GenomeNet

Database: RefSeq
Entry: NC_007270
LinkDB: NC_007270
Original site: NC_007270 
LOCUS       NC_007270            1212663 bp    DNA     linear   CON 18-JUN-2017
DEFINITION  Leishmania major strain Friedlin complete genome, chromosome 29.
ACCESSION   NC_007270 CP000080
VERSION     NC_007270.2
DBLINK      BioProject: PRJNA15564
            BioSample: SAMEA3138173
            Assembly: GCF_000002725.2
KEYWORDS    RefSeq; complete genome.
SOURCE      Leishmania major strain Friedlin
  ORGANISM  Leishmania major strain Friedlin
            Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae;
            Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Rogers,M.B., Hilley,J.D., Dickens,N.J., Wilkes,J., Bates,P.A.,
            Depledge,D.P., Harris,D., Her,Y., Herzyk,P., Imamura,H., Otto,T.D.,
            Sanders,M., Seeger,K., Dujardin,J.C., Berriman,M., Smith,D.F.,
            Hertz-Fowler,C. and Mottram,J.C.
  TITLE     Chromosome and gene copy number variation allow major structural
            change between species and strains of Leishmania
  JOURNAL   Genome Res. 21 (12), 2129-2142 (2011)
   PUBMED   22038252
REFERENCE   2
  AUTHORS   Ivens,A.C., Peacock,C.S., Worthey,E.A., Murphy,L., Aggarwal,G.,
            Berriman,M., Sisk,E., Rajandream,M.A., Adlem,E., Aert,R.,
            Anupama,A., Apostolou,Z., Attipoe,P., Bason,N., Bauser,C., Beck,A.,
            Beverley,S.M., Bianchettin,G., Borzym,K., Bothe,G., Bruschi,C.V.,
            Collins,M., Cadag,E., Ciarloni,L., Clayton,C., Coulson,R.M.,
            Cronin,A., Cruz,A.K., Davies,R.M., De Gaudenzi,J., Dobson,D.E.,
            Duesterhoeft,A., Fazelina,G., Fosker,N., Frasch,A.C., Fraser,A.,
            Fuchs,M., Gabel,C., Goble,A., Goffeau,A., Harris,D.,
            Hertz-Fowler,C., Hilbert,H., Horn,D., Huang,Y., Klages,S.,
            Knights,A., Kube,M., Larke,N., Litvin,L., Lord,A., Louie,T.,
            Marra,M., Masuy,D., Matthews,K., Michaeli,S., Mottram,J.C.,
            Muller-Auer,S., Munden,H., Nelson,S., Norbertczak,H., Oliver,K.,
            O'neil,S., Pentony,M., Pohl,T.M., Price,C., Purnelle,B.,
            Quail,M.A., Rabbinowitsch,E., Reinhardt,R., Rieger,M., Rinta,J.,
            Robben,J., Robertson,L., Ruiz,J.C., Rutter,S., Saunders,D.,
            Schafer,M., Schein,J., Schwartz,D.C., Seeger,K., Seyler,A.,
            Sharp,S., Shin,H., Sivam,D., Squares,R., Squares,S., Tosato,V.,
            Vogt,C., Volckaert,G., Wambutt,R., Warren,T., Wedler,H.,
            Woodward,J., Zhou,S., Zimmermann,W., Smith,D.F., Blackwell,J.M.,
            Stuart,K.D., Barrell,B. and Myler,P.J.
  TITLE     The genome of the kinetoplastid parasite, Leishmania major
  JOURNAL   Science 309 (5733), 436-442 (2005)
   PUBMED   16020728
REFERENCE   3  (bases 1 to 1212663)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 1212663)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR796425.
            On Jun 1, 2012 this sequence version replaced NC_007270.1.
            Data release policy www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1212663
                     /organism="Leishmania major strain Friedlin"
                     /mol_type="genomic DNA"
                     /strain="Friedlin"
                     /db_xref="taxon:347515"
                     /chromosome="29"
     gene            complement(<1033..>1923)
                     /locus_tag="LMJF_29_0010"
                     /db_xref="GeneID:12981150"
     mRNA            complement(<1033..>1923)
                     /locus_tag="LMJF_29_0010"
                     /product="3,2-trans-enoyl-CoA isomerase, mitochondrial
                     precursor-like protein"
                     /transcript_id="XM_003722027.1"
                     /db_xref="GeneID:12981150"
     CDS             complement(1033..1923)
                     /locus_tag="LMJF_29_0010"
                     /note="previous protein_id=AAZ09452.1"
                     /codon_start=1
                     /product="3,2-trans-enoyl-CoA isomerase, mitochondrial
                     precursor-like protein"
                     /protein_id="XP_003722075.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981150"
                     /db_xref="GOA:E9ADK3"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="InterPro:IPR018376"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:E9ADK3"
                     /translation="MRCFRASCCAPSPWQRACSTVASVSDTADLVIVRESPLDNVVLL
                     EMNNGRANVLTPEFISAFLNKLSDLCDPDKSKCSGIILTSKNPGVFSAGLDLNELNTN
                     LSQDRFAQYWSQFQKLFTTLHALPVPLVGAINGHAAAAGCIVALACDYRVMARRHPTK
                     PTHLTIGIAAAKHGFVVPSYVAASMEHVVGFRKAEELLCMGLLLSAGEALKVGLVDEV
                     VEHHDETVVPCLQFMEKLLELPSPAPYWMIKDLSRRHILAPLCTPALRTQDMVSFYNL
                     FSNLQVKKMLAEHAQKFAKK"
     gene            complement(<4194..>7331)
                     /locus_tag="LMJF_29_0020"
                     /db_xref="GeneID:12980858"
     mRNA            complement(<4194..>7331)
                     /locus_tag="LMJF_29_0020"
                     /product="transcription factor-like protein"
                     /transcript_id="XM_003722028.1"
                     /db_xref="GeneID:12980858"
     CDS             complement(4194..7331)
                     /locus_tag="LMJF_29_0020"
                     /note="previous protein_id=AAZ09453.1"
                     /codon_start=1
                     /product="transcription factor-like protein"
                     /protein_id="XP_003722076.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980858"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR013719"
                     /db_xref="InterPro:IPR013953"
                     /db_xref="UniProtKB/TrEMBL:E9ADK4"
                     /translation="MQPSANHTISASRLSAVLAQWQAAAARGDAAAKQCSAWACVFGE
                     RSVNTPDNQRGQAILQYLLEAREPVCNTAALITEDVTLILHGAGVRVAAPPTKLEGHT
                     VEVVEGVEAAQARVAALLAGKTVGAPVNEFAIQEGTFASAFTELVRGAVPSESLLSAA
                     PALGELLFVKDDAALGCVEKAAGLCCAVFRRYARDCIANEMAKRDPKTLYDVRQMLYA
                     KLERPNTIQALESLAVDDFSLVTGLPPCLFHKGTYNSQLNVDEDTLKAACNVPIHGDV
                     VVVRFGVKNTGYTAFFGRTLLVASAAPSNAKEAYQFAYDVSAKLMELLVPGARLSDVY
                     AGVMQYARDQNSDLAALLSKNFGFSTGLLVLEARGNISEKGTAIIADGMSFVIRVVLE
                     SVPSAGGEGTFDVELTDTVIIRGGVAELKTKVARKLAEVLYEDLDETAAAAEAAQQVH
                     RDLSKITRQGQSDTMIISREAQREQELRQLLSELHAEFLAAGGKKGTQTSTKEYRACD
                     IGRLSFDELTPYNPEDRVPPPESKKGIFVQTDKKVVWLPVCGRAVPFHVSTVNRVDVK
                     AEGGKYTMTVTFHAMQEANVGYKLNPTKVFVKELGYSSSRDMFTDSAIAIQGIQQRIK
                     NEDAARKRALTSASNGRLTVTPNPLRLPTVKIRPPITNANRQNKGCVGNLELHANGLR
                     FSFLGGIPIDMLFENIKHVIFQPAVKSIYVIYHVTLKKPIEINRKNVLEVQFVAEVME
                     SSELASSARRSFEEEVQAEERDEMRIRQTNKQFITFAHAVEERSKIKTQLPTNQFSFD
                     GVHARSMTMFKGNREVLWAISDTPAFTQSVDEVEVVSFERILPGSATFDMSLILKDYN
                     KPVITINSIPRDSLDHIKDWCLSARLYYMETAVNPNWRTTMKEIREDPDWDPWLRGDG
                     WSVLNNETNDEEDEEEDDDSDSDSTYYEDEDDSSDSDDSSWLEDEESDPSSGSDESDE
                     ASAASWDELERRAAAKDRQRDMSDDDDYHPRKRQRAGAAAPAPPAAPTTRPSKMPLNM
                     AGRAGGGAVPPARRF"
     gene            complement(<8658..>10061)
                     /locus_tag="LMJF_29_0030"
                     /db_xref="GeneID:12980859"
     mRNA            complement(<8658..>10061)
                     /locus_tag="LMJF_29_0030"
                     /product="ribosomal protein L3-like protein"
                     /transcript_id="XM_003722029.1"
                     /db_xref="GeneID:12980859"
     CDS             complement(8658..10061)
                     /locus_tag="LMJF_29_0030"
                     /note="previous protein_id=AAZ09454.1"
                     /codon_start=1
                     /product="ribosomal protein L3-like protein"
                     /protein_id="XP_003722077.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980859"
                     /db_xref="GOA:E9ADK5"
                     /db_xref="InterPro:IPR000597"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR019927"
                     /db_xref="UniProtKB/TrEMBL:E9ADK5"
                     /translation="MHRFRVCALGAAFCVARRWRSGGGPGDRRVRTDWYRCYPSLMEE
                     KDRDMYHCYYPYLFDHGDKMSLYPKIPDNPREWQVEQLQTTYDAIREDKYDAFVRLRA
                     KFPELYQDTYAWDNPPPFGEFNMFYSVRFGMIGVKAFTCKDYDDLGNQFDCTAFWFPD
                     NQIVKHSTRNGDVGTDKVYVGAMNVPVEFHKPHVAAFYKAAGVPVKHVSAGFPVTPDA
                     YAPVGTKLDVRHFKPGQEVTITFQNTDYGYQGVMFRHGFDGGYVWLGDSKWQRRPGCM
                     GAEGQKRIYPGHRMAGQTGASAETYDGVPVWRIDYKNSLIYLPTLIDADVGTYVKFRD
                     TINTKGYTLWNEHRGTPPFPTFIPSEEEDLSKLATDEGQLTSPPLYMYFRDEFAAAQL
                     VTQADVEDAKSAKPATAAPKKKVYDLKKYTEARKKYRKNLQKARKYKLMGVRTRAHEK
                     QQEARRAKILKYKRVKT"
     gene            complement(<11101..>11964)
                     /locus_tag="LMJF_29_0040"
                     /db_xref="GeneID:12980860"
     mRNA            complement(<11101..>11964)
                     /locus_tag="LMJF_29_0040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722030.1"
                     /db_xref="GeneID:12980860"
     CDS             complement(11101..11964)
                     /locus_tag="LMJF_29_0040"
                     /note="previous protein_id=AAZ09455.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722078.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980860"
                     /db_xref="UniProtKB/TrEMBL:E9ADK6"
                     /translation="MLAAIQGFGTRVAARTAGQALRRGLGVVPLRRCCPFRCASSASL
                     PSDVEVHQGSDDYRHSDDAFTLSTEVLGTAEEKATLDEDEFDELEAASQELHDLCYAL
                     IAHLRCADPEANKALFERRVQRAFREPKPEQYRRLLHGHGDRSLRRRNNYRTRKDFQE
                     AHRLYLQWCDKLLLLLTQPVLDRLVKSAGKGHRDLRTDGVHRYRRPLERATWRSFPHR
                     WFKHAPFEVQQLRADIPESAVLNTRFYRDHATLRYLFTLMEPQHAFREKIERRVMDLT
                     QRYDPLRKSIE"
     gene            complement(<13236..>15251)
                     /locus_tag="LMJF_29_0050"
                     /db_xref="GeneID:12980861"
     mRNA            complement(<13236..>15251)
                     /locus_tag="LMJF_29_0050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722031.1"
                     /db_xref="GeneID:12980861"
     CDS             complement(13236..15251)
                     /locus_tag="LMJF_29_0050"
                     /note="previous protein_id=AAZ09456.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722079.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980861"
                     /db_xref="UniProtKB/TrEMBL:E9ADK7"
                     /translation="MRRPEPWQRLLSHVRHTIATPFVLRIGTGPPGSLPPVAAAPHPP
                     SALPTIAANYSELSAFEKDYAARCLEYVAHQADDTQVEECDSIPHPTSSSSVAPTLPE
                     DPCASTWRPLFDLLVLPDGSLCIGWFRHHALDLQWGHHVEAYVADLWQKAPRTLWLHC
                     REKMNFLVRRQLPMRHRHLAVFSRKDTVSPDEEQSLQAAVRSLHAAASTAYHLEDNVL
                     LHASTSGRPTLLFVRALMRDIERRDRELPTGTAVAVMQLLVLTFATYYDGMPRDMAEA
                     IAASAGQICALTSDSGCHQLLAWGALLVGCTDDHAKAGIEVVQGDAATQALTLTLLSS
                     IAIPGAEREAALRWHAEHHLHPLCDTLVSEEALLLDALSAFRSGAQSAEYRSVRSSCA
                     ATGDVPIDRDATNSGAARGDVAAWHFSRVLDQKVGDPEDEAVLRLEPAKESDQLPLPW
                     LPGTGVDAKGCWCTLLTHSRILLSHSKADSRHARSTAAYRHAATVKRVHCMLRIALVR
                     RCLFETTDANISSQYSILTHLFSSAQAPSARLTLIHLATTHVPREVIDPEKHQRTLMG
                     LLFLFPSLSLRSLYGGTVARAHASLSTAACALQCTSCLDNSQTSAASNSPLTVRIPAR
                     CAEGLATRLHGRDTALICVVHTVSNEPDAAFLLDDLCMNLHTILRRS"
