRFGLTHANGGTTGTGGGSPARTAGFSDADDFAEGSSFPASADDYDVDR
                     RLQTEVDKLFMIRWGRIILDEAHYIRNMRTHQSRACLKLSGVCRWVVTATPVQNSLND
                     LYPLLRFLAVPHFSSLVWWNNEIVRYYNLDPLHPRPVTALSILFGSILLRRTPDSMVD
                     GKPILELPPKRAITYTVGLSREEMRFYQSIHAKATEKLNALRDCDACAARTPLATFTT
                     AFEMLVRCRQTCLHPYIVVAALRRCHRLPGAEAGRCATASPDGIDRTSATANCASSEA
                     ARQQREEDQRTARAIDEFIQTVVLRRLRTIKAREFVQSLVEEIKHQKLESRECIICLE
                     TVNRPAILPCAHVFCEECIKHALQATRRCPLCKRNSKASELLLVPVELLDRTAQQPNT
                     STGGGDRAGDGRTSAAEPAPEVPLHLDLSDMSNWSLQLSSKTQYLIDTIRSLPAEDKV
                     VVFSSFLTYLRCAQHWLQAAGVSCALYSGSMTMKQKQSLLELFHDAARPASPRVLLAT
                     ISSCGVGLNLTCANHCFLMEPSWNPGTEEQALNRIYRIGQTKPVTFTKLIADGTIEQN
                     ISQLCDRKRALSGYCFSSSVAGAAASGGGDGRLRTADLLELFAPEKSSASSDDDDSSE
                     EDDEAEGE"
     gene            complement(<713352..>714071)
                     /locus_tag="LMJF_28_1840"
                     /db_xref="GeneID:5653395"
     mRNA            complement(<713352..>714071)
                     /locus_tag="LMJF_28_1840"
                     /product="putative methylthioribulose-1-phosphate
                     dehydratase"
                     /transcript_id="XM_001684414.1"
                     /db_xref="GeneID:5653395"
     CDS             complement(713352..714071)
                     /locus_tag="LMJF_28_1840"
                     /EC_number="4.2.1.109"
                     /codon_start=1
                     /product="putative methylthioribulose-1-phosphate
                     dehydratase"
                     /protein_id="XP_001684466.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653395"
                     /db_xref="GOA:Q4Q882"
                     /db_xref="InterPro:IPR001303"
                     /db_xref="InterPro:IPR017714"
                     /db_xref="InterPro:IPR027514"
                     /translation="MDTLTHLSHTLREAMSDIVPESHPEHPFNLIPELCRKFYDLGWA
                     TGTGGGISIKMGENYYIAPSGVQKERIKPNEIFVLNASQDVVEEPRTEKQLKISECTP
                     LFFNAYRMRGAGACLHTHSANCVLISLLCDREFRISHIEMIKGIINNETKKALGFRDT
                     LVIPIIENTDFERDLTASMAECMERYPESCAVLVRRHGMYVWSDTWQKAKGAVECIDY
                     LMGLAIRMRTLGLEWEPKDVK"
     gene            complement(<714642..>716993)
                     /locus_tag="LMJF_28_1850"
                     /db_xref="GeneID:5653396"
     mRNA            complement(<714642..>716993)
                     /locus_tag="LMJF_28_1850"
                     /product="putative C-terminal motor kinesin"
                     /transcript_id="XM_001684415.1"
                     /db_xref="GeneID:5653396"
     CDS             complement(714642..716993)
                     /locus_tag="LMJF_28_1850"
                     /codon_start=1
                     /product="putative C-terminal motor kinesin"
                     /protein_id="XP_001684467.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653396"
                     /db_xref="GOA:Q4Q881"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4Q881"
                     /translation="MAGAKGGNAASPTDASPSDSERRLWDTWRDNRERLEREVQILTQ
                     YSHKLVEETQTVQDAMEGMLTEFEGERKRVEAHHGATVARYQGFMDALRAREEACLAA
                     KQRALDRIRTSRETVSRLQREQEATRDAIILATDGRDRLEQELASANGTAAERAISLE
                     RLQQEEDRMKDATYGLSGEVKGWVLEMERLRKEKHRIDVQSMEAEVARRELYSLCEEL
                     KGSIRVYCRVKGSALPVASQLPSDDTICGAAPALQAVRPSRPDNISTCVGEGAAATVV
                     APVAMPPVSRLPSRSGSTGSSLSAGMLAVASTPTSTVGAAVAKADARRNAGGGGSRSG
                     CSTTRSSIATASVMGDGEADATADEGAAPVFSFPDRGEADNLSDANRRAEQGGLLRVR
                     GAAPTATAGGATAASAHAVMPLLCPSTAQGPGEEEAYLLVDAAAAAAVHLPHSSGRSI
                     TIHQTRSNATSTGLSSFTETFTYDKVFTGDARQEEVYRDVEPLVRNAVDGYRVCIFAY
                     GQTGSGKTFTMEGDVQGRPEVYGVTPRALQTILQRQAELANEGWSYELSCTFIEIYND
                     VIRDLFQSGSARYEAMLQQQHTAPTTSSSASVYHTIKHSGDRTHITNVMERNIRSVEE
                     FLQLYKQAVLQRSTAKTDLNDVSSRSHCIFTLHISGTNATIRQRSDGVLCLVDLAGSE
                     RINDSGVQGKQFKEAVNINRSLLDLGKCIRALRCGAVVPWRNCKLTYLLQNYLGAKGG
                     KMLMIVTVSNAKAHALESLNSLRFAARVQETYVGTSVKRVTSI"
     gene            complement(<718828..>719694)
                     /locus_tag="LMJF_28_1860"
                     /db_xref="GeneID:5653397"
     mRNA            complement(<718828..>719694)
                     /locus_tag="LMJF_28_1860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684416.1"
                     /db_xref="GeneID:5653397"
     CDS             complement(718828..719694)
                     /locus_tag="LMJF_28_1860"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684468.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653397"
                     /db_xref="InterPro:IPR029358"
                     /db_xref="UniProtKB/TrEMBL:Q4Q880"
                     /translation="MVFSIPSYLGVGDRYKKPIDARAQGATFLVSRPKTGTNPDALFD
                     KELHHFWNGERGGDSEAVRRRQQLESAKKNLTPNGFVYSSPTPEPAGLGSYFGCFQAT
                     PYAHVPEYPEKHDQAIRKRELPPRGVYTSPAQKGTGYGYAHVALSDVGSNYIATIYEQ
                     KRINECREREEWKKKMPAEPFRPAGREGFTFDESPATGTSRCYMMTVPFREKRPEPAL
                     THFRIDQPWRPAGYVEDKPTTIEYWEDPYRGYDPRKEPKEYVKKPSDAVFLPSSLNDN
                     FWYTQSIVFKRI"
     gene            complement(<720519..>722537)
                     /locus_tag="LMJF_28_1870"
                     /db_xref="GeneID:5653398"
     mRNA            complement(<720519..>722537)
                     /locus_tag="LMJF_28_1870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684417.1"
                     /db_xref="GeneID:5653398"
     CDS             complement(720519..722537)
                     /locus_tag="LMJF_28_1870"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684469.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653398"
                     /db_xref="InterPro:IPR019410"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4Q879"
                     /translation="MEPLLRNTSSLCSFECSFPRSLILFLQSAPPTIALSAFQADCES
                     QGVAWCSAEAQMLAVEWFVRHPVVKKYPPRRRMVRALLKAYINSVEEQYAADCALSST
                     SSEDPVQTELMEEFIRVSIFGEASEQELCFKTFYNPFVNAPDIPAITSPPVAATPLSG
                     SSMSLSAIPTPSQVHPVPPGPSPRASLTPEMHTGSSQRSLNAHSEPTHTLFPYGLQPC
                     TLINDGSKELLPMASVHFPSTSPLQRSPRHHQHQHQQHQQVPLSPHPPAPTPASAAAA
                     AAAAVRPRDQFSSIRVSSEQFSNVGLSLWPAAFVMIQLLAQELKGQTHMLADVLGLPR
                     ATSSTANSSASPAPLLATPNGLHPHTMPTPLSLGPMANCSLRSGKDGSAGSSGTEPCS
                     SQLRILELGAGVGLTPVYLHHMKEYQQHVASFLATDYQESIVDNMRFNMAENGIRLVS
                     DSLAAKRGLEGGPTPPLHGAALLDWLNHADNEEMFMEAEVDMTLVADCIYDTDVIPAL
                     VDTIHLALTARRTAPHTSGTLKKTRCCIVVQTHRQDTTMQKFFSSVRTFGQVRSYTLV
                     RQVVGSLRISEDHSGDDGGCVPLGGWDRQAQLLDPDQVVCALMPDVVLEDGSMRSASG
                     QWHGSDANGTITAAEALLADGMIGPFYTSMVGLIGVHVITLKAAKVAG"
     gene            complement(<726026..>729811)
                     /locus_tag="LMJF_28_1880"
                     /db_xref="GeneID:5653399"
     mRNA            complement(<726026..>729811)
                     /locus_tag="LMJF_28_1880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684418.1"
                     /db_xref="GeneID:5653399"
     CDS             complement(726026..729811)
                     /locus_tag="LMJF_28_1880"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684470.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653399"
                     /db_xref="GOA:Q4Q878"
                     /db_xref="InterPro:IPR007034"
                     /db_xref="InterPro:IPR012948"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q878"
                     /translation="MDEPQKNKSHKSKTVGNKATKKEALRKRRSGIDLEPNRGSNVKA
                     FQGPSAGGRKAQKLYRSLEKKETALHVPTMDKTLRHVVAEPPLLVAVVGPPGVGKTTL
                     IRSMVKFYSNRNLASVRGPVTVIAGRSRRITFMECPNTLASMCDVAKVADLVLLMVDG
                     SFGFEMETFEFLNIAQVHGFPKMFGVISHLDTLKTGKAMKKRKKFLRHRFWHEVAAGA
                     KLICLSPMVRGMYRPTDVLNLHRLLICVEPKIQAWRNTHSCVVMDRIEDITDPDVVAK
                     SPLHSRTVAFYGYARGKPMKPGQLVHIPGLGDFPVAHLSHQADPCQLDKFSGDSKEGG
                     NHRMRHLSLKQKKLYAPYCDVGGISYDDDAIYIQEDAAKGAIERSGEGLQLLRELQNA
                     RPMDAAQTKLRVVPHRRRPMNFRDEDTMELDMGEVRMPSDADDDDWSNDAGDEGACND
                     IVIDSDDNGERERQQRGAPQLSDFGVAKDGEDEAATAGGDDDGGGNSEAALAPRLLND
                     PDAIRLNAIQHDWSDASMLRSLKDLCVTGNWEAGAEGVNEEDAGAAEEGSKGYDSNDE
                     EFEQEARGEKPMTRHGNRRSGTGVAGDFSTSGSEGDDESENGEDGFGSDGDDDLGFGR
                     VRNGSRSTAAAPRRTNALASISYGGGGGGRGSPRQGEEVGVDDKYDGYNILDDDSDGG
                     EVDGSGKAGHSVVGGADRELDDLVSSFLAHGTSHSGNGGSRANGRAATTAGLDGEDGI
                     EFFDEATRYDRDDDGKDGHPRPRRRRVNPQEERIAEAEAGAEAAVRQGGSLTEEQERL
                     LQKKMAKKRAFDEDYDTGDVDGGKNTTFSYYHRLNRQVEEKKERINEALDDVGDDMDK
                     KIQLVGYFSGLYVRIVIDSVPVEFLKTFDPAVPLIAGGINAGEDEFRIVQARIKRHRW
                     FPKILKAQDPLLLSMGWRRFQTQPIFSTEDPNGRCRYLKYTPLHMHCMAAFYAPVAPP
                     NTGFLAIPVRDPRVSSFRIPCTGYTIGNDVSTPIVKKLKLTGTPAKVEKTTAFIKGMF
                     SSDVEAAKFIGAKLRAVSGIRGIIKSVMKGKQGLVRATFEDKLFPSDIVFISAWKSVE
                     PPRYCSMQRNLVDPEWVGMRSMRELRLDYNMPLPRNDDSEYTEIKRRHRVAEEDEDLT
                     KQKVLLSRNLKMQLPYDMKEDFIPINRGTALQERIKGATTVAPEPREQRRQALLDTFA
                     DRADAMTQKKDAAKKRARERSTKEAAKEQEAYLQGLKRAKKDTARMREFRTQHKSRK"
     gene            complement(<730869..>732242)
                     /locus_tag="LMJF_28_1890"
                     /db_xref="GeneID:5653400"
     mRNA            complement(<730869..>732242)
                     /locus_tag="LMJF_28_1890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684419.1"
                     /db_xref="GeneID:5653400"
     CDS             complement(730869..732242)
                     /locus_tag="LMJF_28_1890"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684471.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653400"
                     /db_xref="GOA:Q4Q877"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:Q4Q877"
                     /translation="MSLSTHRPVKGITYGVVCPVCCNPMDFECTSERMYGVRCPTCNA
                     MIDLRNPAETLPDTDTGVYEGDTQRIKVVHYSAEVEPSTGMSASAQVNHLVSSVEAEK
                     RKVMPTVMTGETKQAFSAQRQQALAQKFSLFFPVTHAIEYVVFGRKPYAKIGHVRIFR
                     KRIPFYGYVNIGAPQTTTSYSAPCSFAFLLFIPVEWLFAQLELEWILRYYYTELVLII
                     LFYTLLFRLAYSDPGYVKPGYMDDEGGDTAAAAAAEEMTLRDIERNQRESLWEDVNGV
                     PMERKWCSTCNMHRPVRAAHCYICGLCCYDHDHHCGVLGICVGRRRVEMFSMFVSVAT
                     MMCALPTMIIICALWTNWEKFTAALLAVAFFLVVVLGALSVLLTMTAVSMWQSITQEA
                     STRERIQHVYAHKRNPYNRGFFKNLYYHLVQRRVAASLFDDDFVKRCALRVQERELGT
                     GVTVTCI"
     gene            complement(<735966..>737933)
                     /locus_tag="LMJF_28_1900"
                     /db_xref="GeneID:5653401"
     mRNA            complement(<735966..>737933)
                     /locus_tag="LMJF_28_1900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684420.1"
                     /db_xref="GeneID:5653401"
     CDS             complement(735966..737933)
                     /locus_tag="LMJF_28_1900"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684472.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653401"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:Q4Q876"
                     /translation="MRPVAQQRGGTRGCFPFLLRLRPPPLTLARISHFYCLFIPHLSL
                     SIYACPHCGLVLHAGESLHPSSAGQQTGTTRSQGGMQPSTLNSSHGVSSAHIITSAAL
                     RHPTGATDEEIVECLLLIWRDVSAAAAPRHTPSHPALMHPAALRIFGHDSLQSAATLR
                     HHYRQLAIRVHPDKNTSSRASEAFQLLQSCFEYLISSREVGGVGGVDVVEHATFQRTA
                     DPSRPEEKDAFRRGDAADGEDAKYFSSSTSSSSTSSASPSPLSPPLSPLFSTDSSSSG
                     SGRSLPAHPRTAAAATAGRASPPRPPPPSRRPAPAATSTNRGVILSAPVPEPPDVFAT
                     SADATAAAAVPAPNVFDHSSSDPAVPPPPVFDAHPAFKAGSTGAAQPRIRRRASTGGC
                     TSFAGAASDFGPAPPLVFQQASSTPTDSARGVIARRTGVAKQHSSKQQRSARQPELPT
                     LAELLARLDADDDEDEGDSENILECARGLSSRDGLNGSAARRCRTDETAAVKFSVPPA
                     RLWSSAAHPAASHSRRNTSDSANFESSGAPVTHRASMTTDPVHLDMSCATAVLSAPSS
                     TPSTLEAFYNALQEEVRDTKHCHTSSASPLSHISCGPFAGSSVRSRRAGVGGVEGSSG
                     RATRGRGSGGSTRERCACGKAPRGRCFLCEE"
     gene            complement(<738527..>740560)
                     /locus_tag="LMJF_28_1910"
                     /db_xref="GeneID:5653402"
     mRNA            complement(<738527..>740560)
                     /locus_tag="LMJF_28_1910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684421.1"
                     /db_xref="GeneID:5653402"
     CDS             complement(738527..740560)
                     /locus_tag="LMJF_28_1910"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684473.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653402"
                     /db_xref="InterPro:IPR025602"
                     /db_xref="UniProtKB/TrEMBL:Q4Q875"
                     /translation="MPKRHRQPEPIDIESTSRDRSNHECYDKRRRNSDAILKSSTALR
                     ASSAAATSTASGTERADSVYSPGEIELAEKIRKKAKDFPATPESLVRHRRQLEAHAKR
                     RRISFDKDGQPVGDDNVSGEAALGSQQRRPVLMPGKVSFPSLPGRASSAASKGLDLAS
                     HDEEEDDDDDIDFSSNDYVGDDGNQPSSDDYALGGGSEGDSAAEEEEAELRQLRKSVA
                     AAAAQRRQKIGEGDEDSSDESDGGSDNGEGDEVPDDSSPLGSSDGDSGDSSDMDEEGE
                     SNNDLSDFGREHDNDEESEEEEENSAGGVWGTRRRGGGGAAGQSSDEYDDDDGGGDGL
                     VTVDFGVFDMEASNVDGLLHLMDQLCPDRMNEVDRDELGLALYESPFTSVVRLQNNGE
                     DATGEEAQEFYGLSSVLDVAHGQSLYPAALRPLYGLLQQRVWRQAAPGIPPTDILTSV
                     VDGGPAASSRAKCLLLISEYIRNIPLELTVQILEDVLDRLDAAGQQEKKKIQAQTAGE
                     AMATHEHPIFATHPSMFAVLAKVQRATDAPVTLPKHAVPSSSGGGSEGAGSGGDAAAV
                     AHRKHHNGGSHNTKKGSEGANGSVSGGATGAPDSPLDLTHYIFWREEDNILYELRDKR
                     VATLVYRCRPQYDGQPEHEVPLSLLFVLQYGAVRQAVDKMRRRQMLKAAVERY"
     gene            complement(<742278..>742619)
                     /locus_tag="LMJF_28_1920"
                     /db_xref="GeneID:5653403"
     mRNA            complement(<742278..>742619)
                     /locus_tag="LMJF_28_1920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684422.1"
                     /db_xref="GeneID:5653403"
     CDS             complement(742278..742619)
                     /locus_tag="LMJF_28_1920"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684474.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653403"
                     /db_xref="GOA:Q4Q874"
                     /db_xref="InterPro:IPR002836"
                     /db_xref="UniProtKB/TrEMBL:Q4Q874"
                     /translation="MSRVPISEEQAQQMVAKQQAQQERMEALEEQKENMLRAFVSAEG
                     RERLKRIAQVKAGRSQAVEMHIIQAVQRGKMQPPVSDDTVRELLGQMANQEAESRSHI
                     TIARKRTDDDW"
     gene            complement(<745825..>747087)
                     /locus_tag="LMJF_28_1930"
                     /db_xref="GeneID:5653404"
     mRNA            complement(<745825..>747087)
                     /locus_tag="LMJF_28_1930"
                     /product="putative zinc transporter"
                     /transcript_id="XM_001684423.1"
                     /db_xref="GeneID:5653404"
     CDS             complement(745825..747087)
                     /locus_tag="LMJF_28_1930"
                     /codon_start=1
                     /product="putative zinc transporter"
                     /protein_id="XP_001684475.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653404"
                     /db_xref="GOA:Q4Q873"
                     /db_xref="InterPro:IPR003689"
                     /db_xref="UniProtKB/TrEMBL:Q4Q873"
                     /translation="MREPLEFQSAVASATKTIAYSQGCVGLHPDTSGDGTRRRLSYAG
                     SGHDHGHSHGSGTDGGHGHSHGCASVEGDYMLGLHIAAIFIILAASVVGTLIPIVGKR
                     VPALRLHSYVYAVGKAAATGVVLAVAMIHMINHASDVFGSDCIPESFGEMYEGWAFLF
                     AMIAAIVMHAIDGTVGWIAERWTARAAGKVPPTDPCHDSLCNECSVVPKSELAERPNE
                     GALKGMYGTAEDGRDGVSVLQMDTEGRVGHQHSVAVPEDMPPLQRIVAALCMEFGVTL
                     HSVFVGLALAVSNGADLRALIIALVFHQLFEGLAMGARLADASFKISLELALMLVFSF
                     SAPIGIAAGTGAVMASRDALSGTTYALVSAILDSICGGIMLYIAFNLLFVDFSHDLHV
                     HRGVAKRIGMYAGLWVGAAVMAIIGKWL"
     gene            complement(<749100..>751133)
                     /locus_tag="LMJF_28_1940"
                     /db_xref="GeneID:5653405"
     mRNA            complement(<749100..>751133)
                     /locus_tag="LMJF_28_1940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684424.1"
                     /db_xref="GeneID:5653405"
     CDS             complement(749100..751133)
                     /locus_tag="LMJF_28_1940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684476.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653405"
                     /db_xref="UniProtKB/TrEMBL:Q4Q872"
                     /translation="MSASKQRNGGAAVREAKMTQEGAATQTSRCSPLPRGGNSATAAA
                     FLNGTSEMPAVENNGGSRIRVCYLDEDVTQASWHLVPNVVTLKQMLYEQDQYAVSSPS
                     STSVADHFAKLPLLPPARMPAATSAPHALASEPSAEKTHGSFAFPAIRLSPASSPNGD
                     ARPAWVSIKTVSEEELAAVLENLPVHVLTRRRIISVLCTNTDAGELREPGRGDSSSDT
                     EDTEPSSNRGHEKGDSARRHETARDNFLEYFPAHGYAVLCLQAVGLQSEETTGRGAIQ
                     SVGMSTHGTQLPCTPVVALAFESTLFTFSAGRFGGEGDVQLIMANQSWPTGSSTSTGG
                     AGALALRSAASFAASHASSFSAHKEALVDTAAHDSSLAVWERQGDANLYLDDAGSVAK
                     EGVNGATPRAPHDTCTGRRVVPEPLTYPAAAAAGDPVSALSAERARGAQQPMMLFGTP
                     NKPASPNYCADGAISVVCSSLVSAIIAYFQRSTRALLIEADQLDELVLQILPSRVDQD
                     DMLLRTKNLRHLIAFFHIDALQKERVLKELLLPAMRLTPFSRSSQGVESYQRSLSSVR
                     RTVLSLCKGRDIVNRANMTLVSGVSARLLSHCNFMDYLSHVHTQITVILIPITIVPNL
                     FAMNVRVPFTDAETTTPFFCIVGFTMGILVLSIAPIVYKFLMYKAPGALATLE"
     gene            complement(<754856..>756916)
                     /locus_tag="LMJF_28_1950"
                     /db_xref="GeneID:5653406"
     mRNA            complement(<754856..>756916)
                     /locus_tag="LMJF_28_1950"
                     /product="putative X-pro, dipeptidyl-peptidase,serine
                     peptidase, Clan SC, family S15"
                     /transcript_id="XM_001684425.1"
                     /db_xref="GeneID:5653406"
     CDS             complement(754856..756916)
                     /locus_tag="LMJF_28_1950"
                     /codon_start=1
                     /product="putative X-pro, dipeptidyl-peptidase,serine
                     peptidase, Clan SC, family S15"
                     /protein_id="XP_001684477.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653406"
                     /db_xref="GOA:Q4Q871"
                     /db_xref="InterPro:IPR000383"
                     /db_xref="InterPro:IPR005674"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="InterPro:IPR013736"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q4Q871"
                     /translation="MRRVCTDLPHPTQFVEHIYITLNDNIRLAARLFMPKDASSEHRY
                     PAILEYIPYRKRNGTRIRDEPMHGFFAGHGYVAVRVDMRGAGESDGLLLDEYLKQEQD
                     DALEVIDWISKQPWCTGDVGMMGKSWGGFNSLQVAARRPPALRAIIVLGFTHNRFTDD
                     IHWKGGCLLNDNFWWGCIMQGFQSCPPDGDIVGDRWKEMWLERLDKMPLNAADWAEHQ
                     RYDAYWQHGSIQEDYSSIQVPVLLIDGWADSYTNALFHLLEGLKGPCKAICGPWAHVY
                     PQDGTPLPRMNFLRAAKDWWDYWMKGMTANDVASWPVLQVYIEDSLPPCTIKPMAPGK
                     WVAMDKWVNAEVPTVMYGLGAGRFLTEMGKDGATTATGTVMVHTPLNHGLISGEWMGV
                     GTIGESAGDQRIDNGLAVTYTSAPLTAAMDILGQPIFSVTLTCDRPKGFLFAQMCDIA
                     PDGAATRITYGIKNLVHCGPEGDRAIALVQPGQAVQVTVKMDFCGYCIPAGHSVSLSL
                     ANNYWPMVWCSPGDTTLLLDATTAVFRVPVLHPSATIVPGPDSIPEVAASTPMTVMAP
                     GRVERSVSYEIVLDTWTCVTSVVGGVFGEGIPRLDDIDTTLEHSLRRELTLSNRDPLS
                     ARYTINQKFKVSRPHCVTDVNITSTQHCDADYLYIQSKIKAAHNDEGVFEKSFCRRVR
                     REAI"
     gene            complement(<760673..>762964)
                     /locus_tag="LMJF_28_1960"
                     /db_xref="GeneID:5653407"
     mRNA            complement(<760673..>762964)
                     /locus_tag="LMJF_28_1960"
                     /product="elongation factor G2-like protein"
                     /transcript_id="XM_001684426.1"
                     /db_xref="GeneID:5653407"
     CDS             complement(760673..762964)
                     /locus_tag="LMJF_28_1960"
                     /codon_start=1
                     /product="elongation factor G2-like protein"
                     /protein_id="XP_001684478.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653407"
                     /db_xref="GOA:Q4Q870"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q870"
                     /translation="MLFYAGVTKRVGDVDSGTTTTDFMKEEADRGITIQSAAVSLRWR
                     DHGINLIDTPGHVDFTVEVERTMRIVDGVVALFDASAGVQAQSYTVLQQSRRFNAPLI
                     AFLNKMDKYNADFAMSVNSIRTKLQVEPLLLQIPLHAEDGSFAGVVDVVEQVTCRFDG
                     EHGFEVQRTDLSTIGASPSSTGDGDSAADHELTHLTRPMRKARHDLITQLTAVDDALS
                     EAFIAELDATDGDEAEAERRLSSEALRSAVRRSVVHPPRDRPPLVPVLCGASRRDQGV
                     QPLLDAVTYYLPSPCDRQLTGFTKDGIPVPLPPASAAPTVPTVALAFKVMHMMHPGKG
                     QRLPLVFLRVYSGRIIPRMRLENNSRQKSEVIEKLYVMHANHPVEVPNLEAGQIGAAF
                     LTHTYTGDTLFSQPSHHLLQAKQHVRRGDVREEVHTLEGISAPPAVISFSIEAATRNQ
                     VELLKSALAELSREDPSLRVTESEQGTVVVSGMGELHLEIIMSRLANEYQVKCRLLRA
                     IIEYRETIRATQSVERHTCLLNDLPYAECSLELRPLLENGERCSTKDQCRFRIDSAFE
                     EEFLSGGRHQQQQGGGLSSWSRVSDVRNAKEELRLIAASFQSAVDACMRLGPLAGLPM
                     HGVEVVLTYFRKTAGSQLQERSLAHVARSVLLSLLKATRKDDLALLEPMMEVEVHLSE
                     VTYIGKVVSSLNEHHALTVDVQDDGRSVTAVVAMRNTLRYTMELRKAVKGHANMFVKL
                     HDYRVVEEKAVLARILKNLGIVD"
     gene            complement(<766756..>767274)
                     /locus_tag="LMJF_28_1970"
                     /db_xref="GeneID:5653408"
     mRNA            complement(<766756..>767274)
                     /locus_tag="LMJF_28_1970"
                     /product="putative ribose 5-phosphate isomerase"
                     /transcript_id="XM_001684427.1"
                     /db_xref="GeneID:5653408"
     CDS             complement(766756..767274)
                     /locus_tag="LMJF_28_1970"
                     /EC_number="5.3.1.6"
                     /codon_start=1
                     /product="putative ribose 5-phosphate isomerase"
                     /protein_id="XP_001684479.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653408"
                     /db_xref="GOA:Q4Q869"
                     /db_xref="InterPro:IPR003500"
                     /db_xref="InterPro:IPR004785"
                     /db_xref="UniProtKB/TrEMBL:Q4Q869"
                     /translation="MSKRVALGCDHAAYAAHREIMDMISASGAVSKVMYMGPSSDTSV
                     DYPDYAAQVCEAILKGEADAGILVCGTGIGMSIAANKFRGIRAALCYDHVTAQLSRQH
                     NNAHILCIGVRTSGMEIIRDIITTFLTTEPLAEGRHSNRVDKITVIEEEQMKDEQRCC
                     FSGCGGRKEEGK"
     gene            complement(<768903..>773183)
                     /locus_tag="LMJF_28_1980"
                     /db_xref="GeneID:5653409"
     mRNA            complement(<768903..>773183)
                     /locus_tag="LMJF_28_1980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684428.1"
                     /db_xref="GeneID:5653409"
     CDS             complement(768903..773183)
                     /locus_tag="LMJF_28_1980"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684480.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653409"
                     /db_xref="UniProtKB/TrEMBL:Q4Q868"
                     /translation="MSLRSLVTSGQEPLPPRRLPAYAYHTEPPIRTVVSDMSARESVS
                     VMWKLWLEGQYNELGKRLGNTGEILERKDEARFACEFLASGGLDIYCLILCDPFNPLR
                     FSPERTVRSMSAFERGRRQRTLEHIIGIYAEVMLQLTDLVADQNDLGWVIYDRYPGVF
                     YRLIEFLEDSSLWAAATGLLEHILACVGPVLEISKNPSLIRVLRRASPTALAAFCRFL
                     ALLILPGLAQGQNPILARRLHYPETVAVLRQVQRVVDSNVLWLIGEEGLVSTLISLCE
                     LRPNGLRVQQGGRSMMMFPPETTLIGGTGQRAANATRAGGRASVVPLGSEDVDWEDEE
                     EEDDQWSDNEEQGGSGASGGSGVTADFVFDGSSLPTLFAGIERFLGIGQSQSQAPPPA
                     PFTSPTPPPRPQAPQPSPPSGSTDPPGASPPRADESAAFSEYLEYIRTAVRSGTVSTA
                     LGVNRATSGVAPSLPPPPPLSTPAEQGGIRVEVGSGRGNVAAQMVVELERAGLPRDGA
                     EQIAFLNRITSNQFQAEDPSRLVQWMLDRDMLEDDDMEQNFKSSMDIHWWVGSADTRQ
                     RWRLRDPSLIPERDDNRHALVCSTVRRTIAPGPRPPTLEEFSSANERLSAELFEPLPR
                     VDALDLLDPVDTQRIVESQSEVLYLLNMFLSTFYFSDSWKALRDCRWVPRSVPMLESA
                     FGLDPSLPAFVDVPPHVNLSDKLRALPRYLPPCAPDDQEESDTLADGSPRYPATWRLV
                     PFLQLLGDLAVVYLRDPNQMFEEETENHQHGPDTMRKMELLRGLYEYWNAQDRREQEM
                     VVEDAEVVASAWRNAQAIARVLHRDQEDSCVRASLYQTLDSYLRTFLFREAYRDAPDC
                     PQTRLGQVLLTSVLERIYNGTRIPGLSGSMAPGRLLSNMLQLLGELLRYHAGNLRTLC
                     AYVVGDRDMSRLNEAMSNPNRQNPVILSAEHEEVEEILKRPPLEREEHEPFGSVLLRR
                     LFTFGVDTHHLLRSLLLSLTPGLRSTGNYISKPVNDSVDDVRLPPTLPGIGRTSDIIS
                     GDAVRIAYVIRVSRQYTREISLAPAHGLRREELLRELVCVLARTPHRQAPEHRPFPGL
                     MCGENDLALLRSQWPLPVVGPPLRLRATLFSGFGEGSAKALPSSTPCPEPLLSPPQGI
                     LSTAQAQTASSTDLHDAAETAEDAARLEELAPLTRLLLGEPHKLIFSALCGLNIESME
                     DNSRLSVVTTVLLVFLRVASVGSSRESAAAAEANIRDVLEKMKSFAGHGHSVWLGEER
                     AARAKEREARRRQALMSVSGDQGICACDWHDAPKAAEAEDQRRKPNEAAAALTNSFER
                     PTGDGSAATKSGLAPDELPRRCPSFMAYGSCDPPHEGSVYQREFGGCFYRSFFRLLCL
                     WVGYYASCQRYVETVYFSTEVAFGEYKTMALFLMRILPDFFMPHFSQC"
     gene            complement(<777598..>779841)
                     /locus_tag="LMJF_28_1990"
                     /db_xref="GeneID:5653410"
     mRNA            complement(<777598..>779841)
                     /locus_tag="LMJF_28_1990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684429.1"
                     /db_xref="GeneID:5653410"