     gene            complement(<16161..>17603)
                     /locus_tag="LMJF_29_0060"
                     /db_xref="GeneID:12980862"
     mRNA            complement(<16161..>17603)
                     /locus_tag="LMJF_29_0060"
                     /product="putative tryptophanyl-tRNA synthetase"
                     /transcript_id="XM_003722032.1"
                     /db_xref="GeneID:12980862"
     CDS             complement(16161..17603)
                     /locus_tag="LMJF_29_0060"
                     /EC_number="6.1.1.2"
                     /note="previous protein_id=AAZ09457.1"
                     /codon_start=1
                     /product="putative tryptophanyl-tRNA synthetase"
                     /protein_id="XP_003722080.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980862"
                     /db_xref="GOA:E9ADK8"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002305"
                     /db_xref="InterPro:IPR002306"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:E9ADK8"
                     /translation="MMSPFPPLPVYLSGLLTLHVPTRCLHFLVLTPMKTRVGLHRCCA
                     SYLRLLSQDRLQLHNPIEFIGALHFFTSLCSPLGVADFLRMEDPAAQEVVVTPWTVEG
                     DVNYDKLIKNFGCQAIDDKLLERMERLTGKKPHHFLRRGIFFSHRDLNLILDAYEKGQ
                     PFYLYTGRGPSSESMHVGHLIPFMFTKWLQDTFHVPLVIQLTDDEKFFFKDLTMEEID
                     KMTTENLKDIIAFGFDPKLTFIFRDFEYVGQMYRIVARIEKAYTASQVRGCFGFKMED
                     NCGRWMFPAIQAAPSFSAAFPHIFPLQKGNVFCMIPQAIDQDPYFRLTRDVAPRMGYL
                     KPAVIHSKFFPGLSGSKGKMSSSTGAAVFLTDTPKMIKDKINKHAFSGGGADKKEQLL
                     LGGNTNVDVPVQWLRFFLEDDEELKRLQKDYMLGRIMTGDVKKVLIRQITSIVTAHQE
                     SRKKVTEADVELFTAVRVMGPAKEEAESRK"
     gene            complement(<18767..>19531)
                     /locus_tag="LMJF_29_0070"
                     /db_xref="GeneID:12980863"
     mRNA            complement(<18767..>19531)
                     /locus_tag="LMJF_29_0070"
                     /product="putative QA-SNARE protein"
                     /transcript_id="XM_003722033.1"
                     /db_xref="GeneID:12980863"
     CDS             complement(18767..19531)
                     /locus_tag="LMJF_29_0070"
                     /note="previous protein_id=AAZ09458.1"
                     /codon_start=1
                     /product="putative QA-SNARE protein"
                     /protein_id="XP_003722081.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980863"
                     /db_xref="GOA:E9ADK9"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="UniProtKB/TrEMBL:E9ADK9"
                     /translation="MQEMGDPSWRRACDLLAKHLQSLGQKITAIRRITNRRSSIEEIK
                     KEREEVKHITRDANATDVQDIRKIVKSFERFILLDKGLSDEGRKLAKDAEMVLKDYER
                     TCNDFYRKCMHGESARGTQSNRALRAFREASEDDDENEGQALLNTESPQRVQFERDMY
                     EELMLERQRETGEIAENVRDIHEIFQHINGMINEQGEQLEIVENNLSSAERATRNASQ
                     HLRRAQQYQATSSRNKMLFICMVIMLAIVSIGLLMN"
     gene            complement(<20331..>20705)
                     /locus_tag="LMJF_29_0080"
                     /db_xref="GeneID:12980864"
     mRNA            complement(<20331..>20705)
                     /locus_tag="LMJF_29_0080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722034.1"
                     /db_xref="GeneID:12980864"
     CDS             complement(20331..20705)
                     /locus_tag="LMJF_29_0080"
                     /note="previous protein_id=AAZ09459.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722082.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980864"
                     /db_xref="UniProtKB/TrEMBL:E9ADL0"
                     /translation="MNHSPFLTALYTDVQSRLPLWTTRYVKPISNGTFAVSSTWTDDS
                     GAQLQRLFIAVEASDTNCISEAVLAEWIAFVEAWQAAHKEDEVSCFVGFVDLAGTVSY
                     YRCETAVAGAWRSKPDDHLTCR"
     gene            complement(<21310..>21870)
                     /locus_tag="LMJF_29_0090"
                     /db_xref="GeneID:12980865"
     mRNA            complement(<21310..>21870)
                     /locus_tag="LMJF_29_0090"
                     /product="putative ras-like small GTPases"
                     /transcript_id="XM_003722035.1"
                     /db_xref="GeneID:12980865"
     CDS             complement(21310..21870)
                     /locus_tag="LMJF_29_0090"
                     /note="previous protein_id=AAZ09460.1"
                     /codon_start=1
                     /product="putative ras-like small GTPases"
                     /protein_id="XP_003722083.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980865"
                     /db_xref="GOA:E9ADL1"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9ADL1"
                     /translation="MVLLRLRVAVVGEPTSGKTAFVQMVHSNGTVFPKNYLMTMGCDF
                     VVKEFALDEDNTVEVSLLDVAGQRLYDRMTSHYLESVSAFILVYDVSNKATFESCRKW
                     VTKARTAKKDMIGFLLGNKMDLADKAEVTDNQAEVFARANQLTFFKCSALRGTGTVEP
                     VERLSRMFLEEYQKRLVQLSQLSASK"
     gene            complement(<23983..>25593)
                     /locus_tag="LMJF_29_0100"
                     /db_xref="GeneID:12980866"
     mRNA            complement(<23983..>25593)
                     /locus_tag="LMJF_29_0100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722036.1"
                     /db_xref="GeneID:12980866"
     CDS             complement(23983..25593)
                     /locus_tag="LMJF_29_0100"
                     /note="previous protein_id=AAZ09461.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722084.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980866"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:E9ADL2"
                     /translation="MSHPCEFKNQVTGKVAIPSQWKTETTHEDAATQTSKLKVKSHES
                     QTDISCFQASDQLDKGVGTERRSFQASLEGLQYVYNGVPHDQAKLSTFLEESMNQLLT
                     VLHRNATSSIFDHYSPAWSRKNTELSVLYRLTSPAVQEDNLEALGVTWNTHGNIVAAA
                     YGLMETSGWCYKKGYVCVWNLARPDLRESRPHNTLETETGATCIAFHPTDPCMLAVGS
                     YSGEVVVFANVTENFPGKYSSSASEVAHTEPVTVLQWVKNPQESRHHHQYVLCSASQS
                     GLIIHWSPANKLAKPIAAYSVRSRRHLSVGIAALTYGGVQTQRGSYLPALDGVLLVGL
                     ENGEVGRGRTWPLPIETNSQAPPTITPLELDWLESHCGPLQSLSASPFFRHLFLTTSS
                     DCSARLYSDLQRSPLLTLELSEETKGYLYDGRFSPFRPSVVAVVSRRSLLRVYDLERD
                     QFKPAYTAAVSADGAGALTVAFNSTAAEWLATGDARGVVQVWRLPTELSQITELERAA
                     LRSSQPTCDSTKEPQDSTGILDLFGSRV"
     gene            complement(<27021..>35888)
                     /locus_tag="LMJF_29_0110"
                     /db_xref="GeneID:12980867"
     mRNA            complement(<27021..>35888)
                     /locus_tag="LMJF_29_0110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722037.1"
                     /db_xref="GeneID:12980867"
     CDS             complement(27021..35888)
                     /locus_tag="LMJF_29_0110"
                     /note="previous protein_id=AAZ09462.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722085.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980867"
                     /db_xref="InterPro:IPR027007"
                     /db_xref="UniProtKB/TrEMBL:E9ADL3"
                     /translation="MSTDNDIERQIMMEMEAEISRSRGNRRDPYTNPPSFELSFIEDD
                     PMEAARKAEVDRIQCEIEERLRRKQQQKQRDSLELSPNCPADKGEMGAAYNLLQHPQN
                     ASWTTGAPDRHMVRASLSRESEENEQAEDASRLREDEAAMARTETEEEAHIDMEVQVR
                     RAAEIQALREAEEQARREAEEQARREAEEQARREAEEQARREAEEQARRVAEEQARRV
                     AEEQARRVAEEQARRVAEEQARREAEEQARRVAEEQARRVAEEQARRVAEEQARREAE
                     EQARRVAEEQARREAEEQARREAEEQARRVAEEQARREAEEQARREAEEQARREAEEQ
                     ARREAEEQARREAEEQARREAEEQARREAEEQARREAEEQARREAEEQARREAEEQAR
                     REAEEQARREAEEQARREAEEQARREAEEQARREAEEQARREAEEQARREAEEQARRE
                     AEEQARREAEEQARREAEEQARREAEEQARRVAEEQARRVAEEQARREAEEQARREAE
                     EQARREAEEQARRVAEEQARRVAEEQARREAEEQARREAEEQARREAEEQARRVAEEQ
                     ARRVAEEQARRVAEEQARREAEEQARREAEEQARRVAEEQARREAEEQARRVAEEQAR
                     RVAEEQARREAEEQARREAEEQARREAEEQARRVAEEQARRVAEEQARREAEEQARRE
                     AEEQARREAEEQARRVAEEQARRVAEEQARREAEEQARRVAEEQARREAEEQARRVAE
                     EQARRVAEEQARREAEEQARRVAEEQARREAEEQARRVAEEQARCEAEEQARRVAEEQ
                     ARRVAEEQARREAEEQARRVAEEQARCEAEEQARRVAEEQARRVAEEQARRVAEEQAR
                     REAEEQARRVAEEQARREAEEQARRVAEEQARCEAEEQARRVAEEQARRVAEEQARRV
                     AEEQARREAEEQHSAVAAFVRDADERPASAVSVTHRGDARWQSEYTEQGGTGADAEEE
                     HGMQQQDSRCSRYRTSSPSVSDCDMRSEGSTNSKDSASQTVSRYSLATLEAIRNDNGI
                     LSRTEEEVSYVPRVTKEVPLENFEVALSAELKARGLTEDAIRRSCIEVHRYGTIRESG
                     KCLFPPREVTGEVPAHVKVQLGFFSAKQTIIALQRPLRKPNADRERPCEPGERSLSTL
                     KCYFESEVLSDHTLTVDDEDYPHNAPTERLLTKAQLMRGDSAMVRKAVSQISYGDPIQ
                     VWERAQRNTTAAAEAATKSTAANLWVSDIDTRKPIPAMRTFTGGFVYCIEATKISNRV
                     IELHGASTDPLVIAAALYSWTDRQKVKVSETFYFDSELDIFYPQKERSELAKTNQVVV
                     FVPNEFKGTLHLVMRVYRPCCEDYDNYVDLYSRADRYKQIHVAPMKQETLLLTQVSDV
                     LEELGWNSVPLQDEANHLLPRVAVDRLYRKAFADEDVFRVMKDERWRGAQKALPVDMV
                     FSVSDLSRHEVAFPSDHPETPPEENESKVSLLDPDLPGARPVIYRYSPCCIPILNSGY
                     FTTYNNVYYFSVSKLKVMYAGFVRNIPASHHTYVFQLCVKAKDDGLSEEGAIRCIYGR
                     GLSNLSMETTAWSSSAHTSNDMVLNDEFKLQLPLNLSDRHHIFMTLYATCQRKTPPTP
                     GQPRMFKIGYAAVPLMMNGVVQVRDSIDIKFVSHDQATVAAAGGYLTGFAEAPVNFLL
                     NNGEGVVKASTQTKTTVHASNRVIASVFQQCPSSIAELRKNDKVLDECGALQKLPAME
                     VDPHRNVISLIAQLPLAEILAFYPFLSAYAFSLIGTGSATVSLANRIHMLDVLLGITS
                     KAQQYDTSAHTIRRRHNSEGLTPQVFAKTSVGSILYHFLSNDTLYEGAKCEYKRRLYS
                     GMVEAWLNLLKMVEQQPNGVGADTAKEKSDASAPSSSPASPASLARGSKSPPPARNIL
                     REMSNLSWFLFDTILRSIYLWGAENPTVPRQELFHSSFYTAVAELCILALSRLSTFDE
                     SQLVRHVAIFVRSLMHYADRGRVLMIYERIAAYFEEDGNLESLTNFLKYVLEDPDAIY
                     LLLHSAGAARPVFLTRIVVHSFTILMINPNRVTRSIATDVLYSFLRRLANDSGTPSEN
                     LTCIAAQLFELVRNLGPHWKAITQPNDKIPIEVFQRDKQQLSMTCLWILYYTPRSTLQ
                     QWLQEEVNEKVIAGIMQIVAESQSTFRYTAAPASSSAASPFAGVMKDASNEEVEERRA
                     WEARSTTFVTAIGTQMCSFFLNEMSSILRTVRDNSPSAAVFPFFVMLESVLNLGNSTI
                     SLQMSSAAMHEVVCKLFPEIISRKARMGNGMALLTFRLMSSCCQYVRSSASCTFLLMS
                     QAFFSWKNSLSKIRSLTANALVSVAESRVRDLRLAGRFIEFQFDELIERAKVEEANYT
                     APSCDFASRYEDDSNAPGGDAQMKYRQKVEGQAMSVQRNLPISRYLLEKSNVPDQQPP
                     RFSSEFTAMTVTVLSLFDDVLRLQMDDSMKFKEAKATAYFEVFRNFLRQNALKEALKW
                     LYRLHDVHRANNDYLEAGMVLVFIAALCFRVTEVFYFVKGNDSKGARMPFEILSHVFW
                     HDYVRILPEVDALLPADTVYAIVSELYTCPEDMCFSMEGQVKALKEAAEFQDKGQYYE
                     YSLQTINIANKYLMAASDFKGSSVVHMAMSTWCTAIAEPKSKRHNSRYFFLWARMERH
                     TLPKSRKELHEDANDIKAGEKPRGLPNGNPIRRIYKMPTTTTLEEFKNYARSYVESLF
                     FDTSLVLLTHDLTETLPALPEPDSKRKRVAAVHRQPNHCMVTVSEVQPYFAKGTRVPP
                     DGFDRAMHISYFENTVNVGSRDEVSDGRKLDLMAQRMSVSTYELERSFPSTTSAIDIA
                     KTHQVLLNPFETAEEMLNSRREAMNQAPVNDALITVIRKALSPKELPPGAYMKEVIAV
                     MGDHPEVIHAVRALSTLARAKLEICEKMEAMVKNPEDYALVLKAVTDIECCLVAMQHP
                     DEDDHVSSSSM"
     gene            complement(<38677..>41406)
                     /locus_tag="LMJF_29_0120"
                     /db_xref="GeneID:12980868"
     mRNA            complement(<38677..>41406)
                     /locus_tag="LMJF_29_0120"
                     /product="putative proteasome regulatory non-ATPase