     CDS             complement(777598..779841)
                     /locus_tag="LMJF_28_1990"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684481.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653410"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:Q4Q867"
                     /translation="MALEHCAAAALYISACKREHAQICDAFVQALDRDAKAAALGQGT
                     VPLNDIDVCCVAEVIRTLSDESQLRVLVLEENSFGLPGVTALMEAIEANPNRIRELRL
                     GKNNLKDQAAVVIGHTLSRNGCGLKVLDLSENNITKLGVIPIAAALQQPFCDIVELSF
                     HNNKIECDAASYLGQALRAAPKLKHLHLGYNALRDNGATQIARSVPHAACLSTLDLTA
                     NRISREGGEELVRALMTPTCTVQRLNLRYNQLDSETIVLFADVIAHNTSLIQLFLGFM
                     NPSPEAAAAVLSAIPQNHALLLLDIYGWKLNPKNTLALIQAVQEKNTTLAALVTDACG
                     FIAPQVDEGNLMREERRDLHPIYVGPNDRDAYLATKSLRRYSRAQSRRQSRTASRAQS
                     RTRADGQPASRTGSSHRRSERGGSRQASISSRAVSPAEQEQAPRSQCSTPRHSRRKSA
                     SARRPRHRHGESTPTDPAEATSAGALLRTPRSVPASIRSASRSSRAAAGHLVPVTSRN
                     VDEDMDVLIDELQDTPGDPHTTTILKTIIKSLHGSIKQQRTQIQALKTRVEALEARRE
                     CHCDVRGGSNSRSGTSPQRGGSAGNPANLTGPLAKGGAAAAAGSQSGTKGPSYHRVIS
                     KAGMISYGKITATADANGNGLYVYHGQPNHQAQHNPAAHSFQRSMSRMSQNTSTTVLE
                     RCTTPHVSQDVPPDIAHPNDESGEHHPEGVELQRSAAIQSFPPRIEPSPSQDLNPPLR
                     KSVSHAF"
     gene            complement(<781887..>782216)
                     /locus_tag="LMJF_28_1995"
                     /db_xref="GeneID:12983029"
     mRNA            complement(<781887..>782216)
                     /locus_tag="LMJF_28_1995"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722025.1"
                     /db_xref="GeneID:12983029"
     CDS             complement(781887..782216)
                     /locus_tag="LMJF_28_1995"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722073.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.1995"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.1995"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12983029"
                     /db_xref="UniProtKB/TrEMBL:E9ADK1"
                     /translation="MACVTGGCCSAAYYICLAAICIYLFVCILAVPQYRFVALMIFAL
                     VTLYATSAWRLLPSERLVVREMAEAMARQRCPLPAVAVPFTTPMTAGAAVTHPSLAFH
                     EPYRGSI"
     gene            complement(<793386..>796019)
                     /gene="LDK"
                     /locus_tag="LMJF_28_2000"
                     /db_xref="GeneID:5653411"
     mRNA            complement(<793386..>796019)
                     /gene="LDK"
                     /locus_tag="LMJF_28_2000"
                     /product="putative protein kinase"
                     /transcript_id="XM_001684430.1"
                     /db_xref="GeneID:5653411"
     CDS             complement(793386..796019)
                     /gene="LDK"
                     /locus_tag="LMJF_28_2000"
                     /EC_number="2.4.1.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001684482.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653411"
                     /db_xref="GOA:Q4Q866"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:Q4Q866"
                     /translation="MATGKVIGDVVQYRLDTPIASGAFSTVWRCSELSSGRTYAVKIV
                     EKKAALRNKMTGALVREVNALEIAGSSPYVTGLVDKMVSKHNYYLVMDLAEGGTLLDL
                     IRERRQELRQLQVSSSIGCSVMDSLQLSATPFMPYDRVRYYFKQLLLALSALHDRNVV
                     HRDVKPENILLNKHRTRLLLSDFGFACHSMLGAQLHRACGTLKYCAPELLHEHPSYDG
                     RKVDVWAAGITLYMMLFGGYPYRCSRGDPDALLEVIETTTYRIPRPIPALIEDILQHM
                     LCIDSTQRWSVKQLLQHPWITGLELHSPSASPTTSASAFSGEVLVPPAASAPETEGAI
                     TEMPSEDCPPVDSLLSDEDDVDDGFYQSINHDHLSSSVSSGLNSSTISTQQPRQRSSL
                     ADSRRSHKEAFPLTVSPASPLHCGDPAAVQGGESETPGASKGFAVQPRTRSSRTSAKE
                     EILKYGIEFTSLTSIESFIASDDEGEKGDSDDESRFWDEMREGTATRGHCGNTSMSRS
                     LYTGASHASDVQRSGRRGRYSYGLWLTARMVAHLVAFIAVCVVALALRVFLKRDIIDL
                     PLPKVIRDYISFFLYTPLRRSHAHLSGAAPTLSRSRGGSPTSSALALRQKGIHGDSSA
                     CCPPTTSPIPGSGLRHCVRTADKLMRNSFMGNVVLSHDAPLVDFAYGKTPMPCPRKHS
                     RDHSLSSTPAAPSLATMAPTQPSTRRQSMERIEASTAEVYAENVELSALPLPLNSEKR
                     RENRNCLVSPGGGDEEGCNEQRDRQESDSSLRKERRSTRSPPPPLMSVGDPISATTAA
                     ITSLRTLTSAKTPVRSEARVDSQAGATDDTGSCDSALDKSAYLPHQNIMFSPLDPMPM
                     ALGDHQHEMEDFPVVAKTGPA"
     gene            complement(<798751..>800400)
                     /locus_tag="LMJF_28_2010"
                     /db_xref="GeneID:5653412"
     mRNA            complement(<798751..>800400)
                     /locus_tag="LMJF_28_2010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684431.1"
                     /db_xref="GeneID:5653412"
     CDS             complement(798751..800400)
                     /locus_tag="LMJF_28_2010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684483.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653412"
                     /db_xref="UniProtKB/TrEMBL:Q4Q865"
                     /translation="MHSRIPLSIVFSAEGRRHIIPHRTFRVAAQAADGSAGASTYTDA
                     AEEGIAFFRYLDSNDTRMPSHPHLRAYAHPAEEYETYVGEEVWNDADEGPTSASGQPP
                     VPDTGKAQGGSSPCCATSEDAVPVPSFRSVVEWVNSVFEEEEWASDGVVLCGRYVVAD
                     DGAWVVPSRSPALYTTREVFLLMRNSSKFLHDVHAQVIDVRAAAQKGAHGGSLTFEFT
                     LAKSLAGSGASEMRAILPYPLHFSPQTRTWAVEDTAASLSFTGIGQRVTDVCFPSLMA
                     WTEAEHDDNFRFMQRRIEQAALLERTCAADPGFISRLVGAFDKRRHRGSATDEVAGHQ
                     HSHPSLALLLTLDLLFESPSLPIYVLSAKARLFEVAPRTSATWTAINDASQWHLWTPL
                     LVDADATGADGASDGAAAADAACRGDGNTQATPSRENEDSEGAEEEEDVATGSLGFFC
                     MFRDIDHWNQYVSAMVARLQQSRAGAMGPDDSNKPSRGVQHYCVVASESADLVACADT
                     LTKRGLPLELMHPELLERSEEAAGFLKMLSDGLLKRPGGDN"
     gene            complement(<801195..>802928)
                     /locus_tag="LMJF_28_2020"
                     /db_xref="GeneID:5653413"
     mRNA            complement(<801195..>802928)
                     /locus_tag="LMJF_28_2020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684432.1"
                     /db_xref="GeneID:5653413"
     CDS             complement(801195..802928)
                     /locus_tag="LMJF_28_2020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684484.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653413"
                     /db_xref="UniProtKB/TrEMBL:Q4Q864"
                     /translation="MASSSPQVKMDSAIRATDEYAAAFDLEVWKAQQQLRYQAQLRQA
                     KERLERRLHKEARESEKKKMAELERLRQELETMGHRLQVASETLEKRTAQLDAREAAF
                     NVKRVKVAEQHEAYVARAEEQARRTREEAQLAQSSLQARLQEKDRMILQLQERVSSAQ
                     QEYDLLRRRAARYLSEQNDTEGQRLREQECALSLSQTQLAETQRQLREKSADVARLAE
                     SQASLEQQLHELKRQLAIVTRKYHRLREECQAREWERLRKEQGALSPTRRRQSLHAHR
                     LQQPQQPLSAPFVPSGFINGDASTTAGNIASGVAERDDFYAMLTELRQEVAAGLAAVN
                     RTSRPGPLPFTIVERPPGTLHSTARDTSCHSHASPQTRTCTTSITAGESAGDPTTGVP
                     SRQDTTLETSSVSGVSRILQRKSPPHAHRRPQVGDSGAETSVVVDMGDTSIDSAYPPI
                     DLPPWTTSMIADEEDGVASLPSVRASTLPPLAPAQRGLEEASPDTASPHISPTPEEFV
                     LARSAPLDDTSSAAKSAAARRDMETFLQQLKMNREKLLETGVYSEDDQVVKEMGEKIR
                     MYEHYLAQQRQ"
     gene            complement(<803943..>804464)
                     /gene="NB6M"
                     /locus_tag="LMJF_28_2030"
                     /db_xref="GeneID:5653414"
     mRNA            complement(<803943..>804464)
                     /gene="NB6M"
                     /locus_tag="LMJF_28_2030"
                     /product="putative NADH dehydrogenase subunit NB6M"
                     /transcript_id="XM_001684433.1"
                     /db_xref="GeneID:5653414"
     CDS             complement(803943..804464)
                     /gene="NB6M"
                     /locus_tag="LMJF_28_2030"
                     /EC_number="1.6.5.3"
                     /codon_start=1
                     /product="putative NADH dehydrogenase subunit NB6M"
                     /protein_id="XP_001684485.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653414"
                     /db_xref="GOA:Q4Q863"
                     /db_xref="InterPro:IPR009346"
                     /db_xref="UniProtKB/TrEMBL:Q4Q863"
                     /translation="MLSSTARRLVRDPVPTDTKAFYTWFSGQAYRQERVIPGGYPAVR
                     VYPVYGKRWFTGRTVIAIVAGISIFGAWVRPERERYNMEMMIEFAERQAAHLPYQTAE
                     VNLRCFITGYKRYRYEKENLIDKGYVGLTSEFRKFFYHNDVWRPPLHDVLMHPYVKYG
                     GPMGSYNWSVGYF"
     gene            complement(<805576..>806172)
                     /locus_tag="LMJF_28_2040"
                     /db_xref="GeneID:5653415"
     mRNA            complement(<805576..>806172)
                     /locus_tag="LMJF_28_2040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684434.1"
                     /db_xref="GeneID:5653415"
     CDS             complement(805576..806172)
                     /locus_tag="LMJF_28_2040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684486.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653415"
                     /db_xref="InterPro:IPR026224"
                     /db_xref="UniProtKB/TrEMBL:Q4Q862"
                     /translation="MLAEPKSSVIRGDRKCITSKFTDGSELVDEYDVVTDSLLLRKRR
                     TRNALGGFSEWSIEVGTEAPSRNLDRALIAESSGSPVVVRQDTKESYVVRIRNLPYPK
                     DVFSVAVEREDGDSVGKIVVRTSNRKYFKRLAIPDLERAHIPLESAHLSYDVQHQTLI
                     IQYKKPLSVLAAEAAARKERASMPSKRADDSGPDCKQQ"
     gene            complement(<806906..>809917)
                     /locus_tag="LMJF_28_2050"
                     /db_xref="GeneID:5653416"
     mRNA            complement(<806906..>809917)
                     /locus_tag="LMJF_28_2050"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684435.1"
                     /db_xref="GeneID:5653416"
     CDS             complement(806906..809917)
                     /locus_tag="LMJF_28_2050"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684487.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653416"
                     /db_xref="GOA:Q4Q861"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR006162"
                     /db_xref="InterPro:IPR009081"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="InterPro:IPR025110"
                     /db_xref="UniProtKB/TrEMBL:Q4Q861"
                     /translation="MSSKVRRCVGDGATLSACILAALEERGDDEVMFALLRHRHCDSS
                     KAARLEGSSGAVDGSGAAITAERVTKRAWCALVELLKRRIITSSHDRRSLPLAGGVRG
                     TPGDERGAEDECDVGVYSQETFYACLVESVCLCMGWTFCLFRPDDPPLRLQRLEQRRR
                     PRCKLRSEDVSSLLHEALSAEENSGCNRKLQMVEVGTAAPTRLPVVHVDDSRVAYYMY
                     TSGSTGDPKCVVASRGNLRAYLQRFILDKDGLAVGDARCRFFCLSSPFFDPSIGDMLV
                     GLCTPHSVFYTCTQEDLLNGQAAPLLACVQPTHVVSTPVVWSSLTTAGRLLSVLPSST
                     APMKVFLGGERMSQALITTWADRAELYNIYGVTEATIYQSVWRIFPGTRAEHVKCGPG
                     VGTRVRIQRLDAASDVLLGNSDAFALEEGLLQELGESAGDDYGEVVLYGDQVCCGYAE
                     DSTLSPFGCDAATGKRFFRTGDIGRLVSTGEGGPPDLELRGRRDWEMKLNGQRVALEE
                     VEGTVQRALAGLFSQCACFRVQSASDTPAIGAAVVLTDVVDGGLLSDHREGVAAALQE
                     LLALHLPSFMVPRRWLLFANGASLPQTPTGKVSRTQLAIDAVQEQQEELDAQLNEKHD
                     DCSREEDELYRVVQSVWQGMLGVPVRCDTHYLHAGGDSLGALKLSRAVYLGLHAGSDV
                     GIDEHGRLPPPFQPCVLLQHPRFGDYVQALREAWAEAPLNGVSKPENGETVTALPLRL
                     QPLQVLIPAEAAADSLFREVVAVQCAGIADRLLHHGLADVNGHNRREHRCTTPLHVAV
                     ASCCSLEQELATLRVVEVLLQHGAKLTAVTPDGVTAAHLAASKSAAILRRLLEHDQAV
                     VHCRDARQQSLLHFAARSGNAETARLLHQYGLKIDTRDKWQRTPAHWAVLNGHAAVLE
                     EMALYCTSSATTISAAAASKAPEPNGMGAKRRRCPGNETARFTRLARKKTYLEYETLH
                     EIARRLHPTDDRIKRLCDILAPSVGEASVTE"
     gene            complement(<810518..>810931)
                     /locus_tag="LMJF_28_2060"
                     /db_xref="GeneID:5653417"
     mRNA            complement(<810518..>810931)
                     /locus_tag="LMJF_28_2060"
                     /product="DNA-directed RNA polymerase-like protein"
                     /transcript_id="XM_001684436.1"
                     /db_xref="GeneID:5653417"
     CDS             complement(810518..810931)
                     /locus_tag="LMJF_28_2060"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase-like protein"
                     /protein_id="XP_001684488.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653417"
                     /db_xref="GOA:Q4Q860"
                     /db_xref="InterPro:IPR008193"
                     /db_xref="InterPro:IPR009025"
                     /db_xref="UniProtKB/TrEMBL:Q4Q860"
                     /translation="MASFHPRDAFILHQEHIQRMNEGDEVDTSEEQKVQIDLQRITDN
                     ESTAVVAFSHEDHTLGNPLRHVLMQNAAVTSAGYAIPHPLEPKMLLHVQASDYAVEAV
                     AKGLERLAEICDDTISSFDNCMVEQHRMAAAAQPE"
     gene            complement(<811782..>812942)
                     /locus_tag="LMJF_28_2070"
                     /db_xref="GeneID:5653418"
     mRNA            complement(<811782..>812942)
                     /locus_tag="LMJF_28_2070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684437.1"
                     /db_xref="GeneID:5653418"
     CDS             complement(811782..812942)
                     /locus_tag="LMJF_28_2070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684489.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653418"
                     /db_xref="GOA:Q4Q859"
                     /db_xref="InterPro:IPR005145"
                     /db_xref="InterPro:IPR006070"
                     /db_xref="InterPro:IPR017945"
                     /db_xref="UniProtKB/TrEMBL:Q4Q859"
                     /translation="MAQIIGTSPEDLRRAADALVQGKLVAIPTETVYGLGGNALIGSA
                     VKSIYAVKGRPPTDPLICHVYTLDGACRLWDQKWDEGAVELACTIGAALWPGPLTIVC
                     KANPTLPDCVTGGSGYVGARIPNNPVALKLLEMVDAPVAAPSANTFGHVSPTTAQHVY
                     DDLAARDPELLIIDGGQSAIGIESTVAKVESKDLVVVLRRGCITVSMIHRAIAGRYPQ
                     TRVEIRDTRIMCDPAKALMVSPGQLLTHYSPHVPSSLLTPGSLGALTASADVPVYVHR
                     GKDVVPLCETIVLDFNGYLSRFKDACLSYHDMSPDGNPEEGCYAVFDALRATETVKGA
                     KGLVFPLISEWPHAKAKADLLAAMEDRLFRAASGVTAVLINEAAPASARHTD"
     gene            complement(<814559..>816193)
                     /locus_tag="LMJF_28_2080"
                     /db_xref="GeneID:5653419"
     mRNA            complement(<814559..>816193)
                     /locus_tag="LMJF_28_2080"
                     /product="putative mitochondrial DEAD box protein"
                     /transcript_id="XM_001684438.1"
                     /db_xref="GeneID:5653419"
     CDS             complement(814559..816193)
                     /locus_tag="LMJF_28_2080"
                     /codon_start=1
                     /product="putative mitochondrial DEAD box protein"
                     /protein_id="XP_001684490.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653419"
                     /db_xref="GOA:Q4Q858"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q858"
                     /translation="MRRFASALFGRWGAAQCGVVPFRARPTLLPMMSRVRCFSVISAA
                     YEGLAPATSSNIGDPHAPPKTRASAVSTEHDVSITDGNGDRVDVTPLNSFEELRDAPR
                     WLAEGLKTLKYPSTTDIQKFTIPLLANGHDVIGLAPTGSGKTVAFAVPALAGLKPNPD
                     GTPSVLVLAPTRELVQQTTKVFQNLGCGQVRVCEAYGGAPRDLQARHLRNGCDALVAC
                     PGRLKDFLDGGDVSIRNLSFLVFDEADRLLDMGFQVHLDEIMAYLDSASHPQTMMWSA
                     TWPESVQAMARKYLSDDRVLIRAGTAGAGLQVNERIKQELIFCRTFTERIEKLGSLVE
                     DGTIDDNKDKLIIFVERQADTENTARAFSHRLGIDTRYVGTIHGGLSQRQRDRVMSMF
                     KSNHIRLLVATDVASRGLDIPDVTCVVNFQAPKTIDSYCHRIGRTGRAGRTGTAYTFL
                     GEEDGGLATELVNYLTRCHVTAPKELTQLAESYQHRMQQQRQRFRRVDRGGFSRSENS
                     SGFGRRRSDRGGSREFMPRRPDSRKRDDDLPSTLDW"
     gene            complement(<816665..>818548)
                     /locus_tag="LMJF_28_2090"
                     /db_xref="GeneID:5653420"
     mRNA            complement(<816665..>818548)
                     /locus_tag="LMJF_28_2090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684439.1"
                     /db_xref="GeneID:5653420"
     CDS             complement(816665..818548)
                     /locus_tag="LMJF_28_2090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684491.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653420"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR028926"
                     /db_xref="UniProtKB/TrEMBL:Q4Q857"
                     /translation="MNSLQGSSQVSPEHLKSMKSAIHSFLQETGVYDSIRDIVDTYVS
                     EHGDEAVSSENPSAIMRIVKEKGILQELVSQIQSRPTVGAVPSITVPSDGRHYLLVRV
                     NGGRAFVDNLDLAPSTASKRSVVFAAHFGNQRFCSAVKACSAEPRFDEEFLFEVDATG
                     FGFGEADLIEVSTPFHIAVLREDSQLNVAELLGENIIEWRKVLKSGYLGLTVELCGRN
                     AGVPAGIVDLQLELVSKKRIRYKEEDIVSRVEQQRVAVTNSDREFLVYSRRWWSEYQG
                     LRPTHKDRKVRLFASTSTGRMVPLTHFISPIQAECGLDSPQDAARFVSLLRVTAEGTG
                     SIGALSLEESNWLSPFIFLSQRQGYHCNHAALLCSLLLGFGIDAYCGLGSCHNGEVGV
                     FVVSRSTDARGSAKITVWNPTSGERSSPSEQATFATVDCMFNNKSFFANCQASNNIAT
                     TSFECYNEELWKPLNVLKLRMVPRYPPAPLLFEAVVASSIERSLEIQLRASISMYRDS
                     FGVMTTYDDTVSYVLSQALLLYERQQSEGGAQSFALFQESVKGTLGVGKTFKAIPLNV
                     SYLDAGSVMDVVRAASVGREILDTVVDSAKFGVRAKVFCFPERVFSVWVMIAVNYSAA
                     NVS"
     gene            complement(<818807..>819235)
                     /locus_tag="LMJF_28_2095"
                     /db_xref="GeneID:5653421"
     mRNA            complement(<818807..>819235)
                     /locus_tag="LMJF_28_2095"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684440.1"
                     /db_xref="GeneID:5653421"
     CDS             complement(818807..819235)
                     /locus_tag="LMJF_28_2095"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684492.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2095"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2095"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653421"
                     /db_xref="InterPro:IPR007919"
                     /db_xref="UniProtKB/TrEMBL:Q4Q856"
                     /translation="MTRRRSTIIVASGGIFGCALLVFMDGAVMASKAKLPYNFLMWLP
                     TLVALLGTFVLSLVKPVYILGADSDFDDDDDSIKKAKSMFFLGALLLFTSICFSIWKT
                     VDPYGSKGVAWPGAALLVHSLLLMLMNCALFIARAQYDED"
     gene            complement(<819522..>820571)
                     /locus_tag="LMJF_28_2100"
                     /db_xref="GeneID:5653422"
     mRNA            complement(<819522..>820571)
                     /locus_tag="LMJF_28_2100"
                     /product="putative glycerophosphoryl diester
                     phosphodiesterase"
                     /transcript_id="XM_001684441.1"
                     /db_xref="GeneID:5653422"
     CDS             complement(819522..820571)
                     /locus_tag="LMJF_28_2100"
                     /EC_number="3.1.4.46"
                     /codon_start=1
                     /product="putative glycerophosphoryl diester
                     phosphodiesterase"
                     /protein_id="XP_001684493.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653422"
                     /db_xref="GOA:Q4Q855"
                     /db_xref="InterPro:IPR004129"
                     /db_xref="InterPro:IPR017946"
                     /db_xref="UniProtKB/TrEMBL:Q4Q855"
                     /translation="MRLLSTIALSGGAYIAFCICLLQIAVRSKRRKSLLKKKFSYPMT
                     KIAHRGGSLLGPENTIYTFMQAAKVGLCDMIELDVRESKDGQIVVCHDRTLERTCGPE
                     YAGVMIADLVVGKNPSKTLPQCKRTIELEFATRDTKQYEASDSVPIDDTTRICLLSEV
                     LKKFPSMPLHIDIKDESKDFVAAVLDLLAAHGRESITLVGSSQPKNRQFINEYFAERE
                     PEIRKRYRIFGGPHDFFKTYLLFYTGLLPYFSVDYDVFSIPVFASSMKNDAARKYGRV
                     VAAMGAFLFSSPLLWRYLQSRGVAVIGWNLNDEVDILQGNQWPLNGLMSDDPIKLCQL
                     IDANKRVARLNALAG"
     gene            <824941..>827241
                     /locus_tag="LMJF_28_2110"
                     /db_xref="GeneID:5653423"
     mRNA            <824941..>827241
                     /locus_tag="LMJF_28_2110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684442.1"
                     /db_xref="GeneID:5653423"
     CDS             824941..827241
                     /locus_tag="LMJF_28_2110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684494.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653423"
                     /db_xref="GOA:Q4Q854"
                     /db_xref="InterPro:IPR001373"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="InterPro:IPR016159"
                     /db_xref="InterPro:IPR019559"
                     /db_xref="UniProtKB/TrEMBL:Q4Q854"
                     /translation="MAEQESRTWNSFPPLWKEVAGVCNTAFQKFKKRPSQNLCKDYNK
                     LISQICEAHGLVYNLTAYQCSNYPALVRGSNSTPVVGETVESTQVLVVYYLLRELLKK
                     QVNSVKSTIQKDSILSYLDAYEKYTAGGNVVKSIFTYLHWSWQKRGLPAEHIIQPTEI
                     VVGHLWMDVILTSELKESFRAKVNEIVCRVRSGGPTSVGEMESVKRFSLNLGCSTDVR
                     LTLYSSMVEETYLKSLASFYCAKRPGFKALGVVEYINQCVKAVKKEDVLARCFLIRSS
                     YEQVSESVLRILIHEEKNYLLPFCKKCIDPSDGNDPLSSKKSLSALYDLLGGGAEESW
                     MEDLLTETVSEYADRELKKTSDSSEASSILRILKKAQQTFEMTISGIFGHQPRLIRAV
                     YDGIQANLAALERPTATEDNAAKIAKRLAKYAAEEIKSMPIDELRRTNNWIAVIYRLC
                     SRQDVYHLSYTRFLQERLLTNIFGTGKQSEIAVREESMLSSLLIKDKNFAFIFNCMRM
                     LNDARRNDSKRAERVQQLLVKPYILTAFAWGESRRSPDMGRTSVPLELQSVITHDIDA
                     YSALRNGRKLLFSPEHSGARVRMSVSNKAASFLLLVSLLQMRYLLVMNKMSEWSADEL
                     CSQTRTSLEECKRALTPFVQTGLLQETAQHVFKLDPNIFALQSGEEKMYDLRYIELGS
                     QQSNPEKNTLFLRGEKSHVLSIEGAVMRLLKELGPLSLDVIIGKVSASLGKLSVQRRD
                     IKKVLEKLVEREYVERSEDNCFSFIP"
     gene            <828172..>830325
                     /locus_tag="LMJF_28_2120"
                     /db_xref="GeneID:5653424"
     mRNA            <828172..>830325
                     /locus_tag="LMJF_28_2120"
                     /product="putative cullin 2"
                     /transcript_id="XM_001684443.1"
                     /db_xref="GeneID:5653424"
     CDS             828172..830325
                     /locus_tag="LMJF_28_2120"
                     /codon_start=1
                     /product="putative cullin 2"
                     /protein_id="XP_001684495.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653424"
                     /db_xref="GOA:Q4Q853"
                     /db_xref="InterPro:IPR001373"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="InterPro:IPR016159"
                     /db_xref="InterPro:IPR019559"
                     /db_xref="UniProtKB/TrEMBL:Q4Q853"
                     /translation="MCNTVMDAYLLVYHLISHPCSNTPLVKVNGKEIWEGQQIMAVYS
                     LQGAIFEKHLLNNVMPAFSQVSNGSTIQTYVRSWRSFLVAVVNIKTVFSSLADKWSLL
                     GLEDNPLDRTEDIALRKWSSVVLTPRMVSQLRKELRALLADERAGHGAPDLSFAVEIK
                     DELSMLPDSNYYRSVVEVDYIRDMCDYCWSKVGGVVESDLFTYAKLCLGLIEEEVKRA
                     ERFLTSKDHAVDRLVETLVDDRISAFECGRLSQWLGSIGQRETDEKLQTVFHLLWWSK
                     CKGAPLMEGMFKESVAQHTSSALTGTVRAAGEGTDVYAAVIECFASIIRKYRDVVMTI
                     FDYNGCMLEAMDDGLRCGFTSLRSFNYKKLADRLAAFSNAILGNTGSTKLRLEDVVSV
                     YYFLPDAENAAKDVFLVSYQKHLAKRLLLHHYDEAREQRSMEQLVQIKQSPILFCCRS
                     MLKATTTQSIYVGASSVNGVKVNPALLSRGTWPSLPHTLASSSVSDSVLRQIEGAQRI
                     CSTRRHGQRIEFSAPYSSAVIRMFRPAGSTAAGDSVQLKVSFLQMCIIDHFNAKSQCT
                     VQELCESLQVSEVECAFALNPLVSATVLKLSGAMEPSSIVSLGPCDSSIGDVTNVMPL
                     EFHSFAHRAVVKSHEQRTLQSAAKANPQRMESQVVHTLKQSGSKTAEELMIYLTSAMQ
                     PLIVSRGELKRVLEKLIERGLLVRDDSQRKFVYSP"
     gene            <833997..>834269
                     /locus_tag="LMJF_28_2130"
                     /db_xref="GeneID:5653425"
     mRNA            <833997..>834269
                     /locus_tag="LMJF_28_2130"
                     /product="putative Dynein light chain LC6, flagellar outer
                     arm"
                     /transcript_id="XM_001684444.1"
                     /db_xref="GeneID:5653425"
     CDS             833997..834269
                     /locus_tag="LMJF_28_2130"
                     /codon_start=1
                     /product="putative Dynein light chain LC6, flagellar outer
                     arm"
                     /protein_id="XP_001684496.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653425"
                     /db_xref="GOA:Q4Q852"
                     /db_xref="InterPro:IPR001372"
                     /db_xref="UniProtKB/TrEMBL:Q4Q852"
                     /translation="MTQVPGATVKLSEMPKEMENFAIFCAQEGLAKLRTAQELASFIR
                     KEFEKKYGPTWNCFVGRNFGSFVTHEEGNYVYFYVGQTGVLLFKSS"
     gene            <834957..>836462
                     /locus_tag="LMJF_28_2140"
                     /db_xref="GeneID:5653426"
     mRNA            <834957..>836462
                     /locus_tag="LMJF_28_2140"
                     /product="putative A/G-specific adenine glycosylase"
                     /transcript_id="XM_001684445.1"
                     /db_xref="GeneID:5653426"
     CDS             834957..836462
                     /locus_tag="LMJF_28_2140"
                     /codon_start=1
                     /product="putative A/G-specific adenine glycosylase"
                     /protein_id="XP_001684497.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653426"
                     /db_xref="GOA:Q4Q851"
                     /db_xref="InterPro:IPR003265"
                     /db_xref="InterPro:IPR003583"
                     /db_xref="InterPro:IPR003651"
                     /db_xref="InterPro:IPR011257"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="InterPro:IPR023170"
                     /db_xref="InterPro:IPR029119"
                     /db_xref="UniProtKB/TrEMBL:Q4Q851"
                     /translation="MPRGSACKQSMCGEWLTPLGSFATHEYYRSVQEEVIAWWRQHQR