                     subunit"
                     /transcript_id="XM_003722038.1"
                     /db_xref="GeneID:12980868"
     CDS             complement(38677..41406)
                     /locus_tag="LMJF_29_0120"
                     /note="previous protein_id=AAZ09463.1"
                     /codon_start=1
                     /product="putative proteasome regulatory non-ATPase
                     subunit"
                     /protein_id="XP_003722086.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980868"
                     /db_xref="GOA:E9ADL4"
                     /db_xref="InterPro:IPR002015"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016643"
                     /db_xref="UniProtKB/TrEMBL:E9ADL4"
                     /translation="MDSKGKEVVVDVPSKDPQKDATINEKKKKENEHKMSEEDMRIKE
                     EVELLVTRAADSDVDIAKIAVERLVDLLRTSSSGSLAAVPPPLKHVRALYPELEAALK
                     SSQNPSVSRRLHDLLSFISMTLESSNGGRTLLEHKLKGTKNDLAQWGHEYLRFLAGAI
                     GEEWRERPTNKESTEYLNGFVDQIVAYMLAHQDEATAIDLLMEIDGVTRILPLVEASN
                     YKRIANYIAAISKYLTRPSDSEALRTVYDIYKKMQAYPDAALTALRLNDRDLVAELFS
                     ECKSKPERLQMALLCARQKCFLDLDGEEDELLQDANGNMGLSQLYRHTAQEFDSMAPK
                     TLDEVFKMSPDEKSGPRDLQNNLVCAFVSGLANCGYGTDKFLSDTPAFFFDQREDRII
                     STTAALGLLHLWDHTEGLQQIDKYFYSESTYVKAGACLASGIVMCGVKNPFDPALGLL
                     SEQINARETEVAIGAILGLGYAYAGTRKEDVKELLIPLLADSEQKLLVQCMAAYALAT
                     VFVASADEDISETMMNCLMEVPENKLKEPCVRYLILALGCMFLGRQEAADTLLDATRA
                     LPVAIQRYTEIVVRSCAFAATGNVVVIQSLFHVIAENDEAPENDEEKNDDEAREGNAS
                     EEAAAKPEEEKTAPLNHKAAAVLGIGLVAVGEDLGMEMTKRAIIHSLLADTVSKGKDP
                     MSGRCAVPLVYALLSAGNPNMPVVETLNRLAHDSDLPTATNAITAMGIVAAGSNNARV
                     ATKLHSLSSYYQKPIFAGATFAVRLAEGFCAMGKGHLTLSCMQNDSNVVNMTALMGVL
                     SLLHSSLDLSNTLLGECHYMFYAITPSISPRMMMAVNEDMEPVDAVLLRVGLPVDTVA
                     LPGNPKAITGFQTQKTPVLLSATDKVECADVKYVPVGTVLEGICVVKERPQAE"
     gene            complement(<42670..>45165)
                     /locus_tag="LMJF_29_0130"
                     /db_xref="GeneID:12980869"
     mRNA            complement(<42670..>45165)
                     /locus_tag="LMJF_29_0130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722039.1"
                     /db_xref="GeneID:12980869"
     CDS             complement(42670..45165)
                     /locus_tag="LMJF_29_0130"
                     /note="previous protein_id=AAZ09464.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722087.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980869"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9ADL5"
                     /translation="MRSQRMQLHRAADKRQRRPQVMTENSGFNAVHDYKLDMEELAKI
                     PPSLGLNELQGWDVAQAQEKRLQRSTVHAVAAPKASPPLKSASGPSTSLAAAAANPLH
                     AVGPAREDTRTYTELLDWYSMHEFIIRKGKALRNTPEFASFKRYSASSWGEVDGLIEV
                     LEEMLRSYGVELAYVDGKRLAQLASYQAPDLVSAKEMLECINNAEEVLPLLMDASRPY
                     RYGPKRHQVAATKIQATWRMYQQRLAYIHLLIGTRAAIAIQRQYAMYRAHRMTRRTIR
                     SIRETRMTQWRETMREFKAAWPRIEEGRRVIVHLPSLSYPTYQAKKMPFYEARQLGQL
                     TRLSVLADPHVQLVFVVPVKPETEIQQYYMSLLAENGVSNVAGRLTFVVPENVRRLPA
                     GMSLTRMVLLSPRLLKLLSALCTGKPAYILPGVVGVEELTLATQLNIPMLSSEPHLVQ
                     AYGSKSGCRRLLAASDILTPPGATQLRSRVDLLHALAGLVVGRRAVQRWLVKLENEFG
                     SQGHAYLDVNRLSSLQNEGSASGSVDAASSAALSAAVFHELEVNGAKRMRLVHPNSYP
                     NWEAYLAMFDAVGGCVEAVLPGLCTSVTANVFVAPSGEVRVESVVEPLLAPALTAMGS
                     LFPYRSSVPYTAVRGASLSLGQAAYRKHIMGYLSVDFVVTTEVDAEGDASFSPQTRLW
                     GVDVDFGLTTQASAHALACVFSGSVWDEKSGSCVNQSTGKPLVYVYSGVLYNPYISSI
                     RHSSFFSLCCNRGLTYNCSRQSGIVFHFLNLLLCNCLGVLSVGSEEERVVQQITEFQA
                     LLNMQFPAQGQHSADSNCVYFSSLVRQLSQFLT"
     gene            complement(<46143..>47156)
                     /locus_tag="LMJF_29_0140"
                     /db_xref="GeneID:12980870"
     mRNA            complement(<46143..>47156)
                     /locus_tag="LMJF_29_0140"
                     /product="DNA-directed RNA polymerase I-like protein"
                     /transcript_id="XM_003722040.1"
                     /db_xref="GeneID:12980870"
     CDS             complement(46143..47156)
                     /locus_tag="LMJF_29_0140"
                     /EC_number="2.7.7.6"
                     /note="previous protein_id=AAZ09465.1"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase I-like protein"
                     /protein_id="XP_003722088.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980870"
                     /db_xref="GOA:E9ADL6"
                     /db_xref="InterPro:IPR001514"
                     /db_xref="InterPro:IPR009025"
                     /db_xref="InterPro:IPR011262"
                     /db_xref="InterPro:IPR011263"
                     /db_xref="UniProtKB/TrEMBL:E9ADL6"
                     /translation="MRLEIVECVKNEHAAGETLTFQLSEVDSSFANALRRVMLAEIPT
                     LAIEYVTIRQNTSVLPDEMIAHRLGLVPLFSEKAKRLNFPQDCGCGGSGCPDCQITGS
                     LKVQCPPNQHSKQVFIGDSLQIDDAEVYPVSAEEHGIWLVTLGRSQVLDLHVVIRKNI
                     AKTHAKFMPVATVAMRYAPEIILNPNGFQTLGKAKAREWVARCPRNVFRFVERTGQVE
                     VQDEDACIFCRECTSQEPPFDRLPEPLVFVRQKKNKMGYFDFTFTVESTGVLPVLQIV
                     YDAVAVVRKKLQRVSEGLMKDPNTDGVKTRTIGQSTTAPVVPNADAVRKGAEEDNLDF
                     TMQ"
     gene            complement(<48527..>50608)
                     /locus_tag="LMJF_29_0150"
                     /db_xref="GeneID:12980871"
     mRNA            complement(<48527..>50608)
                     /locus_tag="LMJF_29_0150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722041.1"
                     /db_xref="GeneID:12980871"
     CDS             complement(48527..50608)
                     /locus_tag="LMJF_29_0150"
                     /note="previous protein_id=AAZ09466.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722089.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980871"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:E9ADL7"
                     /translation="MMSMRPTTGMAPPPTGMAFSATGSSHTGPMRPTTTMGGGTTLGR
                     IQAQVQEGTFTSTVYGYIRDHQYEEAVELLATQLEEFPRSRAAASLMAYCYYMMGDYG
                     EAASLYEQLTKICPNIEEYRVYYAQSLYKAGAYAESNRLCTLITSPQNQTTLNKLQAA
                     IAYEQEDIPQTKSFLDQAPETDTDMLVLRACVLSKEGSYEEALEKFKEAQNAVGFSAA
                     LTYNMALMYYKMEQYGPALRHLAEIIDRGVEEHPELNIGTNTEGGEARSVGNTQLLRE
                     TALIEAFNLKAAIEYASKNMQAAKEALTDMPPRTDAELDPVTLHNTALINMDENPTNA
                     FKKFNFLLQNPPFPPETFQNLLLFYCKYQYYDLAADVLAENPHLAWQYLSQNNQSLYD
                     FLDGLITAQTSPAEAYRKFDILAQKMVQQLRNMTRRIQEADQSQDAAVAKTAVRTYDV
                     TLEEYIPVLMAQANIYWEMENYPMVEQLFRQSADFCSENDVWKQNVAHVFFMQETKFK
                     EAIRYYSPVVEANRENILNCSAIVLANLCVSYIMTAQNEQAEEIMRRIERAEERLTYE
                     DSSKQPLHLCIVNLVIGTLYCSKGNFEFGISRIIKSLEPYDRKIMTDTWFYAKRCFLA
                     LAMNLAKHMVSLKDSSFEEILFFFDQADLHGEKIFAFIHPDPSKQDTSPRNTARWEAR
                     QLKKLYLTLKE"
     gene            complement(<51437..>53146)
                     /locus_tag="LMJF_29_0160"
                     /db_xref="GeneID:12980872"
     mRNA            complement(<51437..>53146)
                     /locus_tag="LMJF_29_0160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722042.1"
                     /db_xref="GeneID:12980872"
     CDS             complement(51437..53146)
                     /locus_tag="LMJF_29_0160"
                     /note="previous protein_id=AAZ09467.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722090.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980872"
                     /db_xref="UniProtKB/TrEMBL:E9ADL8"
                     /translation="MAAGTRRGLVLLGTHSFVVQSLRVVFTALFMEYYVHGFLLIVDT
                     RKGKKASLTDILEWRLRISKLGLCVLVAAQLMYTIASVLDGSGVVAFSSVVARVWRLT
                     PRQRLASNEHCFALAFGVSWWMLRLPLVPSAVSFTLATAVVGILSDRCTAFAQKLARE
                     MATQRPKEERLVQLASRAASGGAAVVVLVAALLYDGSCPKRKFLRGFHWCLLLLSGAA
                     VCAFSGLQRWRCSSHGEEAPSAARGECSLSSHSVSGFGGATMIEFQGFVRQTWQRRSM
                     KALLVVRALHCYVHAVVVGFFHLLLTLGCAPRLSAAARAIILTFVVAAPSFLAPMHIA
                     SAGAVGKKRLVLIMLLGVCALGLVSLVAAFFMRGAVEVAVAPALGEGGTATSSGAGIW
                     LCAILLTLLRLLLDSVRDVLELAQEDVVEEDAILFGRATPMASWTRRLCALVTTPMES
                     LSRIATVLLLAFTNAFESVVLAPPAIIDNSTITQAASALQRAAAALALEQASLSSAFP
                     AVVATANATSTVLALLSLHTSGVALLMMVVWHRYYNLEGKHLLFVQMATRKRKDEQCV
                     ALI"
     gene            complement(<58422..>58835)
                     /locus_tag="LMJF_29_0170"
                     /db_xref="GeneID:12980873"
     mRNA            complement(<58422..>58835)
                     /locus_tag="LMJF_29_0170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722043.1"
                     /db_xref="GeneID:12980873"
     CDS             complement(58422..58835)
                     /locus_tag="LMJF_29_0170"
                     /note="previous protein_id=AAZ09468.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722091.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980873"
                     /db_xref="GOA:E9ADL9"
                     /db_xref="InterPro:IPR007062"
                     /db_xref="UniProtKB/TrEMBL:E9ADL9"
                     /translation="MSRLKHVEWDEKNLEANAEYQRQHPVTIHITEPKTPYSYADGDD
                     LEAEEEGLLKWDPAVNAKVKEIKEQIAGDFSDRPVAPIAKSGRPMLAEGTSTGELAQQ
                     QHQKEFRKMRKAVYADEGAMFKRALSHECKDEDDE"
     gene            complement(<59536..>61149)
                     /locus_tag="LMJF_29_0180"
                     /db_xref="GeneID:12980874"
     mRNA            complement(<59536..>61149)
                     /locus_tag="LMJF_29_0180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722044.1"
                     /db_xref="GeneID:12980874"
     CDS             complement(59536..61149)
                     /locus_tag="LMJF_29_0180"
                     /note="previous protein_id=AAZ09469.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722092.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980874"
                     /db_xref="GOA:E9ADM0"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="UniProtKB/TrEMBL:E9ADM0"
                     /translation="MSDPVGARHGREPSFPFDDSGSSFSSLSYSYDSSRSPSRSYSYS
                     SSVSSSSSDEHPLRGHRRLRSRSPSEDSAHKQPRSDSVLGDDLLFTSGHSAPPPYHHP
                     SSSSAPVLPPVLGDAVLPATHGGQLSSVLGAPDTPNEDWPCGVCSNINSKQRTSCFRC
                     GCHYAESLLAMPGYEVSLTHLPASCTSAMVEEALRRVAPNCSLHYIGTDAEKGIMYIQ
                     FSSVEEATKCLVQSHCELQLRDRGGEDGASVRTRLSFSLGPHPRHERKETEEQVARAT
                     AQAAAERQEAALQKAGVPRFLWPHTWRQPPSFPSAEKCKVFLSTMSAHWDHLSEEQKR
                     YYDAEVKKALLRTAASTESTAKMNGMPASSPAKAGAAAEVTAPLSAESSPASSSLATP
                     AEAKETGKTSHALDGLKKRLAERKSAMKKVDGPEGAKAAAAAAAAGTQAGGPVAGHGK
                     DVSSGGSGGAGGLASSLRGCSGDFPATPSQMPAEVLLWDGFPVPLQYTSLGKVPRSID
                     LPRVPMSVCERLLPPALLQVARMQFKQAR"
     gene            complement(<62282..>65344)
                     /locus_tag="LMJF_29_0190"
                     /db_xref="GeneID:12980875"
     mRNA            complement(<62282..>65344)
                     /locus_tag="LMJF_29_0190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722045.1"
                     /db_xref="GeneID:12980875"
     CDS             complement(62282..65344)
                     /locus_tag="LMJF_29_0190"
                     /note="previous protein_id=AAZ09470.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722093.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980875"
                     /db_xref="UniProtKB/TrEMBL:E9ADM1"
                     /translation="MEHYEDSFESATTAMNEEEEAMSVRTSSTAATSGDSVDAGDDGS
                     VGDVDDAISGGKGMSDVLTLSSAATLSPTARYLALPLPASPVPVPVPVPTLTPSPASA
                     LKGDSENGLHASSILSAQNASACKRPLGFAPRATVGAVESEERSASLTDSARAQHLAT
                     LEASCVAQGEFAGNSSDDADHSRRGLKGVGFEALAHFVAFGDSGNYSTTGPTSHRHSS
                     VIRTGVEGFPSPLGKMLTTKREVEGESPREGEELRPTADSLASQSTSARQAELPQKTA
                     ASKAASVAASSVFSTLSQHLQQQKPQRQQPQPTLVPAPAVNSAPVVPSIPTPATTLPT
                     TPPASFKVPTASPALQGCASLSLPALPPPGWSSTTAPNNATAGMGTPLTVLSAAAAKD
                     ATGTQHGWMIGSVQYRTSPTDTEAVQQIPPLPPPYEHPRPIAEQTRTSELREASEAVE
                     RLVKAFAMLKGYNRLEQAKSRSRPLADGVPASVEAVADVVASARQARAASTVQVRDTV
                     RPRRSRVCAPGVASAATLASTSAAAVALPWVSAPRREDSESVAEDVVLDCVLGLLQER
                     TRGTGTSSTGEHEWEGVRSTKRPTAASSWQAARPHYEVVTADTFAHGGGAGGHGRASH
                     FTAGTVSAAARTQVYFNSSSAFLGGLGSSSVPLFDPRDLQSAVDLYNAVREALDKYVL
                     RRVATGAEKAEGPEPHVSAPRARSITAIFAWALLLDMVNLCEEIARVAYDAAPRTPSA
                     VYPVLAQFRGDAACEEVVKAAMHCLPFEALHTSGADTLAPGDGGCTFRMACWVTQQQL
                     WTIADAMVDTVREDMVRRAKALKYSPFNTAAVAEVDPRLLVPPTTPMLTLRPLPGRRG
                     GGAVPKVADTSTTAGTAAACARVHGGGRGEGGGPDSGSAGNELFEMPAAALQKVAYHV
                     SVLTTDLLSDMSTANHHELSALTAEDYPDVATAVSETMSELLHDESIKAAVRRRAAEK
                     VKQTQRARADFAATSRQRKEQAIIEKAEKEAEEVVQHILQEMRAQGVA"
     gene            complement(<66614..>71344)
                     /locus_tag="LMJF_29_0200"
                     /db_xref="GeneID:12980876"
     mRNA            complement(<66614..>71344)
                     /locus_tag="LMJF_29_0200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722046.1"
                     /db_xref="GeneID:12980876"
     CDS             complement(66614..71344)
                     /locus_tag="LMJF_29_0200"
                     /note="previous protein_id=AAZ09471.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722094.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980876"
                     /db_xref="GOA:E9ADM2"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9ADM2"
                     /translation="MSANDANAGSSMSGGADGSRPPHGALELPPVMESVLRPHQVSAL
                     EFIWRRLVLDGALRMAARTFSSTIEQRTRLYQEVFGVILAHSMGLGKTLTSLSFVLLF
                     QAQALLMAMKRERVRRQQFGSASAATAASVALKGAVCPALRVLVLCPRSCVLHWQASI
                     SEWIQPRYAGTMKVNSYVPSAMGVSLSATHRGTGGRSIEDVLRSFYQEGGLLLLGYEE
                     YQRILQYAQTQYRSNPTNKWPRVWSLLDRLRLHLPLFQEVRLLDIIETADLVILDEAH
                     RLRRSSSNLVTALTQHIRNIQLRLALTGTPLQNHLEEYNTMQSIITGRELDTQLFHKH
                     FIAPIERGQCVDATYPQFLEMQRCVASLRRYFADSAHHCGPEVLAATLPPRREFLFFF
                     RLSAAQEAAYRAMLKYFHTQVAAGEKGDSVLRLHHVASHICLHPALSELEEPRSSTAL
                     ASCKDGEEDGDDEDEDATLAAPPTLPAAALTGVDVSMSPKLSFAFHLTVHIVREQREK
                     VVIFSQYLSHLRLMGQLLAREGISAPSLTGAASDAERCRCISELQNNDACRVLLCSVR
                     AGGVGIKLTAASHCILLDVSWNPTDDMQATYRLYRYGQLRPVNIYRLATWGTSEHIVF
                     AYALQRSWLQKKIADISDPRRQQRHQTRSYFRYPCAVPLPDDGSSLATDEQVALQQSR
                     PALKETLASSCRPDYALEVCEIQCPIAACVLRAHPEEKAYLYTVIPQSVLLLHNEDDV
                     IRERGRRFEDAAHKSRASVAIPLQMPSGGAPPAHAREDVSLLDACEAELVDAARQAAH
                     LVITHVLRAREEAVSESDTVSEVRMLDQSMCQRLQPLLAPVLEKRPPPRFLAEVLLLC
                     YQAGAADLFRTLLQSSSYLKLRTYLASRVPAVTRRRTRDTALPTRSPLEEALLFTPVS
                     LFKSMSSVEATYVATELGCDRPFVGFCLLRGLQKLWFVDGRLAISEAALEALATLLGI
                     TPGRIDGDSDSAEDEGTAEGEDGGRALSRRNDDGTFAEALAALAQSVLTAMTSCLEEQ
                     WPPYEGFALPPQHVQLDREEMRMGRAYRAASRAHMEGLLPIAQVADLLRLPSYRQGQH
                     MYGCARCRSPLLQRLDATHLECPRCHYNAEFEVRADPRTQQQTVLYQLSVVANLLDAF
                     SITKSFAVSFSPAECADASAALREVHTSQAVFEFVRRTMEEGVQAFLSEYPPRLIRLL
                     GLQMGTGGDVEALRRVLLTNGRLASHTNVREHLRQRLAQAFADFVHPSTLTQFVAMPL
                     MLIVTALHYLARCERLTYAHELLLDECLTPRRKLLRFASDALVKVLYVERLLKHCRQK
                     PLPSSYASSMSVTACGATLGSGAVAPQKGAVSNDADDAASLTSLVMAASSSSESRSRS
                     SASTSSSSSFHSDSAAGTQPAHKDPLAHLMGSSGSGSRTASASSSPSSARHSSSSSFI
                     SVYSSDRASFPDGGESDAEERDEVMRGQHGTLTWLEELAGNTLERAAPTAEELESEAV
                     QQQRSAQYWIAFCEVYGTHSAETLTVYIEDTASGAKVLPPPPLSCWISQVAHTTMAGH
                     RMTDMLDIFFKKLLELSQQVRVIS"
     gene            complement(<72543..>73346)
                     /locus_tag="LMJF_29_0210"
                     /db_xref="GeneID:12980877"
     mRNA            complement(<72543..>73346)
                     /locus_tag="LMJF_29_0210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722047.1"
                     /db_xref="GeneID:12980877"
     CDS             complement(72543..73346)
                     /locus_tag="LMJF_29_0210"
                     /note="previous protein_id=AAZ09472.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722095.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980877"
                     /db_xref="UniProtKB/TrEMBL:E9ADM3"
                     /translation="MIARQRPTTVAALLLLLCLLASASLVDAWGSSDDAKAIANREKH
                     EQIQFWEREVNILRQGELKRAYNKLYQAETALESARAKQGFFYTRPQDKATIRLLDED
                     YRRTLMTVKALKEQERLIMTKLKPLYGVVSLHFAQEQKRTISESIKTVQSLSYDNAWY
                     SSLFSLGEAESFSDIIMGFIGNWVIGFVILYPFAVLYYALWAAPWSVYEYTSGVADLV
                     PGAVAYAACVVVMCLPLIVLALTFYLLIRHYGPQLQAAAQQAQARRHQD"
     gene            complement(<74726..>77626)
                     /locus_tag="LMJF_29_0220"
                     /db_xref="GeneID:12980878"
     mRNA            complement(<74726..>77626)
                     /locus_tag="LMJF_29_0220"
                     /product="putative protein transport protein Sec24A"
                     /transcript_id="XM_003722048.1"
                     /db_xref="GeneID:12980878"
     CDS             complement(74726..77626)
                     /locus_tag="LMJF_29_0220"
                     /note="previous protein_id=AAZ09473.1"
                     /codon_start=1
                     /product="putative protein transport protein Sec24A"
                     /protein_id="XP_003722096.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980878"
                     /db_xref="GOA:E9ADM4"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR006895"
                     /db_xref="InterPro:IPR006896"
                     /db_xref="InterPro:IPR006900"
                     /db_xref="InterPro:IPR012990"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:E9ADM4"
                     /translation="MMYSAGAMYAEIYRNQAAAAAAKPREESAPPPNLHHTFEDPNQF
                     YTAPALGYGQQPPVPPFPHQQQQQGAPAGCPPMGGSGPYGQQPAQPPFVSPHSQANPY
                     GDVYAASPPQQGYSSYAPPPPPQHQQQQYNAPNQLPQQQYGNYTQPPAAYGHQPQMNQ
                     PQQPLQPYGTPGYTEQLHPDFIRVTQVQLRKSSNKPGALYDHPSVPRMMPQDIEEDLQ
                     QRMPAPVHITPTHRLCIRPTMGTFPQTQQLADSLGLPLGINFRPFAEPRLNEVDLSDK
                     GNAMIRCKACGAYINPFTTFTEANDGSRWQCILCKHINVTPRAYFSHVDPTTGQLEDI
                     MSRPELLNGSVDFYATPEFLKRPPRRPVFLLMLDCSFSAVASGLLEAMCRGALMALDS
                     MKDDDALYMGIMGYDSTVYFFNLRSSLRAPRMIASPDTVKDIANVNDDFKLEKVELPC
                     PTGDLVVSVKESHHLLRMALESIPNVFASTKEVGCAFGPSLAAAVTMLDANGGKILAS
                     ITNIPSEGDGKLKHRFDPAKLSNQPKEYTMCAAANDWYKQRALACSNSAISVDFFVGA
                     NKDVDLTTIAPLSRFTSGSIHRATAVTMSGMADQVQRSLLRFTAFDCTLRVRTSKGLI
                     VPNFYGHCHVRVPDLLVLPIADEDSSYSIEFKMGPNYTAKFAYVQLAVVYTTRSRERR
                     IRVHTVQIPVSSTIGPVINSINSLGMSCFLTKMCVDMAVNGPFPQAQEKITEKLTTAW
                     KAALKQMEAQGVRPGAGELLIPDSMRFIPQLLCGFFRCAATGLATVRPLPPDERVASM
                     SSVMSCPIEAMVPWYVTWTYVVYAPEEDVSQLPASIFSSEQCVHREGVYLINVGAVIV
                     LWFGKHVHPTICQLFGVDPGEMTPEKAGKQEQLSASPEQLEALRQRVEDLIWTHRRIN
                     RSVFTAVMEPCAQGNATYEPMMKRGMGEDNTRNLIAYGSYLRKVWDAVSVGK"
     gene            complement(<78616..>79263)
                     /locus_tag="LMJF_29_0230"
                     /db_xref="GeneID:12980879"
     mRNA            complement(<78616..>79263)
                     /locus_tag="LMJF_29_0230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722049.1"
                     /db_xref="GeneID:12980879"
     CDS             complement(78616..79263)
                     /locus_tag="LMJF_29_0230"
                     /note="previous protein_id=AAZ09474.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722097.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980879"
                     /db_xref="UniProtKB/TrEMBL:E9ADM5"
                     /translation="MFRLSSQRLVFRKLSQTKLGSEVLAQTRSEMRHLERKDNALMRF
                     MTRRRPIDYLAIEVDGPVTKELHPSFRHVKNGITCFVFVPFLALLVAGYLQPTYYLLV
                     PTGLVPYDHYVRMWSFSNWAVVLAGQLFFALVVYDLSVYARYPFFAYVLAPAYRKLGW
                     FRPLPAASLTIEQLKTGASRRVHARPLGRPLGDVQRQRKAAAAATADPFGRTPRS"
     gene            complement(<80614..>82230)
                     /locus_tag="LMJF_29_0240"
                     /db_xref="GeneID:12980880"
     mRNA            complement(<80614..>82230)
                     /locus_tag="LMJF_29_0240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722050.1"
                     /db_xref="GeneID:12980880"
     CDS             complement(80614..82230)
                     /locus_tag="LMJF_29_0240"
                     /note="previous protein_id=AAZ09475.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722098.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980880"
                     /db_xref="GOA:E9ADM6"
                     /db_xref="InterPro:IPR000687"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR018934"
                     /db_xref="InterPro:IPR018935"
                     /db_xref="UniProtKB/TrEMBL:E9ADM6"
                     /translation="MRFAKDAELLQYMVPGSTLADIVSSEEDDDDYDAYFDAPEAKAE
                     GVSGVVPGEGSAGTGTNAQGAATSLAKFQPAQHKNADSKVLSRIHIDDYYDGHSSGGG
                     ASGGAQSNQRVLNELRDMTMSSRFAQNAASKNVDRSERATVENVLDPRTRLILYKLVN
                     SGILSEINGCVSTGKEANVYYAVSGDGSPAALKVYKTSILSFKDRDQYVSGEFRFQRY
                     CKSNPRKMVCTWAEKEARNLIRLQDGGVLAPAVKLLRQHVLIMEFLGEDGWPAPRLKE
                     VTFPSAKALDTCYLDLCCTMRKMYARCHLVHGDLSEYNLLLYRGRVVVIDVSQSVEYD
                     HPRFMSFLRRDIVNVNSFFRSRGLTRLFRLQDLFHFITADPAKSGWQRCQGPPNDEEL
                     MARLKEVRDGYGEGGAVPIDAEQAKVDEQVFLNITVPRSLNEICDRAGPNKEVAVFVE
                     GMTAAPAAAQTEDHSGADGEDDEDCDDEDSETGDANSPMKAKAAPQAVLANMTKEERK
                     EHRKAVKEANREKRAEKKKSNANRKKKGRK"
     gene            complement(<87481..>88440)
                     /locus_tag="LMJF_29_0250"
                     /db_xref="GeneID:12980881"
     mRNA            complement(<87481..>88440)
                     /locus_tag="LMJF_29_0250"
                     /product="putative thymine-7-hydroxylase"
                     /transcript_id="XM_003722051.1"
                     /db_xref="GeneID:12980881"
     CDS             complement(87481..88440)
                     /locus_tag="LMJF_29_0250"
                     /EC_number="1.14.11.6"
                     /note="previous protein_id=AAZ09476.1"
                     /codon_start=1
                     /product="putative thymine-7-hydroxylase"
                     /protein_id="XP_003722099.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980881"
                     /db_xref="GOA:E9ADM7"