                     QDLPWRQTLPRGSGDLSGAVDGEKHRTSATTARYDPYQVWVSEVMSQQTRMETVIPYY
                     VAWMKRFPSIEALAASTEDEVKSVWAGMGYYRRAMYLRKGAKYLLERSKEKEGTAAVC
                     MPSSQEELLKVPGIGPYTSAAITSMCFGKPVCSVDGNVIRVLSRLRGARDFDPKVPAN
                     VKEAAAWGQRLMGNSPTTSAVVCQDPSALNQGLMELGASVCRPSGAPLCTSCPLQRFC
                     RASALLRGGDIEAIEGVIPVRAAKMAKRSARKLCVVHEMSASRIGDARRFVVVRRPAN
                     GLLGGMLEFPTVNASAADDEEAVVPLLKHPLSMLAWKARARPTFARLCGNVRHIFSHI
                     VMDVGVAHVQWPADADGAALLKRVAEVVDDHCAGDCCNELPTAARIFLMSEADLRENA
                     PSRLMLKVLQKVSSVEVKQVRTSRTGKRAIQESSDSLSPHKKVARGEQARS"
     gene            <836968..>839472
                     /locus_tag="LMJF_28_2150"
                     /db_xref="GeneID:5653427"
     mRNA            <836968..>839472
                     /locus_tag="LMJF_28_2150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684446.1"
                     /db_xref="GeneID:5653427"
     CDS             836968..839472
                     /locus_tag="LMJF_28_2150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684498.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653427"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:Q4Q850"
                     /translation="MQSWYEFGYDGFPSGEQRRRFYRQRDDPCDSEEERDYDDKTNDR
                     PIFYYPLRASEEGIRSSSVSLSSSTASGEDDRGGCATDGEVPRTRRSDAYSSRRSRRP
                     RRVSHKESSLDCLLHTTLYEDMPAWYGSSSVTLTSPGLPHGVYTLQHGGAPCAAPFAV
                     SNQFSLWRWSLSPATVASTPQNEASGNIHCVRLVDDPSLLSRLQWSALHPALRLGHTS
                     TLRAPPRIGHCAVPLTFPDAPVLQYFLSDHSQGAHETEVSRLATTAGRCGKKALDSIP
                     VLLAGSDVDLDVSLVVGGASHLVDMSNNTGAGSLHGSNGARGPLPEGDSIAFRGPNLD
                     RVAIDGSHILSHPALCLTLLAHSAAQPRQHTIYFPLDGPSVSVLAPRAFATLTPWPDA
                     NGEEFALRSFAYIGGTDNGRDPLSHLEVELLQLNLDTWVWSSNPVCTYGAKPPPRFGH
                     SVAMVKEDVCLLMLGGVGAGRTYLNDLHVLDLRTRVWREVFIPLGVDMPCRAFFTVAV
                     LTLPDIPLRDRSGGAHAAFVDSDDTTFARRAAATVARQLTPFSRPGQGVSLPPSVAQQ
                     GSSSEDEGEWDDGVWSAGVTAARSRGALVVLGGECEGKPVTSAWACILRNGSWRHLAF
                     PLRTQPHFSHVARSAMLTEADAERASSTLSRTDFRTAMQALMERVPHPSAPTAFDSFG
                     HSNTTHEPYMAVCHGSLAQAVLLPSDTGVAERLVLNGGSQGLPVSVVSEMSFMGTSLR
                     DDVSLWLLTARQQNSLSSALCKRVQELHLLFFRKNAGLSRAAQSMLQPDNDTAARPGP
                     LSAEDVRFNHFLSNCVLDGQLTEWTRLARKRLREES"
     gene            <839947..>840678
                     /locus_tag="LMJF_28_2160"
                     /db_xref="GeneID:5653428"
     mRNA            <839947..>840678
                     /locus_tag="LMJF_28_2160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684447.1"
                     /db_xref="GeneID:5653428"
     CDS             839947..840678
                     /locus_tag="LMJF_28_2160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684499.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653428"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4Q849"
                     /translation="MVPRQYRPKANMLALFSDQVKSLRSLVYDTCIVPMTSRWYREVL
                     LECPTNSVMLDIGIGTAASLIANRDIIVSKKMTVTGVDYDLAYVRSAQMNVAACGGRL
                     QDLVRIEQADIHDYNKSHAKKFDILYFSGSFMIIPSQVGALRHCVQMLRSPAPQVPGG
                     CNIFFTQTFERRTFIGQYVTPLVKRLLKAITAIDFGEVTYEDEFRAALEEAEVEIVCV
                     KPIHASYYRTQALVMARPRVTMQYE"
     gene            <841486..>843441
                     /locus_tag="LMJF_28_2170"
                     /db_xref="GeneID:5653429"
     mRNA            <841486..>843441
                     /locus_tag="LMJF_28_2170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684448.1"
                     /db_xref="GeneID:5653429"
     CDS             841486..843441
                     /locus_tag="LMJF_28_2170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684500.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653429"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="InterPro:IPR007052"
                     /db_xref="InterPro:IPR008978"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q4Q848"
                     /translation="MSVPVTESIGKARWTQGEDDETSLEVRIPCGLPDGVRPRELTVQ
                     IKDGSILCISHKETRILQWRLYAAVSDEVEWRIEDDNVFVAELEKKSGAPWSCLLDLP
                     MRGDDELLTPIAEIDRMFRTQLPVLPSIEDSESEDAAKQASGQGEADKNGKAGGAGAG
                     GEDDLDKLLDEVAKEVTGKEAKESDGEDDSTAAFIKAELENYRVEEEEIKKKLAEVEA
                     TLNSSTDTEATNTAGEQKNILNKMVQLHSQCRAIRSQPSTLENFLKCTQLDLQKARVN
                     IGETGENEEEEYQSDKERELNATELMTCGLKFFEDQDIKGCLHFLRLAAIHHKHEQST
                     LLLYNIYSQLQSPRGAFLLMKRALDDSAPSAAVNQKVGELYDQGARHFLPLFPAAIYF
                     YQRAAKLGHVNGMLSLAQLWLRGATASSMLSEEEVEAQQSIPKYHAWLQKAMDRGCGS
                     AYFVRGCMHIKGEHGMAKSYAAAKEYLDAAASAQPEILRRAPQIPMMLEALREEEEKS
                     AKPTQETTSTPASTTKTAAAPAGLAAPVAAAKPFDEGVKVTSSVARLNALSNKAAGSS
                     GSNGFMASRPVSESAAMRARKGLGSGSRSKAFWERACVASVTMYSVYTLAFPIRIILL
                     PFFYSAISGIIESIPWLANSNADLSMF"
     gene            <845331..>846068
                     /locus_tag="LMJF_28_2180"
                     /db_xref="GeneID:5653430"
     mRNA            <845331..>846068
                     /locus_tag="LMJF_28_2180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684449.1"
                     /db_xref="GeneID:5653430"
     CDS             845331..846068
                     /locus_tag="LMJF_28_2180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684501.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653430"
                     /db_xref="UniProtKB/TrEMBL:Q4Q847"
                     /translation="MERAVDARRAIYELWSRTAAAEEHAQFSSDSTSTGEEAAAEAKA
                     AEERSTAVAALLDKYKLDPATPREEDISRGLGDALDRLLLLCVPLSSRHGADLLVKLM
                     QVSAQQGRQFSMRTIQHLFARTSSYAEALAVFYAMRRSNFAMSMEAYHAMLYSLQRLE
                     EEGWAARFHEEFAASKGEAISEQALDFVLRGVDNQLMPENKPWLGRIMFAEVKDNKAT
                     QRQSMASFDAMGKLWVQRYKNGGTAPE"
     gene            <847557..>850295
                     /locus_tag="LMJF_28_2190"
                     /db_xref="GeneID:5653431"
     mRNA            <847557..>850295
                     /locus_tag="LMJF_28_2190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684450.1"
                     /db_xref="GeneID:5653431"
     CDS             847557..850295
                     /locus_tag="LMJF_28_2190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684502.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653431"
                     /db_xref="UniProtKB/TrEMBL:Q4Q846"
                     /translation="MKHERQTAATARTGTQSVNAGVSVLQSLQNENDALRSELLRVRQ
                     HKADMQRQLHDLRAVAERTVREVAMSGKEQVRALEERCRLLADRLIGSKREEQVSETA
                     RVGFLLRSQIEERRFLKRGLEAMQEVLASVDGSAASASRNQHPSTNASTRPEDKEPEG
                     EVHTGDLHRLMMTVSGSLHAHTASTKLEKARIRLTLEQAASLLDELHDAVEDATRAAF
                     DAAVQASVACDAGTTSPAGGDVFQLSSVLMVPFGAPASAVQNASSFTPAHRRGGGRDG
                     HLAGSAGAASSLRHQGAGAFPLAYSLMTPSSSAQLGLELEWVCDVLKACMKGAAEVRA
                     LIGAAAEGLKAPLPLLQRRCDVGDRPSTAEQALPLASAASPEMNALLRSFLEDLWTLK
                     QQAARQQEDMARQLAQEVERHFQSTQQYEQRVKLLEAECARLLFYVERQATQRPGVDA
                     ATQTSSCQNATVSTTLMPALVPVQDTLVTPERYVASRDVAKLSERRSAQPPRKPLVAT
                     ARVLLSDQRTPPRVSSPLRPKEAQHAALASSADHTMEVDDPVHANHDARSHCFQKGLS
                     FSRPSSPSKPSRATAPNDPSPAASAIRSAYGDQKVTPQRPASEALRSPPRLWSQLLSP
                     APPLVHPKALTTTSASTAPAHSLSPRQRSTTVPMPSRSRGTALFRAGSSTATRSSASF
                     ASKRRSPVRPGNAADSLVSSHQRTHTAAASLSSAELRPAITAAAVPRDSTPSPSGTSV
                     ATPRPGRQTSRHRTHLSQQIYGEAAADVFSFHSTTFGGAPSALPSVRRLQSESSRMSD
                     VGSTAEVQTPSPRRPARLSLCLNRASPGETAALRATRQLHTPPSPVSAVLSGHVLGDG
                     STVDISRQAETPSTPPIWRRIKEEASFQRQHLPSPIAGGDTSSLFGTPHEVPWTNA"
     gene            <851385..>854228
                     /locus_tag="LMJF_28_2200"
                     /db_xref="GeneID:5653432"
     mRNA            <851385..>854228
                     /locus_tag="LMJF_28_2200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684451.1"
                     /db_xref="GeneID:5653432"
     CDS             851385..854228
                     /locus_tag="LMJF_28_2200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684503.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653432"
                     /db_xref="GOA:Q4Q845"
                     /db_xref="InterPro:IPR004888"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="UniProtKB/TrEMBL:Q4Q845"
                     /translation="MRDRRPLLRKDAETAATELSMPAETAQERYQHAKKRQAKDMQRG
                     VLSYLLFILVFLGVPLLIVAYCTPFFVLQNLRCRLQEKYFWSDTTVRAMEDGYTRYFN
                     EPPLYPSTEYNRTMMWGTYEPSRIFAVKSRSLKPVTVGIAWYDSAMAHPLRHTMPYLH
                     NKVSAPRSTQKKGIDVEVMQVKWVVNDGLHYAKEVVEDRGNKASLEIELLKSPFADAW
                     HVRIHARVESDSPLVMVVYMSHADTQERIELEAPTEYNDGDWSPVLKSRMQPEGETEH
                     TDFTLRVYDDHSPLHDTAPWHVYGLHTDVEAAFQRKAVDAVGTTPAERAAAGGRGIGG
                     GVHVGDLQQQQLDLRRLPESAFTYIQAKDPQSFRTPPSWTSHNVMILRKSYDSSFRLE
                     LSLSPADHAQGNGAPGASATNRIGNLVPRYEALSTCQLTNALRWRSKAISLHSAKIFR
                     PFLSVFNSSKDLYERIATVTLAELFGSLTFTSGHYLHVGADMDDAWDQQGRAKTMWSD
                     AKLQSSRQRVSAIAVVGSRTDEAFGQPSLTGLPLLFLTRWNKEVVKDILASWLLGAQD
                     AETGFVPNRAVFGPETRSFTPQAQRYEHPALASPPTLLLGLQELLKEMSRKSARLATA
                     NHRKARNTPEYLERERAADEAFLRAILPALKRWRKWWHHTQCGGATDELARQCRSRKP
                     LEEWPLRPAEDQPESLLVYRWRGRDGHRLPTSGMEDYPRPICAGEHHREAHVDAFSWV
                     ALLSTLISRIETEFLHEAESVSLDWEAHLNAVHWDAAEMRYSDRIGCSSWTHSPYFGY
                     ANLYPVMLGVVRRDLSRAARTIALAQRELESDYGLMSVSFSSVRLARESGLPHHNMWM
                     GYVWPSANLLFLYGVKSHYLEALDSTSAAAGGLTEARLRDFYTSLRVNIIEAIRGGSR
                     WWEYYSPLDGRGEGSKTHVATRSLLLGLLDDFA"
     gene            <855479..>855652
                     /locus_tag="LMJF_28_2205"
                     /db_xref="GeneID:5653433"
     mRNA            <855479..>855652
                     /locus_tag="LMJF_28_2205"
                     /product="putative ribosomal protein S29"
                     /transcript_id="XM_001684452.1"
                     /db_xref="GeneID:5653433"
     CDS             855479..855652
                     /locus_tag="LMJF_28_2205"
                     /codon_start=1
                     /product="putative ribosomal protein S29"
                     /protein_id="XP_001684504.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2205"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2205"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653433"
                     /db_xref="GOA:Q4Q817"
                     /db_xref="InterPro:IPR001209"
                     /db_xref="UniProtKB/TrEMBL:Q4Q817"
                     /translation="MGHLDQWRSRQKIGMGKGARCCVICSNQKALIRKYELNVCRQCF
                     RENAEHIGFTKLR"
     gene            <857975..>860125
                     /locus_tag="LMJF_28_2210"
                     /db_xref="GeneID:5653434"
     mRNA            <857975..>860125
                     /locus_tag="LMJF_28_2210"
                     /product="putative glycoprotein 96-92"
                     /transcript_id="XM_001684453.1"
                     /db_xref="GeneID:5653434"
     CDS             857975..860125
                     /locus_tag="LMJF_28_2210"
                     /codon_start=1
                     /product="putative glycoprotein 96-92"
                     /protein_id="XP_001684505.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653434"
                     /db_xref="UniProtKB/TrEMBL:Q4Q843"
                     /translation="MSAAPSDVAEQHFDPAPANNVAPLANAAQQEESATNKFHSGSTG
                     NGKVLPGNSTTKKRLLRKNRSVATVEAAKKCKEEDKKLADEIAKAREAEARAAKEKAK
                     RIREAEAESRKKRDQKDVRIQKDVAEERKQREELQRQREEEEKQRIEMVRKQREEAQK
                     KREEIQKQREEEIKRRKAEIEAERQKLKELQEEHEREQEEARQRRVAEEKEAQKKAEK
                     KAEEAEDELAATRRQRKGELEELQRQREKEEKQRIEMVRKQREEAQKKREEIQKQREE
                     EIKRRKAEIEAERQKLKELQEEHEREQEEARQRRVAEEKEAQKKAEKKAEEAEDELAA
                     TRRQRKGELEELQRQREEEEKQRIEMVRKQREEAQKKREEIQKQREEEIKRRKAEIEA
                     ERQKLKELQEEHEREQEEARQRRVAEEKEAQKKAEKKAEEAEDELAATRRQRKGELEE
                     LQRQREEEEKQRIEMVRKQREEAQKKREEIQKQREEEIKRRKAEIEAERQKLKELQEE
                     HEREQEEARQRRVAEEKEAQKKAEKKAEEAEDELAATRRQRKGELEELQRQREEEEKQ
                     RIEMVRKQREEAQRKREKLKERDIKEAEEIKRQRKEELAELQKRREREQEVQRKKVEE
                     LRTKGKKDSKKEQILKEKRRTAAAERERLEEQRRKQKEEEEKELEAKHKRVMEQLEKN
                     YNIVDEEEYEREREKARQMREEQEKAAAVALGLA"
     gene            <862904..>865405
                     /locus_tag="LMJF_28_2220"
                     /db_xref="GeneID:5653435"
     mRNA            <862904..>865405
                     /locus_tag="LMJF_28_2220"
                     /product="2,3-bisphosphoglycerate-independent
                     phosphoglycerate mutase-like"
                     /transcript_id="XM_001684454.1"
                     /db_xref="GeneID:5653435"
     CDS             862904..865405
                     /locus_tag="LMJF_28_2220"
                     /EC_number="5.4.2.1"
                     /codon_start=1
                     /product="2,3-bisphosphoglycerate-independent
                     phosphoglycerate mutase-like"
                     /protein_id="XP_001684506.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653435"
                     /db_xref="GOA:Q4Q842"
                     /db_xref="InterPro:IPR004456"
                     /db_xref="InterPro:IPR006124"
                     /db_xref="InterPro:IPR009288"
                     /db_xref="InterPro:IPR013024"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="UniProtKB/TrEMBL:Q4Q842"
                     /translation="MTTVCYLIFVCGTLQRGENNYPYWLADEAEAVFVARARTVSRYP
                     FFVNLLPDHPGCLPCVLDLPDCNVPGCAQVEGEVFSVSAKMKAWLDVLEDISGGTHVS
                     VPTLVELCEAPSASFRARGGTTAASLKWPAAVDGEAVTVAAALYFRAKGYPDDWSSPT
                     PRSSSRLVSKFSAASMLRLYGDRFNGGVPAHLRADGNYAKATAMQTELNALPEAHWPP
                     STIAYYAAAAKARMAQSDGEHVSATPPPIPCYGAPLFPKPMILFIIDGIGDNTYCELG
                     GRTPLEVVAGVPAVSQRAPSPATEPPTAQSLSVMEGVLADSANAALRETLNEHVTPGI
                     NVVSRHGVSGLMDPYMAGKSCGSDTAHLSIFGYPPTMYYRGRGAYEALGAGLELEEED
                     VAFKCNFSTFADRTEELCGDEDPAMEATALSLASSADQYVTHRRCDRDFTVEGPVLCN
                     DLNGTKVAADLHGIPFDYPHTIKMQYATEHRCGVALSGARRVVRADGSTELLGMLSDK
                     ITGTDPLMDRRLLLHCKPTVEKGHPEYAAAVYTCRLVEAASAALTRRLKVHPVNEARR
                     QHNRAVAARIANESGRGGSETMTRKNLANLLLFRGAAKKGWVPTFAVRHGLHGLILAP
                     TCIIKGLGICCGLRGEVCRACDPTGQESLRGATGDYHSDLIVKVRAVLHALRIECPSS
                     HEAAVTAAVQSKAMTAPQAGRIIDPHYNFVVVHVKGVDNAGHDKSLQLKLEMLRRSGW
                     AMEALWRELPAGATMAVIADHSTPLGIGDHCCEPVPVSVAVKRTTSEGALSACPADGV
                     EYYSEVKAASGGLGRFRGEDLIPLMKRVHHSYHYV"
     gene            <867186..>870002
                     /locus_tag="LMJF_28_2230"
                     /db_xref="GeneID:5653436"
     mRNA            <867186..>870002
                     /locus_tag="LMJF_28_2230"
                     /product="putative cyclin dependent kinase-binding
                     protein"
                     /transcript_id="XM_001684455.1"
                     /db_xref="GeneID:5653436"
     CDS             867186..870002
                     /locus_tag="LMJF_28_2230"
                     /codon_start=1
                     /product="putative cyclin dependent kinase-binding
                     protein"
                     /protein_id="XP_001684507.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653436"
                     /db_xref="GOA:Q4Q841"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="UniProtKB/TrEMBL:Q4Q841"
                     /translation="MISKGGNSGLGGGSGVNPRLVAKVSGVQRATAFLSAINPTELRP
                     HPLRGVARSITEDSSGSDSSSSSNPDSLGGSFNNAETKEERAVLDGISRALGTGVDGC
                     DTLRNFTIRVPSSSALEAPANTHVGGLASGATQSTSAPTVATTISSSDPDATAATDAA
                     AAGRPHFSSTIPRVPAGKAVSQLTPQQLQHRRRQPFAADFSLRYRRQENFLKSLDASM
                     KPVKRHRRHNSSSSSSSSSSSSSSSRSRSEIQRSAASPVNTSGATAAGGLGAGAGGAR
                     QDAGASAANGGLTAAGGDVSGTTLNGGATGAGGELNLLPSQGHRHRVSCNNGGKPPLQ
                     VHELVKREGQRVRLRWIYGDFQQRRSSSSSSSPSSSSRSSGPRQSRGKRSPKYGPGGG
                     GGGGDGGVAVGKASLTTYGRGSVSGALETEWSGTPQHLSSTSHTLVRSLSLSSSSSSS
                     SSDGSSRPRRTRSKERRQRQWWAQSAATPMSLCTILTKFEPRVTSLWKEDQVIQPYRG
                     ESNASSSRSSSSSKKRSSSSSSSSSSSSSSSSLSHTWDLTNVDDEYQDFVVNGQYLAG
                     NYADRRHVAEMTSVVVSSSSSDSGLRTHSLYSSSSSKTHSDSSTHSRRGSSNRTQSHS
                     SSSYGSSRGSSRRSRCSSRSSRGSSRSSSNARHRRRHHNRGRGGIISGEGDIRSYRKV
                     LARQQCRNNPAFSNAYFLDTGNITGGERRRKMISLPSYRVSMISFVDKKILKKDLNHN
                     FYIQHPELEVRDIKLTHLRKIKHELLVYALEDNSLLDLTTTAYAYWYFERLVVQGMVG
                     KHNRKEIMAACVLLAIKFLETGDLMKKIAYFKNRWRRFHNVSGVHVGNVNAMLGGGGA
                     KGVEEDDEEVVHVNWKKVEEQEFPVYVGLDFTLLPDGDGQVIKTHIERLLQLINVTSQ
                     EYYSKKFVSPAYLNHYNCYSNLYY"
     gene            <871478..>872380
                     /locus_tag="LMJF_28_2240"
                     /db_xref="GeneID:5653437"
     mRNA            <871478..>872380
                     /locus_tag="LMJF_28_2240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684456.1"
                     /db_xref="GeneID:5653437"
     CDS             871478..872380
                     /locus_tag="LMJF_28_2240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684508.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653437"
                     /db_xref="GOA:Q4Q840"
                     /db_xref="InterPro:IPR009218"
                     /db_xref="UniProtKB/TrEMBL:Q4Q840"
                     /translation="MLGQLVAYEAEHGWHGAYMPAMVEAPVSSSAPPLELLTGADRVA
                     YEWTGTVLLLSVLFHDVVYDPTRGDNEEASAAVAAEFLQEMQRESDVASSSSSAAAAA
                     VRAAAPTSVAGASALPSASGATCTEDDASPQHPPPYSSAPPLLWADAQAIEFVRNSTT
                     TYILKTKEHLAVEPKQPLHLPASPAEASTSAERGVASAVVQQSRDDPLHVFLDLDLAI
                     LGHPDADTYRHRYADNIQREYSHYSRADFLKGRAGFLSGFAQHPQWYKTPYFFYRLEA
                     HARHNAAQEVKALTAELADMQVAS"
     gene            <875539..>876204
                     /locus_tag="LMJF_28_2250"
                     /db_xref="GeneID:5653438"
     mRNA            <875539..>876204
                     /locus_tag="LMJF_28_2250"
                     /product="glycosomal membrane protein-like protein"
                     /transcript_id="XM_001684457.1"
                     /db_xref="GeneID:5653438"
     CDS             875539..876204
                     /locus_tag="LMJF_28_2250"
                     /codon_start=1
                     /product="glycosomal membrane protein-like protein"
                     /protein_id="XP_001684509.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653438"
                     /db_xref="GOA:Q4Q839"
                     /db_xref="InterPro:IPR008733"
                     /db_xref="UniProtKB/TrEMBL:Q4Q839"
                     /translation="MSSVALGASRVLERTDSVDKLIKLMAGAFTFLSTTNSLKQEQYA
                     NSARHLADVRSVLRLSRLFGLTFKMQSLVEVFAAQGFAWTEQKKFLEFFKTICDFLYA
                     AGDHALLVAREGLLGKDVDVAHLRKCTLAMQLFGHFLGTVLHLFELLDAARKLHYDPP
                     AAVRACKIATIRATREAVDTAVTLSICNCAGSACRLSPRASGTLRCFSGALSLYLNLQ
                     ANT"
     gene            <877125..>877793
                     /locus_tag="LMJF_28_2260"
                     /db_xref="GeneID:5653439"
     mRNA            <877125..>877793
                     /locus_tag="LMJF_28_2260"
                     /product="putative glycosomal membrane protein"
                     /transcript_id="XM_001684458.1"
                     /db_xref="GeneID:5653439"
     CDS             877125..877793
                     /locus_tag="LMJF_28_2260"
                     /codon_start=1
                     /product="putative glycosomal membrane protein"
                     /protein_id="XP_001684510.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653439"
                     /db_xref="GOA:Q4Q838"
                     /db_xref="InterPro:IPR008733"
                     /db_xref="UniProtKB/TrEMBL:Q4Q838"
                     /translation="MSDFEKLIKLLGQTDGRDKIYKLLAGLFKILAAVAASSQDSRAK
                     AYVAIGNSIGSARSLMRMGKFVSDVPKMQKIADGVVARGFAGTECKKFIEFLRIIGNS
                     LYIMGDNAAFMAKHKLVPADAKCIVKYAKTAQFWGFFLAAVLDLIALRAALQKRVSDV
                     STSKKEAKAAVISLTKDASDVLVTMAAVGYLKSLWSPSPITAGALTCVSGGVATYLNW
                     SKIK"
     gene            <881638..>883455
                     /locus_tag="LMJF_28_2270"
                     /db_xref="GeneID:5653440"
     mRNA            <881638..>883455
                     /locus_tag="LMJF_28_2270"
                     /product="putative histone acetyltransferase"
                     /transcript_id="XM_001684459.1"
                     /db_xref="GeneID:5653440"
     CDS             881638..883455
                     /locus_tag="LMJF_28_2270"
                     /EC_number="2.3.1.48"
                     /codon_start=1
                     /product="putative histone acetyltransferase"
                     /protein_id="XP_001684511.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653440"
                     /db_xref="GOA:Q4Q837"
                     /db_xref="InterPro:IPR002717"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:Q4Q837"
                     /translation="MAVAQSAFGNGTEDSAVLSSTPDTAAAPYGLADGMAQLSRVLHR
                     PWLSGVYMEVTPGMARTQRARRQLDYLEERLLRDCRTPTTVRYFVYLNTYVFAPWYYA
                     PFGLLNSEYDPMLPWTGAADASTGAIPAGEGADATGSSVGVQQQQQPFIRDAFLCPFS
                     LRIYSTYAQMHYETRTYRAGRLRPPGEEVYRDEVRGLSLFKINGSQHVTYCRHLFLIG
                     KSFLENKLAGHDVHNYYFYVVCLHHRYFPDYVSDPSAMYFAGFFTWEKHVSEYNLACI
                     ATLPCFGRRSSRQRPVASPAGSTAAASRPPRVLRHLGQFMIAASYELAYRRKQTGTPE
                     KPLSDLGAVAYQHFWRCAIVRWMKDTLNAMRRAAAVCVDDDDVDKTDQKGAQAGGPVA
                     PRLSRASGKGASLALDVDSAAAEVVMLATEDRMVSGEHDADSRRSGEGKATLHEQRSK
                     APPSARKRSRADAKTEYERDVDGDEEARLPSSHGKLPLAATAPLSSTKREVLGVSAAA
                     PSPAGTSSAAGAAAFTQRTTINDIAAAVRLEEADVLRTLLGMGVLHRSSEDRGIQLLL
                     PQRYVDWMYDEMLRWESSVEHAVFQSALLKSRGSHTSTR"
     gene            <884562..>889055
                     /locus_tag="LMJF_28_2280"
                     /db_xref="GeneID:5653441"
     mRNA            <884562..>889055
                     /locus_tag="LMJF_28_2280"
                     /product="DNA topoisomerase ii"
                     /transcript_id="XM_001684460.1"
                     /db_xref="GeneID:5653441"
     CDS             884562..889055
                     /locus_tag="LMJF_28_2280"
                     /EC_number="5.99.1.3"
                     /codon_start=1
                     /product="DNA topoisomerase ii"
                     /protein_id="XP_001684512.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653441"
                     /db_xref="GOA:Q4Q836"
                     /db_xref="InterPro:IPR001241"
                     /db_xref="InterPro:IPR002205"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR006171"
                     /db_xref="InterPro:IPR013506"
                     /db_xref="InterPro:IPR013757"
                     /db_xref="InterPro:IPR013758"
                     /db_xref="InterPro:IPR013759"
                     /db_xref="InterPro:IPR013760"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR018522"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR024946"
                     /db_xref="UniProtKB/TrEMBL:Q4Q836"
                     /translation="MGKTVEQIYQKKTQHDHILTRPDMYIGTLEPVTDDIWVYDDAEN
                     SMKQRKCTWTPGLYKIFDEILVNAADNKVRDPIGQTVIRVWMTESYVRVYNNGEGIPI
                     QKHREHDLWVPEMIFGHLLTSSNYDDEEAKVTGGRNGFGAKLTNVFSKQFEVETVHSR
                     SRKKFYMKWTNNMLQHDDPVIVPCDSADYTMVTFYPDFALFHVDKFTEDMLLMMKRRV
                     YDIAGCTDKTLKCFLNDERIACTTFPEYVDLYPTMGEERKAASYSRVNDRWEVCVRVS
                     NIGPQQVSFVNSIATTRGGTHVKYIMDQITSKVMEQAKKKKKTDVKPHMIRPHIFLFV
                     NCLIENPGFDSQTKETLNTVKSKFGSTCDLPNSIVDYIMSSGIVERSVEMANSKIARE
                     MASKMRSSDRKQIMGIPKLDDANEAGGKHSHRCTLILTEGDSAKTLCTAGLAVKDRDY
                     FGVFPLRGKPLNVREASLKKLAACEEIQCVMKIMGLDIRQTYENSDGLRYGHLMIMSD
                     QDHDGSHIKGLLINFIHCFWPNLLRVPGFLQQFITPIVKARPKGRGGAGKAISFFSMP
                     DYFEWKKAIGDNLSNYQIRYYKGLGTSGAEEGREYFENIDRHRLNFVEQEQSEEDRIV
                     MAFGKDRVEDRKEWITNFKTNVNVNESMDYNVRQVSYRDFVDKELILFSIADCERSIP
                     SVIDGFKPGQRKILFSCFKRNLVNSIKVVQLAGYVSEHSAYHHGEQSLVQTIVGMAQD
                     FVGSNNVPLLRKDGQFGTRLHGGKDHAAGRYIFTRLMQVARAIFHPADDFVVEYKDDD
                     GLSVEPFFYIPVIPMVLVNGTTGIGTGFSTSIPNYNPLEIISNLERLMRGEEVHKMQP
                     WYFGFTGTMEEKEPGKFISHGRYEIRPDGVVCITELPIGVWTQAYKKFLEDMREKELV
                     VQYREHTTDVTVDFEVFLHPQVLEQWVAQDVVEERLQLKEYVHATNIIAFNKEGQITK
                     YSDAESVLKEFYLVRLDYYAKRKQYLLGELRRLTSKLENMVRFVREVVEGTLVVTKRK
                     KKELLEDLQRRMYLPFPPHTKKKLSSTTVEEGDDEGAPDAQNSEEDVLGVGNAADSGA
                     DDGAAEPPEMRRATRDYDYLLGMKLWSLTAEMIARLEAQMARARRDTAAMEARTPKDM
                     WMEDLKVLRTKLESFYADREVEIATIQRKKVKKPFDARRLRVPILSDKARSLLQKEAE
                     KSLKANGVGGRRRVGGGDDTLAGGAASAVGEVARPKPKKAAAKKRRKAKDSDDDDDSD
                     SDEEWMFDNSDNDDEGENIVGMGDAGAPPVPERARVCGSPKKPRAAPKRHAASKPRKK
                     VRNSDDDDSGDNSNSGSSKPVRRRPKKDAISAAAAAATKTALDDLDLDGFGLDALASA
                     SAVSAAPKMAMTAAPPSNGGAARSTKPTADADDDLLLLGLVKAKTETAPPAATAASKR
                     ATAASARPAKPHAKPAARRRRRGSSSDSSDDDDEDSTDASASSLEESSASSDSDSDYS
                     FSD"
     gene            <889917..>892427
                     /locus_tag="LMJF_28_2290"
                     /db_xref="GeneID:5653442"
     mRNA            <889917..>892427
                     /locus_tag="LMJF_28_2290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684461.1"