                     /db_xref="InterPro:IPR002283"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR026992"
                     /db_xref="InterPro:IPR027443"
                     /db_xref="UniProtKB/TrEMBL:E9ADM7"
                     /translation="MSLPVIDIAPLYSDNKADLLRVAHAIDEACRTWGFFYITGHHIP
                     KERIEQLTTMASKFFALPQEEKLRINIEKTSNHRGYGMCAAEQLDPSKPGDWKETFDM
                     GFHLPLDHPSVVAGKPLRGPNNHPMWIEGWTELMEQHYSDMQGLALLLLRALALALDI
                     DENFFVSKFHEPLSVFRMIHYPALPDEKGRVVCGAHTDYGIVTLLYQDKVGGLQVQNL
                     QGEWMDAPSLEDSYVVNIGDMMAMWSNGRYKSTLHRVINQGVERISMPFFCEPNPETT
                     ISCLPNCFDDANPSKFPDVKAADWLLKRFQQTYAYRADDLKSQ"
     gene            complement(<89214..>91067)
                     /locus_tag="LMJF_29_0260"
                     /db_xref="GeneID:12980882"
     mRNA            complement(<89214..>91067)
                     /locus_tag="LMJF_29_0260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722052.1"
                     /db_xref="GeneID:12980882"
     CDS             complement(89214..91067)
                     /locus_tag="LMJF_29_0260"
                     /note="previous protein_id=AAZ09477.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722100.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980882"
                     /db_xref="GOA:E9ADM8"
                     /db_xref="InterPro:IPR004344"
                     /db_xref="UniProtKB/TrEMBL:E9ADM8"
                     /translation="MYFSPSPCLCRFRGHLVLVHKYMRVHEEKHTHMHHAQHPPPVSS
                     AGGPLREPSGGIVIDCRSTRYHVVRAAARMVDWTVYDTDTEERPPPLFHGVSLESPER
                     VATPPHAPQVVWVDKSVVRSRVAEVACYQRLNHYAAMNVIARKALLFRRLMQLSRLPS
                     ADSARSKRLGGGAAVDGTNGVESTLERFLALSVPASFSSLTDLGRLAAFRRELAERAG
                     PSSEARPVFFIIKPNTGCEGRGIRLTTSPEADLTEAERRDQKRECVVQLYVDRPLLMG
                     GRKFDLRLYVLLVAIVPRQQSRRSTATPAASCDVSTVSKSAVSESCSNSTEVPRDVQG
                     VELYVHREGLVRVCAEPYAAPTDGNCGDASRHLTNYAVNKTSSLYVPAADDDVAEPHV
                     DVGPSPRQSRAPVDREDSNKQSLAAFASFIESLQVPGGWPRVRRSLDECITLTILSGV
                     EVLRRELIGAGGARGYRADGRSCFELLGFDVMLREEDLHPVLMEVNHSPSLFCDTAFD
                     FAVKSAVLRDTFRLLETHIPPWGQHEGSPQRYEACMQGDAKAWMEQRADMLVRGAAAE
                     PFGFRRLLPHYSAGCGTGGTERPGDGAGIDDWLPAERAAQQRMVELSRRLP"
     gene            complement(<92015..>93070)
                     /locus_tag="LMJF_29_0270"
                     /db_xref="GeneID:12980883"
     mRNA            complement(<92015..>93070)
                     /locus_tag="LMJF_29_0270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722053.1"
                     /db_xref="GeneID:12980883"
     CDS             complement(92015..93070)
                     /locus_tag="LMJF_29_0270"
                     /note="previous protein_id=AAZ09478.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722101.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980883"
                     /db_xref="UniProtKB/TrEMBL:E9ADM9"
                     /translation="MRVPHLPSVLPNMVYVGYTASLSLSGLFPAITFFSCCSSEEHDR
                     TRLVQRNRVANGSVFDLSRLPSLPSLLFLLCASQACANLSFLDHLSHKLHASPQRQRR
                     MPFWKNYIYTKPEVDDDDLPQAEYRLFDDEGRMIDDNVVTMAVTAWRRSSTSSKASAN
                     AKKSPPLSQKKHASLLKSVGAKLTTPVKEADLKDFSHSPSKAASHSPHASKLAARLPA
                     ESPARANSPEPQLVTSARSTPRKASPKKAPPKKISPKKSSSKQSSPKKAASRSPARAR
                     SPSPTKPKSAAKTSARRRRSRSRSNSRRKAATAPSKTPSPKWTLAALKEFAKDNSIQL
                     KGVKTKADILGAIHGSP"
     gene            complement(<95982..>97457)
                     /locus_tag="LMJF_29_0280"
                     /db_xref="GeneID:12980884"
     mRNA            complement(<95982..>97457)
                     /locus_tag="LMJF_29_0280"
                     /product="D-lactate dehydrogenase-like protein"
                     /transcript_id="XM_003722054.1"
                     /db_xref="GeneID:12980884"
     CDS             complement(95982..97457)
                     /locus_tag="LMJF_29_0280"
                     /note="previous protein_id=AAZ09479.1"
                     /codon_start=1
                     /product="D-lactate dehydrogenase-like protein"
                     /protein_id="XP_003722102.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980884"
                     /db_xref="GOA:E9ADN0"
                     /db_xref="InterPro:IPR004113"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="InterPro:IPR016164"
                     /db_xref="InterPro:IPR016166"
                     /db_xref="InterPro:IPR016167"
                     /db_xref="InterPro:IPR016169"
                     /db_xref="InterPro:IPR016171"
                     /db_xref="UniProtKB/TrEMBL:E9ADN0"
                     /translation="MNAVEEFEFEPFTARQSKYKACLDELVALNLGPKSMVTDAMTLR
                     KFYSKDKSSHARSVPVAAVRPNSTEQVAAVVQVCAKYKVPMTPRGAGTGIEGACIPYA
                     GGIVIDTDRLTRMDFDLDNSCVWVGAGVRKMTLNKAAAKHGFVFGPDPSSNPCVGGMV
                     ATSGSGMCTLRYGTTRENVLSLRVVTPQGTVVQTRQVVRKSSAGLELTQLYIGSEGTL
                     GVICEVCFRLFPIQKCSSGGVGFFATTRAAVRAVVALKQQGVPHTLLRCELLNKESVA
                     AANSYNKTNLRVSACVLLEFVCDSAGQRHIHGDYKKVAAVFKKFGAKEVRYLKDGKAM
                     DAVWEARRSCFFSAMHAIKTKGAQSVITTDVCVPISRLAECVEATEEDFKQNSRPCLI
                     CAHISDGNFHTLVPYTDAADFKRARELEIRMVRRAVEMGGTVSGEHGVGIGKVRHVTQ
                     EHGKAHICVQETIKKALDPDNIMNPGCFYPFQQVMYPTAHL"
     gene            complement(<98701..>99915)
                     /locus_tag="LMJF_29_0290"
                     /db_xref="GeneID:12980885"
     mRNA            complement(<98701..>99915)
                     /locus_tag="LMJF_29_0290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722055.1"
                     /db_xref="GeneID:12980885"
     CDS             complement(98701..99915)
                     /locus_tag="LMJF_29_0290"
                     /note="previous protein_id=AAZ09480.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722103.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980885"
                     /db_xref="InterPro:IPR026319"
                     /db_xref="UniProtKB/TrEMBL:E9ADN1"
                     /translation="MSATRDGSRSHSDGGFDGRSLLSEQTKLLRESTPADINFIQFLK
                     LRLSAQQRATAQRNYWQRVQREAADSMNANTAHRQGRGGISASVAPVSTSAAGRESEA
                     SSNHIGSGRRNWHAAGSAEGASFSTYDAEHMMLEHSTASFGTLSKQDAFTRATSHGAV
                     PPPTVHQHSFEDLRAAVLKRRSTPASELTDFVAVSTAELSEDGNSSQRRPSGPLQEED
                     AYALAPFIASSYSAAAAAAIDERPAMACGKPQVPVDVDEMKDVALEPCPHCGRTFAPA
                     RLERHVVTCERHRNTLPKTKGDMKSCRAFSSRKKPDRTAGGDGAAASAAATANTAGAA
                     PGGPLRWSTDTAIKPEKWRKQSAQLRNAMAGASVAVDDDRVLCPSCGRHFSDDVAARH
                     IPICKSKGGRAA"
     gene            complement(<101138..>102451)
                     /locus_tag="LMJF_29_0300"
                     /db_xref="GeneID:12980886"
     mRNA            complement(<101138..>102451)
                     /locus_tag="LMJF_29_0300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722056.1"
                     /db_xref="GeneID:12980886"
     CDS             complement(101138..102451)
                     /locus_tag="LMJF_29_0300"
                     /note="previous protein_id=AAZ09481.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722104.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980886"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="UniProtKB/TrEMBL:E9ADN2"
                     /translation="MGPATGEGWRWGGGAASRGVGPPAVRQRGRTHEGQRLCVARIGL
                     ARPLCADACGAALLCVVSAPLLSFCGCQLPHRPLQNVPARAHVCESAHAQNSRAVVME
                     APNYGRTGLLTSRRGGLPVTRPRLLLPGSSAASRPVKWYPSLLTIPQQLLDALRREDD
                     AEGADGNVPGTTTSYSSDPTLITYLRVATIAECLVQWWRRWAAAAASKRTTEALAPTG
                     PSHEQLSALYTGILQWHRDELVSGKTVPSSALAHGSSSSSTFFIPAYKLLAMKHDRKV
                     AEYANITWRSVWLLGKDPDVNDVPLEHPSCSGQHASMEMRFVLADEAALDAYVTEKVK
                     TMSPDAPMLPSSGADVPPFAQSKQALRSFCTGMWAMLEEALTSAGGDASVVWTAELQL
                     IDLGSTNHTKLNGEVVPAMEATTVIDSDVLEFGCSTRKYVVMRSA"
     gene            complement(<107207..>108253)
                     /locus_tag="LMJF_29_0320"
                     /db_xref="GeneID:12980887"
     mRNA            complement(<107207..>108253)
                     /locus_tag="LMJF_29_0320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722057.1"
                     /db_xref="GeneID:12980887"
     CDS             complement(107207..108253)
                     /locus_tag="LMJF_29_0320"
                     /note="previous protein_id=AAZ09482.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722105.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980887"
                     /db_xref="InterPro:IPR006636"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:E9ADN3"
                     /translation="MEAGARFPAAATPPASAGAAAVQGDAESEPDDERWSLSDGEPEA
                     IPAKNGEPSDADVDAAMAAKGEAAELHGEGKQEEAIAKMGEALAYNPGNAMYWGMRAL
                     YHLEFNKPRAALHDANKALELNPQNVRALRVRGTVNRHLGHWEDSLKDLSAAQAIDYD
                     DKTNETLKYVQSRATQRHKRQLARHHAEEEAAARRQEELRRQRQREAEEAAAAAEAQA
                     APGSMPGGLPRGFPGGMPGGMPGGMPGGMPPGMESVLQDPEIMVAMQDPEVAPKLAQM
                     MQNPMAAMSMMNDPKVGPVMQKIMAKMMGGGGMPGGMGGMGGMGGFQGAGGMPSHRGA
                     ADGASGSTRRDDLD"
     gene            complement(<109054..>110217)
                     /locus_tag="LMJF_29_0330"
                     /db_xref="GeneID:12980888"
     mRNA            complement(<109054..>110217)
                     /locus_tag="LMJF_29_0330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722058.1"
                     /db_xref="GeneID:12980888"
     CDS             complement(109054..110217)
                     /locus_tag="LMJF_29_0330"
                     /note="previous protein_id=AAZ09483.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722106.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980888"
                     /db_xref="GOA:E9ADN4"
                     /db_xref="InterPro:IPR001164"
                     /db_xref="UniProtKB/TrEMBL:E9ADN4"
                     /translation="MSCPASQRPQLTAAAMPVADKPKERRHRKSKEASTEGGHHHHRS
                     HEKKKGKSAATADASTSSTMTLSAPKRRGTEADEDDEDWEENRAAVERLCSQYPNNVC
                     ADCGETGTRWASVNYGVFVCIRCSGVHRSLGVHISKVKSTNMDRWSLAEVRLMEAIGN
                     AKAKTLYEARLPTGVRPSGRADAAADDAVRSFIQRKYEQREFAMRNLQDVLGRLYKDT
                     GYGRPKMASKPGAAAEGTVTSSTRGSSSAAVPTDRAAATGKRGDTMRALYGDAAAEMQ
                     RGSTRRKDAARLSAALAPKPTYGTFGMVNVPGEEYEARWQRTLAVFSSVEPLPAAAAA
                     PAGEMLSADERGKKGGTTIVTPLTDPSDTTAERPQMGGAEATPAAASASSVVV"
     gene            complement(<111289..>112575)
                     /locus_tag="LMJF_29_0340"
                     /db_xref="GeneID:12980889"
     mRNA            complement(<111289..>112575)
                     /locus_tag="LMJF_29_0340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722059.1"
                     /db_xref="GeneID:12980889"
     CDS             complement(111289..112575)
                     /locus_tag="LMJF_29_0340"
                     /note="previous protein_id=AAZ09484.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722107.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980889"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:E9ADN5"
                     /translation="MSDVDVVANFVVMTGATEDQAIHYLSTYDFNLEDAVLAFQVDNP
                     HPSPLHTGEDSAHYSSVDTGSPMSAPSPASHQVEGFAFPQAAQRPPTPPRQRALASST
                     AEAIQRLFARPDYVVGSDRATFDAECEKAASRHCWVVVSVVDNSFPCECFTRDIWASD