                     /db_xref="GeneID:5653442"
     CDS             889917..892427
                     /locus_tag="LMJF_28_2290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684513.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653442"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR011004"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q4Q835"
                     /translation="MDMAAVRRGVVDRSDRQGPKLIAVIIGEALLPTRLHGGRATVVG
                     PLSPLSPSPRIPAALLPVCNTPVIDYVLENLVLNGVDEATILLNSSSAATTIAHLSEC
                     RTARGKPWMLSDSINVTVVECARRITTLADAADEMRERNVVPQNGSFLLVPIDTVASF
                     TNLRACYQTHLERVRKVSKYAATLLCVSSRPALAAALRNSLINHLAEAEEVSSQSPVS
                     PIGGSGRHGVLSIRQTSEMLRLRNYTAPVLPRERHTMFVLNKATQVVTYMARFENGEE
                     TPESPAVVFSSSAPQSVRMDLLPTGYMFCCCEALSLIEFHIRDLYSFFSTSLLGQTEI
                     YGNVFGLIELPSSSAVVEPINSAEAYIQCNLDVCARRLFPMTRESCFAEELAKYAVSS
                     TCETVYLHTTARCASSSLMGPNVVVGEEVSVPASVELAGTVLGARVELGDEASLRSCV
                     VMEGARIGRRCVLHGCLIGPHAVIGDGAELSYVVVGERCVLDGATISGAPLVLQHQAI
                     ECDVDDISGTDEDGVSRGDKGEEGSSSSSLSSSSEGAVGHKTEKLLTGANGRGHALED
                     RYSSNILPTSALFTEDPVARPSQSDGEGESSEEDDEQGLFRRSIQRHVQAALLQPSRI
                     ESSSYDMSTICLSSGFGYPELCEIVTELLMEHLLSTHRDESPADIVEVARDMFHTWCR
                     PFYSNFLSKNQQPNVDAMVATLEGLCGAIGGENCPLRCYGPQLVEILYYGCDDDLYNE
                     RGYCIVSGESLIAFDAEMEHRREVLQRYTAFKGGRVKNRGAARLSSSDSDTSSSSSSS
                     TSSSDDEESRDLHEEGKVLVAVSCHDFIMGVKDFLEAE"
     gene            <893811..>895676
                     /locus_tag="LMJF_28_2300"
                     /db_xref="GeneID:5653443"
     mRNA            <893811..>895676
                     /locus_tag="LMJF_28_2300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684462.1"
                     /db_xref="GeneID:5653443"
     CDS             893811..895676
                     /locus_tag="LMJF_28_2300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684514.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653443"
                     /db_xref="UniProtKB/TrEMBL:Q4Q834"
                     /translation="MSAIQHESAASVIPCSSSFSSASTASTAARSSPVSDYAVPADTA
                     SFEEAPLSLSRLERHTRILEEERLHYAQLGQRAADAFEAHRRELTQLVQKERAIRGHR
                     EDVLRAQLQETLQANRELMARVSEQRRQREEEWVAELQGHRGSSTGQDELESTLRQLH
                     EEWVELRRDVAETEASHEEHRRSLAACLRDQESLRSRVRSLQDGLRGAEAAVAAAEQL
                     EEVVADGRGQTGSAPAPVKSSKENWVKKPSSRTSVAASPQLTQYPRCSYCDMPPKVWD
                     APSPTRRAPCRHFVPSGPWDACSPCRASSPCTHNVEAMVATIERGNYLRPRLYYHRVG
                     CEPTDVAGAPVAAASPYRQRRGGLSRARPPPPPPAACASSFCASATPPRTGDYRHLHN
                     CQHSPGLSSSSTSSCTRTPDTHTTTGSSSSLCSCSACAPAPASATVKESTPSPSARHR
                     DERRREASPYWPRSRCFSPRTRGERPRADAQASAGVRMPPHHSEPTIASSSLPAFHRV
                     PLPPPRPAADGLHGAALNATCRALITDLADMRAEYRRCQHQLRDMHGDSVAASQAMRR
                     LMHEMDSKAAQIHALRLEQGRHNNALRVRDVLREVMAENRYCEAVYSDLLDLIRT"
     gene            <896720..>897937
                     /locus_tag="LMJF_28_2310"
                     /db_xref="GeneID:5653444"
     mRNA            <896720..>897937
                     /locus_tag="LMJF_28_2310"
                     /product="putative eukaryotic translation initiation
                     factor"
                     /transcript_id="XM_001684463.1"
                     /db_xref="GeneID:5653444"
     CDS             896720..897937
                     /locus_tag="LMJF_28_2310"
                     /codon_start=1
                     /product="putative eukaryotic translation initiation
                     factor"
                     /protein_id="XP_001684515.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653444"
                     /db_xref="GOA:Q4Q833"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR016650"
                     /db_xref="InterPro:IPR019010"
                     /db_xref="UniProtKB/TrEMBL:Q4Q833"
                     /translation="MDMLTKLLPYMDKHLALGLLNHYAQSGEDVQDAMMKLIETTGLN
                     ADGSIKAETEEMMAKATAAAQPALKEFFDESEDDHSTYQFKLTETEIGERRTQGELSH
                     EFLSEKKGITAAVMNALYKLAYLYYDTGAYGDASELLTLCQCVSGYDNIRSDTILWGK
                     LMSDIGAVNWQSAMRIAEEIRRVHNASEEDLFGAPNTTTVRARVWLLHWVLFPFFKGG
                     LQYSLQLLYFIFDHRHDQTYRKAVETVCPHYLRYICAAVLLHRTRYSNFVSAAELVES
                     IYEYSDPLTQLVSLIQKASFEDAIALLPEVRRMIKEDYFLADYEDELIENAKRMIFSK
                     YMSLHSVVSIPYVAEQLDMSKADAEVWLVNLISESVKHRAKIDSVNEQLNVEPQTRSL
                     ESLIYDKLDTVMR"
     gene            <901284..>903998
                     /locus_tag="LMJF_28_2320"
                     /db_xref="GeneID:5653445"
     mRNA            <901284..>903998
                     /locus_tag="LMJF_28_2320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684464.1"
                     /db_xref="GeneID:5653445"
     CDS             901284..903998
                     /locus_tag="LMJF_28_2320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684516.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653445"
                     /db_xref="UniProtKB/TrEMBL:Q4Q832"
                     /translation="MSRVSLQRRPHSSAPDEVRCAGAPVPSNARHAPPRRRASACSSS
                     AAYFPTQASLFRDSYNLPLTCGAVSSGCSYQLPHRRLHIYANGGGRDVGLRDHDVTCS
                     PGARRPPPPPRRAVTAGASAGRSCAANGSGAADAVVFQYYSQQRQKRGQLRSQSFLHD
                     FEATATPVRRQSSTSSGGGISAPATPAGGNAEASSPPLPFRCTSRPPAHDRDAGIHAR
                     LHHQPSASPLSMEQASVIHDTSTSLIPLMPPIDESSWPVQLSPSQHQHCEAMVRLLVQ
                     LPAAQAHRVVLAAIRQYEAQRLLQYYGGVHALPVTESSPHAMPRTPSTSSLASSPIKV
                     PPARRHGDGRSALFEALQDRLDDMQRADLAAQALSPFTAASSHWQRRGGSRADRPARG
                     QLHVSHFIRVSPPTIPPPTAVRRPYLARRQTPQDSAIRQCPDSGDARAPRQLRRRILA
                     SRVAKPRARGAEQGCCTGENGAAVRDASASSQTHSTPLLQQRHDFMKTIKPPHRHALA
                     GALLVEPGGSAEAAPVAHDHDSGRRASIPPGAQVTAVAGRGKGAREEGLYRPASMAER
                     NGGSLPPPLLALTATSKEMPDTSVGWPLAEGTALSPGAAAARRAYLEQQQKEQQQRQR
                     PSSLSRLSADADEGEGSELLPESAWRSHVTPDESDAACRYPRNSSADCFGSSSGKRGA
                     ASPGSVSLEDSAPRSEGLRGSSVPSVTPAPLTGVLAAPPPPKQIPGVHLPTRVATVGS
                     AGEPAAFITDCTGVSTSALRNPKARPHGRKGSDDAGTSDAPPSNSGAFWGEDYVAVEV
                     GGSSELHGQNRYREGGSGADPSTPPLQGKRAAGLDGQHLFSAPAQFEDSVITASSISS
                     EPFLQEDTADNDRDGVTALTAHSTSRPVAAGSLAANKSTDELLLPWEI"
     gene            <904652..>907321
                     /locus_tag="LMJF_28_2330"
                     /db_xref="GeneID:5653446"
     mRNA            <904652..>907321
                     /locus_tag="LMJF_28_2330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684465.1"
                     /db_xref="GeneID:5653446"
     CDS             904652..907321
                     /locus_tag="LMJF_28_2330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684517.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653446"
                     /db_xref="InterPro:IPR019134"
                     /db_xref="UniProtKB/TrEMBL:Q4Q831"
                     /translation="MKGISPRQRLRRVCVSSMTSIVHEGGQGRSWSEGIDEETCAACV
                     GVLLSNASQLPLLPLPQEAPHIRLSSPPSPRRLACSLPFGCFLAFHLPRFSAYSLSFP
                     LALPLTFFRPPSTYVCASNLLHRPTRLPDDAHAQHRSYRDTYMHIYIYIYAQIGRHTH
                     TQTQTHTHTQTHRHTSGTKTTDTRENIARLRVKVQVGHTAMDWDRPSGKRRRTDEEEA
                     CEALGGLLRQTASRAMERVRLQRQQRGWESQLTALSSSAAAAVARSVKPMDVLVIRFC
                     MHYLDCSKVAAANHFVRLAQEVVTSSIERVLVPQLFSRDGSSLPALCESLVAEHTAED
                     IQVTVKEVSEFVEARGALGAWIADATATRGDRDDDDYDDADSCGGGYYDHSRSRDRDD
                     GYSRLSNEEGEDHRADDDGRPASPHQDVEDFALATTLCQACEFWVRVQAFLNSLSLHS
                     ARLHVFAMPPRYERELLLLLYAATRGGGGEASREGGSYGGRTTPVEGASLSSSANAAA
                     AKVEKEETIKQEPMWDSDEEMAAQVVGEGGTDDEGAEQTEAPAGPRQLQQLYKASALL
                     ADVLALSRCPEAPTASSSSPTGTASGPALISSPLSAAAPQISAEAMQRLRGLNSNFYK
                     MVYARLGVMVARDRLHRFDRGSAITPPELTVQQRNLHEQLIQQGQQQQYKADLMSAAL
                     GIPGQPEAGLPAAYVPDDAYYEKLLHQQHDTIDEDEEVYKGEVMDYYLSHPDRPGAAA
                     GSSSNYSRSRSHHGGSSARGGEAEPLMKPHRFCKVKTGFTWTQYNRTHYDSRTNPPPR
                     TEMWYEFTLFYPALANTKRDMRHIFRIEDTPEGPNDQYCLLVFSVGPPYADVAYRIRK
                     KQWDTRRGGVRISFDQYGRYKLFFRFTNSNYRR"
     gene            <908157..>909014
                     /locus_tag="LMJF_28_2350"
                     /db_xref="GeneID:5653447"
     mRNA            <908157..>909014
                     /locus_tag="LMJF_28_2350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684466.1"
                     /db_xref="GeneID:5653447"
     CDS             908157..909014
                     /locus_tag="LMJF_28_2350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684518.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653447"
                     /db_xref="UniProtKB/TrEMBL:Q4Q830"
                     /translation="MLRFTVPALVVFQNAYAPRVLNRMTPDRMELTMLILKERKKKVR
                     YLGSNFQGFNDRVHLFNAQGGVRRGTRYIIETHHNRIQFKHRSRNNSMVDVRAVKMAG
                     SQYDSIGNYTRMTWDNSLCTTNLLSDPNFKRHFKNMPKEETIGVLEEWGVRYILLDEI
                     RKPSLMDCKYHKHHLYADKFWWSPSPETNHMRGDAEFKWKGNELIAYGDYNAHMQHPA
                     NFVTSSSSGSSGSGAATSKSAAAAAGSKKGASARPWFRRTVVVRKSQASDTKPLSTAS
                     KIAAAGTSK"
     gene            <910249..>910983
                     /locus_tag="LMJF_28_2360"
                     /db_xref="GeneID:5653448"
     mRNA            <910249..>910983
                     /locus_tag="LMJF_28_2360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684467.1"
                     /db_xref="GeneID:5653448"
     CDS             910249..910983
                     /locus_tag="LMJF_28_2360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684519.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653448"
                     /db_xref="UniProtKB/TrEMBL:Q4Q829"
                     /translation="MAFRGSSARLAATPGVGIAPETTPVKYVPEMLNIQNAKWWNGRG
                     KPVYRSTYNEKSWLEKARWGAFTKGSRPVMRQRYSAAALKEALEMVPEGFETCDVPRP
                     PQRIRAQSEGVVGRWYTNYWTLHSVRYQCQLAGVEWQFGERQRPRTNYDEPHMYTDFE
                     ETKAIRDYRSRWINVNRSLVGMSRRMKESEEEARYLHFKKVQDTFWSNRKVLVNRIKS
                     MHNQGTLQSAKDLPIKTINIKAFLAE"
     gene            <913389..>914813
                     /gene="SHMT-L"
                     /locus_tag="LMJF_28_2370"
                     /db_xref="GeneID:5653449"
     mRNA            <913389..>914813
                     /gene="SHMT-L"
                     /locus_tag="LMJF_28_2370"
                     /product="serine hydroxymethyltransferase (SHMT-L)"
                     /transcript_id="XM_001684468.1"
                     /db_xref="GeneID:5653449"
     CDS             913389..914813
                     /gene="SHMT-L"
                     /locus_tag="LMJF_28_2370"
                     /EC_number="2.1.2.1"
                     /codon_start=1
                     /product="serine hydroxymethyltransferase (SHMT-L)"
                     /protein_id="XP_001684520.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653449"
                     /db_xref="GOA:Q4Q828"
                     /db_xref="InterPro:IPR001085"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR019798"
                     /db_xref="UniProtKB/TrEMBL:Q4Q828"
                     /translation="MILRAAPASTHRHRSPSLPGNISLRDHDPEVHQLIQREMRRQIE
                     GLELIASENFTSRAVLDCLGSVLTNKYAEGLPGNRYYGGTEVVDELENLCVRRARAAF
                     CLDAALWGVSVQPYSGSPANLAVYTALLRPHDRMMGLSLQAGGHLTHGFYTATKRLSA
                     SSIFFESLPYSITPKGLVDYDQLAYLADIYKPRLIIAGGSAYPRDWDYKRYREICDSV
                     GAYFMVDMSHFSGLVAAREHNDPFEYADVVTTTTHKTLRGPRSGMIFFKKSIKQGKEN
                     VCVEDSINNAVFPALQGGPHLHQIAGIATQLKEVASPEWRTYIKQVKANARALAAVLT
                     EGGETLVSGGTDNHLLLWNLRPHGLTGSKLEKLLDMVNITVNKNTIFGDRSAQAPYGI
                     RLGTPALTTRGLQEEDFRRVGQLLIRSVQLSKEVQKSAGSTKLVDFVKAAETSKALQE
                     MAEEVKAYARQFPYPGLESAYPIQ"
     gene            <916728..>921938
                     /locus_tag="LMJF_28_2380"
                     /db_xref="GeneID:5653450"
     mRNA            <916728..>921938
                     /locus_tag="LMJF_28_2380"
                     /product="subtilisin-like serine peptidase"
                     /transcript_id="XM_001684469.1"
                     /db_xref="GeneID:5653450"
     CDS             916728..921938
                     /locus_tag="LMJF_28_2380"
                     /codon_start=1
                     /product="subtilisin-like serine peptidase"
                     /protein_id="XP_001684521.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653450"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR002049"
                     /db_xref="InterPro:IPR013032"
                     /db_xref="UniProtKB/TrEMBL:Q4Q827"
                     /translation="MRIFSSMQKVYTTDTAPVNASEDVGVEGKRYPTHALGRFIVQYP
                     APMLLTLVLPFVFFVIGGAKLQSGLSYSLDDYQIRSTIGVRRDALRVNSVLNDWAFFL
                     SGAHWLSDSVDLSHPRTSVQDTLELRAVINLQDLMEYAKKVGWSPETRDAHANLLNPD
                     LFEIYRAAEQYVTELDGYEGVCFTNDLRNGQINSIYPTCTPVSSVTQYIYPSWNGLEW
                     FMNGSGTVFQLDYMQRLFANPSYGWFFDNNFSTLNQRALQLRSQYTFASSWSESKALY
                     RKRVKRFLPRAMNFVNSGQAVSLPFVEFHLGGGSSQDILMEIAGEREGYKVGVAAVIC
                     FLLSWWHCRTFIVGLYTAAEAVFAYMAAVGLYALIYRTLPLTTYSAIIWVMTFCMHGT
                     LSFYDMFVFSGIMATKGRQNNLSVVQRLCFTMRRISVGVWIADALAIIIFAVNTTSLF
                     LCVEQFSVFMIIALLWNMYCIALPTPALIVVHHLYVSNQRRNLQKQSDVLKDALLGCR
                     RSGHLVRVLEVVQDNIADGERAYRMEEDLVRQRIGEDFGINRKRYGGPLDFLRQQVRE
                     GRDKVRAARRDVVGALHKAQKAKDRVVKSVDMRDGMGLPSFSLQDFLEIGDANPLAEE
                     TGVGPYRLPLYYNPRMVLPSDLVHIPAVYVERSEECWSGMCDALGLHARASDGEVIPP
                     RAYSLRNQGTSSAEVSAFADWWRELGTRLGVETTSNNRSAELVPFAVRNAVRAQDPTM
                     VVDACASARRGAHKGGAAGGGGGGGWASPRATGGPSGMGLGKLRYRLAHRADLPRLWC
                     CGLFGRVADETPEQRVRRLMARKVKRDVYSLFELFLLQYYLPAIYYVRYALLALLVVL
                     FIVVCMLGCRIAVAGLPNTLLVDQRSIADTFAAMDDTFGQRGSCTFCGPYYRSPQDYR
                     QATITDIAACSVDYGVQMNLYADSCGACNGTDACVDCAGTAHGAAALNDCGGCAVAGS
                     SAAAPCTCPLTRDCQYCEWALGKGSAGGGSCSVTCDASTCGRNGKCDQYTGTCVCSAG
                     FTGAACNECEAWLLPAALNPGCALECNAAMNSAACDCDASSGRCRSCPAGTRGYDCSQ
                     PSVDCHSHGTFDPATATCTCSSGWTGAFCNVSSVCSGRGVLLSAADSPTGSEMCGCLG
                     HWRGRTCQLCDCINGGMCNAVTGKCECVGAFTGPRCETCAANCTLRGTCPDVSTPDYA
                     LWNVRACIPNACSEADVQSETMCRACSPTQMVPVGACKAASKESCMAMSDCWWYMDGN
                     VAPYCGMARQVSDVTALSCTCRYPKVWSGPTCGSCPAPAGATCLDDGIVLGCNRLAYT
                     SLSSVVSIDSCGVCGGDGLCRGCDGVPGSGATYDACGVCGGNSTCSGATAAMPMYVEY
                     LFDLTKVPRILNNAAWCKVVASIAANIRRLDSAGSQMRTVLEDYLANDASYELTSLQD
                     FYNYAKENGRLSEAVFTLSYNGEPLMLQQILYRVESTLATNQSSPSRVVAAYYWISRD
                     IIAPFQSLAQASGITVYYTSTLFQPAVARVGALQSLWFAVGIGLAVTFVLLLTYYVSL
                     TTAVAATIVAAIVCFGSLTVCAVFDWDVDAVLQVCISCTVPISVEYVVHFCSGYFDYL
                     QTTTSHLFARDVTRRTAVQGALLRSAPAVCTSVVCVIVVSTMFGVSSLVPLRRAGQVS
                     ITLHLLVLLAGVLFTGAVAALGPMSVYQHWTLSAAICIVCAALAALAVLVMYGVHGVL
                     GPHGNMILTR"
     gene            <925006..>927648
                     /locus_tag="LMJF_28_2385"
                     /db_xref="GeneID:5653451"
     mRNA            <925006..>927648
                     /locus_tag="LMJF_28_2385"
                     /product="putative DNA replication licensing factor"
                     /transcript_id="XM_001684470.1"
                     /db_xref="GeneID:5653451"
     CDS             925006..927648
                     /locus_tag="LMJF_28_2385"
                     /codon_start=1
                     /product="putative DNA replication licensing factor"
                     /protein_id="XP_001684522.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2385"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2385"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653451"
                     /db_xref="GOA:Q4Q826"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR008049"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="UniProtKB/TrEMBL:Q4Q826"
                     /translation="MNPPDIRDDPALPQPTAEVAPVLEVDADGIRVREAVHLFLSRLI
                     DPLLRADPNLAVAGTSGRDDISGAHSSLDYVVAQMERISTSTSWSTCVVRWADLLRFD
                     EDAAAVLESDFQRFSPFINEALHQVLLQYYGEEYANRGKCNPSLVFSNVPRCLTIRSL
                     RASLVGQLCAIKGVVTRTSQVRPELLVGVFRCSDCGTGSLPIEQQFHYTEPPTCRNPQ
                     CENKNKFQLIPNHPQTRFGDWQKLRMQEDANNIPAGCMPRTMEVIVRADAVEVAKPGD
                     RILAIGCAIVVPEVAKLFNLANRREVQRQLTGGQRAQQDAQADMEGTTGLRALGVRDL
                     NYRMCFLATTITDATGDDRKMTQAVKEATDGAAEREEVVLTPAERQRVQQMRRHDNLL
                     KALTSCVAPNVFKHDVVKLGLLLQMVGGVSKTTIERIALRGDINVCIVGDPSTAKSQF
                     LKWVSANMPRGVYTSGKASTASGLTATVTRDADTGERTIEAGALMLSDRGICCIDEFD
                     KMEMKDQVAIHEAMEQQTISIAKAGIKATLNAKTSLLAALNPIGGKYDRRRPLQKNIA
                     MTAPIMSRFDLMFVIVDDSGDDADFAIANQLLRLHRFGGAAVRPPFTTEDFQLYLRYA
                     RSLTPRLTREASQLIVAAYRDMRLQDSLSNRSKVYRVTTRLLESMIRLSEATAKVYMS
                     DEVRPTHVEVALELMRQSLSTLDMTEVELVGGAADDTLHEEQDRVVKQEPEAARGSAS
                     ASSGVAGHGTDKGRVADDSAGTDGQTSFADEPASASSAAVAAPRRKVSIKADHYFSIV
                     NRLVAHLKSLGDDAAPTRQELVTWYLEQVKTLNRPLLEAELRYVNLVLSKLVREGKLL
                     EVNVREGDLPRLYLDPNFNPDVTQ"
     gene            <928993..>933066
                     /locus_tag="LMJF_28_2390"
                     /db_xref="GeneID:5653452"
     mRNA            <928993..>933066
                     /locus_tag="LMJF_28_2390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684471.1"
                     /db_xref="GeneID:5653452"
     CDS             928993..933066
                     /locus_tag="LMJF_28_2390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684523.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653452"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="UniProtKB/TrEMBL:Q4Q825"
                     /translation="MPPVRTVKQETDVIVPRAGETYVADDGTVSQVLDDHIDANYEPT
                     EEEVLEFADWIGMKLPQDSEFLWLAREGLKTPLPKEWKPCSTNDGEIYYFNFKTGESS
                     WDHPMDGIFRQRFEQEKEKARARKPASAASSTTANRSTSGPNSSTPSNTTSAIPQTHV
                     MMTDTGVLRRDAGPGAAPRPSPVVTSISGGLKGVGAANARSEAKPIMHYPLQQQSRST
                     TVTTRTTANPQSAAGSSASTAAAAGNPARSSSGLAPKKVGAAEASSAAPPRIVSEAER
                     ALEERVQREMQLALEAERTKIEEAHQGTMSTLQSNFDKEVAELRSADAARRAASSREE
                     EEERERRLQQTRSMCEDNYGDELRSLEREAESYAAKVQKLEAEAARATTGNTQRATIE
                     AELKTALAKQRADAEADIKKQHDTAMEAAQSAHAAAMQKVRDEEQNRITAAKQAWQRK
                     FDEEERALALQAETQRKRLEVQLKELDEKLASFAARAGASTTTATPPATDSSPPGSGE
                     SLSERLARVTAAKAAQLQDIEAAAAREQSDVRTDGEAALAELVKQAQLAQQAAQLLPA
                     GATPIGSLSRAASYASDRSGFVTPQGGARPTSATLSVAFTQELNRIRLARGKDRQERL
                     AKLRADREAALAAIEALSDAASTAKSRGSDTGGDTQTTPKSGGGSSLTTVEELKAAHA
                     VELQAKRALYAKMEEDLKQRYACEAADAAGATTEMQQSALVAKAVDMEMDLYIQQATA
                     RYDRMRAEAAAKRDKALADHQLAMEAYERRKLEVEARQAREQQEAQEAFIQSRLSTAV
                     EVERTKLAADHAAAMARLAARYDEERDAVKAEVEEEMAAYEAAVRQEIKTAASTTAAS
                     ADKVQGATAPSATADTGEGTAATEALCSQVQKQHADRHAEWMSRKRVQAAQRAALEEK
                     QATLQAQKRRAEQHVEALKEEVTNLVAAVQAAEARQPSPSSPSTPSRSPPASTLASVA
                     TAGGHLRSMHEASMQALEQGYRSQEAALEAELQTWRGKIRALQQSQLQQSYASTSLST
                     PRQQVLTDAAHLGSAAMRPTSTSYVLHRHPSPIATAAAGASLLNTPTISMSLEDSPWQ
                     PTTRAGLPLLQNGMMACGPSLASGVPGTTAAILSYQQQQRALQQRQASLEAAREAWQL
                     HRRRKAELQQQEQSRLNLSALAAASQQDQTHEGVEPSILGAVGGVHRSHQELLSLVLS
                     RLIERLDAVTGQAVQLQHQHDQQRYSRSQSAARAGVRAETASSPHARAHSAHSHHCDA
                     RSLPQRGSVVPMTALQPRHSTLMNAADAASSAKVASSTKPSSFSARERASPSVRHSRS
                     GNRVGGAEGETRRGGASSSNVSSKWSMLLSQHHRHRS"
     gene            <934045..>935088
                     /locus_tag="LMJF_28_2400"
                     /db_xref="GeneID:5653453"
     mRNA            <934045..>935088
                     /locus_tag="LMJF_28_2400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684472.1"
                     /db_xref="GeneID:5653453"
     CDS             934045..935088
                     /locus_tag="LMJF_28_2400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684524.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653453"
                     /db_xref="GOA:Q4Q824"
                     /db_xref="InterPro:IPR014816"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4Q824"
                     /translation="MLLRDTRAYPNTPQLCTRMLAHRGTIAKDGDVVLVVHGHQNIVP
                     LVLQRGAVLHCKAGKFDHNNIIGQPLGIYVKGRSNQKNDPREPSVLVLQNSADMWTQA
                     VPHRTQIIYDTDIAVILSNLRLGPGKKVVEAGTGSGSLTHSLAKAVAPSGCVYTCDFH
                     KQRCLEARAEFRGNGLDSHLVCSQWRDVCTTNTGAADVVDGVDADVAAMEAPLTGFGV
                     PAASVDAIFLDVPAPWAAIENVCHVLKEGGMLCTFSPCVEQTQRTVEALRAAPHHFVD
                     IRTVEALTKFFEPVFKRARDAPDRDCTKFRASCVSKGHSAYLTVARRRLAKSERLEAS
                     GAEKNGVEGATTA"
     gene            <935891..>938029
                     /locus_tag="LMJF_28_2410"
                     /db_xref="GeneID:5653454"
     mRNA            <935891..>938029
                     /locus_tag="LMJF_28_2410"
                     /product="putative
                     dolichyl-P-Man:GDP-Man5GlcNAc2-PP-dolichyl
                     alpha-1,2-mannosyltranslocase"
                     /transcript_id="XM_001684473.1"
                     /db_xref="GeneID:5653454"
     CDS             935891..938029
                     /locus_tag="LMJF_28_2410"
                     /note="unknown EC_number=3.6.99.-"
                     /codon_start=1
                     /product="putative
                     dolichyl-P-Man:GDP-Man5GlcNAc2-PP-dolichyl
                     alpha-1,2-mannosyltranslocase"
                     /protein_id="XP_001684525.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653454"
                     /db_xref="GOA:Q4Q823"
                     /db_xref="InterPro:IPR007594"
                     /db_xref="UniProtKB/TrEMBL:Q4Q823"
                     /translation="MTPLAPSSFKGQLLLALMLSIGLKVLTFSLSTILTRLLLPYQNG
                     VYFTFNVYNDAVLFIAREATRNVASRLPIIEPSAEAEDSAEHHGKGGAAHEMSPAERG
                     RAPSAPSASSARTPASLVRVANVRAVVSIAFCSVPLAIVVAAVLEALGTCLGVASFVP
                     SMMQHARASQQVFRKAENASGLDGASTLTGLPFLLLPYMPEMTVVLCAVLMAAVEPCV
                     VLVQSLNLFRVVVLAECATLVARLCTIIGIVYACQRYSAGGRTPHGEVGNGLRTMWEA
                     RMALAFGQLAYAITHVIYYSLVLSGLPVARWLGCSTAMEQVRAAALLAHARDMRQSEQ
                     DTGAGGSAGDAKAAPSSALAAPLQAGRWATFAFPFCFYSIVDSVAVCRRYAALFSTFL
                     RESLLRLVLSEGESLTLTSLGSETARGYYQLISSLGSLVARLLFRIWENACFVKWSRE
                     ASLGHRHTAVQLLKLMLRLAFYVSFSFTLLGPPLAKTFLATMYTSRWATPQVSTALQL
                     YFYDLPLMAWNGLLEAFLRAVASPAVLHRLQGWMVGETVLYIAACYVTLVAFGKADSQ
                     GESVSVLVLLNIFNTLWRCGVSIYLLVSSPGAAVGAATAASTSAQAKDGGEPAAPALP
                     SLAPPSPIVHLRDFVSLFPKHVLGSILGIFVCSRVLRENSVVTITAVGLAYAAVILAW
                     DGEVRQLLVTPAWSRMRPLLLGAPMARTRA"
     gene            <938464..>938832
                     /locus_tag="LMJF_28_2415"
                     /db_xref="GeneID:12980843"
     mRNA            <938464..>938832
                     /locus_tag="LMJF_28_2415"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722026.1"
                     /db_xref="GeneID:12980843"
     CDS             938464..938832
                     /locus_tag="LMJF_28_2415"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722074.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2415"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2415"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980843"
                     /db_xref="UniProtKB/TrEMBL:E9ADK2"
                     /translation="MISCVPRPPPSSRLCAHRVCTASFAALAPPPLLPLHLVCRGFLS
                     RVSFSTAAAAAIPIPVDGCVHPLTHVCGDSCPHGRFEISREVPQLAMISRYVLTCVCM
                     STSHINTLLQEEYHCLTDIT"
     gene            <939577..>940746
                     /locus_tag="LMJF_28_2420"
                     /db_xref="GeneID:5653455"
     mRNA            <939577..>940746
                     /locus_tag="LMJF_28_2420"
                     /product="putative 2-oxoglutarate dehydrogenase,E2
                     component, dihydrolipoamide succinyltransferase"
                     /transcript_id="XM_001684474.1"
                     /db_xref="GeneID:5653455"
     CDS             939577..940746
                     /locus_tag="LMJF_28_2420"
                     /EC_number="2.3.1.61"
                     /codon_start=1
                     /product="putative 2-oxoglutarate dehydrogenase,E2
                     component, dihydrolipoamide succinyltransferase"
                     /protein_id="XP_001684526.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653455"
                     /db_xref="GOA:Q4Q822"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001078"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR023213"
                     /db_xref="UniProtKB/TrEMBL:Q4Q822"
                     /translation="MFRRVSTRVLPTACSAAHNLNLRFCLSINVPTIAESISTGKVVN
                     WTKKVGDAVAEDEVICQIESDKLNVDVRAPANGVITKINFEEGADVEVGAQLSTMKEG
                     PAPAAAAPKAAEVKLDAPKAEPPKAAAPAASAPAAPAAPAAAAKPAMHTIAGADPRTK
                     SVRISSMRRRIADRLKASQNTCAMLTTFNEIDMTPLFQLRDKYKDEFHKRHDVKLGLM
                     SPFVKASAIALKDVPIVNASFGKDTIDYHEFVDIAIAVATPRGLVVPVIRDVQNMNLA
                     NIETAIADYAARARINKLTMAEMTGGTFTISNGGVFGSWMGTPIINPPHSAILGMHAI
                     KKKPWVVGNEIKIRDIMAVALTYDHRLIDGSDAVTFLVKVKNLIEDPARMVLDLS"
     gene            <943761..>945248
                     /locus_tag="LMJF_28_2430"
                     /db_xref="GeneID:5653456"
     mRNA            <943761..>945248
                     /locus_tag="LMJF_28_2430"