                     AMRSLTSGSLFCYEINVTHTRGMALAEKYHVDNGNLPRMFMVDPVTQFKVQELPLISS
                     EVWQFDSAMVVDAIMLFITNHDPPHDPFASTNDPPQNEGGGGDSAESASAGASVKAPV
                     VVDVDEGDSEAEMVSPPMISRSVAGAVASTTRTLEVGEPVPVVAPSPVTLDEYTVPEG
                     TTGDASSVFRLRCRLPHSSSTLQLRPDTPVARLIDYLAYLLYAEDTTRYSVPPRISIF
                     SGFPPKNMTAREMEGVTLSTWDGVRSGDVLMVRANA"
     gene            complement(<114301..>118275)
                     /locus_tag="LMJF_29_0350"
                     /db_xref="GeneID:12980890"
     mRNA            complement(<114301..>118275)
                     /locus_tag="LMJF_29_0350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722060.1"
                     /db_xref="GeneID:12980890"
     CDS             complement(114301..118275)
                     /locus_tag="LMJF_29_0350"
                     /note="previous protein_id=AAZ09485.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722108.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980890"
                     /db_xref="UniProtKB/TrEMBL:E9ADN6"
                     /translation="MASAEDGINRNRLRQEAGRRVQHITCGVAERQTYRDVLLHIEDR
                     FAHASHEELRPLVLPPQLPSIVRPRDPQMSKFSRGMTMRHRLKGGSSAGAFLSAAALT
                     GGPRHGGTDGHREPAEATTEASTEAASASTGFTDAHRWEMLDVTDRAFFRRLTANAPT
                     STCGSTASSTVAAPSEPRNLAASTPMDLLSTLAEKCAYLCELETAERQYVLAYERWDQ
                     QVVLEMMAVNFVTFVLKPCMDVLRKEELEQREAIAQEEDRLSFYMYNDSSLALQVQEG
                     KKALKARMLQLDRILGLTSAAPRSTALVEAPAEATHATSVTAAPASAAVPVQSEGVSK
                     GSPMSFSLDARTASLVAVTSPQLPLDTGVPSDEARRILRRYVLQRHGASLSAVGACTA
                     MAQYDNNWPQTMASAYPSGDRSDTVCQSSTLILPPIASAQAPRRNAVGIADYIALLDE
                     STKYYEQIVKTEERCRTDMNQAFYEELQVVLEWQRHRMHLERLLYWRRQRETVLQEEV
                     EALITVTPVLRLDAKVLLLLEILEGEEETARRSVQDEEHAFFQLLRQAGEDLRDVNNN
                     VSLQERCMDTLSSKVWAAEAVARRRLVIAEEADVRRYSERLYREHLTATLTGGMAQLR
                     ALWHVSTVSAQCAALQVLQKAFRRSLCGRLGWRFTHQALGCEINDARNAKKIATGKLA
                     FQSFKNTLLAERAQLCEEQAQQHLREQYKLFTNESGDRAAVCAEQEWSRNGVARARLL
                     HVEEVYAPLLTGTVVAESEARLELEVEEELDRDALLVTNTALIRIIEQKEATLLQERA
                     GRKSTVREEETSWRQLLSVEYDEREVHRIDEEARAATRETARAAFAEAAVDESCRHHE
                     RAMLMHVARMSEALVRLLSYEVGDSARRRGIEQEEAVAARNLLDTMATTQCAAYASTL
                     EQCRQVELDRVHQQAICIEEMENRASILHEEAAAWVTTEQEALILLSGPLHDLLARRG
                     AVNVISTWYTALRNGEIGRSVSRQRLRQDLSRHREERQLRSQQIAQRLHTQHVRSQLD
                     TLMMEMQKDQQEAMQQLLNTLVKFEEPRKREQIASLQEIVFGILERNAEAHLVEVRRN
                     FVNTEALIWQQESYERKVLTKAWRRTREELLEQRRLQLNEDYFALRIQRTWRKYAAEL
                     ECRRKMSVQLAQLAALEVQARAAVGLEELEEAATQLHKLCLSSLYVDTHVRQSLMRAC
                     DELAVVVADATQAEEWSERVSLLWEMCYEDCDPCLCEDEARARRVLEAQFHKPFLLQS
                     ELKDEEHLQRTMLMRERTLFLLRILAREEHQRRLSLMSVEDQQRVSLHEQLTASTPVD
                     VQVQ"
     gene            complement(<119440..>119964)
                     /locus_tag="LMJF_29_0360"
                     /db_xref="GeneID:12980891"
     mRNA            complement(<119440..>119964)
                     /locus_tag="LMJF_29_0360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722061.1"
                     /db_xref="GeneID:12980891"
     CDS             complement(119440..119964)
                     /locus_tag="LMJF_29_0360"
                     /note="previous protein_id=AAZ09486.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722109.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980891"
                     /db_xref="GOA:E9ADN7"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:E9ADN7"
                     /translation="MLRIGRTLLAEVTTINSTTASVSGRLIRIRKKSKWIDRRSTRVP
                     HNGKDIWYFGDQPSCALCHIRFRYKQDYEAHKESELHVNRLRWVETMNWWRETGEPAY
                     LKASNEQWEWFEQHVLPTKAQEMGCTLDEARRVYRQAIMTETPTWHRPLQCPTVKQEV
                     QEPRDQRWPASPKW"
     gene            complement(<123811..>127977)
                     /locus_tag="LMJF_29_0370"
                     /db_xref="GeneID:12980892"
     mRNA            complement(<123811..>127977)
                     /locus_tag="LMJF_29_0370"
                     /product="protein kinase-like protein"
                     /transcript_id="XM_003722062.1"
                     /db_xref="GeneID:12980892"
     CDS             complement(123811..127977)
                     /locus_tag="LMJF_29_0370"
                     /note="previous protein_id=AAZ09487.1"
                     /codon_start=1
                     /product="protein kinase-like protein"
                     /protein_id="XP_003722110.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980892"
                     /db_xref="GOA:E9ADN8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9ADN8"
                     /translation="MSSRGVDGDAEHNSYQSSEQPRSPEPPGTLPLSLQQSRDPQRRE
                     VLFPNPVGAALQRKAVRSPKSCDASVAHGIVSASAVSFSSEASRKRSNNAGSPERNGK
                     DEESEEDRPSTAPAAGPRRLNSTSCCPSQMPDAEAPPGVTIAFHRYLEQTRHTILCAD
                     SSEVDRAVALDGLLMRCRELFDLLRDMYALVHVPGATADHKHLSMVKVLPYDEVSTPS
                     STSVSSTLSIPPGVALRTQERTSDAKGMPLSSKTQPWNSQLPPLSWRPLTAATAARSK
                     DAFERGRRTSASSCSSSVACIEVLNNYYVTQLIGVGATGRVYLAVDRHTCKAFAMKTV
                     PRHSRRAVSRRFPLASMSASDSEALQLEGSTLRAVRIDGATAHAAGSSTTTNVPLALV
                     RPFAMNVASARSVTRREGTRDSMDVNLCEAALESLVHVAASSHPSDAAIPFVESVTAP
                     SSATTAGSGDVEAPNTSKRRAPRTSSSKHLNGSGSPICAGGAGLHTTVLRSTNAGESV
                     GGDSVTKFVKSAHSSELPAVEREIRVMRRVCNHPHVAQLKEVIDDDKEDSVHLVMTYA
                     ENGPLTVMHGFDAVLGCAPCDVVRPFSRCARLLHQLAEALIYVHRQRIVHNDVKPDNI
                     LLTEADNILLTDFGESVLISNKLPQMPAAHMSVGAAGGEGLNASVLVPHNRWKSPRGA
                     NDSWATLSTADRSPCSSGAAGHTANTSQMMAETSFLPDSSMFLAAGVDVEGRLKGNRS
                     AIGTPAFAAPELIMSSTCSYDSDAWSFGVVLYSVIFGRLPFAAATISETFSEILNSAL
                     SFPTLEEVPERVGMTETEYHQWVELCTKLLVREPRQRLPLSAVLRHPLFRASAAVGAK
                     SSTSATGVAEMPRGRRPPSRIHSDLSSVPTLWWSNHSSQASRSVSDKEGSPLMSRAAR
                     ATMPPLMACEVAASVSAVSNRRCSTEGSTTPLTRGGAVREAVLDRHRLQTMPGSSRTS
                     SIFASTGASMASLSPPAASAGFGRRSKPIVVEAAAPQMWPEVRPLQVARLQCQCDSPN
                     SSPAGRRSFSCASSVHTASFTATDHVGRVREHTLVYKQGFASQSASAIQSPINRSFFS
                     TSTPFKESPPDRVVTPGIQSTSCTDFTSPLPCPLTRAGSSTPDLCTKDHEEDQQDESG
                     KVGSSSSNAAGAATALAVVAAPAPPASPPATSSAGRPRSVAAARGAREDTAAVGLRVQ
                     RRCSEEEPCEGDGSSGASCNFSYWDSSSDVADSGDSADEGRNQEISNKASQLPKPPLM
                     PPRRGSTQSSSGVRPLVSVQEVVAQHVKPKGRGEHLKSVAGVPYGDSTIALGSSENLS
                     ATRELVQKVRETESPVQQQVSRSSPLSNNLEANGTGRGGFSSPCPSPLKSTAEIPPGQ
                     AKRSWFWCHR"
     gene            complement(<130178..>133072)
                     /locus_tag="LMJF_29_0380"
                     /db_xref="GeneID:12980893"
     mRNA            complement(<130178..>133072)
                     /locus_tag="LMJF_29_0380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722063.1"
                     /db_xref="GeneID:12980893"
     CDS             complement(130178..133072)
                     /locus_tag="LMJF_29_0380"
                     /note="previous protein_id=AAZ09488.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722111.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980893"
                     /db_xref="InterPro:IPR024583"
                     /db_xref="UniProtKB/TrEMBL:E9ADN9"
                     /translation="MQRHATTAAVTPERDLEDRLQRALHENSILKLQKNELEEKLKKV
                     QTQFRRLAADWRRAQESGAVVSPGSVSSPCWAALPARPHSAAETGIRGSSATPSLRGL
                     LPPLNPNQPAHAPTGTSPDTAKQFKKQGSSPSFTTAAAGVSEAELAACKAALAHAQLE
                     LQQVRAAALAAAKARTTALAASSNATTKSADASAATLAVAKQEAAQLRSQLQQVREEL
                     NAALLGQQQLQAQSSQAVQGLQQQLEAQYRASIDTLAREKQELSLKVRLMEADRQATN
                     SVEAGGPDPMEMVTLQGEVHRKASEATLLNSRLQYAQGQVETLKGECNRLIEELKEAH
                     TAHADTKRALFTVEHEAASLRTRCGSMDELELALQRKTAECTNIEQELLKLVGSLQMC
                     QRETETAVRLEFDSRLTEVQEMRDTAERERREVERKLLNCQHDLAELRRRLESTQEDL
                     QLYRGQVAKLEKEKSTMSAQIAFAGHTAAAAAAAGADLTDDDVHRALAVAAIKKRGSR
                     IPKREADLGGAGGGTADRGGAATSRGDADTAGAAPAKEAREALDLFEALSWDGDWEQG
                     QMREALATAAMDLELAETRCQQMAEQVEQSREMLRKVSDERDMLLEESIALRGRVTHV
                     QTIFAKQQLQAYRAAAAASGLDTEGLITFSIRGLQSQEAAMCRSLGIANLKAPVSFFF
                     TLEGLADYEAMVGPTLRALDDVVDVRFQYEGLAKDAVTLAAIEQTTFCFQLHCAAGET
                     SRLVGMAELPGASLLNAREVPVEDTLNLIDGEGQTVGSILVEFCCARLVLPILLGAPL
                     SDPRAGEASFTLSAPEIKSAMVALRTVCHLRIQVFRAEGLGGSAEAGTAPQPYVFYTA
                     TSPLGALNCVRDTVVHPSSRAFTTDPVFDAMPVDHRVIVDPALIRFVAFGVVSFVLFD
                     ERATNVQANLGVVEVALRPLLNSPHATVRVTEKLHPQGTLSVGLSWVSGV"
     gene            complement(<134475..>135254)
                     /locus_tag="LMJF_29_0390"
                     /db_xref="GeneID:12980894"
     mRNA            complement(<134475..>135254)
                     /locus_tag="LMJF_29_0390"
                     /product="putative RNA binding protein"
                     /transcript_id="XM_003722064.1"
                     /db_xref="GeneID:12980894"
     CDS             complement(134475..135254)
                     /locus_tag="LMJF_29_0390"
                     /note="previous protein_id=AAZ09489.1"
                     /codon_start=1
                     /product="putative RNA binding protein"
                     /protein_id="XP_003722112.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980894"
                     /db_xref="GOA:E9ADP0"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9ADP0"
                     /translation="MATYKREDLRRVSFANLDEHCDEGIVYELCLQFGRIQNISWPTE
                     VNINGMPQRASRCYVDFENAEDAKYCFEALYRARVKLFNKELRVFHASNELAQSGAAG
                     SPRNGAAVIGLHEVGAKVVVRNIDYRVTEFDVTRFFESFGPFAAPPRMLRDSVGNFRG
                     VVILSYKTFEASDRVIRDMDQKVFRDRVISVHYAQMEDGSGRLHGTKEERANAALIRE
                     EERRYREMVAKEMAEVRQERQQSRVRDASWAEVNVYSRPRR"
     gene            complement(<136164..>136664)
                     /locus_tag="LMJF_29_0400"
                     /db_xref="GeneID:12980895"
     mRNA            complement(<136164..>136664)
                     /locus_tag="LMJF_29_0400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722065.1"
                     /db_xref="GeneID:12980895"
     CDS             complement(136164..136664)
                     /locus_tag="LMJF_29_0400"
                     /note="previous protein_id=AAZ09490.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722113.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980895"
                     /db_xref="GOA:E9ADP1"
                     /db_xref="InterPro:IPR005574"
                     /db_xref="InterPro:IPR010997"
                     /db_xref="UniProtKB/TrEMBL:E9ADP1"
                     /translation="MEESYVEGNLGPVFSNAEPLSLPIVARILHEKRIGAEETDKIKG
                     VLIQSCSEAVNILQEDCAPESMVNSLHGKRLRLRVGGGGVANVHLTGLQIDENGYAVL
                     PPEGTAPSAAALSSESRTERMKPFEIIALTTLRPTTTREAVELIPSLYRFEDAELDDI
                     LGMLSY"
     gene            complement(<137296..>139032)
                     /locus_tag="LMJF_29_0410"
                     /db_xref="GeneID:12980896"
     mRNA            complement(<137296..>139032)
                     /locus_tag="LMJF_29_0410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722066.1"
                     /db_xref="GeneID:12980896"
     CDS             complement(137296..139032)
                     /locus_tag="LMJF_29_0410"
                     /note="previous protein_id=AAZ09491.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722114.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980896"
                     /db_xref="UniProtKB/TrEMBL:E9ADP2"
                     /translation="MLSLLIDQCGADASDLPQLVRLNELIRAEEEGTGGGSIVAHTLV
                     ATQAPPSPPLAAPTVAPAEGTHVERQAAEFATPFVSTPAKDNTALGFLLLHCALPEEQ
                     AQCTALQRLQGLLLEETHEGGADESADGNFSPFRAKPPTLAPAPTAAAVVANAIKPPH
                     KHDHPAFSDVGAMHQNWIGATTAVPSPALPGTAPPPRPRLSIPVPILPGAGEWKGTTY
                     FRAEEAASPQPSAQPVPRHAVSAASAADISAAGVDGNAMSDETDALRASSPLQPSESK
                     ELPPSDDDKQAENKQAPVTVLLPSHAALTKETCAAQTAHETPAAGEGRRAELKAATPL
                     RPRHTPHTSSYAGRMPCPVSEALAARNSATARLLAGSGATRAASETPPVSRPMSEFAK
                     RFVMRLYERPCTPCVEATSSPIPRQHQHHTQHPPQMLAAGSGVDAARGRRASSERSLL
                     RAPLAEMWQSRQAVDACHVLPAQERASLLAQKVVTRPMLRTPTPLQHDHQHRGTGSEP
                     LRPHCTVPHRPAAGSPALLPSARPFHRHSSFPHSAGGSSGTAAVEPLSDLMVVGVRIR
                     LPAVGPKRPRHA"
     gene            complement(<140112..>141326)
                     /locus_tag="LMJF_29_0420"
                     /db_xref="GeneID:12980897"
     mRNA            complement(<140112..>141326)
                     /locus_tag="LMJF_29_0420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722067.1"
                     /db_xref="GeneID:12980897"
     CDS             complement(140112..141326)
                     /locus_tag="LMJF_29_0420"
                     /note="previous protein_id=AAZ09492.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722115.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980897"
                     /db_xref="GOA:E9ADP3"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:E9ADP3"
                     /translation="MGRNKPRSKAVDVTKSLLQPTSITDHIAVQVAANNVIQVAEDDL
                     SPTQGSEAAFALRREGKLDASMKLCLNWRQGNCYNHAACSFAHVIPYFGVSSDGGGTP
                     GTPGKPAGFNVDGGGGFTYSSAAAGGEAGGRGGNAASSSSWPQRIASPLYTATTVGQR
                     GEEDKTMSAAASAQLSAASAASVKPEVADSTDTTEVGSMAPSSNVSAPPPAVVSGDGL
                     RSILVSLTAALANKAALCAISDLAEPTDADDDVDFTQPHAAWLREMAERAEEEERATL
                     TDGAYSWQQPLKVSLAEFVEVAGKSLLGEPLWQDCSAADLYHSLADRATAAAATSMRR
                     RREAAQSQAQEEAADHVAAADPRAFSTAPTMADAGGVGARAAPLTLVDLLLDEAGGAD
                     AEDNSAPAPPLA"
     gene            complement(<142625..>144319)
                     /locus_tag="LMJF_29_0430"
                     /db_xref="GeneID:12980898"
     mRNA            complement(<142625..>144319)
                     /locus_tag="LMJF_29_0430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722068.1"
                     /db_xref="GeneID:12980898"
     CDS             complement(142625..144319)
                     /locus_tag="LMJF_29_0430"
                     /note="previous protein_id=AAZ09493.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722116.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980898"
                     /db_xref="UniProtKB/TrEMBL:E9ADP4"
                     /translation="MQLSQNVARTTVPSYYHIRTNLPQRKPQNQWEGVYYYSGITKRQ
                     QHVVLLQRKREREMYLRQYNRQVASLRGQYAAHHEKPLASLPERLMFATKLASCGMHN
                     EAATFVDAMHHGKELRAIDYVHLISSLRASDLGTCILHSEAACDPALTFKFLGDNAGA
                     ERATEAYRWYDMAMSALAHECGSLRPESTPAASQLTNALMRALMTCGYAHVKAIPDAV
                     YDRMGARGISPTASTYDHVILALALTGNAAEAEDVFRFVRHRHAEHVTVHGYNALLLG
                     NREARLFDRCDGLWQELVDRRWPRANPLTAELYLRSVVDHAYTPTSEGLQRFGSVHVV
                     EKKKVPIVLTQMDELGIPRTHLSGPLRDEVEDALRKFSIYRNRFYEWGRAVKQFDFIE
                     FRRRHGWMYDLHLMKNTTKMLPPIRDPSQPDSTMASAAMVELPAFFTERHPWERNALE
                     SLLSVTKERERMDDVRAGDIYYDDTKSIHERSSTWMNEVPETRYDQLYGINHPDVSKI
                     GIRTHLEVEYTNRKEVMEKDAALVRKSIRRGRRLRHRVEVSRTHRNEGSLTAKESK"
     gene            complement(<149466..>150608)
                     /locus_tag="LMJF_29_0440"
                     /db_xref="GeneID:12980899"
     mRNA            complement(<149466..>150608)
                     /locus_tag="LMJF_29_0440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722069.1"
                     /db_xref="GeneID:12980899"
     CDS             complement(149466..150608)
                     /locus_tag="LMJF_29_0440"
                     /note="previous protein_id=AAZ09494.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722117.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980899"
                     /db_xref="GOA:E9ADP5"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:E9ADP5"
                     /translation="MAPPRKIDLFVARAYSRKGVQSGLFFWTVLALVFAGTFVVSKIP
                     LGLYTPTVGFQQGKHREPPKQSIPPTPTTPAGRGIIRAYNQRIIAIGDLHGDIDRLRS
                     TLRAANVLEKDVDAWRKGCTDVVVQLGNVVGYGPDAPEMLQLLSGLKPQALASGGRLI
                     TLSGNQELLTLSGVLEYVHPRQLNLSAGYVGLRYLYGPGGRYGRMMAEENLAVAIVSD
                     IVFVHGGLTAAYARRGVNKLNAEWYEGAALMNLARHPFHDEESPLWDHSVVRAAMGGN
                     CGPLSAGMAALKAKENRDINLMVVGHTTMRDGKVGTWCAGKLMTIDVAMSRYVENGGY
                     EAFVSFLPMLKKVKRKKLVLGTAERVQTHYPLGPGVRAALLASTEA"
     gene            complement(<151650..>153602)
                     /locus_tag="LMJF_29_0450"
                     /db_xref="GeneID:12980900"
     mRNA            complement(<151650..>153602)
                     /locus_tag="LMJF_29_0450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722070.1"
                     /db_xref="GeneID:12980900"
     CDS             complement(151650..153602)
                     /locus_tag="LMJF_29_0450"
                     /note="previous protein_id=AAZ09495.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722118.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980900"
                     /db_xref="GOA:E9ADP6"
                     /db_xref="InterPro:IPR013765"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9ADP6"
                     /translation="MSAIVPAAHAREDMGGCAPCRVSSFHPCEGDGAEEKECNASSGA
                     DAAAAAEPLDPLRCFSAFDVLRDVLAACTCAPALSRSTEKGADSPSLLPGAPLPSAWR
                     TEQTREALRTLVDLVAADVGVSSARHGQGEAPEEAEIARSRLSVDALLLHLTTEGPNL
                     RAALRRRRRQLLPMPPRDDATTQSEREACDEAHAACEEDEALAALTRCAASVALINRD
                     LGSSARKGRKAVQTAASCVLQTRTALSLLRTSSLVHQPLRAGAGHAAASRSAIAAADV
                     SAYWCSTGCMGLDQALGGGGFRSGWVTEVYGEAGAGKTQLGLQCLLQQAATDVCHAAV
                     ALALASGADFTSLAHMATTTGMCGSRSPVVKCMEVFDRDAVEAARCAVVYLVSEDVPT
                     SRLGPLAAAAVGRAVRAVRLHPLVNQLPSGVVKTVWGCVERTCTVPTVLSRLQIRHVA
                     SVAEVLRLLEPLPHPQLAQVSRTSSPPNVIPNRAQRPRNSNLVEAVRVLAGTHGRAVV
                     VLDSVAAAVVAGQWDMQGVAQADATVTALSLRLRQAAMTHNWCIVVTNQVRAIPTTAR
                     QRQCALAPIKRARSPTTSSTASAPSVTRTVVPALGFSWASAAHCRVFLRKSLSHGVRQ
                     LVLRHAPSHPPAQASYLITEHGIEDA"
     gene            complement(<156290..>158485)
                     /locus_tag="LMJF_29_0460"
                     /db_xref="GeneID:12980901"
     mRNA            complement(<156290..>158485)
                     /locus_tag="LMJF_29_0460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722071.1"
                     /db_xref="GeneID:12980901"
     CDS             complement(156290..158485)
                     /locus_tag="LMJF_29_0460"
                     /note="previous protein_id=AAZ09496.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722119.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980901"
                     /db_xref="UniProtKB/TrEMBL:E9ADP7"
                     /translation="MAIPPLRASDLSSPSPSIAPQRERTRSVGTRLRTSITRDDAERV
                     LPASSSQVETLARDATTTCEQQLMQEEELCGPSYREVEGRRPSRALSPSGAGDTSGVE
                     DGGRARGREYVEDSDDEDVYNSHVARRIRAFLDSIKAEDFTRNPSPVDVTGMAANGEG
                     IDEEALRQQWLERATVDEARSIAAEAQRELLIVLHDAITLETDLAEMSEDAAVLERAV
                     NHREETVEMLKMQLSIADEYNEELHGAKKEALRKLSDAKTEIALLSQRNATLSKQLHE
                     KEKALQLSLARSASASARTSPPAAERRDEGTITTAELQSALIAATASTGLPNNGSLST
                     PSSPAQHGECELKGMLRKLQLVCDTLQSTVTAKADLDQQLRQWTMGVGESRADAAACG
                     SASSDAGISQPHGERCAPTDAEQRLLRRRCEDVARCIDSLENDIRMLRAKVRAQQACT
                     DAVEGGSAGRRRSAAEAEAATRPQPVETPGPASASATLPEGPGGSGGCAEPADSNLAF
                     LQRQLDRAQADARRLESELRAEREKSQRQSAAEKKLLENVAYLTRKLRAREALDREAR
                     LQRRGEKGGTHGDGGDTADGRRTLLYPHRFSHGDSAGVRRGASTAAGDVCGEGAPTSA
                     LRRVNREADAVGMGAATAAARKGRANSQELRQRRESVFAALRDAQRASDERRSSHVVS
                     DTRRSSDVQTSFSPILPTSSSRDAALKASGNAVKSGTRATTPTLTPSRG"
     gene            complement(<162464..>163810)
                     /locus_tag="LMJF_29_0470"
                     /db_xref="GeneID:12980902"
     mRNA            complement(<162464..>163810)
                     /locus_tag="LMJF_29_0470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722072.1"
                     /db_xref="GeneID:12980902"
     CDS             complement(162464..163810)
                     /locus_tag="LMJF_29_0470"
                     /note="previous protein_id=AAZ09497.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722120.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980902"
                     /db_xref="UniProtKB/TrEMBL:E9ADP8"
                     /translation="MQTCISRHHTSKLTLVGTYVGSKVAKAVLMSAATGKLTPEIVGE
                     ALMSSSTIRGHVQREAVRLLVVRISMRAPQQLQWLLNLIGDCAGSLSATDALSSLAKR
                     SLFYQVTSFGLHGSAASAITTAALQIGMTTCTLLTSNAALWRDQDNRMSLRQYRYELL
                     TSLYTSVGTVAGGAAGAAAGSMIMPGIGTAFGSVLCSVGGGYVPGYLRDKKGPDDRRR
                     QQATALRRFTPLRMHDTPDGAVFMSMEQLAETPPIAPASAATQVSEAPKTLQELQNTG
                     DTGAREGGAAKATKVDSENGDAEVGDEPVWLDFVRTETPATISLTESSADTKASVDGE
                     DGSQAPLMRSCLRFSPSLAVLSKKGSFHCDCSSGMQSGGTSFQEADAVSADAATITSL
                     SSAPSSFCDAVDAETATTAAERFEGRAKCVTASTAEELQRELEKCGGDSDVLFLFA"
     gene            complement(<165434..>166390)
                     /locus_tag="LMJF_29_0480"
                     /db_xref="GeneID:12980903"
     mRNA            complement(<165434..>166390)
                     /locus_tag="LMJF_29_0480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722073.1"
                     /db_xref="GeneID:12980903"
     CDS             complement(165434..166390)
                     /locus_tag="LMJF_29_0480"
                     /note="previous protein_id=AAZ09498.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722121.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980903"
                     /db_xref="UniProtKB/TrEMBL:E9ADP9"
                     /translation="MGNRVGDEARQRNSVAVHRIFDRNADQRARTAAQLHRDHGECAT
                     VRAASDRYDGCESTGPSLRVSSTSAAALVGTVGRDDRGVRPAWCDPRCGRLLSRSSLD
                     VPLHVSNQMKPAEHTGALPPSHQQPLLAGTALAQQPTGAVPPEDMNGASRSCFLFEVQ
                     KAQHARGIDTSLADAALTPCEARKAQLRAYHHQQAVLRYERTIPRRRVVDPYVHLTGA
                     QADVCLVAPNTYTADRLVERNGGRWVLDNPHRQQLYKGEPIMTRIMQGEFYSEGAARR
                     AAGVPRHCVLAKNRRDVRVASEINRAERQRRQSPSRHCVCSK"
     gene            complement(<167811..>168905)
                     /locus_tag="LMJF_29_0490"
                     /db_xref="GeneID:12980904"
     mRNA            complement(<167811..>168905)
                     /locus_tag="LMJF_29_0490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722074.1"
                     /db_xref="GeneID:12980904"
     CDS             complement(167811..168905)
                     /locus_tag="LMJF_29_0490"