                     /product="putative vacuolar ATP synthase subunit b"
                     /transcript_id="XM_001684475.1"
                     /db_xref="GeneID:5653456"
     CDS             943761..945248
                     /locus_tag="LMJF_28_2430"
                     /EC_number="3.6.3.14"
                     /codon_start=1
                     /product="putative vacuolar ATP synthase subunit b"
                     /protein_id="XP_001684527.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653456"
                     /db_xref="GOA:Q4Q821"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR000793"
                     /db_xref="InterPro:IPR004100"
                     /db_xref="InterPro:IPR005723"
                     /db_xref="InterPro:IPR020003"
                     /db_xref="InterPro:IPR022879"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q821"
                     /translation="MGRDEEHVRVLSKQELLATHIKELNESYSVKPHLEYTTIRAVNG
                     PLVILEDVRKPTFAEIVNIELADGTARRGQVLEVDGTKAVVQVFEGTSGIDVVRSKCE
                     FTGKVMELGVSEDMLGRIFNGSGIPIDNGPPVLPEQFRSIEGIPINPRARVYPEEMIQ
                     TGISSIDVMTSISRGQKIPLFSGAGLPHNEIAAQIVRQAGLVKREGKTEDFCVVFAAM
                     GVNQETARFFRTEFEQNGSMEKTVLFLNLANDPTIERIVTPRLALTTAEYLAYDCGKH
                     VLVILTDMSSYADALREVSAAREEVPGRRGFPGYMYTNLACIYERAGRVLGRAGSITQ
                     IPILSMPNDDITHPIPDLTGYITEGQIYVDRQLHNRQLYPPINILPSLSRLMKNAIGE
                     GMTRKDHSGVSNQMYAAYAISRDILAMKAVVGEEALSSEDLLYLEFLDKFEHKFICQG
                     FYETRDIFQSLDLCWELLRTFPKSMLNKIDMKTRDEFYDRHPGRK"
     gene            <947699..>949720
                     /locus_tag="LMJF_28_2440"
                     /db_xref="GeneID:5653457"
     mRNA            <947699..>949720
                     /locus_tag="LMJF_28_2440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684476.1"
                     /db_xref="GeneID:5653457"
     CDS             947699..949720
                     /locus_tag="LMJF_28_2440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684528.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653457"
                     /db_xref="GOA:Q4Q820"
                     /db_xref="InterPro:IPR005907"
                     /db_xref="InterPro:IPR011004"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q4Q820"
                     /translation="MSSDTAASCLLDIVVFAGGDSLDLMPLTAVEQKTMLRICNRPLI
                     WYAITPWIEAGFRCFFLCVNEDYATLRAYLSRAFDGVDFHYILVPSNMGDHPSTTCDA
                     VKAYLKYKEALRLGEEGTLAEVSRGMPDRDDSAINVEVSGGRSPSVMSLHEAQQHRGA
                     SGSRNHGGSTSHSNRDPLKLERMNSAGLPRDALLLSCDTILVDVDVASFVERHYASLA
                     SVTAMLYRPLRKRGGSGDHKGGHRHGKGGGGASADSAEVSYTHALSCVAYEETDVLAS
                     MGLGAASSAPTSSCSRRLPSGMPSQSLHASASLFARSPCEVRTMSAEPVHVHHHRMHY
                     LNPLEGKPEVRITMAFAARRPDLTFAADVVDAHAYLMSRWVLEFIAESAGVSDMSVRK
                     DILPLLARSQHTTVNAAEKVFVTPADKLKMNVPLHWLGEGAEISAQSLNAACGLSLPE
                     VTDSLRVFCTIYEEDPDVACRICSMNTRDNYRALNHDIISAKCSQLQLEEPPLGTGSA
                     AGVGGAFGGGTSAVNRFALPSLLPHGGAHAGHTGAAGGAAHGDSGKPAPSAGAVALSS
                     LLPDNPITLREKIGDQQVCIVGSFIDSVPPPNVFVTRSVIGAHVTLEPGVRITDSILM
                     GNVEIGAKAVVSNSVIGTGAVVNAGCRVVGTIVGPRCVVEENASDTIIE"
     gene            <950825..>951703
                     /locus_tag="LMJF_28_2445"
                     /db_xref="GeneID:5653458"
     mRNA            <950825..>951703
                     /locus_tag="LMJF_28_2445"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684477.1"
                     /db_xref="GeneID:5653458"
     CDS             950825..951703
                     /locus_tag="LMJF_28_2445"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684529.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2445"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2445"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653458"
                     /db_xref="InterPro:IPR007751"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q4Q819"
                     /translation="MMGRRLHLCRASYSSLLAATKALKRMPACLPARVATSAKSALVS
                     MQLWPKSSASVVSRVVAAKATGATADRATTAVRHKLCFSAVGHSMGGLILRAALPELI
                     QTVEEKYEAFKEVCEVHWDVFCTLATPHLGVGYMQSKRTTFLGRHVGCHLWRAMAGLL
                     CRSSVVRVDLVSDACLAAWSRFKRRVLVNVVNDDAVLTYSSSFVVTLRVLRRVGAPLP
                     STDEEIADVCSTAKGEEPPSALWQLCSSTRLPWRQVCVGRERSCATTVRFPQIYLPSC
                     GRSTCSWRKACWRSAS"
     gene            <953655..>956099
                     /locus_tag="LMJF_28_2450"
                     /db_xref="GeneID:5653459"
     mRNA            <953655..>956099
                     /locus_tag="LMJF_28_2450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684478.1"
                     /db_xref="GeneID:5653459"
     CDS             953655..956099
                     /locus_tag="LMJF_28_2450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684530.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653459"
                     /db_xref="InterPro:IPR024881"
                     /db_xref="UniProtKB/TrEMBL:Q4Q818"
                     /translation="MGSAAVTRTHASQRPRGHQGMRSPPLLSLVALSVLHVLLTLIGV
                     AHAAVERQGEGVLLGQWADATSTYFGTTATPFVLENGTTVYLPAPPLRVLTLVDWQNQ
                     RHTEFLSSWPNQSSLTLWANRNTAISYASRIISSDLVYRAAWSTGPLPAKTASGSTVG
                     DAELKVVSAMAADLLGIGELDIVVQASNGSIWVLNHSSVASASSSSSKSAFEPIFVIN
                     ADAAATSVTTTDTAASDVSMQFKVPNAPQLAVVPDVLCDLANPHAAQTALAFVNTDDQ
                     LVLLSRTTNATMASTVQWPPRYVARVLVDEHSNTTQRAVLPLSIALADVNEDCAAELL
                     YAVRDTQEHRYEVRMVSQSGLSVPAATSSAAASASASSLLLLQLAEDAGERYGETFTL
                     ADVNGDGLPELLLSVQLANATSSCTAADTADVTEPCTPYHAIRVFYPIRASGVSGAPS
                     CGLSALSDERHLTYTVAQSELLALTAEWCRVADWIEGDQSTAGGSFPLYMPSYPSAPL
                     VLRPGDYNRDRLVDLIIPSSFGPLVLTSRAVSGARSMMCTPLDASAGVSAVRQAMKTS
                     KLTSSSTVSREAYRTAIPFFGTLGQLGRLEVVLTHHRQYSSTVTSRTAVVTAADFARN
                     AMQVYQNGAVPSRSYFLSASAITAAAHGAACVGATHHMTWHDIHMRSHWATVTQLERT
                     QGHALLPSQVLVGLDETFSYVHDYTVGLRVTQRTSDVGSTSHENKSSMTKLTQTVQRK
                     EWPSYLVPNAVVFAQLTPVDKPHEWNLEMYLPTSTYRVLLVTALTVALVAIGLPVVWL
                     RCGEMRRDYNEWRTPL"
     gene            <956784..>956957
                     /locus_tag="LMJF_28_2460"
                     /db_xref="GeneID:5653460"
     mRNA            <956784..>956957
                     /locus_tag="LMJF_28_2460"
                     /product="putative ribosomal protein S29"
                     /transcript_id="XM_001684479.1"
                     /db_xref="GeneID:5653460"
     CDS             956784..956957
                     /locus_tag="LMJF_28_2460"
                     /codon_start=1
                     /product="putative ribosomal protein S29"
                     /protein_id="XP_001684531.1"
                     /db_xref="GeneID:5653460"
                     /db_xref="GOA:Q4Q817"
                     /db_xref="InterPro:IPR001209"
                     /db_xref="UniProtKB/TrEMBL:Q4Q817"
                     /translation="MGHLDQWRSRQKIGMGKGARCCVICSNQKALIRKYELNVCRQCF
                     RENAEHIGFTKLR"
     gene            <958674..>959552
                     /locus_tag="LMJF_28_2470"
                     /db_xref="GeneID:5653461"
     mRNA            <958674..>959552
                     /locus_tag="LMJF_28_2470"
                     /product="MRP protein-like protein"
                     /transcript_id="XM_001684480.1"
                     /db_xref="GeneID:5653461"
     CDS             958674..959552
                     /locus_tag="LMJF_28_2470"
                     /codon_start=1
                     /product="MRP protein-like protein"
                     /protein_id="XP_001684532.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653461"
                     /db_xref="InterPro:IPR015223"
                     /db_xref="InterPro:IPR019591"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q816"
                     /translation="MRFSRVSVPGVKRVITICSAKGGVGKSTTSVNVALALKNMGHSV
                     GLVDADITGPSIPTMMGVESSQVETYRVAGSDRFGPPMNFGVKVMSMGLIVPYDEAIA
                     VRGPMVNKYIRALLFQTDWEELDYLLIDMPPGTNDVHLTITQEVMLTGAVIVSTPQKV
                     ALIDVRRGIDMFAAVNAPVLGLVENMSYFKCDSCDKRHYIFGRGGVARAAEELGVPFL
                     GEIPFVSRIMQDTDEGVPPALRGDATLEAAKPYYELAERIHATLGESERNRAGDGSGG
                     DDRQRAPAPEPAIVFE"
     gene            <960284..>961189
                     /locus_tag="LMJF_28_2480"
                     /db_xref="GeneID:5653462"
     mRNA            <960284..>961189
                     /locus_tag="LMJF_28_2480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684481.1"
                     /db_xref="GeneID:5653462"
     CDS             960284..961189
                     /locus_tag="LMJF_28_2480"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684533.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653462"
                     /db_xref="UniProtKB/TrEMBL:Q4Q815"
                     /translation="MTRRSKFVRAASAGVALTMIVMATLCCTSAVCVPATARTNFENG
                     RRFAAIPEIPAVVKQIWSVPPASDEGAGSPLHVMVSAPSKYELAGQEYPPNSASRIEC
                     TLPLVVERVHKDADHAHASSPGVVAMDTAAIAPADQPHIMPAALPAQLLRSPLANGEA
                     APTLKPLSKTLSLLPIHQRKQLVSPSYRAAGQLAAHQGGQKAAVEVAPAAVTANASSS
                     GSSEGSSSREDNHGVILSSGVIASFTVAFIFAGLLLILVLAEACAMVSAFMAHRRMRA
                     ARDVEGADNPIEPKCADFRDTAVDV"
     gene            <962954..>964489
                     /locus_tag="LMJF_28_2490"
                     /db_xref="GeneID:5653463"
     mRNA            <962954..>964489
                     /locus_tag="LMJF_28_2490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684482.1"
                     /db_xref="GeneID:5653463"
     CDS             962954..964489
                     /locus_tag="LMJF_28_2490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684534.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653463"
                     /db_xref="UniProtKB/TrEMBL:Q4Q814"
                     /translation="MDPVQELIAGVGLSDVEGGRRPEQASLSASSTAFDASSAPAPAP
                     LLPAAPPRRTKMVFLYSDEDGVDGDDDDEGRRVTQSASGVAEVLCDDHAIAVSADSLA
                     ELQAEAAEATAVGVSDAQTSLLNANGFSFEEDVLSGLVGGASASCTTDGGIRVREVTA
                     PRLWEGAVAPAASSSLHGGGEGAASSAADELPLLLRRGLPAADFVLQSRRKRFREVPA
                     SAGATVQPSPKDAAAAAAAGESAAASSEAAAESAPQDPSSSSELHVGHPQGGQRDDGS
                     DSVEVEVEEELDVYPVYEENGRTVRALRTRCGYELTLDERDLLEDWAEGDEEDTGEGC
                     ADKGEDAAPPAAAAVTEENKQTDDGDHVVYSHDAPSTTRAAQTANSAAAAAADEDDED
                     AGADLPVQVEAEDWGDFRDFDEEEDEEEAELDEAIIVAVVEQLVRCCEADDLDPQISV
                     EAARFIGAAKPLLEQLTNEVISPAEFVQCMERDLRRFQRIYKSIYRPRDSPIVIDGVV
                     TDL"
     gene            <965413..>966462
                     /locus_tag="LMJF_28_2500"
                     /db_xref="GeneID:5653464"
     mRNA            <965413..>966462
                     /locus_tag="LMJF_28_2500"
                     /product="putative eukaryotic translation initiation
                     factor"
                     /transcript_id="XM_001684483.1"
                     /db_xref="GeneID:5653464"
     CDS             965413..966462
                     /locus_tag="LMJF_28_2500"
                     /codon_start=1
                     /product="putative eukaryotic translation initiation
                     factor"
                     /protein_id="XP_001684535.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653464"
                     /db_xref="GOA:Q4Q813"
                     /db_xref="InterPro:IPR001040"
                     /db_xref="InterPro:IPR023398"
                     /db_xref="UniProtKB/TrEMBL:Q4Q813"
                     /translation="MNPSAAAYIPQQSDAKGDPKSSSAAAVAKPPSTQPATKLSAAAE
                     PFVPGGPKQMSATSTHVDPKATTEDEKTTAPLLMECPASSLPDSAAAAGAAKKEADEN
                     DDSQLDWLPEAQPTDWSESKLPKLFGCHNTAAKATSSAIPLHASWDLYADDHQGSSNM
                     ASNSSPTSTMSFEPIFVSNVGDVESFWRLWRYLPAPSALPTVYTYSWFRKDIKPEWEH
                     PRNKKGGTISIVVFDRDRSGLSDKQVLDDVFMAMLVGAVGESFHECSTTLNGIMLKVR
                     SNKPVTLQLWTAHSEVGKLKAFANSVRDTLTKIMGAKTLQKLEYYSHHQKQAATNSLA
                     ARMKGKTKISPDHTF"
     gene            <970365..>972254
                     /locus_tag="LMJF_28_2510"
                     /db_xref="GeneID:5653465"
     mRNA            <970365..>972254
                     /locus_tag="LMJF_28_2510"
                     /product="putative acyl-CoA dehydrogenase"
                     /transcript_id="XM_001684484.1"
                     /db_xref="GeneID:5653465"
     CDS             970365..972254
                     /locus_tag="LMJF_28_2510"
                     /EC_number="1.3.99.3"
                     /codon_start=1
                     /product="putative acyl-CoA dehydrogenase"
                     /protein_id="XP_001684536.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653465"
                     /db_xref="GOA:Q4Q812"
                     /db_xref="InterPro:IPR006091"
                     /db_xref="InterPro:IPR009075"
                     /db_xref="InterPro:IPR009100"
                     /db_xref="InterPro:IPR013786"
                     /db_xref="InterPro:IPR025878"
                     /db_xref="UniProtKB/TrEMBL:Q4Q812"
                     /translation="MLRRVCSSAAASHAAAVTMAARSLTYQPRIRDVQFLYEEVFNMY
                     DHYNNLGKSGAGGSDSVVTKELMDALLEESSKLAVQTLLPLYESSDSEGCVLKNGNVT
                     TPNGFKEAYQALTAGGWTGINEAEKYGGQALPLSVGFTTREMMATANWGFSMYSGLSL
                     GACRTLMAWASDELKEQYLPKLVSGEWSGTMCLTEPQCGTDLSQVRTKAEPSGNGKSY
                     RITGTKIFISAGDHDLTDNIIHVVLARLPNSLPSTKGLSLFLVPRHVVNDDGSLEAAK
                     NVECIALEKKMGIKGSSTCQLSFHNSVGYLIGEPSAGMKQMFTFMNAARVGCALEGVC
                     HAELAFQNGLRYARERRSMRALGGTKEPEMVADRIIYHANVRQNVLFAKAIAEGGRAL
                     LLDVGRLMDLHAAAPDAATADALDHEIGFYTPIAKACVTEWGVEAASRLLQVWGGHGY
                     IKGNGMEQILRDSRIGTLYEGTTGVQALDFIGRKVLSTKGGNQAKRFGKRVSKLARAH
                     MLSTGGLARYGRQLWLMQKQWRIATTRIGLMALKNRDAAAASSEDFLMYTGYMTLGYY
                     WLRMAEVAQCKVATGQDADGFYQTKLDTCEYVFTRILPRAAAHRRIMQAEPTLCAYKE
                     ENWDI"
     gene            <975049..>976971
                     /locus_tag="LMJF_28_2520"
                     /db_xref="GeneID:5653466"
     mRNA            <975049..>976971
                     /locus_tag="LMJF_28_2520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684485.1"
                     /db_xref="GeneID:5653466"
     CDS             975049..976971
                     /locus_tag="LMJF_28_2520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684537.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653466"
                     /db_xref="GOA:Q4Q811"
                     /db_xref="InterPro:IPR001374"
                     /db_xref="UniProtKB/TrEMBL:Q4Q811"
                     /translation="MDARASMRAILESARQSIRNRAANPTGRTVLKKGRTLEDSASPS
                     RHPQPTVQPTPSSPALDVAEGLHFQKDTASDADAATTEATALHAKENQMRFVRHYHRL
                     LLAFIEDKSKYELELPNLSSLDRMVVHALAEKCNLSHESTGDRADRVMHLKKDILFFQ
                     NPEAAKQVNLDDIIERVSWKESKFQIRYVRSANPAQVAIGDIGSYADEDALEKIERFC
                     RATDEYRHATNMGYTQQELLLAEAGIKGEGADAADGQGYAVSGRLEEILSRPDTSSTP
                     AITTGPASAVASSPSPPLSSSTSTIAAAMARSKATAAANAAKEAAAATTVFYDEVCRT
                     CGSRARLGGSPQGWRCSHYCAHCTRQSIWCLEEVRIKEEPAKHHKRRRDGASLAEYGG
                     ESGRRRRGEPVVEEIDREEDEDDGAVRHSRSRSRGSSGEEDADEALTSEDVVEMAATN
                     DFSAKDTNWLREFASRGSARVADQIAFCIDFNDLTEARVFRRYGGAAAPSEAACWYVV
                     LRGVRELSLTVSDLVRELLNEAFLDPSSAAAQDGDERATSAPTVEAIHTEEVEERAMD
                     HLGIAFPNLSVYGTDCVAVCQLRPAVRWASVPRLPICEAALQHLRQRYGARHVFPTQS
                     LEEAVRRAAESDLPSS"
     gene            <979046..>981856
                     /locus_tag="LMJF_28_2530"
                     /db_xref="GeneID:5653467"
     mRNA            <979046..>981856
                     /locus_tag="LMJF_28_2530"
                     /product="putative PIF1 helicase-like protein"
                     /transcript_id="XM_001684486.1"
                     /db_xref="GeneID:5653467"
     CDS             979046..981856
                     /locus_tag="LMJF_28_2530"
                     /codon_start=1
                     /product="putative PIF1 helicase-like protein"
                     /protein_id="XP_001684538.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653467"
                     /db_xref="GOA:Q4Q810"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010285"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q810"
                     /translation="MEANAGAAETGEAPSASASCVPVPLPRVHLPMEFAPPQKEPTLR
                     TSLCAQHGTGDGCYATPAAAAAPSTSTGSDAASPSIAPTTVTHEVYSGLFRESFVNPF
                     NGRLVRTTSLAAKMLFGVGFYRGVSNPLQIEWSPAEYMVALQKIMSTQQRNASRRRER
                     QAQQGLRDAKAAAAAERTSSASATKKARAGGSRARSSAKCSVSEVAPMPADEAMAQAR
                     SQLLRPFLRRGPDHWTARVAKLLERHDAFTYMNKELGQLYARLRDAYMPPKLDTPADP
                     CAMGMTLTLDQHHVVRLALRGFNLFIGGSAGTGKTVLLKRIYQELCQMGLRVAMTATT
                     GVAAVQLGGCTFHHAFNAPLDTAPHRWDANALRAVDVVIIDEVSLLDASMLDAFDMEA
                     RLARMHHSPFGGLQLIVCGDFLQLSREDTLPAYESVAFKHLVALRLVTPMRHAADDPL
                     MKLLEDLRRGRFDVERFAALDRPIPPNTTHITYLFPRRREAQQLNDLKLGELMTQEMI
                     FTPQRGPLQLCGSFTRSALVELNRDANGMRAAMPNRERLLEMIHEEAQRVRAGLHRKD
                     GGGREPVPSVADHELVLMPVRAEGGLETRFILRLRCRERELHNPGARGGGDGDADSGD
                     GGASTRSSALAAGGAPALMADRTHSGTLAAVAAETLRKPVIALTTKRTRRVTAPFSAA
                     EWEGIAAAVATRLGGRVITMLEEEPSSMAPLSVAMTLADMTSSDAALSLTPLRLKLGC
                     RVMVNRNLSRTVSNGSVGVVEAFAPPDVSLFPRRSDRAARVIFKRVCQQRLFAQLPVV
                     RLLGGEVVQIPPISILLGGTAQSYFYGHEVLTIPLQLGYAFTVHKVQGLTLQGTVVLD
                     CEKFFDCAHLIYVACSRVRKLDQLVVYRVQPNMIIVRRSALEFSDKLQDARNSNVLIS
                     PPPAARSSWIMHTEQRVFAVSA"
     gene            <983257..>987930
                     /locus_tag="LMJF_28_2540"
                     /db_xref="GeneID:5653468"
     mRNA            <983257..>987930
                     /locus_tag="LMJF_28_2540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684487.1"
                     /db_xref="GeneID:5653468"
     CDS             983257..987930
                     /locus_tag="LMJF_28_2540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684539.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653468"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q809"
                     /translation="MSTAGLSRAYAVLRQLDVLRAESITNPLPMSGDRRSRARRKERG
                     GSDVGRSLFPSREELAVRGVRLQGYRTPPPSDRRGWCAGHGGVIWEDSIDVGATQGPP
                     SRLAGATDHRGYSSKHPHAYTPARSHLIPASPTHDGPQVESSRPAAAERDCHAAAATT
                     SADVQSRRSPLSSEYALGDRYDHHAPPPPPPSCGSGASPLLLSSSNSPVSHHRYNTQI
                     AREQPLRRSPSARVAVPSPVVLPSSFTSEAAHVAAAQTSSLLEVYFDKDDMHAVLDSV
                     AAATAAAATSPAQPVTVAAGAADTACCTHTRTARGTHRGYGAAADFMHSLGASVDASA
                     TTEAAATPSSLSNSSLTAMAGGDAQSASGTSLVTAADDGRHPLWQLSMSRHDVGDKQH
                     GCRSAAAASAASLPTRVKDVSITPSVERLLGARHQRSRSVGQQHQQLQREAAAPATAA
                     SLRPLFSPPPSGDLSSFYTAAGRSVRAEGGGNAYAAEAPQHQQEEACISLSRHSRLPL
                     HGIPSPRGAVDAEPSSPRVLADGRSEGVGDDGSGGADESEGSSPLGLHGLSAGRADEG
                     SIDQDAYRREGESLRRRALLGAAEEKSVQRAAVDDDHQRRDTHRPSQNDSRGQGVACG
                     ERRRVMPLFPAAYTKAVPFLDYLARVNAAGSHQLLKELAAMGDAWATTTPAEDAAGGG
                     GEHPELTEQVVVDCLAMDLLLNKSDALGCIVVPWLRARLESMMATHSADRMNSSARKH
                     RDRGKAVAANTLRRTGESEAEGLGEGDAAANNSVLCAIIGLGPVAFTLLPTLLQLLIG
                     LPPPSPTSMCDVRLVGLAIRTAGGADGLEAVIRIVQQQAEGPHVLAAAAYALGTYSFE
                     LVGHTSVLCVPAGAMRRPDAKGGADLLFQLVPDDLSATTADLLSASPMMEELRPLFGR
                     DSLLFSPTATTAAPTGRHLLYLQSPPPYQPTHVLVDAELARCELLAYLRSDQFRVTDA
                     HPYVMALLNDALSARLLSAVVTPAAQSLYSATMSRLRRDLHRVLAEGVGSTAPHQRDN
                     DDGSDVDETGAAAHALLRLPLLPYSLDRFFAEEKDLLFALESALVHALLARFATPLVQ
                     EQALMSLSTLPPVARVHVVQPVVDFFMRSARTLQLRQATTMRRSVAQAGRTDPPATSR
                     APRNGAREVDADDNVTVAAAIAAGTVCVNPLAPSSCVDSCVASLVPVFQELLHSPLWR
                     VRHAACVGLARVGPLTADPSSIVDFLLTCLVLHAPSVTEESTSNQAPSAAATRSPELP
                     LQSSTVVWCLAQQRQGGARALLQLLQDPQQPSQVHHWCAFQLAEVDVREACANLNRGE
                     SPEADALLDEMVQVLGRLIATQGALEEDALLLCVRALAEVVHRHYVNATSPASTAAAM
                     NAVLFLDTAEPSQEAATLCQEEEEEPNACYIVLTSVLESALLPTNVLKALCLYLCRYG
                     GGHGELYACKALLQSSSVAVRTAAAFGLRACGAKVLRSVVLGMNDDSFDVRRESFETL
                     TVIGAAAALEVLHRRPVEHRYQVQTALRDCLLQDASRPVPRKVAETLYRALVSEEPLV
                     AQELS"
     gene            <989482..>992511
                     /locus_tag="LMJF_28_2550"
                     /db_xref="GeneID:5653469"
     mRNA            <989482..>992511
                     /locus_tag="LMJF_28_2550"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684488.1"
                     /db_xref="GeneID:5653469"
     CDS             989482..992511
                     /locus_tag="LMJF_28_2550"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684540.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653469"
                     /db_xref="InterPro:IPR002893"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q4Q808"
                     /translation="MAAKTVRALHLEGNKLFEAGRFSEAARAFRDSVDRFQADRLSTQ
                     SAVAEFVKVAGNLCVCHHATGNWHECVKTARELLAIYPIIPKAYAAIGMCIVNRLLEQ
                     EAEQRAMDAQNSPRMPPRSSEEVRRDARRYLVKLGGVVCTADDAHKYLCRAILLSEGA
                     LQVSLGPYVETAVRWVSEQLLSAGLSLEREYGDGVMGELSVLEESVSDAPPLLDVAPV
                     PIERHSIRVLDAADMSGTGAGGIAPEGCRVEELPEAEAEGILQAIQEGQRAARGESAD
                     SPSPAAESDAAGTSTATDHSGSVFSNSSSRGSHAAEAPPLDYFLSQQRTRVRVCHAER
                     GGIPRGLTLARASKPFAVGQHILPAPPADLSAVAGAGGPSPAARLALPSSTQGELVPL
                     HVDLATSASAEGAFALHAVSSSLAQIGSGDALSMRGLPTSESPPLLMCSACGRELNPV
                     QFADGPPTGCSKCNGVVYCSTACAVAYQGRHDRHECALRLALQRRVEVLTAVPPSTDP
                     ETPLPVGDVLPGGGWNALDLHCRILPLCIAVYSGLRSSAPGAAEVQAQVQRGVQRRLR
                     HALPAEVAETLAGWVKTLESALAAPVSTTGTVSSALPSQDEEVSKQCGDQQCGHLTDA
                     ATPTSCAAAGEKPSLADHLLAIFFIVRLLTVNHAESRCSAFYVERLLLRHSCEPNCVW
                     SDTLRGILTARFICKGEEMTMAVDDCFPQHWPWQVRQKWFVHHHGVPCQCARCLREGA
                     DLHHSRGMLANAVVEQLVTADVMGHPCPTPAHKHPTHLFHLPVQRLVEQSKSPRQRNA
                     PALLCRLDEMRAEVGKYVLPSHYLLEDIRRAMLNVAEAEGHLTGCTVEAQSSLLFWES
                     QWAGAIPAKVQRLRLLPNIFECGRRRKLHPHQQLHRRRNTRQPAASASAPAEQPQDTS
                     PERRESVSPPSPVPTPMEVPHGNSGTALLAVHACCPAGAGYGDHEANKAEVASAAATA
                     AAPPRTPVPAPLIATKDFSSGRSIIDLFYGSYQTWYM"
     gene            <993269..>993700
                     /locus_tag="LMJF_28_2555"
                     /db_xref="GeneID:5653470"
     mRNA            <993269..>993700
                     /locus_tag="LMJF_28_2555"
                     /product="putative 40S ribosomal protein S17"
                     /transcript_id="XM_001684489.1"
                     /db_xref="GeneID:5653470"
     CDS             993269..993700
                     /locus_tag="LMJF_28_2555"
                     /codon_start=1
                     /product="putative 40S ribosomal protein S17"
                     /protein_id="XP_001684541.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2555"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2555"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653470"
                     /db_xref="GOA:Q4Q806"
                     /db_xref="InterPro:IPR001210"
                     /db_xref="UniProtKB/TrEMBL:Q4Q806"
                     /translation="MGKIRTKTVKRASRQVVEKYYSKLNFDFYQNKRVIMDVTIAESK
                     KLKNKIAGYTTHIMKRLARGPVRGISLKLQEEERERRMDHAPATSDVDKVIQSGVSVD
                     KKTMQMLQRLEIGVPRRVKRADAAVTKVKAAPRRRQQKSSK"
     gene            <994835..>995266
                     /locus_tag="LMJF_28_2560"
                     /db_xref="GeneID:5653471"
     mRNA            <994835..>995266
                     /locus_tag="LMJF_28_2560"
                     /product="putative 40S ribosomal protein S17"
                     /transcript_id="XM_001684490.1"
                     /db_xref="GeneID:5653471"
     CDS             994835..995266
                     /locus_tag="LMJF_28_2560"
                     /codon_start=1
                     /product="putative 40S ribosomal protein S17"
                     /protein_id="XP_001684542.1"
                     /db_xref="GeneID:5653471"
                     /db_xref="GOA:Q4Q806"
                     /db_xref="InterPro:IPR001210"
                     /db_xref="UniProtKB/TrEMBL:Q4Q806"
                     /translation="MGKIRTKTVKRASRQVVEKYYSKLNFDFYQNKRVIMDVTIAESK
                     KLKNKIAGYTTHIMKRLARGPVRGISLKLQEEERERRMDHAPATSDVDKVIQSGVSVD
                     KKTMQMLQRLEIGVPRRVKRADAAVTKVKAAPRRRQQKSSK"
     gene            <996230..>997024
                     /locus_tag="LMJF_28_2565"
                     /db_xref="GeneID:5653472"
     mRNA            <996230..>997024
                     /locus_tag="LMJF_28_2565"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684491.1"
                     /db_xref="GeneID:5653472"
     CDS             996230..997024
                     /locus_tag="LMJF_28_2565"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684543.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2565"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2565"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653472"
                     /db_xref="UniProtKB/TrEMBL:Q4Q805"
                     /translation="MLRFGSRCTGSSPSVYFTLPTAVLLSASAARALCPSAAMHDDQL
                     RFFRRYTRVFPATAYARHTPRVGCSVATDARSATCTSLSSVASRTSCVRILALLCSKE
                     PSHATSADTTPEKCSALPTSAQSIAVSHKRTRGECADSRDASAPEQTSTASPEPRRGG
                     EVKRVRSDTDGSSAPAESSGTPTTLASSAAVKQEAKARTTVTNVAEGKAAAADSCDTT
                     EPTLTASLYVRVQYDKALITTLPIEVMRVQHPQVLIDYLLSMSVWA"
     gene            <997983..>1001063
                     /locus_tag="LMJF_28_2570"
                     /db_xref="GeneID:5653473"
     mRNA            <997983..>1001063
                     /locus_tag="LMJF_28_2570"
                     /product="putative splicing factor 3B subunit 1"
                     /transcript_id="XM_001684492.1"
                     /db_xref="GeneID:5653473"
     CDS             997983..1001063
                     /locus_tag="LMJF_28_2570"
                     /codon_start=1
                     /product="putative splicing factor 3B subunit 1"
                     /protein_id="XP_001684544.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653473"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR015016"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q804"
                     /translation="MGSSGVAAGGSTPLFASGSTPRMGGVTPMFTGATPAAGATFGAT
                     PNYQYEGGTPLQSHFASSVETQSITTAAIEAKAKALEKEWNRKNKRLTSEYLDSILPR
                     EFFTVAAVPADYNPLPSEEPNFYEIAVRSMDVFSMQAGAAAAVTTGLDANGQPIRYDI
                     PEDMGDGMPAMKVEDAAVFVELLKYHKAEKIPDEHLPSYLLMKNLFKIKNGDTMQRRA
                     GTRYLLDKATIFGSHFIFQRLSYIWSSDILNIEEKHYFIDFIKSLLQQMGKGARQFTK
                     EVIHLVEPLLTAHERILRDDGKQVLTLLTRVVGFQAVFAVIREDFGHAESIVRRHTAR
                     VMAVVGYAAGTEEVTAALRDMSYAPSALARQTVVRSMAELAKMVGHALIAALPEMVAM
                     LERLLRDEKRVQRDAALAVAAIAEATAPDGIEELAPLVDVICEECMKGIGSMASPFIQ
                     AFGALVPLMSPYDAQARTAAMMPNLVNQFSTPEDEFRRVLISVVRKCVLAEGVTPQFI
                     RQTILEPFFEGFWRVRRLAAERQTSGSLVATTVEIAKKLGSVDVLVKLSPDMKDESEE
                     YQRMVLTAIKKVVDATGMDAAPDTLVTFVLDGAIAAVRQDELGTSKLVMNVLATICNA
                     LAARLRPYLKQVFDLIKRRRENREASMRAQTADLVSRIARTVMLADGAVFLQDLGLSL
                     YERLEDPDARALSANLRAVRSILGELGSRRFKPSVRELLKRLTFVIKSRNSHVQNSAI
                     ALIEDIATNYDTDVDAIHLHQLATRGLFELLDSPQRATRHACARTFGVIAKKIRPFAI
                     ILELVDNFRQDKRQIRICTAVALSAIAKECGPFTIIPYLLNEYKISEGKQVAVIVQHS
                     VLKAIRYIFEAIGSIGKEYVYPMIPLLERALTETNIQMRRMAVEACRAILLSVAGNDG
                     FEDIALHLLNFVHPNIVELLAKNEVKIGEERLKMVTAVVSYYEAARLVIEPGKLLQYL
                     LQGLFHPARKVRDIYRRTYNLIYVGSPERLVPYYPRIENDASHTYVRHELEVLL"
     gene            <1002695..>1005352
                     /locus_tag="LMJF_28_2580"
                     /db_xref="GeneID:5653474"
     mRNA            <1002695..>1005352
                     /locus_tag="LMJF_28_2580"
                     /product="putative leucine-rich repeat protein"
                     /transcript_id="XM_001684493.1"
                     /db_xref="GeneID:5653474"
     CDS             1002695..1005352
                     /locus_tag="LMJF_28_2580"
                     /codon_start=1
                     /product="putative leucine-rich repeat protein"
                     /protein_id="XP_001684545.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653474"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:Q4Q803"
                     /translation="MLTPIHGVLDLSFAPGKDQELSDLPFERSMLQELAPEEVRELNV
                     THAQMLSLTSTPGALINDVLRYVTVLRAAHNHVSSLHGIEAFSSLEVLDLSHNCLRVV
                     DAHGASLLRTLKQLRTVDFSYNNMNLLDLNVSLGAPSSRLSGLRAGATPAFSTSGPGG
                     GSGRLSFSVADPSDGLLSLTAINLSHNAFLDLPDLRSAPYLQVLNMSHNKLDALAELD
                     TRLPLLWLHSLALHSNQLRTATVLLPLCALAATLKHLQVFCNPFTLVQSGPKTTIRNT
                     TNSGRANLPGGALDESMWWRPFLLWLCPLLVTVDQAEFTASERRVAAIMLFRENGSLS
                     KSRMEYMNPQRKDDLEAYLRRNSEFATPPHDAMAIIDNIERQEESLQEYSGVAWEGDA
                     EGAGQVVVPTSHMNPSGIRGAATAPRPANGILSRSPNTYPDPAPLEVVGPTLPGATSM
                     AQFSRGAGGAARRSSSGARVVVVAPEALFTVSSSSSGVLNTNRNRQRAHPASMTSFVR
                     ALQRKLRSIEEVVAVLWHADLSRRTRAAIVIQRVMRGALARMHLSEEDAESCRFIRYQ
                     LQQATAASAAQAAHIASGAAAQVSGSGAGGNVSGRAATRGVNQRHPSLEPVEDTGSNM
                     QEVLVSMRSLQEVMSNMWADLEEYRAMADREQRRAAVLIQRYYRGYRARCEYGRALKH
                     RRSFVPPPSSCAAGCRCASEATSLRKEVSELRSEVRELRALLQQTTRQQRLAAYDNPE
                     RAMDEIIRKHEQRSNADILAEPTHRLRSNGSSRSPSDMPSLIEREVGGSASEKAADDI
                     DQDRHQPMADNGDDDGTAGTLETNDGQLSGSAALPHRRPATMSQSPEQASLFDSMSSK
                     QPASMQTTRITKLRPNSGSIVNARQIGKE"
     gene            <1006542..>1007795
                     /locus_tag="LMJF_28_2590"
                     /db_xref="GeneID:5653475"
     mRNA            <1006542..>1007795
                     /locus_tag="LMJF_28_2590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684494.1"
                     /db_xref="GeneID:5653475"
     CDS             1006542..1007795
                     /locus_tag="LMJF_28_2590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684546.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653475"
                     /db_xref="InterPro:IPR005502"
                     /db_xref="UniProtKB/TrEMBL:Q4Q802"
                     /translation="MVATLSHTSPPVVENFYQNSFKQLSMVQQKQVGLLVGVAVADAA
                     ARPLNDHSQEQVEAYLRSKCEETGGTALTPTAVTETEISFLAFARVSPREIKARSSLA
                     HGSEDRSSAASSSLLESSYAPLLVHSFTYQLYFEMLRAMSSARGKFAVDYVQERLVRA
                     AAAVDVQQTFAAEHASLLHTLCTLLPTPAIYPYASDAALRSYLDPFTAFLTESPMSLQ
                     VTDADGGQGDGVSPAEAAAAEQAAVRDYTVSALGVVLRQLQSSPDATRNAAFMAVPGT
                     AAVFPLDVQPFVPCKADTSAEPRARLCPVPQHQATRATSMGSSAMAGSRWLPQRCTAT
                     DAATVCEGLSIAQAPVTFAQGVAQAIRLGGPTCQRAMLVGALLGAKLGVRHIPMEWLS
                     ATADHKPVSTMALEVAQWSWNPPPH"
     gene            <1009159..>1014423
                     /locus_tag="LMJF_28_2610"
                     /db_xref="GeneID:5653476"
     mRNA            <1009159..>1014423
                     /locus_tag="LMJF_28_2610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684495.1"
                     /db_xref="GeneID:5653476"
     CDS             1009159..1014423
                     /locus_tag="LMJF_28_2610"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684547.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653476"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="UniProtKB/TrEMBL:Q4Q801"
                     /translation="MFTETQPKEVVLVDAHHASASSEKVAGIGCVAATAVRQVEASGL
                     KKGRPGGGALPPIHAKAASTSETAAAPHLRKQRPLSGRQEPQQGPDSDGQACPVALLA
                     IGDLPGRPPSAAFSVTATLRRDDDLRSSRSAAPRRPPSAGRSPARHRSMQASPLPQAR
                     QHSANLTDANAISARAGSIGRMEGRHLSGQAPRRTGLKSLKLRVESEEAAVGQLMQAG
                     NIGGALVRLSCTLQRVQDYQAASSTRSSRRGAVSSTASARTSQVAPQLGGTGATWAAA
                     TAQRLAEVYTSIANNAGVQCNTAAEPIHVQEAYFQAAMRYLVKSSTEDLFSEWTAEGA
                     AATSEKRLPHPPPQQRPRRYPVRSAVRPPARELPSCFPSSRPSKSKDGDQQQPQQPAI
                     VRRLLRCAVRTNAAVCLGDSATPGGQARIIYELLKALAESVGVWSMALLYNLAVSFLR
                     VGSYDDAAEAIARFMEVSWYYLEWAEHLQSTEDGGSVASVAAAVHTHAALQLIRGHHF
                     IAAMAAWCEPQGPMEVYHCELASACAEHYLSRSDRAQRRCQRRLAAAQARATTGASAT
                     EAHTVAAADGPPSPLMLPYVTQDLILSCPSFTREAVTGDVGSITVMMHLLVEALVASS
                     SLSASLPAEVRAYVREVQKGESMRYWARMALRAGASPPFLSAAVAASTATPVPPVLTA
                     LLSHCEEGECVWARQSWLQSLARRDAEDDASSPLWPLTSAAIPARASRASAAASSSPC
                     RDVAPGKVADASTSLITTAPPTPHHEHGVSLGATSPCKPSKPAPLFVTTLPKSAYSRY
                     RRLREGIVAQLENAEQTAQREADVFEAAGPLSVGGDDADAVRAESANSRSTATSTILP
                     ADAAAAPSRRQRVTALLVGASSTVTSPAASLSREGHGGDATGLFGLLEEEATEHHDLR
                     SVATTIVLDPTLLAVPVRPSELLRQLDLETEARYSRLVADPLADLQRVASTRVQAWWR
                     MQLAREALRRRAADVEMYLRRDAAASLIQTGYRHWKERAPAKAELHRLRAHRERVRCV
                     TILQAFVQQRASVEVWGRACLAWYQALVVQREIERRRAAATITLQSWWRMHMARRQLR
                     DSVAAAIRLQCLWRCKLARCELRTRRVHRRLMQEQWRRERVPQIIFVQRWWRACCARW
                     AVGDLLCQRQRAVEEYLTAQESEYEAVMRTKLRSVDNVEAAMRCVLAVLAGSRDRRQL
                     TQIAMHARVRQRVVHRFVLLWRGREELQQLRRGRAAALALQRRREEVAVATVTLQSWV
                     RSWLPHRRAIRECADRAYLQAHAFKIWDAFRHHRARQALVNGRTERRMLGVARRLADA
                     RNDAATRIQSTWRMYRTQRELFDLFQFMLRDRHRYATAVQRRWRGHYARAVLAPQREA
                     CATEREAGLQHRAVLHCAATRVQSLYRMYRVRIQLLRLGVLLRPTSMFRIAAARRIQT
                     CWRACAAHRRVLRLRLQRSYALKLAQSQEALHAYATLIQGVARSYLVRCGRVPQPKPA
                     PEAPAPVAAVTKLCILRPPPIHRACAAAASRSTPLHRVPSTEHNIGTVPVPPLLTRAP
                     VTVEETVAMPIYSSHGAPAVVRIHQCNFDGRSSAQSLISADPLSLRTTSMTKSRCNSA
                     SLSRLTSTSDKPLNLLQSVSTDVVGSLRSTRLPPSCPHERAAVDSHRVVGLSCETEHL
                     PASTDSIAQTSTYSAAAKAVPQTTTGLPVAQSSIGCSLLCHHTPQQVEAAVRIQAVWR
                     GYHVRCTIEFYYEECSEEIEEEETKEDS"
     gene            <1015514..>1018111
                     /locus_tag="LMJF_28_2620"
                     /db_xref="GeneID:5653477"
     mRNA            <1015514..>1018111
                     /locus_tag="LMJF_28_2620"
                     /product="putative coatomer gamma subunit"
                     /transcript_id="XM_001684496.1"
                     /db_xref="GeneID:5653477"
     CDS             1015514..1018111
                     /locus_tag="LMJF_28_2620"
                     /codon_start=1
                     /product="putative coatomer gamma subunit"
                     /protein_id="XP_001684548.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653477"
                     /db_xref="GOA:Q4Q800"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR009028"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013040"
                     /db_xref="InterPro:IPR013041"
                     /db_xref="InterPro:IPR015873"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017106"
                     /db_xref="UniProtKB/TrEMBL:Q4Q800"
                     /translation="MVDAVSRYDDDEEDDALPFEGLDKASALQECRVFNKIPLDEEGS
                     IRAMTQVLYLLSIGVRLTEAEATDIFFMSTKLMQSNYAKLRRLQYILMKELSPLVEQS
                     FIASNALMTDIKKKGDSDKSSAIRALYAIMDSSMYNSMDRTIVECMTSRNPSVVTAAL
                     VTGIHMSNTLPEMPRKWATQLNEVLRERSKAQYPAIALLHKIRNNDRLSVDRLIEDAQ
                     AGRVRSSLAVCIIIKMCTELMQDDFTSSLEIYKFVTSMLHRSDMIAFEAAKSIASLRN
                     VSDRELTPVVTMLQLYLSSQNQVLRFAAVYLIGRISTTHPAAVAPINAEIEALALDPN
                     RVIATLAITSLLKTGTESTIGRMLTQLSSGSYMSELGDQLKLTIVDAMRVLNAKFPSK
                     YETLLAFLFRALSDEGSSSLKQSVVDAMLDISNSNPSSKEVVLTHLAEFIDDCEFSQI
                     TKRVLMHLGEGVPHCSNPRHFVRYVYNHATLEKPEVRAVAVATLAKIAASVPSLRRSI
                     VALLKRSCSDGDDEVRDRAVLYTKLFLQNDDTLVRTYVENVAAAVQHQRHTLREAHKK
                     TSADGVLGGSTSADTMVAIAAAPNHTDASGMPAPTPAILQGRDALHHVRQLRELGEPA
                     KSTEPVLITEADNEYVVSVMKHVYPEHVVVQFKVKNMMDNMLFKNVIVVTNTEELEAE
                     PLYAIPIESIRPGETQYGYVVLQYAPGKFPSGTVEPMFRFAMAEREDEDAGDHDEYPM
                     ESFDVDVCDFVTPIDLGNSMEDKWAEQEGNETAGTFALHSMKNLTEAAQQLADFFGMH
                     IEGGVPEKITTTSHVVKMSGVLADEDRTLVLVQAKVFIATDNHVALHLALRGGSADIR
                     EYLANVLLR"
     gene            <1020499..>1021824
                     /locus_tag="LMJF_28_2630"
                     /db_xref="GeneID:5653478"
     mRNA            <1020499..>1021824
                     /locus_tag="LMJF_28_2630"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684497.1"
                     /db_xref="GeneID:5653478"
     CDS             1020499..1021824
                     /locus_tag="LMJF_28_2630"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684549.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653478"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7Z9"
                     /translation="MPSSLAAAAPLGAATATLCGVAVDAPPSHATLMPTSSSSWLAAD
                     PCRRLGSSGDDVECIPTYETLLGAIRGARMPQEPPPLEGVRSCSRSSNSSDAGHSNLF
                     PPWTGGGGGRQSLLEPTRGGAGFQTEALTPPAPSAKRRFRDGETEDGGSPAGPGSSWP
                     QAKRQRGEEATVGSLAGALLAPPMQEGGMRDPGGADSIRGGGDVDVRPTLHTFSSGDD
                     GDPWSARGGVCGFLTPLSTKLLCLPPVAFTPLPPSQHLHARACRPASLLDREHAVPAW
                     QVLASAPTTAEEEQREGLGRVASTSSNTTLYTPARGNVHLRSAVDDAIVYSPLTLDDV
                     SPILCLSEERLAHRRMRMVECDRRPSAEVDDEEHWANEAFAATLPSTSPHPSRALTPA
                     ESRGDEEDMSGIALDLPSQYPAGSARFLHEEALRLLTVTCEDEHGHLLQ"
     gene            <1023869..>1026157
                     /locus_tag="LMJF_28_2640"
                     /db_xref="GeneID:5653479"
     mRNA            <1023869..>1026157
                     /locus_tag="LMJF_28_2640"
                     /product="putative molybdenum cofactor biosynthesis
                     protein"
                     /transcript_id="XM_001684498.1"
                     /db_xref="GeneID:5653479"
     CDS             1023869..1026157
                     /locus_tag="LMJF_28_2640"
                     /codon_start=1
                     /product="putative molybdenum cofactor biosynthesis
                     protein"
                     /protein_id="XP_001684550.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653479"
                     /db_xref="GOA:Q4Q7Z8"
                     /db_xref="InterPro:IPR002820"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7Z8"
                     /translation="MKHLLTPATPPPSAAFGGRGPAIPSVSIVEEYYTSKKGPLFATA
                     VVAGTNAVKQVSSLVPFCYPTPIQRCSFTFRRRQVLQPPRSAQMPHRVVLRRRTSEPG
                     PQQSRPEYSVLYCFCTVATENRGGVEMEALTGAMMASVTLYDMLKGLPGAQEDGLSLG
                     EAFVLAKRGGRNDFTKLLMSEPERPLVESGLRSGGAEIHALSPISGAVNGGGVQPPTG
                     ATHASPSAATATGTSRAATLDANGHASANAEQARVEGQEASEEVAEEEDYHSAAKRVI
                     RRPAPATATAHDVVDGSAAPGDADAWWRSSKHEKRLQELYPRRKYGDNARLVPPSPAP
                     MTPVSPVTRARTRTGPSASSDSGAEVVAGTAAVLAARPKLASKASMIRDRQASSAGKG
                     PASTAALPKVARRPEPTGSIHEADEADEEDDMVEHRRSSNRSRLAKKSARAAASAVEA
                     DDEDNGKPAAAAAEEEEEADEEAATTTSTAVDEVDEEEGTAMTAAAKKRRHSTAVTAA
                     PKSHAATITAKSLVSGKRTQTGHKRYLAEVEDEAAAAEEDEDATEDNEGADAEARMPV
                     KGSAAAATRKAHAHGGATGRRTGKDAIERPSRSFGASGRKQRAGRVTPRKGRASAEPD
                     DYHDDEDMSAPEERDDGIEEDDTAAGDENDNAVSAAAERRRGKAAVKQIRPAAPKRGG
                     TLRPVRHDSWDVGFSQRSRHDAGDGDGDEGHEDAVEEEEAEAAETIDEDGEGDEAEDV
                     TPPPPPRKKLKKPLKRAAPKRR"
     gene            <1027319..>1028965
                     /locus_tag="LMJF_28_2650"
                     /db_xref="GeneID:5653480"
     mRNA            <1027319..>1028965
                     /locus_tag="LMJF_28_2650"
                     /product="putative membrane-bound acid phosphatase"
                     /transcript_id="XM_001684499.1"
                     /db_xref="GeneID:5653480"
     CDS             1027319..1028965
                     /locus_tag="LMJF_28_2650"
                     /codon_start=1
                     /product="putative membrane-bound acid phosphatase"
                     /protein_id="XP_001684551.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653480"
                     /db_xref="GOA:Q4Q7Z7"
                     /db_xref="InterPro:IPR000560"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7Z7"
                     /translation="MSFVVRSLLPHSMRQMCVLVAVTALLAVAHLPTPSRGSVEWVLQ
                     QVQVLHRHGSRSAIPTHNTTAICGSTPCGFLNPQGEIMMRNVGSFLRTRYNTDATVVD
                     EPFLPSLDYNLTVVESHSTDVQRTLQSAHMFLAGMFPNESRLIPAIHTVPTSQDTMLN
                     TFSQPWVALYVTYAGAAQSARMNPTIDRYFPDWTELRDLGAALWSEGYCSNFTTRLNC
                     VIMVYDIATAKLAVGELPVAVAARYDDLHEIIAECYRGLWYYDPSNSFSVQQGGRGQP
                     FLQQVVRNIDDFVAGRNTYKVMHYSGHDISLGAVWGTLGDKGVHAMQPPYAQTLVLEL
                     VKSASSGEHGVRVLRGWPGQTSETGFTFSWDPTWQLQCQRSNGTNYAATDNLCPLEDF
                     RRYVAWTVGTDPRGMCLLDEETSALLDCPTAEEEQTVSVALPESCLLYRSACPAYACA
                     PGYVLSALGSQCKCTSASCLDLGSHGSNNLVNLTVKMSGVSGGAVAGISVATFCLGAL
                     FAVAVSLIVLALMSRGGDCAPHFGHRDKSVVPDQRLRPDL"
     gene            <1031652..>1032092
                     /locus_tag="LMJF_28_2660"
                     /db_xref="GeneID:5653481"
     mRNA            <1031652..>1032092
                     /locus_tag="LMJF_28_2660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684500.1"
                     /db_xref="GeneID:5653481"
     CDS             1031652..1032092
                     /locus_tag="LMJF_28_2660"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684552.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653481"
                     /db_xref="GOA:Q4Q7Z6"
                     /db_xref="InterPro:IPR002579"
                     /db_xref="InterPro:IPR011057"
                     /db_xref="InterPro:IPR028427"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7Z6"
                     /translation="MTTPLTNCAGPQEKDGSKDMSDEEWRRILTAQEYHILREKGTDP
                     VGGKYDDVFDEGEYVCAGCKTPLYLSSMKFACGCGWPGFYDCIPKRVREQPDRDGRRV
                     EIVCNVCNSHLGHVFRGEGFRNPPPNERHCVNSTSIIFRPTQQS"
     gene            <1033529..>1034452
                     /locus_tag="LMJF_28_2670"
                     /db_xref="GeneID:5653482"
     mRNA            <1033529..>1034452
                     /locus_tag="LMJF_28_2670"
                     /product="putative protein phosphatase 4 catalytic
                     subunit"
                     /transcript_id="XM_001684501.1"
                     /db_xref="GeneID:5653482"
     CDS             1033529..1034452
                     /locus_tag="LMJF_28_2670"
                     /EC_number="3.1.3.16"
                     /codon_start=1
                     /product="putative protein phosphatase 4 catalytic
                     subunit"
                     /protein_id="XP_001684553.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653482"
                     /db_xref="GOA:Q4Q7Z5"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7Z5"
                     /translation="MSSDLNQQLEAMYEGKLLTEEQVVQLCSRCKDLMLEEGNIETIY
                     APVTLCGDIHGQFSDLLELFSKGGRVPETSYVFMGDYVDRGYHSVETLLLLLLLKARY
                     PDRITLLRGNHESRQITQVYGFYDECYRKYGCANVWRLCTELFDYMPLGAVVEEDIFC
                     VHGGLSPQIGTLDEVRVLDRKQEVPHEGPMSDLLWSDPEDIEGWSVSQRGAGFVFGGD
                     VAKSFNHRNGLSLIARAHQLVLEGYKSMFDSNCCTVWSAPNYCYRCGNVASILEVGEH
                     SKTDRNVVYFTAATADVRGHLAKQPPPEYFL"
     gene            <1035405..>1036652
                     /locus_tag="LMJF_28_2680"
                     /db_xref="GeneID:5653483"
     mRNA            <1035405..>1036652
                     /locus_tag="LMJF_28_2680"
                     /product="cytochrome oxidase assembly protein-like
                     protein"
                     /transcript_id="XM_001684502.1"
                     /db_xref="GeneID:5653483"
     CDS             1035405..1036652
                     /locus_tag="LMJF_28_2680"
                     /EC_number="1.9.3.1"
                     /codon_start=1
                     /product="cytochrome oxidase assembly protein-like
                     protein"
                     /protein_id="XP_001684554.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653483"
                     /db_xref="GOA:Q4Q7Z4"
                     /db_xref="InterPro:IPR003780"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7Z4"
                     /translation="MQRFTARYVVSAAASASARRLPSRFGMYWAQRCPSRFAATKFHL
                     SAADETAAAAKPWVAPPHNRSVAHWLYISAACVGAVVWLGGVTRLTESGLSLVEWKPI
                     SGVRPPLTDEEWDKEFRHYQEFPEFKQKPNMTLREFQFIFFWEWAHRVLARGLGLVFG
                     GPLLYYAGRGYFKGNGKFLAGLVGILGLGAAQGFMGWYMVTSGLDNKLLEERKKATVS
                     AYRLAAHLILAFTIYSFMLRMGYGLKLPVMAPFPRMAKVQLWLRMSFAMMFVTAISGA
                     FVAGLDAGLLYNDDFPWMAGGVFPPADHLFALEPTWRNFFENHSMVQTTHRVMAGATF
                     LTITGLNVAASRRRGFIPPPVFRNLMFVNTALLFQVSLGMWTVMSTVYVPVAVSHQMG
                     ALILLTTLIRMCAVVGSRGVVLA"
     gene            <1037246..>1038358
                     /locus_tag="LMJF_28_2690"
                     /db_xref="GeneID:5653484"
     mRNA            <1037246..>1038358
                     /locus_tag="LMJF_28_2690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684503.1"
                     /db_xref="GeneID:5653484"
     CDS             1037246..1038358
                     /locus_tag="LMJF_28_2690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684555.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653484"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7Z3"
                     /translation="MARRHRPLFYTVLASVIALLVVHGGAPAAALFGSAPCPATVEAA
                     LEWCNGLFGGAGGIVTVGAWSEHFFACVCNGVAPLVISRHTDSPGGSEQQSSSSLPEW
                     DSSRAWSTQLSPSMAISSSSAPSKHTCRWDGFFSSYPDGEQCLPSTGVCPTNCTVMPP
                     FLCDSQQASRCTISDNGTLLYTCLTCTGRLFTINKTGPDTCPRTYTGALCDPRTECSG
                     HGCCAMHNVEPSSSSATGGVCNCFANRSHGYYAGENCAACAPGYYVDSEGVCKTRVQP
                     VQILLASIGKTWTMVSPNVSVLFLFVIFSMVRKLNTSDRPFELTGLRRANLSSVQVAR
                     RRQQSLFHSKYIPMRPAKSRSFTNPHQPRTRGPPAY"
     gene            complement(<1039014..>1040405)
                     /locus_tag="LMJF_28_2700"
                     /db_xref="GeneID:5653485"
     mRNA            complement(<1039014..>1040405)
                     /locus_tag="LMJF_28_2700"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684504.1"
                     /db_xref="GeneID:5653485"
     CDS             complement(1039014..1040405)
                     /locus_tag="LMJF_28_2700"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684556.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653485"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7Z2"
                     /translation="MSAMVLSIGIPPQERVRLCAVAAADVCQRAVAHMKAAAQCEAHD
                     AAAEPYIRAVYVHRADSVAPERVAVASGSECGSYLRETLRATVAGIGAPSVACWLTVM
                     LKDTCILQHAVFAISPNSKEPLKMMSPVLAQFDGAALSAGARRWSLLSAHAPGRSTSD
                     GNVYTPRNEQPAARVITPAPAAEAGPPLSATRRRSLGTVPCSHSARTSSKTMAAAVQQ
                     PQSHAQLAPPPETQRRQQQPPRNVYEQLEKYQTDTPRERASSSRRSSRAAPPPDEDAA
                     TPHLSQNTDAAAPRLGGPGRKASTSSHPSSSVRSRQQSAVDHSTGVYSASNTSDAAAL
                     ARPDSQQPPSGAQPQPGSHPPLSGVSAERPVCRPSAVSSTSAAENFGRPQAPPPNADD
                     PTCGCPRTDLAVPSDRQQWGDWAFRTGYSPRREELWEIADAVMTHNYYDQIIENVGEP
                     PCDGRVSSRRNKF"
     gene            complement(<1040954..>1041814)
                     /locus_tag="LMJF_28_2710"
                     /db_xref="GeneID:5653486"
     mRNA            complement(<1040954..>1041814)
                     /locus_tag="LMJF_28_2710"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684505.1"
                     /db_xref="GeneID:5653486"
     CDS             complement(1040954..1041814)
                     /locus_tag="LMJF_28_2710"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684557.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653486"
                     /db_xref="InterPro:IPR027450"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7Z1"
                     /translation="MRFVFRRLLPASTAAVAAPPSLLSMRGAPSFVHPPAEEAIGKDV
                     RATPANWVTAYVLPEVITEQEEKTLLDFSEPWFERLSYNDGHMDGLIHHYKEFYRSYA
                     AITQAAETGSDAGLNMPHANLEVDLPLVSEALARAHDLAQTYLPCIPIDDRVHFLRLA
                     GSGFIRAHVDESRNSTGIVAGLCLNAGRVMTLTHPAYPGERVELMLAPRCLYILIGRA
                     RYDWAHSVDWVGDDDEHIRRIQKSLAVEGTPIRFDGAETPYRRSDRTAIIFRGVSPMT
                     LLVRRMRQRG"
     gene            complement(<1042539..>1042907)
                     /locus_tag="LMJF_28_2720"
                     /db_xref="GeneID:5653487"
     mRNA            complement(<1042539..>1042907)
                     /locus_tag="LMJF_28_2720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684506.1"
                     /db_xref="GeneID:5653487"
     CDS             complement(1042539..1042907)
                     /locus_tag="LMJF_28_2720"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684558.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653487"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7Z0"
                     /translation="MNTTTEKVTINFNTSRFGVKVADGSFDPDTTIGEVHARLRKKLV
                     KAKAMAVPVASGGSEGSAAIGNSTVTSGSGATFIFVRNGTEAFIPAPEQTLQTLLDMY
                     ATAPEARRLYVTIDPEVFSG"
     gene            complement(<1043560..>1045371)
                     /locus_tag="LMJF_28_2730"
                     /db_xref="GeneID:5653488"
     mRNA            complement(<1043560..>1045371)
                     /locus_tag="LMJF_28_2730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684507.1"
                     /db_xref="GeneID:5653488"
     CDS             complement(1043560..1045371)
                     /locus_tag="LMJF_28_2730"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684559.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653488"
                     /db_xref="InterPro:IPR003774"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7Y9"
                     /translation="MLTRSRLLRVATTSTKPTTKDIAKRPATATSVPAVSPAVVRSLY
                     RSLYREVSRLDKEPVLKVLFPCNNELQAVLGVSGPLHVPGCQRYTDVLRNVFRDATRV
                     AKISLAFDTLNRLRAHYDNVRGKLPTMDKDRARLLASLRSSAVAERRKSFFRAQPIRP
                     TPGAGPRYVQAAPGVPTRVVLREARHSLDLSEGTLLLAHPLSSAHVDRRVMMITECTP
                     ILTSALVLDLQFTYPLSRGNSMFPEVFWGHDVYDGGFSQIGFTMPPTAQIAVLHTLES
                     RDTVAGRSASPLGESSVMSWLKWKGPPSTSGAGVSHAASTSAASCSPEAAQKHELFCR
                     PLICGGVLDDGAREPTLYLSKAEALPYLAELVEGQPRSSLRVYWGNMRWTTSQLEAEV
                     ANGHWMAVKTSPSFFRAYALSATSDDAVERFPTAAQLAEAKQLREKRYGADITPPQVF
                     PPDQIMRRRECLWDQIMFALGGEYAALVGCSNPFSDSPRWSSLQILAPHMSPLPLSTE
                     AAETAAAAEAGVVAAADEAMASEVVLDEDADEGDDHDGEDELDETVFVPGSPNILERH
                     TTDAETEREGDRDEAPSASLPATKSSGNHKDGDDGAS"
     gene            complement(<1046693..>1047631)
                     /gene="LACK1"
                     /locus_tag="LMJF_28_2740"
                     /db_xref="GeneID:5653489"
     mRNA            complement(<1046693..>1047631)
                     /gene="LACK1"
                     /locus_tag="LMJF_28_2740"
                     /product="activated protein kinase c receptor (LACK)"
                     /transcript_id="XM_001684508.1"
                     /db_xref="GeneID:5653489"
     CDS             complement(1046693..1047631)
                     /gene="LACK1"
                     /locus_tag="LMJF_28_2740"
                     /codon_start=1
                     /product="activated protein kinase c receptor (LACK)"
                     /protein_id="XP_001684560.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2740"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653489"
                     /db_xref="GOA:Q4Q7Y7"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7Y7"
                     /translation="MNYEGHLKGHRGWVTSLACPQQAGSYIKVVSTSRDGTAISWKAN
                     PDRHSVDSDYGLPNHRLEGHTGFVSCVSLAHATDYALTASWDRSIRMWDLRNGQCQRK
                     FLKHTKDVLAVAFSPDDRLIVSAGRDNVIRVWNVAGECMHEFLRDGHEDWVSSICFSP
                     SLEHPIVVSGSWDNTIKVWNVNGGKCERTLKGHSNYVSTVTVSPDGSLCASGGKDGAA
                     LLWDLSTGEQLFKINVESPINQIAFSPNRFWMCVATERSLSVYDLESKAVIAELTPDG
                     AKPSECISIAWSADGNTLYSGHKDNLIRVWSISDAE"
     gene            complement(<1050749..>1051687)
                     /gene="LACK2"
                     /locus_tag="LMJF_28_2750"
                     /db_xref="GeneID:5653490"
     mRNA            complement(<1050749..>1051687)
                     /gene="LACK2"
                     /locus_tag="LMJF_28_2750"
                     /product="activated protein kinase c receptor (LACK)"
                     /transcript_id="XM_001684509.1"
                     /db_xref="GeneID:5653490"
     CDS             complement(1050749..1051687)
                     /gene="LACK2"
                     /locus_tag="LMJF_28_2750"
                     /codon_start=1
                     /product="activated protein kinase c receptor (LACK)"
                     /protein_id="XP_001684561.1"
                     /db_xref="GeneID:5653490"
                     /db_xref="GOA:Q4Q7Y7"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7Y7"
                     /translation="MNYEGHLKGHRGWVTSLACPQQAGSYIKVVSTSRDGTAISWKAN
                     PDRHSVDSDYGLPNHRLEGHTGFVSCVSLAHATDYALTASWDRSIRMWDLRNGQCQRK
                     FLKHTKDVLAVAFSPDDRLIVSAGRDNVIRVWNVAGECMHEFLRDGHEDWVSSICFSP
                     SLEHPIVVSGSWDNTIKVWNVNGGKCERTLKGHSNYVSTVTVSPDGSLCASGGKDGAA
                     LLWDLSTGEQLFKINVESPINQIAFSPNRFWMCVATERSLSVYDLESKAVIAELTPDG
                     AKPSECISIAWSADGNTLYSGHKDNLIRVWSISDAE"
     gene            complement(<1052384..>1054168)
                     /locus_tag="LMJF_28_2760"
                     /db_xref="GeneID:5653491"
     mRNA            complement(<1052384..>1054168)
                     /locus_tag="LMJF_28_2760"
                     /product="putative gamma-tubulin complex subunit"
                     /transcript_id="XM_001684510.1"
                     /db_xref="GeneID:5653491"
     CDS             complement(1052384..1054168)
                     /locus_tag="LMJF_28_2760"
                     /codon_start=1
                     /product="putative gamma-tubulin complex subunit"
                     /protein_id="XP_001684562.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653491"
                     /db_xref="GOA:Q4Q7Y6"
                     /db_xref="InterPro:IPR007259"
                     /db_xref="InterPro:IPR015697"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7Y6"
                     /translation="MWMGVNHTQYFTYDPSADVYRLAPDTGGAMQQQAAEVFQECGVL
                     ARHIDVALRQPSATGDSFLQQSLRSALRRQLTQYHYLVSMLRERRSPPLHMGDLVVAY
                     KRVHPKLWVMDCVLRETQHVKGGELASRMQQLVQHGSHRLASLLHDIYIETVSPLLHM
                     TVESITKGDVCDPMREFYIVPMDGIDDAAENFWVAKYVLNTEMLPRTVPENVAQDILL
                     VTKNIRFICRCCRAKQWRMDPSLVAEAERATFDTLPAVVHRALVFTNTAVLRLIREEF
                     QLHEVLRLVNAFLLVGYGDFYELLITKLEPVLSKMSSAVSVSVVRDQVQSALAEITPC
                     ARHLDTDRFALLHCELVKDEAKLGWDAFVMTMPLPPPLNNVFDHGAMKVYRRLFRLMF
                     RVKVAEVALKKAWRQNVVLDRLISSVQRTMQERSAWREVAADAHLLGLQLNHFVNNLW
                     SYLVAEVCTVAQDLLLKAVEQCASMDDIRTAHNTYLAYLTQRSLLHTDCATIRMNVEN
                     ILTIVREYCGSQALLASLLQRGSGDLSTVKRQYQGLTDDFHREMSSLLTTLEEQHVHF
                     DFLNFLLLRLNFNRFYHDTSDTAYNTEF"
     gene            complement(<1056925..>1058901)
                     /locus_tag="LMJF_28_2770"
                     /db_xref="GeneID:5653492"
     mRNA            complement(<1056925..>1058901)
                     /locus_tag="LMJF_28_2770"
                     /product="putative heat-shock protein hsp70"
                     /transcript_id="XM_001684511.1"
                     /db_xref="GeneID:5653492"
     CDS             complement(1056925..1058901)
                     /locus_tag="LMJF_28_2770"
                     /codon_start=1
                     /product="putative heat-shock protein hsp70"
                     /protein_id="XP_001684563.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2770"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653492"
                     /db_xref="GOA:Q4Q7Y4"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7Y4"
                     /translation="MTFDGAIGIDLGTTYSCVGVWQNERVDIIANDQGNRTTPSYVAF
                     TDSERLIGDAAKNQVAMNPHNTVFDAKRLIGRKFNDSVVQSDMKHWPFKVTTKGDDKP
                     VISVQYRGEEKTFTPEEISSMVLLKMKETAEAYLGKQVKKAVVTVPAYFNDSQRQATK
                     DAGTIAGLEVLRIINEPTAAAIAYGLDKGDDGKERNVLIFDLGGGTFDVTLLTIDGGI
                     FEVKATNGDTHLGGEDFDNRLVTFFTEEFKRKNKGKNLASSHRALRRLRTACERAKRT
                     LSSATQATIEIDALFENIDFQATITRARFEELCGDLFRSTIQPVERVLQDAKMDKRSV
                     HDVVLVGGSTRIPKVQSLVSDFFGGKELNKSINPDEAVAYGAAVQAFILTGGKSKQTE
                     GLLLLDVTPLTLGIETAGGVMTALIKRNTTIPTKKSQIFSTYADNQPGVHIQVFEGER
                     AMTKDCHLLGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSAEEKGTGKRNQITITN
                     DKGRLSKDEIERMVNDAMKYEEDDKAQRDRVEAKNGLENYAYSMKNTLSDSNVSGKLD
                     DSDKATLNKEIDAALEWLSSNQEATKEEYEHRQKELESVCNPIMTKMYQSMGGAAGGM
                     PGGMPGGMPDMSGMSGGAGPAGGASSGPKVEEVD"
     gene            complement(<1060574..>1062550)
                     /locus_tag="LMJF_28_2780"
                     /db_xref="GeneID:5653493"
     mRNA            complement(<1060574..>1062550)
                     /locus_tag="LMJF_28_2780"
                     /product="putative heat-shock protein hsp70"
                     /transcript_id="XM_001684512.1"
                     /db_xref="GeneID:5653493"
     CDS             complement(1060574..1062550)
                     /locus_tag="LMJF_28_2780"
                     /codon_start=1
                     /product="putative heat-shock protein hsp70"
                     /protein_id="XP_001684564.1"
                     /db_xref="GeneID:5653493"
                     /db_xref="GOA:Q4Q7Y4"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7Y4"
                     /translation="MTFDGAIGIDLGTTYSCVGVWQNERVDIIANDQGNRTTPSYVAF
                     TDSERLIGDAAKNQVAMNPHNTVFDAKRLIGRKFNDSVVQSDMKHWPFKVTTKGDDKP
                     VISVQYRGEEKTFTPEEISSMVLLKMKETAEAYLGKQVKKAVVTVPAYFNDSQRQATK
                     DAGTIAGLEVLRIINEPTAAAIAYGLDKGDDGKERNVLIFDLGGGTFDVTLLTIDGGI
                     FEVKATNGDTHLGGEDFDNRLVTFFTEEFKRKNKGKNLASSHRALRRLRTACERAKRT
                     LSSATQATIEIDALFENIDFQATITRARFEELCGDLFRSTIQPVERVLQDAKMDKRSV
                     HDVVLVGGSTRIPKVQSLVSDFFGGKELNKSINPDEAVAYGAAVQAFILTGGKSKQTE
                     GLLLLDVTPLTLGIETAGGVMTALIKRNTTIPTKKSQIFSTYADNQPGVHIQVFEGER
                     AMTKDCHLLGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSAEEKGTGKRNQITITN
                     DKGRLSKDEIERMVNDAMKYEEDDKAQRDRVEAKNGLENYAYSMKNTLSDSNVSGKLD
                     DSDKATLNKEIDAALEWLSSNQEATKEEYEHRQKELESVCNPIMTKMYQSMGGAAGGM
                     PGGMPGGMPDMSGMSGGAGPAGGASSGPKVEEVD"
     gene            complement(<1064631..>1064831)
                     /locus_tag="LMJF_28_2790"
                     /db_xref="GeneID:5653494"
     mRNA            complement(<1064631..>1064831)
                     /locus_tag="LMJF_28_2790"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684513.1"
                     /db_xref="GeneID:5653494"
     CDS             complement(1064631..1064831)
                     /locus_tag="LMJF_28_2790"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684565.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653494"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7Y3"
                     /translation="MPRTDESAVARNAVQEITSPLQELEAKYEAVLAENEDLSHQLRL
                     EQLQRQRYEKAYRRVQEDVQSD"
     gene            complement(<1065641..>1067137)
                     /locus_tag="LMJF_28_2800"
                     /db_xref="GeneID:5653495"
     mRNA            complement(<1065641..>1067137)
                     /locus_tag="LMJF_28_2800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684514.1"
                     /db_xref="GeneID:5653495"
     CDS             complement(1065641..1067137)
                     /locus_tag="LMJF_28_2800"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684566.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653495"
                     /db_xref="InterPro:IPR001466"
                     /db_xref="InterPro:IPR012338"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7Y2"
                     /translation="MSDAPDAAAARPRLRIDFPPVKDNEELVKKQRAAVAQDEIRDDM
                     EKDIPPVIRSVLELSHLTMSGHSQWLRAAPGYQGGLFHKGKPFCFASGYRDTSRPLDA
                     EDKGNHMKLKDPLVYGTLSLPITAAYICELHGKGIFDLETPLIQYLPELQGKLSEDVT
                     ARSVLSFIHGIDDAHLLKDAGARWHRPCFSPSLCAETHARVYEPVNRFLAGGTTPATA
                     LTGQQQRANLVQYVRSSPRITRNFTRSLHRAYISHTSVALLLAAVETQLKGHSFESDI
                     RTVFFEPAQSHGTGYGAPTLWKDPNELFYQPTGQALQHETFKRPVAIADPRNCSPAVW
                     NGSLNLYAPVEDYGKLLLLSLDTIMDARELLGKPSNASGRPYYDFGVQYVPSKDHLQL
                     TKSVLYGIDALPAVASFRYSCEHDLGCFGVASCGSRGARFFVNNLSRIIQHLFVKHVL
                     AKGLDPEKPVNLDDPAQKGKETEETLQRMMKQQKFTSYFTKYEAHRRY"
     gene            complement(<1067936..>1068562)
                     /locus_tag="LMJF_28_2810"
                     /db_xref="GeneID:5653496"
     mRNA            complement(<1067936..>1068562)
                     /locus_tag="LMJF_28_2810"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684515.1"
                     /db_xref="GeneID:5653496"
     CDS             complement(1067936..1068562)
                     /locus_tag="LMJF_28_2810"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684567.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653496"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7Y1"
                     /translation="MPPPPRDRYHSVHGLPSRPGQHRQQQQNAKKDVPRHAGKKMSAA
                     TGPSATGPSASAVAAASTAREEALREALAKALSHGGVEGGATSTSENSVDTYGCGSPT
                     DRLQFGYSPSVAAEAVAFHTRFTKDAWVTARKRNGRLVFVKKQKLGITNCEPITSILK
                     LQNHWKQMNAFQSDVQGGAVRKLKAEDLDMLVDMLASKQRIGDDEDEA"
     gene            complement(<1069350..>1071338)
                     /locus_tag="LMJF_28_2820"
                     /db_xref="GeneID:5653497"
     mRNA            complement(<1069350..>1071338)
                     /locus_tag="LMJF_28_2820"
                     /product="putative heat shock protein 70"
                     /transcript_id="XM_001684516.1"
                     /db_xref="GeneID:5653497"
     CDS             complement(1069350..1071338)
                     /locus_tag="LMJF_28_2820"
                     /codon_start=1
                     /product="putative heat shock protein 70"
                     /protein_id="XP_001684568.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653497"
                     /db_xref="GOA:Q4Q7Y0"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7Y0"
                     /translation="MSFTEEFDGAIGIDLGTTYSCTAVFVRGQAEVIPNDMGNRTTPS
                     CVAFYNDDVLVGDAAKTLLGRGVSGVVFDAKRMIGHHFSDKSIQEDRARWPFPISEGV
                     KDSIQINVTHKGEELQLAPEQISAKVLTYLKECAERYLGKQVKKAVVTVPAYFNDAQR
                     ERTKAAATIAGLEVLRIINEPTAAALCYGLGIGSGTGQQQGEDQPRNVVVFDFGGGTF
                     DVSVIVIDSGSFAVQATAGDTHLGGQDIDSNLLKYVLDDLQSRYNLRIAEQPRLLAKA
                     RTACERVKRVLSQSTAEELALDGVLPSGEEYTLSVSRAKLEELNASVFAQCMKVVQRA
                     LQDAAMKVEDVHEVVLVGGSSRIPKLNDMLRVFFNKARLCHSVHPDEAVAIGAAVQAS
                     ILTNSLEQQSEKTANVVLMDVVPLSIGVEIDDGKFDVIVPRNTTIPYKVTKEYSTVED
                     YQHDVDVCVYEGERPLTKHNHKLGEFTLEGITRAKKGKPTITVTFSIDANGLLTVTGT
                     EELANKRHTLVVQNTDRLSEAQVKEMIDMAKKFAKSDAVDDAREAARRMVQGALEALF
                     AAIAAMPRPPPSQLQKRLDAFTSHTRDWLERQLPSYSTVAEVEEKATKIAKLARKAMK
                     KVEKKVRGGEPASKRHRDEGNGGNESSSDSDVENEAGK"
     gene            complement(<1072400..>1075237)
                     /locus_tag="LMJF_28_2830"
                     /db_xref="GeneID:5653498"
     mRNA            complement(<1072400..>1075237)
                     /locus_tag="LMJF_28_2830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684517.1"
                     /db_xref="GeneID:5653498"
     CDS             complement(1072400..1075237)
                     /locus_tag="LMJF_28_2830"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684569.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653498"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7X9"
                     /translation="MCIPTAPSAHTPGKAVPASTQRFGGSNTAAVFQAKLQRALWLDQ
                     LTTIAHNEARARAKTRCNEAEERDALWWQHQRERQRQQHIEDKVFRLEALHEAQAAPV
                     WDVLSHRWADLVMREEASDRRAVEAVAQDGLRMLYAAPHTWQLQEAVRELEWQQRDAE
                     AVQHAAKHVRTLELKLAARSYRAVPAFEPAVDDLFNLAEGIHMPASAPPAPKVVPPSP
                     SLPVNHEPPCEAKIREIYDRRALVYDEAKERLLLDWWQGAAQLRYVEALSAWQSFALW
                     SYYVRSPVCMRALVTVQQWWRMQRVAPWSRHRRAALKTSLGKLRGHYYAERCRQHLRS
                     LQRTLSREKDGDTSAADDISAALVALAAAATSSRRYRTQMDLYTYTVVQKARAALASR
                     PIQDAAVAAMMQVSLRPMYTCDRYPLPYDSWRHCRWALYSEAHRLAAAAVERAETSHR
                     QCVEAEEAKYRHHAAVFRAILHRGPLAVLDLRAGQVALAQEERRSQLRIAHQETYEYN
                     VLRATVAAELPSLSQADPPLHRCKAVNREVKREAQTTAAAMSIYVAAHSLGGHGTTES
                     SDTAAASSSTEQGAWAQVLRCAQLAHEVLASTQEQSAQAHPERSGASTDTETAAALSE
                     DAVSLYCAAFDEAATAVYHDQYTSVRERYVARNAEALEQMRESFKAGLRERAIIIAEE
                     AQELEHICHCDTSARHINCFRLERSESDRRAALERAQGRVAAGLYEALSDSLHVSRWA
                     AGARERDEEAHLAAARVRLHLSLPLPSLSPAERLLSREAVCRTRLMCDCAAALADVLV
                     QSSRSYHERSYQDWTALCGRDGAALDSAASSHLPLGQMCILKANEWDGRRCIWREAQA
                     GARTLLVDGHALYGANTAWSDYLFGHLKLTSEASYMDAQLREYLLMRVANVKLKVGEL
                     IQMETMARGRVEYAEAITRDLRFHLQRLRVE"
     gene            complement(<1075917..>1077392)
                     /locus_tag="LMJF_28_2840"
                     /db_xref="GeneID:5653499"
     mRNA            complement(<1075917..>1077392)
                     /locus_tag="LMJF_28_2840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684518.1"
                     /db_xref="GeneID:5653499"
     CDS             complement(1075917..1077392)
                     /locus_tag="LMJF_28_2840"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684570.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653499"
                     /db_xref="GOA:Q4Q7X8"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7X8"
                     /translation="MASAFSPSLAPRSSACDCCECGVVVGTEGSQRGGLLLPCQHVLH
                     MGCVEFIRRRGKVLMGMDSTDLPLDEEEGSRVSGGGADKIGVALSSRGSSAWASRTHG
                     CCVCPACFTQITRIIPLYLRSTNDDVGADSTVTVPTPSHVTTGASATAEAEYRRVHAA
                     QKQVLHRLRSLCDQRRRVTELTHACANLHEQRARCLAEVEREERCFPGLTHSGGLVDG
                     EARVESSSAVVSSTAASPALEHMGMTELELYMAQATPQLLRTQAELRKERQMVERRTK
                     RLNALRVHYRSMRERRARDEVIAQREAHARRNTADAARHSTPVPSETLRRAPLHASEG
                     APRIQEPGVCSSSGVASGPGAAAAPSRKRHRGDAAIDVDDEVSPDVVEVLSGDGSDAD
                     DSGSPTDVTVLDVDENTGSDASDKDGSMGLDVAPMADDGTYADESAYEAPYLVPCYVR
                     PATTSSSSSVGSKAPTPAVTQHHLRLLPRREDRLWQPSLQF"
     gene            complement(<1078225..>1079544)
                     /locus_tag="LMJF_28_2850"
                     /db_xref="GeneID:5653500"
     mRNA            complement(<1078225..>1079544)
                     /locus_tag="LMJF_28_2850"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684519.1"
                     /db_xref="GeneID:5653500"
     CDS             complement(1078225..1079544)
                     /locus_tag="LMJF_28_2850"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684571.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653500"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7X7"
                     /translation="MSASPLVTLTGSAAGRRKSCVTRFASFDALCRAQQRPDTHALLR
                     KELEAKLPRPSPRNDVVAVGDAAIELVLQFLGPVSRDSAAFAQTCRSVRRALFHVMDL
                     EVVVVTPAMVVASALSRETVRRALITFAAARSAQVRTLVLHEDGLDAVKCERDDGTPA
                     AGLTLPAPWLLQLISQLPYLTELDVRHVRFIEAHHSQALHYLLSDLHLAAAGTLCTLK
                     MDAELMRYWAPGWWRRLINLSSLVVGSRYCPPELTSDTTASVISPSSLELPSDYFTLM
                     CEEGRGWKLNLWVPLQAASLKRILMPASGISYAGVAELLVNMRCNERTCEWSDAVGGH
                     TLPLPSPAAATASGTASELSPETRNSGASCKAGTGATAGIESGEVCIYPALTTMTVVD
                     VQERPEVAAEVYQAMLDMAPALVHFNVCDTVSVGTASEAPKKRRGKG"
     gene            complement(<1081619..>1082593)
                     /gene="cMDH"
                     /locus_tag="LMJF_28_2860"
                     /db_xref="GeneID:5653501"
     mRNA            complement(<1081619..>1082593)
                     /gene="cMDH"
                     /locus_tag="LMJF_28_2860"
                     /product="cytosolic malate dehydrogenase"
                     /transcript_id="XM_001684520.1"
                     /db_xref="GeneID:5653501"
     CDS             complement(1081619..1082593)
                     /gene="cMDH"
                     /locus_tag="LMJF_28_2860"
                     /EC_number="1.1.1.37"
                     /codon_start=1
                     /product="cytosolic malate dehydrogenase"
                     /protein_id="XP_001684572.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653501"
                     /db_xref="GOA:Q4Q7X6"
                     /db_xref="InterPro:IPR001236"
                     /db_xref="InterPro:IPR001252"
                     /db_xref="InterPro:IPR001557"
                     /db_xref="InterPro:IPR010945"
                     /db_xref="InterPro:IPR015955"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR022383"
                     /db_xref="PDB:4H7P"
                     /db_xref="PDB:4I1I"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7X6"
                     /translation="MSAVKVAVTGAAGQIGYALVPLIARGALLGPTTPVELRLLDIEP
                     ALKALAGVEAELEDCAFPLLDKVVVTADPRVAFDGVAIAIMCGAFPRKAGMERKDLLE
                     MNARIFKEQGEAIAAVAASDCRVVVVGNPANTNALILLKSAQGKLNPRHVTAMTRLDH
                     NRALSLLARKAGVPVSQVRNVIIWGNHSSTQVPDTDSAVIGTTPAREAIKDDALDDDF
                     VQVVRGRGAEIIQLRGLSSAMSAAKAAVDHVHDWIHGTPEGVYVSMGVYSDENPYGVP
                     SGLIFSFPCTCHAGEWTVVSGKLNGDLGKQRLASTIAELQEERAQAGL"
     gene            complement(<1083439..>1084191)
                     /locus_tag="LMJF_28_2870"
                     /db_xref="GeneID:5653502"
     mRNA            complement(<1083439..>1084191)
                     /locus_tag="LMJF_28_2870"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684521.1"
                     /db_xref="GeneID:5653502"
     CDS             complement(1083439..1084191)
                     /locus_tag="LMJF_28_2870"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684573.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653502"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7X5"
                     /translation="MAQTVDQVLLEWLEAAPRVPRRERQTLLLKELMFLHALQGIRLS
                     TGESGKEETEQRSWNDNHTRAAAKVSAALRRAFLDTVDTDAARRLAESLSVSTDVDML
                     YGALDTHCIMLLHVAGDGPRRPARKLRGVEDIINELSEFQESVLLLRVDLTSSAQSPP
                     ATASPPTLVGGVSQVKSWVEQCTAELEIGTQVTYYADAECSHAFFDVRSVFVFSADGA
                     KVERISRELLPRGGHDLNDVLRSIRFGGFCVG"
     gene            complement(<1085494..>1098171)
                     /locus_tag="LMJF_28_2880"
                     /db_xref="GeneID:5653503"
     mRNA            complement(<1085494..>1098171)
                     /locus_tag="LMJF_28_2880"
                     /product="putative dynein heavy chain"
                     /transcript_id="XM_001684522.1"
                     /db_xref="GeneID:5653503"
     CDS             complement(1085494..1098171)
                     /locus_tag="LMJF_28_2880"
                     /codon_start=1
                     /product="putative dynein heavy chain"
                     /protein_id="XP_001684574.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653503"
                     /db_xref="GOA:Q4Q7X4"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004273"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="InterPro:IPR013602"
                     /db_xref="InterPro:IPR024317"
                     /db_xref="InterPro:IPR024743"
                     /db_xref="InterPro:IPR026983"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7X4"
                     /translation="MYSQKRRGSAELKASASSVTLTASTMPLAKRTKLEVTQRNPIHI
                     SKDVADACGTVNPLSARLYSDGISSGAQVGVPNRLTQCQSPAVSFVPHPPAELAATTF
                     AKTDPAASARPRGETHMVNSLHVFNPPSHTDAELKEVFAASAKSISSRLPRGTAAAAP
                     PAKLAPLTSERVSAGGGNTGAAATALFDPEQGKSTAEATAMRALATIPRFHKSTSNSP
                     NEFVYLMMRPRGIRDPLNPYDLQPMARTEAQGRNYYTVSAAGVTHFTEGGAEFIELPK
                     WERECRIFHAIRELLVFREYKRWRNFVLWRSLVRRSATANTRQFLAAHLFAAHPSLSG
                     ALQAVRNICLETAASEDLYQSSTETSTLDVYTTTLQTHLQEERRRLENMIKRIRDHVE
                     QACKTTMFTWQLERERQKLLYEDADQQKRKVLDVRELGMQEQPSYIELTQRKTMCRRL
                     TAFIKLCDYLIVECLTGLAAKAVSHVRRDLEMSNTVPASAPAAATEKTRRGGGAAAAA
                     TTSAFTGPLWNVDVVYNADQQAIELVPSAVQIREAIEDMLQDYVRAVGVIPRLTSLNT
                     FLIYTSNAQDELGNDTVGAGPDVADMVMAEESYKQDVAAIHTSLASSFAKMHRYAHTF
                     EVFKEMYISNSQLREEALLESNETLHYFREQLATYKAQTDSISSNIPNFEDIGMMRMW
                     TEGLRDFFTPSPVTCLDIFHKALPVIARRRNETLLKELQEHTTYLAAAPKTIEHYVEY
                     LDYCNALENSFDGIASSYDVVRELFNLLQEEKIDVNEEDDETYRSGTRPQFDKLRTLL
                     QITEDSKEAQQRFFSRSIEEEMDQLRRRIESVYDRAGQSIVMSGEADVAEANAYMKAL
                     LEEAEGIAAREKKLREFQIEIGAEETVVEVMAEMLHDVSIKAKLWAGIGDWNTFTEET
                     HVLPFDQLDVATVQEVVQKYSSLVKQVSSKLASNAVVPRLKSSVEEWRQLLPILQALT
                     NPSLKSEHHAKISLIVGPVADASGSTSKTLSEWANQFTIGMLLQHEILKYRDEILVVS
                     ASATEEDKLQRQIDRVNAMWNGGGPKPPAEFQFHAHKDSKDVFTLVGASVEDVTTLLD
                     DSTVAISTIGSSKHCQGVLRSQVDRWENRLKYMSETLERWVELQRNWIYLENIFSSVE
                     IRSQWKDDAQRFEKVDRFYRDLMRKAHDLPTAYRSLLINPPSFDTAATGSGRTLKHDL
                     ETYIKELEKVLISMEKKLEEKRRAFPRFYFLSNDDLLDLLAKAKTPELMMPHMLKMFD
                     GIKSLTLSAQNDITHMNSMEGEQVELDHQGIKARGPVEVWMDLLEREMFSALRCRAQR
                     CLEDYEARQDRTDWMFQHPVQLVLIVEQLLWTRSVEEALDKIDSPQLMLRMRDKQRRN
                     LEVLAELTARNLSKVQRVLLSTIITIDVHGRDLVEEMCDSGVAESLEFGWTKQLRVYW
                     EKGADGNGTVFIRQNNSRFVYGYEYLGAQGRLVITPLTDRIYMTVTGALKLHLGASPA
                     GPAGTGKTETVKDLAKNLARQCIVYNCSDGVTYKMMEKFFSGLIQTGAWACLDEFNRI
                     NIEVLSVIASQLLEIKLALQNAQETFTFQGTPDVRVRPTYGAFVTMNPGYAGRTELPD
                     NLKILFRPVAVMTPDFRMIAEVILYSEGFKNAHDLSLKITQLYKLSSEQLSPQDHYDF
                     GMRALKSILVMAGDLKRSQPDVEEDLTLIVACNDSNVPKFVAEDIPLFRGIMQDLFPG
                     VSFPEREYQELLPAMQRIMAERKLVDVGQWMKKGIQFYETLIVRHGVMLVGVTGTGKT
                     EARQCIAGALTNLAVAGSANKMARPVIEFVLNPKSVLLHELYGQLDVNTNEWKDGVLA
                     AIAKECVRASEVSSDHRWMVFDGPVDTLWIESLNSVLDDSKLLCLDSGERIKLPDTIH
                     MLFEVADLAVASPATVSRCGMVYVDAEDLPWNAVACQWSETKLAAAGAQPQCRAYILS
                     LFDAYVEKGLTWLRQLPASASLISAGDINVVQSLCDLFTALMHVNKVQLMADPVGEAP
                     PPSDDPMFRERNEICNAIFAFSFVWSIGGNVDHAAMESFDTMVRTLLESVARFPNYGS
                     VYDYAINFSTRLLVPWESLVPEFTYNPATPYFNILVPTVDTVRYSTIAQTLLQCKKPI
                     LFNGQTGVGKTFIMADCLQRNKESLQLSLVTFQFSAQTSSERTQELIEAKLKPKRKNL
                     LGAAPGKSVVLFIDDLNMPAVEVFGASPPIELLRQLMGQRGFYDRKLAGMWKTVQDVT
                     VVSACGPPEGGRNPITPRLTRLFHLLQVATLTDDSMKRIFGSILRGFIEAKNFAREVK
                     DMVPSLVMATVDVFNAIRDALRPRPTTPHYTFNLRDLSKVFQGMTQVIPRVCRDTATF
                     VRLWIHEVMRCFYDRLATVEDRRYFVEGVLAEAASRVFPGAAESLLASPALWADFTRF
                     GSVEKVYEEVPEAQRLAQVLEEYQDDYNATEATAKPDDASGGTTTVQASQLGLVFFKD
                     HCEHIARIIRILRQPRGNVLLVGVGGSGKRSLTRLASFIGGCRIFETSVGKGYSMNDF
                     HEFLLEVYTYAGVKNEPCVMLLSDNQIVDEAMLEDVNNILNSGEVPSLFNAEEREKRV
                     NACIEAAQQHGITSREDIYNFFINRVRDNMHVALCMSPVGDKFRTRCRQFPSLTNCCS
                     VDWFDEWPREALEGVARRMLQDMAGAVPASFHEKLPQLCVDVHAATTEMAQQYYDELR
                     RRYYITPTSYLEFIETYKALLQSRRSRVEAQLAQVENGTEKMRETEETITKMKVEIEE
                     KRPQLEKASEETQAVVADLKVRQAKAAEVQVQVRAQQESATVQQHDASQIAADANARL
                     AEAKPIIDKAKAALDTIQASDLNELRSFANPPSAVLKTTQACMTMFDAKDFNGAWSGN
                     TDWKGAREFLSHRSLLDMIRGYPTDNVKPAILQKVQKYINDPEFTVEVCSSKGSQTCG
                     SLCAWVHAVNEYSKVVKEVAPMRQAAAEAEQHLAATNAKLHAAQQQLKEVEKELSDLE
                     QRYQSSVAKKNDLEKGLQLCIIRLRNAETLSGSLRSEGARWTENIKLLRAQLAALPLQ
                     VFMASASVAYFGAFTPAFRQRLIAQWTAQLAERGCEVGDFSLTAVLGDPVDTLNWQVN
                     GLPSDETSTENAIVAMLSTAPRRWPLFIDPQEQAVKWLLRQFQQTQAVSGSGAVASKN
                     RNMLRVVKLTDPTWMRTLELQIRLGGVVIIDDVGESLDPALEPLIARRVFTADSGGLQ
                     IQLTPQSGPIDYHPNFRMFLCSKLPNPVYLPDISTRVTLLNFTVTMEGLSEQMLGEVV
                     SIEQRSMEEEKNSIIQRIAQGQRRLKAIEESILERLQSTKGNILDDEDLIRELQSAQS
                     SAEVISRSQAEASEKMLTISTARERYRSVAVRAALLFFVLADVGRMDPMYQYSLQYFV
                     KLVQHEVEGTTKPPGYTEADPAMLEDHLHAAVSNLTRATYTQICRGLFNKDKTILSLL
                     IATAIARHDGVIADEEWQYFVRATAFVASELPEQSPALASWMSRVQWELAEALSRTVP
                     TFRDLVASMESEPEVWREYAQSDVPHSATLPGDWQSRLQLFQRVLLIRCFREEKLSFA
                     LADYVRQTMGAEFIEMPPMDLTRTLKDSTAHTPIVFILSQGADPMEALQSLAKAEERE
                     LQCVSLGQGQSENAKRLIATCRKSGAWALLQNCHLSKTFMPELSAAVAGLQPDAAGAA
                     EIHKDFRLWLTSMPTDFFPVFVLQSSVKLTNEPPTGLRANMLRCFGELTPQEYETFGD
                     EAIGGKELKGRAFKKLLYGLCFFHSVVLERRKFGPLGWNVKYEWNDTDFHVSKQWLRL
                     FFEEQEAIPWESLEYIIGQINYGGRVTDPQDRGTLLTILRNYICPRILEEGHRFCEEG
                     QYIVPASGTLAEAQEHIQAMSLVDAPAIFGMHENANLRYQLQTSEYLLAKIVSIQPRL
                     TGSAGGSGATPEEEVRRKCQEFEATLPALLTREEAGPRTFTTLANGLPNSMSTVLAHE
                     LVKYNKLLDKIHQTLSDMQKALQGLTVLSADLDAMYSSFLADQVPQLWTTVSYASLKP
                     LGAWYRDLLARVQFIRSWLQKGEPAAFWIGGFFNPSAFMTGVYQAFARAEGVSVDKLG
                     FRYEVLGVEPEAIESGPVRGCFVYGIQTDAWRWDVERRVMADSLPGEPYAVLPPVHFL
                     PEPSHTKPADFHAVPLYRTTIRAGVISSLGASSNYVLSIEVPSVDGSDYWLLKGSACV
                     CALNQ"
     gene            complement(<1099905..>1101062)
                     /locus_tag="LMJF_28_2890"
                     /db_xref="GeneID:5653504"
     mRNA            complement(<1099905..>1101062)
                     /locus_tag="LMJF_28_2890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684523.1"
                     /db_xref="GeneID:5653504"
     CDS             complement(1099905..1101062)
                     /locus_tag="LMJF_28_2890"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684575.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653504"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7X3"
                     /translation="MSIVFDTISAKSPPCEGEGASSAESLAALMQQAYTQQYTEARNQ
                     YKASHARFTARVKRPPLSQLERYCTSVFQDLSLYTSAINAEEACAPSACTHGPRRIGI
                     HSVNHELRLRAQKRLRAAPAKPKRDADDVIALLVAQEAAEYADLLELEAKSFMGVARA
                     YYQTIFGPTNDLVWLEAQARRSFEDEYSRATMAFLAQLREEIWRAEQRLFLRALGMFP
                     DALPHVAQLRRIAAEFDALQQAKLSVLESREAVPLWQRVCIIRGETESEEDIIFRRIL
                     LACVVEAHGISEGYLRYDTVTGRLRHTYKEVPPFMRDVIDYSMQFEPFAAVLEEETQR
                     MRIVEEAEGACASLAAALASGDDAEGNVSSTPDTSNAPVAPSHADQPAAET"
     gene            complement(<1102802..>1104403)
                     /locus_tag="LMJF_28_2900"
                     /db_xref="GeneID:5653505"
     mRNA            complement(<1102802..>1104403)
                     /locus_tag="LMJF_28_2900"
                     /product="putative oligomeric golgi complex component 8"
                     /transcript_id="XM_001684524.1"
                     /db_xref="GeneID:5653505"
     CDS             complement(1102802..1104403)
                     /locus_tag="LMJF_28_2900"
                     /codon_start=1
                     /product="putative oligomeric golgi complex component 8"
                     /protein_id="XP_001684576.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653505"
                     /db_xref="GOA:Q4Q7X2"
                     /db_xref="InterPro:IPR007255"
                     /db_xref="InterPro:IPR016159"
                     /db_xref="InterPro:IPR016632"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7X2"
                     /translation="MTTSSAEEARVRQSIVNCAVDHYDLLTNAQAANVAAASLSSTAE
                     DTAKELTASLQTLHSWSQLLQYAGQSWRQEKTQLHSAVMSHQKIVALMESPALVEECV
                     RQTMFHEALLIFDHVMMLCQHMSDVYVFQRLQKEVVDTMEQAVNTHVLPMLSGGLTVD
                     TAYKAISLLRRLGGSPASLRALFLRSRAAYIRHLLQEAESSVVPYSLILKYITVYKMH
                     VNEVTLQYKACFPSSTEAQQRQATEELSLWCQEQAHMFMHLIAAALQHLHNGSELALV
                     VQQCRSCASASARVHTDVLGLLGSILVQKVHALFADGMRQARTTYRTAMQTSSWRVSV
                     YCRNNSTLASSTVIQAPQTISDTPAVQLAQWLPLAYALNGMLSSFNAIRKCLLPGFEA
                     PCGEEVRQLVCEVGQDMLNDAPLLDTMYSAERAVFMAFVKAFQRLWYPYVLHLVGRLL
                     GPAHREDLEDRTQALMYGIGELLFAVEPSSTVPAAESASSVAPAPAPAHPHASTTLAP
                     PTPDLTIAPVAAPSVQPAPTTSAPT"
     gene            complement(<1108085..>1109443)
                     /locus_tag="LMJF_28_2910"
                     /db_xref="GeneID:5653506"
     mRNA            complement(<1108085..>1109443)
                     /locus_tag="LMJF_28_2910"
                     /product="putative glutamate dehydrogenase"
                     /transcript_id="XM_001684525.1"
                     /db_xref="GeneID:5653506"
     CDS             complement(1108085..1109443)
                     /locus_tag="LMJF_28_2910"
                     /EC_number="1.4.1.4"
                     /codon_start=1
                     /product="putative glutamate dehydrogenase"
                     /protein_id="XP_001684577.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653506"
                     /db_xref="GOA:Q4Q7X1"
                     /db_xref="InterPro:IPR006095"
                     /db_xref="InterPro:IPR006096"
                     /db_xref="InterPro:IPR006097"
                     /db_xref="InterPro:IPR014362"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7X1"
                     /translation="MASGCLKYASVDDFIAKCILSRDPYQPEFTQAVREVMTSLWPFL
                     QKNPKYTQDGLLERIVEPERVIQFRVPWVDDKGVTHVNRAFRVQFNSAIGPYKGGMRF
                     HPSVNLSILKFLGFEQTFKNSLTTLPMGGGKGGADFDPKGKSDCEVMRFCQSLVAELY
                     RHIGADTDVPAGDIGVGSREVGYMNGMYWKLRNTNECTFTGKGLAFQGSAIRPEATGY
                     GLVYFVQSMLTHVNDSLEGKTVLVSGSGNVAQYAIEKCMELGAKVITASDSKGYIQDP
                     SGFDKVKLAKLMKLKNECRGTLEEYARETGVTYVPGKRPWCVKADIALPCATQNEIEG
                     ADAKTMLTNGVKLVAEGANMPTTEEATEIFQKAGVLFAPGKASNAGGVAISGLEMSQN
                     AARLVWDAEEVDSRLRSIMSSIHDSCVQYGEKDGKVSYVDGANIAGFVKVADAMLALG
                     IV"
     gene            complement(<1111764..>1112300)
                     /locus_tag="LMJF_28_2920"
                     /db_xref="GeneID:5653507"
     mRNA            complement(<1111764..>1112300)
                     /locus_tag="LMJF_28_2920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684526.1"
                     /db_xref="GeneID:5653507"
     CDS             complement(1111764..1112300)
                     /locus_tag="LMJF_28_2920"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684578.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653507"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7X0"
                     /translation="MESYETDASLEQLPKGVEFPELVLRCTVVAAIPLRICEFGDGKV
                     FTVVGSVAPCTPGACAAKTRLLRINFYNSWGAAAAFMDPGDVILLRGFCLLDVPPHAS
                     GGGAAKSASDPQPLFVRPLPSKSTLRVLQKGMKELVMEVAVSPENWDAIGMRSLPKSD
                     AENQRYARTCWGLEELSC"
     gene            complement(<1113441..>1115645)
                     /locus_tag="LMJF_28_2930"
                     /db_xref="GeneID:5653508"
     mRNA            complement(<1113441..>1115645)
                     /locus_tag="LMJF_28_2930"
                     /product="putative sodium/sulphate symporter"
                     /transcript_id="XM_001684527.1"
                     /db_xref="GeneID:5653508"
     CDS             complement(1113441..1115645)
                     /locus_tag="LMJF_28_2930"
                     /codon_start=1
                     /product="putative sodium/sulphate symporter"
                     /protein_id="XP_001684579.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653508"
                     /db_xref="GOA:Q4Q7W9"
                     /db_xref="InterPro:IPR001898"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7W9"
                     /translation="MKFGKRLQDEIVLEWADYYVSYKRLKQFIHNSELRGSEFSHELL
                     NIITEELAKAEGLFQQLMTDLQEEHDRLMKMHPDLPVAPVIKPRKFHRRKKGSSANDE
                     APNEETGFVSTATSSVCDPSVLDGEVVPRHQRTGLGALLKRLFLLLIGDSQVKEVESN
                     TPRALFLEWHSNAHQLQHFAELNLEAIRKSAKKLKKYRRMEDDCTAAIEAELARSRLV
                     TLMPRLRNLLLDVSVDFERKFKVPLDQYANVAMSQEWHARWRYIFVGAALFLVVKRLP
                     VLTEEPAAHNCLALFVLIITLWITEAIPFFCTAMLIPLFAVPLHIVMDPTKRESATAT
                     VASQIILGKLFNHVQILVMGGLTIAKAFSRTNLEMYAASMLHRWTAHRPSLYLLGVML
                     SSCLLCAFVSNVAAPLLVLGVVQRTLWEFPEGTNAPHGILLGLAFACNVGGMLSPIAS
                     PQNAVAISALSFYKVSFAQWVGVALPVVLFSVVAAWAVVLIVWRPFVDVPYIPLQVVN
                     TAAEEQVSSATRVVVLVVSAITITLWILPANLFFGDTGIVALIPIVVFFGIGILSKED
                     FNTLSWHLMFLLAGGNMLGLCARDSRLLDIIAMSMKSTLTDSPPYLTLLVVLVAMGVI
                     TTFVSHTVAAMILLPIIVKIGFLMPESTGVMAVTPQSMVMLSALMCSGAMAFPISSFP
                     NVNSLLAEDSKGKLYLRAKDFLFCGTVITLVFTACLVTWMVPLTNYVLPADH"
     gene            complement(<1116610..>1117038)
                     /locus_tag="LMJF_28_2940"
                     /db_xref="GeneID:5653509"
     mRNA            complement(<1116610..>1117038)
                     /locus_tag="LMJF_28_2940"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684528.1"
                     /db_xref="GeneID:5653509"
     CDS             complement(1116610..1117038)
                     /locus_tag="LMJF_28_2940"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684580.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653509"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7W8"
                     /translation="MDGVNDARLPPARAFRVLRRKRWFGKQVDERIELETLAVYVSND
                     FSGTAFYLEFPYTAAGMAGDGAASPECTSLLGPMEPTGAHGMMTLECEAGSFSCRLQW
                     LEATLKPPIILLSVARREAQTPVPAEQGLPKELLRDRVVR"
     gene            complement(<1121161..>1122174)
                     /locus_tag="LMJF_28_2950"
                     /db_xref="GeneID:5653510"
     mRNA            complement(<1121161..>1122174)
                     /locus_tag="LMJF_28_2950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684529.1"
                     /db_xref="GeneID:5653510"
     CDS             complement(1121161..1122174)
                     /locus_tag="LMJF_28_2950"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684581.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653510"
                     /db_xref="GOA:Q4Q7W7"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7W7"
                     /translation="MKEVMQRNRNRRRGPPEGRSVQNVLSTDGIPPGMFAVIDPLSKR
                     LFIPLESMLDTRAMHRKGVPSLCRVFLEGRCRQGTNCFQAHANVDLVLELRAKALAEP
                     TCCALHGAPSDTSGIDPALRLVVRNDDGETVGRAQLPQTLVTNGLRTLIAAQTSAAGM
                     QAPVDVVVPTSALCRLHSGADGSPCCRFEGECNFVHLCRQLMAHIDQQRAAIKVEKHL
                     TAPVLAIGRRPPETNHEELVTVLDKEFQGSASSPLQMRSQPASSVTVPMSVSANLGVT
                     PPIRFDPLALAATAPSSMPDNGVLLLGRSPLMSRSFSSTPSGLVWRHNPYNSSHASSV
                     IET"
     gene            complement(<1123909..>1125252)
                     /locus_tag="LMJF_28_2960"
                     /db_xref="GeneID:5653511"
     mRNA            complement(<1123909..>1125252)
                     /locus_tag="LMJF_28_2960"
                     /product="putative U5 snRNP-specific 40 kDa protein"
                     /transcript_id="XM_001684530.1"
                     /db_xref="GeneID:5653511"
     CDS             complement(1123909..1125252)
                     /locus_tag="LMJF_28_2960"
                     /codon_start=1
                     /product="putative U5 snRNP-specific 40 kDa protein"
                     /protein_id="XP_001684582.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653511"
                     /db_xref="GOA:Q4Q7W6"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7W6"
                     /translation="MCCLYPPFRPFPPRVVFPCRCSLLILSCSFLLVPLLFAVCRGNP
                     RRLCLTVGTSLAARATQVHFISSRPDAEGARLTYLGRTERRRKREADGGVWYCCFPFT
                     RCLSLPRPLLFSLSSSSILLFSQMALTVTSSSAPSGGAEAVYWNLHGHLEDVVCAAAH
                     GRVCATGDVDGAVLLWRFAGAVPEHVCCMNTGGPAVVDVAWSGATALLVAQGDGCATV
                     WDVEKGARLRTISRYAVKGRCAWPVVNCVAATGRDSFVFGGDDGYLVTADKRSDKVVA
                     GVHIAVPLTSATTTGFSLFVGDVCGTLHWFDTRAGSREMERIVCGSAGITSIIADPLQ
                     DRVVTYSMSGTVQVTDTQPFALLSSDRLLGATELGVNERQVLLRGAWVPRSDAVVMPS
                     GKGNVVSVSANDVVGGVTRTVHAGRTGSAMNVSVCVDDEYVVCSGDGGEVAAYQW"
     gene            complement(1126765..1129646)
                     /locus_tag="LMJF_28_2965"
                     /pseudo
                     /db_xref="GeneID:12980857"
     misc_feature    complement(1126765..1129646)
                     /locus_tag="LMJF_28_2965"
                     /pseudo
                     /db_xref="GeneID:12980857"
     gene            complement(<1130835..>1131410)
                     /locus_tag="LMJF_28_2970"
                     /db_xref="GeneID:5653512"
     mRNA            complement(<1130835..>1131410)
                     /locus_tag="LMJF_28_2970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684531.1"
                     /db_xref="GeneID:5653512"
     CDS             complement(1130835..1131410)
                     /locus_tag="LMJF_28_2970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684583.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653512"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7W5"
                     /translation="MRCGTALVPSLAIRRFPSVRARTNSLGTRWHCRRCTDLHEKSTQ
                     ISRHTHTVSRAKAHIYAPFLPQPTAWMSRGVKRGRIEASSPAPGSRESSSPPPLAEVL
                     PATTKVRTPKRQDTKKYLPDTHTSESVDASSAHSDESVHMESSREREDAVLLEGCDLS
                     GDALKSFLQKNFVDYIEDELFDVAALEALED"
     gene            complement(<1132077..>1132586)
                     /locus_tag="LMJF_28_2980"
                     /db_xref="GeneID:5653513"
     mRNA            complement(<1132077..>1132586)
                     /locus_tag="LMJF_28_2980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684532.1"
                     /db_xref="GeneID:5653513"
     CDS             complement(1132077..1132586)
                     /locus_tag="LMJF_28_2980"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684584.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653513"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7W4"
                     /translation="MNRSFVSSADLRGLTAAFCGSLTCQKRFWAKPKKRPKVGPGFHE
                     KAQKWRDEYLLDRHRVLADSLRAYVDFSSTKRVEPWDTRFAPFDRVEKDGVYILTRYL
                     MDDKLQLCNYHHRPVKRMLCNVGLMGPQVTTTARWKPYRFATNPANTTRAERTFTKDK
                     TVFTGYHHD"
     gene            complement(<1133387..>1134094)
                     /locus_tag="LMJF_28_2990"
                     /db_xref="GeneID:5653514"
     mRNA            complement(<1133387..>1134094)
                     /locus_tag="LMJF_28_2990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684533.1"
                     /db_xref="GeneID:5653514"
     CDS             complement(1133387..1134094)
                     /locus_tag="LMJF_28_2990"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684585.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.2990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.2990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653514"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7W3"
                     /translation="MGYGVRLSILPLSGGCRRWFSGCCTGSILGADTVSGSLLKTLQE
                     DLSDENELRTKGIGETLQNYVHRAELSHMESPEADEAFSKSLDAKVDDLFARIPLPQD
                     PMKVALALTDEEAREEAATELVKEAVREMYWRKLGAKQAEELRLKKAQEKLQKQGAIQ
                     YFEERREEERLREHENTQFAAQPLAVEPQSPVGKGVTASPLQNLDSTLSAEELRKELA
                     AMKANVSRLEELLRYKT"
     gene            complement(<1134827..>1135990)
                     /locus_tag="LMJF_28_3000"
                     /db_xref="GeneID:5653515"
     mRNA            complement(<1134827..>1135990)
                     /locus_tag="LMJF_28_3000"
                     /product="putative protein kinase"
                     /transcript_id="XM_001684534.1"
                     /db_xref="GeneID:5653515"
     CDS             complement(1134827..1135990)
                     /locus_tag="LMJF_28_3000"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001684586.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.3000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.3000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653515"
                     /db_xref="GOA:Q4Q7W2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7W2"
                     /translation="MMEIAADFARRGLRFVGFLGCGAFGDAYVVRDASDTCFVVKRSK
                     SLVKQSGFLEEYLGMMNLCSLNVVTSHDAWIDHESRVCILMDYCDAGDLGDYLKKGYP
                     LPEEEVLSIVAQLLLGLDHIHKRNRVHRDIKPENIFLSSARTGGGRWPVAKLGDFGSV
                     KRLSRCGARVVSRVGTPLYLAPEIISGYAYTSKADIWSMGLVVYRLMVNNSPFRVTSV
                     DTHTRCVLRLSPPHPSTLSGYSRALGDCVMAMLSRNWKRRPNAEALLRCDLFQPTLLR
                     HLWIPAPLHVSPCLFVQLRSSLLVVYAAPSERARTLRTLKFGDQVYLSSRRDHSHQGV
                     WLEVLHPFAGFIRNTGKGEPLLDSYASDECTASIGSRARVLNRAGKHVCRDIS"
     gene            complement(<1136720..>1137166)
                     /locus_tag="LMJF_28_3005"
                     /db_xref="GeneID:5653516"
     mRNA            complement(<1136720..>1137166)
                     /locus_tag="LMJF_28_3005"
                     /product="putative glucose 6-phosphate
                     N-acetyltransferase"
                     /transcript_id="XM_001684535.1"
                     /db_xref="GeneID:5653516"
     CDS             complement(1136720..1137166)
                     /locus_tag="LMJF_28_3005"
                     /codon_start=1
                     /product="putative glucose 6-phosphate
                     N-acetyltransferase"
                     /protein_id="XP_001684587.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.3005"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.3005"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653516"
                     /db_xref="GOA:Q4Q7W1"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7W1"
                     /translation="MSSSIIIRDLETCDLGEVLELLSHLTSAPALSQEELEQLHARRV
                     LAGVRTRVAVSSTTQKILGTASLIVEPKFTRGGKCVGHVEDVVTHPDCRGQGIGRELL
                     SSLVEVARASDCYKVVLNCTDDMVAYYSKAGFRKCENQMRMSILPQ"
     gene            complement(<1138020..>1141037)
                     /locus_tag="LMJF_28_3010"
                     /db_xref="GeneID:5653517"
     mRNA            complement(<1138020..>1141037)
                     /locus_tag="LMJF_28_3010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684536.1"
                     /db_xref="GeneID:5653517"
     CDS             complement(1138020..1141037)
                     /locus_tag="LMJF_28_3010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684588.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.3010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.3010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653517"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7W0"
                     /translation="MPPLSRLDAVCDTATTATTNLEDLQELCRRVQLLRKGVNDICNR
                     KIPALESSIEQFHETHLHRLLATKDDFTMDSPVHSIGLLLSSIDALLLRTENSSQKRW
                     TAAHRSSAAESSSTTIFAVGYSPETMVPSSDLVHYAEPKKVEIRPCDSSRNSRPPERE
                     RVTRSTSTTAAEKPAAAPESKPASGGFGFGAGAGAAEKPAAAPESKPASGGFGFGAGA
                     GAAEKPAAAPESKPASGGFGFGAGAGAAEKPAAAPESKPASGGFGFGAGAGAAEKPAA
                     APESKPASGGFGFGAGAGAAEKPAAAPESKPASGGFGFGAGAGAAEKPAAAPESKPAS
                     GGFGFGAGAGAAEKPAAAPESKPASGGFGFGAGAGAAEKPAAAPESKPASGGFGFGAG
                     AGAAEKPAAAPESKPASGGFGSGAGAGAAEKPAAAPESKPASGGFGFGAGAGAAEKPA
                     AAPESKPASGGFGFGAGAGAAEKPAAAPESKPASGGFGFGAGAGAAEKPAAAPESKPA
                     SGGFGFGAGAGAAEKPAAAPESKPTTGGFGQAPTTAFGKTPPASSAFGQAPSAGAAQP
                     AAGGFGQAPATAFGKAPPASSAFGQAPSAGAAQPTAGGFGQAPATAFGKAPPASSAFG
                     QAPSAGAAQPTAGGFGQAPTTAFGKTPPASSAFGQAPSAGAAQPAAGGFGQAPATAFG
                     KAPPASSAFGQAPSAGAAQPTAGGFGQAPATAFGKAPPASSAFGQAPSAGAAQPTAGG
                     FGQAPATAFGKAPPASSAFGQAPSAGAAQPTAGGFGQAPATAFGKAPPASSAFGQAPS
                     AGAAQPTAGGFGQAPATAFGKAPPASSAFGQAPSAGAAQPTAGGFGQAPATAFGKAPP
                     ASSAFGQAPSAGAAQPTAGGFGQAPATAFGKAPPASSAFGQAPSAGAAQPTAGGFGKA
                     PPTALGKAVCGFGAGSAFGIVGGFGSGATSASFSSASTPGFGPTSAFTSAFGGAPQGG
                     GFSSVPKSAFSGGGNTNSAFGASSFSSLAANFQ"
     gene            complement(<1142086..>1153731)
                     /locus_tag="LMJF_28_3030"
                     /db_xref="GeneID:5653518"
     mRNA            complement(<1142086..>1153731)
                     /locus_tag="LMJF_28_3030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684537.1"
                     /db_xref="GeneID:5653518"
     CDS             complement(1142086..1153731)
                     /locus_tag="LMJF_28_3030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684589.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.28.3030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.28.3030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653518"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7V9"
                     /translation="MSQLAQPSVSDMYANHAEAAPLADAFLERQNDNTDALRSSSERG
                     TMRFIGLSNDYGDTPQLKCVRGLEALKNPLIAPTTRTGVIAPNTVWRCVVCHKVKDLR
                     GAHLDGKASVRSDCWPCGKKTTFHRDVSAMSESGAVAAPTASHPQAPNGADGAAHAAG
                     SPNMSVLAASAATSSLQVLVSPSGIASMPAGTAPFKSAFGAVSAPDAAKPAAAPFKSA
                     FGAVSAPDAAKPAAAPFKSAFGDVSAPDAAKPAAAPFKSAAGGVVEWSGPMPPILPAV
                     KSGFGAGREEGSAMSLLGPSSAKVMSGVTQQPPKAMDASTAATSAEAAGLEQSDCVLR
                     ERLWRCVVCHKVKDLRGAHLDGKASVRSDCWPCGKKTTFVQENTGDGSLAGADRRASR
                     LAEAAGDEGVPALRERRCTVFKDPVVPSESEEERCMLPVTKGGGAQRPAEHTSGAVLS
                     GNAFWRCVVCHKVKDLRGAHLDGKASMRSDCWPCGKKTTFHRDVSAMSESGAVAAPTA
                     SHPQAPNGADGAAHAAGSPNMSVLAASAATSSLQVLVSPSGIASMPAGTAPFKSAFGA
                     VSAPDAAKPAAAPFKSAFGAVSAPDAAKPAAAPFKSAFGDVSAPDAAKPAAAPFKSAA
                     GGVVEWSGPMPPILPAVKSGFGAGREEGSAMSLLGPSSAKVMSGVTQQPPKAMDASTA
                     ATSAEAAGLEQSDCVLRERLWRCVVCHKVKDLRGAHLDGKASVRSDCWPCGKKTTFVQ
                     ENTGDGSLAGADRRASRLAEAAGDEGVPALRERRCTVFKDPVVPSESEEERCMLPVTK
                     GGGAQRPAEHTSGAVLSGNAFWRCVVCHKVKDLRGAHLDGKASVRSDCWPCGKKTTFH
                     RDVSAMSESGAVAAPTASHPQAPNGADGAAHAAGSPNMSVLAASAATSSLQVLVSPSG
                     IASMPAGTAPFKSAFGAVSAPDAAKPAAAPFKSAFGAVSAPDAAKPAAAPFKSAAGGV
                     VEWSGPMPPILPAVKSGFGAGREEGSAMSLLGPSSAKVMSGVTQQPPKAMDASTAATS
                     AEAAGLEQSDCVLRERLWRCVVCHKVKDLRGAHLDGKASVRSDCWPCGKKTTFVQENT
                     GDGSLAGADRRASRLAEAAGDEGVPALRERRCTVFKDPVVPSESEEERCMLPVTKGGG
                     AQRPAEHTSGAVLSGNAFWRCVVCHKVKDLRGAHLDGKASVRSDCWPCGKKTTFHRDV
                     SAMSESGAVAAPTASHPQAPNGADGAAHAAGSPNMSVLAASAATSSLQVLVSPSGIAS
                     MPAGTAPFKSAFGAVSAPDAAKPAAAPFKSAFGAVSAPDAAKPAAAPFKSAFGDVSAP
                     DAAKPAAAPFKSAAGGVVEWSGPMPPILPAVKSGFGAGREEGSAMSLLGPSSAKVMSG
                     VTQQPPKAMDASTAATSAEAAGLEQSDCVLRERLWRCVVCHKVKDLRGAHLDGKASVR
                     SDCWPCGKKTTFVQENTGDGSLAGADRRASRLAEAAGDEGVPALRERRCTVFKDPVVP
                     SESEEERCMLPVTKGGGAQRPAEHTSGAVLSGNAFWRCVVCHKVKDLRGAHLDGKASV
                     RSDCWPCGKKTTFHRDVSAMSESGAVAAPTASHPQAPNGADGAAHAAGSPNMSVLAAS
                     AATSSLQVLVSPSGIASMPAGTAPFKSAFGDVPAPDAAKPAAAPFKSAFGAVSAPDAA
                     KPAAAPFKSAFGDVSAPDAAKPAAAPFKSAFGAVSAPDAAKPAAAPFKSAFGDVSAPD
                     AAKPAAAPFKSAFGAVSAPDAAKPAAAPFKSAFGAVSAPDAAKPAAAPFKSAFGDVPA
                     PDAAKPAAAPFKSAFGDVPAPDAAKPAAAPFKSAFGAVSAPDAAKPAAAPFKSAFGDV
                     SAPDAAKPAAAPFKSAFGDVSAPDAAKPAAAPFKSAFGDVSAPDAAKPAAAPFKSAFG
                     DVPAPDAAKPAAAPFKSAFGAVSAPDAAKPAAAPFKSAFGDVSAPDAAKPAAAPFKSA
                     FGDVPAPDAAKPAAAPFKSAFGAVPAPDAAKPAAAPFKSAFGAVSAPDAAKPAAAPFK
                     SAFGAVSAPDAAKPAAAPFKSAFGAVSAPDAAKPAAAPFKSAFGDVPAPDAAKPAAAP
                     FKSAFGDVPAPDAAKPAAAPFKSAFGAVSAPDAAKPAAAPFKSAFGDVSAPDAAKPAA
                     APFKSAFGDVSAPDAAKPAAAPFKSAFGDVSAPDAAKPAAAPFKSAFGAVSAPDAAKP
                     AAAPFKSAFGDVSAPDAAKPAAAPFKSAFGDVSAPDAAKPAAAPFKSAFGAVSAPDAA
                     KPAAAPFKSAFGAVSAPDAAKPAAAPFKSAFGDVSAPDAAKPAAAPFKSGFGDVSAPD
                     AAKPAAAPFKSAFGDVSAPDAAKPAAAPFKSAFGAVSAPDAAKPAAAPFKSAFGAVSA
                     PDAAKPAAAPFKSAFGAVSAPDAAKPAAAPFKSAFGAVSAPDAAKPAAAPFKSAFGDV
                     PAPDAAKPAAAPFKSAFGDVSAPDAAKPAAAPFKSGFGDVSAPDAAKPAAAPFKSAFG
                     DVSAPDAAKPAAAPFKSAFGAVSAPDAAKPAAAPFKSAFGDVSAPDAAKPAAAPFKSA
                     FGAVSAPDAAKPAAAPFKSAFGAVSAPDAAKPAAAPFKSAFGDVPAPDAAKPAAAPFK
                     SAFGDVPAPDAAKPAAAPFKSAFGAVSAPDAAKPAAAPFKSAFGDVSAPDAAKPAAAP
                     FKSAFGDVSAPDAAKPAAAPFKSAFGDVSAPDAAKPAAAPFKSAFGDVPAPDAAKPAA
                     APFKSAFGAVSAPDAAKPAAAPFKSAFGDVSAPDAAKPAAAPFKSAFGDVPAPDAAKP
                     AAAPFKSAFGAVPAPDAAKPAAAPFKSAFGAVSAPDAAKPAAAPFKSAFGAVSAPDAA
                     KPAAAPFKSAFGAVSAPDAAKPAAAPFKSAFGDVPAPDAAKPAAAPFKSAFGDVPAPD
                     AAKPAAAPFKSAFGAVSAPDAAKPAAAPFKSAFGDVSAPDAAKPAAAPFKSAFGDVSA
                     PDAAKPAAAPFKSAFGDVSAPDAAKPAAAPFKSAFGDVSAPDAAKPAAAPFKSAFGDV
                     PAPDAAKPAAAPFKSAFGAVSAPDAAKPAAAPFKSAFGAVSAPDAAKPAAAPFKSAFG
                     AVSAPDAAKPAAAPFKSAFGAVPAPDAAKPAAAPFKSAFGDVSAPDAAKPAAAPFKSA
                     AGGVVEWSGPMPPILPAVKSGFGAGREEGSAMSLLGPSSAKVMSGVTQQPPKAMDAST
                     AATSAEAAGLEQSDCVLRERLWRCVVCHKVKDLRGAHLDGKASVRSDCWPCGKKTTFV
                     QENTGDGSLAGADRRASRLAEAAGDEGVPALRERRCTVFKDPVVPSESEEERCMLPVT
                     KGGGAQRPAEHTSGAVLSGNAFWRCVVCHKVKDLRGAHLDGKASVRSDCWPCGKKTTF
                     HRDVSAMSESGAVAAPTASHPQAPNGADGAAHAAGSPNMSVLAASAATSSLQVLVSPS
                     GIASMPAGTAPFKSAFGDVPAPDAAKPAAAPFKSAFGDVPAPDAAKPAAAPFKSAFGD
                     VPAPDAAKPAAAPFKSAFGAVSAPDAAKPAAAPFKSAFGDVSAPDAAKPAAAPFKSAF
                     GDVSAPDAAKPAAAPFKSAFGDVSAPDAAKPAAAPFKSAFGAVSAPDAAKPAAAPFKS
                     AFGDVSAPDAAKPAAAPFKSAFGAVSAPDAAKPAAAPFKSGFGDVSAPDAAKPAAAPF
                     KSGFGDVSAPDAAKPAAAPFKSGFGDVSAPDAAKPAAAPFKSGFGDVSAPDAAKPAAA
                     PFKSAFGDVSAPDAAKPAAVELKVVYGDTQYMCESVLSEDGEESLRWRENSKRRECVD
                     LAKGGQLGISDAKGGVADKACGAGPSVSSSCDMVCSTALVPSVATGCCSSAVVEKLIT
                     KALKEQRVEMKEELECFRKDLLFEVRQAISQGHVYAVARDRASFGEPPAQMTESLIRR
                     HLSKAFRKS"
CONTIG      join(FR796424.1:1..1160104)
//
DBGET integrated database retrieval system