                     /note="previous protein_id=AAZ09499.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722122.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980904"
                     /db_xref="UniProtKB/TrEMBL:E9ADQ0"
                     /translation="MFSRGVNEDVLKSEGHNVPRPMTEVEQANAEPYKMRFWYNFVDP
                     QHKNHKRPLVDVSSPFNALDETHQARRYGVQKVAVGFLSLNEFIGTHEEVPYTESHHT
                     SEIFRLWMVGLNVWYMNYFIARAQVSGNATGNPRTKFAWTIAMMLGMIRVNIAGLIGV
                     GGYFYSYEYLYTHGPKPFRIRDPTPNGWKRAWDDGQECYLPRAAASVFPALGYAFFMG
                     RWKKSGFWFTITLCAGIYYEYARRNILSGSRLFYSYLANQDSQRQAAWGSLAPNLKHL
                     VDPDTNRNESVAQFKYFRITSGTLQDTVWSNCTHETQPLARSGIKIPNPYFNWRKAPQ
                     NYNAKPWKVKNDMWEMPQVLNAQMRSSAMD"
     gene            complement(<174568..>178119)
                     /locus_tag="LMJF_29_0500"
                     /db_xref="GeneID:12980905"
     mRNA            complement(<174568..>178119)
                     /locus_tag="LMJF_29_0500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722075.1"
                     /db_xref="GeneID:12980905"
     CDS             complement(174568..178119)
                     /locus_tag="LMJF_29_0500"
                     /note="previous protein_id=AAZ09500.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722123.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980905"
                     /db_xref="GOA:E9ADQ1"
                     /db_xref="InterPro:IPR024750"
                     /db_xref="UniProtKB/TrEMBL:E9ADQ1"
                     /translation="MASSEGNSTSANLDDVADEQRCSRCFCAYLEPTEIHAVGDDLFS
                     DTGASSVSGRRSRSSSVCRSTEERGVLWTQVFPLHISVYLRVRDVVEVSQVCRIAHCA
                     VQQTWVWRSLAEHHHSIQPAALERTFSMAVRQWGEKRPTERPQRLCACSPLPLLTGTN
                     SRASQRSVHFRVETAARTAAGDDEDASIEEAETCELDSLSNDEDAGELDTTQPPRYTD
                     AEMPSSAAVAAAGAASAPASSTAVVEEVGSAPPRPGRPALPHGASSRFLWQATAAAMP
                     SPSSPVSSPPSEDDEAADALEAPSVTPLPREAAGRGPAPLLPMVNAAAATACEAEQPN
                     MCASPHSAVLTSLTEGQRSTTVVTGNGAGTLSDAKWHARRWAAAQECLPPPSPAELNS
                     SVTGAGATAEGDASSRTSISAGSLRCHPSYVLEMATDVTVDGAASPMPAAALSSAAHG
                     GRLSEQVPIPTAAVYSFTLCRATAERTVLHSVPEFPWKAFTQYLHINRVGRSLSQLKA
                     LSNIARAELCRGGAWDAAYGALSRAIHVLFQAGSCRSVEHLTHLAETLVRRASLCRHR
                     GHLYVLAAFTDLSVAWMLCPDRTASSDLAELRARKELAQESPATWLQRCNDAAHVATP
                     VALLGIIAQVPTLFPQNRALCLCSALTFYIYAKRTLRHSLTHLLCRAAECMTPSTEEE
                     LLVTALREVAAAQLSKEVASAQKACATADYAFSLLPLHMRSAAETLAAAWVRDCFPPD
                     GPASTATITGWADVAPESLAYIRATPLEARWLAWLVCEVRWFAYEELMGPLPYQTALL
                     SIVFGPTTSSRADGLVRLSMQYANADVRSEDLRPALPHGTSRGHLAQNLLESALQLRP
                     LHPTAALLLARMHARDAEGLGRANAVLTDSIHAWAQRFSMLALRGSAEVKLGVAPEDQ
                     QAPPVRESTTALAYLHRRDRRPELCFIPSELLVERSRCLHTIADIAEATEQHPTLSYP
                     YQMRAAMAMDRGYHLGAVMELNCIMMLTMDPNDIALRVRFLQDAIAMASSSTEADASA
                     TAAEGISDLASAGIAAASGGNGNSDGDLALPSLQLVPLYCAWAAKMSGLLTLLRPPMS
                     TSPGSQQLRSRFPGREWLPAPSGAGSSMSSEGHVSRIASMAFSDGDDEATLMGAATDE
                     FDAGHVRAFLEDLLSPTAAPLAFTAVSSGAHTPAYTR"
     gene            complement(<185329..>185748)
                     /locus_tag="LMJF_29_0510"
                     /db_xref="GeneID:12980906"
     mRNA            complement(<185329..>185748)
                     /locus_tag="LMJF_29_0510"
                     /product="ADF/Cofilin"
                     /transcript_id="XM_003722076.1"
                     /db_xref="GeneID:12980906"
     CDS             complement(185329..185748)
                     /locus_tag="LMJF_29_0510"
                     /note="previous protein_id=AAZ09501.1"
                     /codon_start=1
                     /product="ADF/Cofilin"
                     /protein_id="XP_003722124.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980906"
                     /db_xref="GOA:E9ADQ2"
                     /db_xref="InterPro:IPR002108"
                     /db_xref="InterPro:IPR017904"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:E9ADQ2"
                     /translation="MAISGVTLEESVRGAIDDLRMKKSRYVMMCIGADGKKIEVTEVG
                     ERGVNYTDLKEKFSAEKPCYVAFDFEYNDAGSKREKLILIQWIPDTARPREKMMYSAS
                     RDALSSVSEGYLPIQANDESGLDAEEIIRKVRLHRSV"
     gene            complement(<186478..>187152)
                     /locus_tag="LMJF_29_0520"
                     /db_xref="GeneID:12980908"
     mRNA            complement(<186478..>187152)
                     /locus_tag="LMJF_29_0520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722077.1"
                     /db_xref="GeneID:12980908"
     CDS             complement(186478..187152)
                     /locus_tag="LMJF_29_0520"
                     /note="previous protein_id=AAZ09502.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722125.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980908"
                     /db_xref="UniProtKB/TrEMBL:E9ADQ3"
                     /translation="MQAAAPGQTLSSALRFWADVSYGDAPPAALIDYPPLGFEEDSSR
                     LTVGALQASRDAAAADSRRQLGLKTQRASEDVDGSAHPALLLGVKEESSTLAVTREEL
                     EGEEGPAWLQPPLLLQLDDGLEDRQFAAATTTGRTAPVPHLRYDGAGLLAVMHVHSSG
                     IAYVGYPRASDTVSSAEPTDGLVRLPDNVPPADPLAVAAPTPAPICSLPMSSSTGFVR
                     GLLGLS"
     gene            complement(<188993..>198019)
                     /locus_tag="LMJF_29_0530"
                     /db_xref="GeneID:12980909"
     mRNA            complement(<188993..>198019)
                     /locus_tag="LMJF_29_0530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722078.1"
                     /db_xref="GeneID:12980909"
     CDS             complement(188993..198019)
                     /locus_tag="LMJF_29_0530"
                     /note="previous protein_id=AAZ09503.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722126.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980909"
                     /db_xref="UniProtKB/TrEMBL:E9ADQ4"
                     /translation="MYRRESSERLRGSAFGSRAASSYHTDTALPHQVYSDTVGSHEGR
                     GQGQGRCEEEVSIQHGEEDDTSRLASTQSYGERSSMSAATFARSGGAPPASAQVERSV
                     YTPHRTSPHASVALPFSVGPSIRLPASPAGCLRPSSLIAEDAASNPAAAAGGGRVTTS
                     HPLPGVLDVKVIETDVVDPPFRSEIQCRICGLSVLRSDWEAHQVTTLHRRRLRECATA
                     CGSCSGSSSRPLTAVVQGSSISQPAAAAGFRGLQGPVVSGDAQKASSSATPSARAPAL
                     SRENPQERSQAAAEVERRPSSRPHPSRRKLDSASSDTASSMYSTSSSSTSSSSSGTRS
                     ISSSSAGSTRSRSAVSKGSAARGRSDVSAVPHATPPRPNGQPLAPAAPSSPTPSFVLP
                     PLSPSRFSAASSASAAACLASLPVKALDSDEAAAAVHCAQPPEEEQERRRVRKLEKQL
                     SSYLSHHEHKVLAACVRRWYEAMFTKATAPITDSDPPKRGGGAVVVASAPCSPRGCAG
                     TSLSPETVRAHRVAVTSPSPPRVSEMVLDNVDSTPYEPGVSSAPHNSTSPAVSAAANG
                     AAFRSHGQDNRSRDVAEERVDDGDRGSLSRRSNTQQPASPSCSMPHCGEDMQMNRPAA
                     VGVKCAASPQVVDANPMHTEHAGVLMTRGEGEPTPTPFFTTCVKSYARVHVTADGYAF
                     PAEVRCGTRDGSAESEAQDLEVMQTKVSWVVRPASRPAAARRSSSDSSDSTAARRDWR
                     SAIGCSGAAVGAAAAAAAARGSTSDSLQPPANSPGVEAAWWQARGKVAGRHGNSRAQP
                     RCAAKGARGTVSGRRPHLPQPHSAAPSNVAGYGRYGDDDGDVGARAVGDAAASEEPPE
                     ARRRRHRTKHHHSGKPKAEEWRSLSRKKRRGYGGDERAEGDCVSRRTQTPDEEEAHAS
                     AVHQPPHRADASGTEATSAVSAILYAGGKGGGCDSVERTGEERHRHKGTGDRREGKRE
                     SGQPYSSDSAATAATPIPSGEADASTEEDEGELCEPSPLTSEAAGGRHAVSTGLAVPK
                     CNRSSTLDEASPRQSSNAPPPKAAASKRDPFSHAGALKDDHAKAASPSSSIALTGASG
                     ERSSSISSSSFSSPSSFSYSIGSDSDMAELAARLSPSTQQRAWQLLRPGSAPSLLAHS
                     AGVPKMPACASDTQQHREPDLAAAIMSATQTLTSAFVAGQGNPAAQAEEEEQARLGYL
                     PAIPFSASAPLMPQDVRGRGAAAATTPIADILSGVLTGVPGGDGGHAAASETGEQSAA
                     HGPHHHLYRSHPRDANAAVQLPKTLLALHVMSAGAASSSVVAPPVDALDGRVSDCDGD
                     AAQPPQEPSVSFVVNQASAEVGLLLPSSSGHPYNFGGPPCCGSGRGGHARAGPRPFLG
                     ATLVARQSGDDKEESSVAGMPSAERYDDVYLAYAHEAATTATHGVDEGRAQQGSGAPE
                     EHATVGQSGNADDVLPPSSIPPTGLGVLQVSRQPSRALFAAVSERVTGAPEDASSAVQ
                     LPPSSFSTHALVEPGVAQSPAEGLRLHAVEVAQRCSATANAAAGPARDLHGVPSEGAA
                     TEGRRMLAPAGAVGADVDEGRRLVGGVAPTAAYTSDAEVAQAPSSLSSATGSGPTATR
                     TGAGALVPFRPIPQLHKAVAEGPGAALPRTNQLLAASPFAFSSGGMRAANPADAVVPS
                     SAPAQLHVDPLRGPMWNMDQAAKRRPLSLDQHTYTVAPTTSAAIESGGDASSWPPRPA
                     DGRHVGKTTSGTPHPGLHPTTASEAAGFSAVWRDAAGASGTALVRMAEPLNTPPCTTL
                     VPCSRADGAGGFLYDFPSLKIPVLRARGDRDGLDEDPPQLARGRRLRGTRLSRGATAQ
                     AAVVTGSGNVPLLVPYALLPAAECTESSPETLVQPQQSTLDNHPPRPFRLPHLRDVEA
                     GISNLGGNIVTCSPTQHPEAAEASALSGALAPASAGTAHTVSCLPHGVMPTTHPYCYA
                     TLKGAAGGEPSTKRDDRIAESELVATALRSTLAVRASLGEGLEDSALHHASASFTAVT
                     PLVAAAASGLGAARDASPLSSSPSSYSHASPARVHPNRRPSHHRRHCDGPAASQKKSR
                     EERRKQRGSGQESRRDGDASLGHHRQHRHHRSGRRHEEDSNDETHRSQHRRHHRTHAK
                     HRVLRHGRERPQVQDTSATAAQQAHLPLLYALEASPQQGLTGADCRDVPYVAQEAGKR
                     LPSGARPPHPYRVAPPSAPVLPGAFGDEALTRGKDHYGQPAAPCSDDMARAARQRRSH
                     RGGSSSAPHIRDGASDEDAALSRHLYRRPGERERAWGHRHRCRRRPSASVLSTSSSSS
                     RSIGSSSGSRVSSGGDIEVVSAGPPCRGRAAARVSVPPSTAADVAREPDSGDVPGGKE
                     EVGAAERSRSDDAAHSVEAPPRQPMMSIEAWRGERGAQLPSELEWGSAAAHGMSTRAD
                     VCVPEIRPSANARAGIGATSYAPVRGEAVDGKGARSVDSHQPPELAGSIHATVQESPA
                     GDEDGVLLSRASSTAAPAGSAPGKHAPGAQAPCSGAHGSAYVSSAKLGRPRRPSADTA
                     TASTTRGQDAVDGQPAPPQHGDLLYRDSAGRFHRVNSAELPSVLAGEVRWRTSPEPSQ
                     SPPGSTRRPLYVVHNPAPSACAITGRQARRAWTITNPTNSLGCGRLNPYCSSCRAKYN
                     LMFVDPQMRPVQWPSAQSAELDQMGDCRIHSGYIFGGGDTESKRDAMLVQQRLRSKRM
                     AAWPELPHSGRDHLIVHEEDLDGPLRQLAPPPQGRFVHIAYAEDMRLPVGPALRRRAP
                     LLAASAGRSFAFLPSSAALSQLPRHPVPGDASGDALRFVTSPAGERVSDCPPASSAHW
                     YPSTIRSGTCSYDSYLRNPTRGRNSPHNQHKRCSSCNAKDVGSAPVNQLDKFAEVTAA
                     KSRQPPPQSYPALETVGVAKRLVGDDAGATASTSAATSGMAAEPASVSALRQEERRIK
                     KALKQLLWRDLPQQRGTAEWENYLRSLSEGLRQQPGIALSLVPPLPVQVVETVQASLI
                     DSAAKS"
     gene            complement(<199325..>200833)
                     /locus_tag="LMJF_29_0540"
                     /db_xref="GeneID:12980910"
     mRNA            complement(<199325..>200833)
                     /locus_tag="LMJF_29_0540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722079.1"
                     /db_xref="GeneID:12980910"
     CDS             complement(199325..200833)
                     /locus_tag="LMJF_29_0540"
                     /note="previous protein_id=AAZ09504.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722127.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980910"
                     /db_xref="GOA:E9ADQ5"
                     /db_xref="InterPro:IPR006055"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="UniProtKB/TrEMBL:E9ADQ5"
                     /translation="MVRIRSLAKELRQLELQKQTASLPPPRAASSDDVLDDATRSATS
                     SRKPEAPSCSSSPRDGDILTNAAHASTTAEAEAVPSSSPASRTVAAAEPQPTSAFPLS
                     QLSLSSPDGAHNRSRNSLYSLGGSRFNILLGGSHGDGGACRKSQVRKATRACASGGGK
                     NGAATATATQVPQRRGEAGGSSLLEKGKDGEVVANPAPPLGTSSGIPTRPPFKRLLAQ
                     PFSHVLVCDFEATCASGSVHYPHEIIEFPVVVLDTATLRIVAEFHRYVRPLRNPKLTA
                     FCTELTGITQEMVDVADPLPTVVAQFQDWLKTEVYPLCWMWARHYGPNRLSHNLKSEQ
                     RRFVYDEHTDAAKANTSAEAMVCMATDGPWDMRRFMHQCSVLRDGVDFPPVCYRYINV
                     RHSYSDHFKCRQAKLTHMLKKMSMSFEGRRHSGIDDTRNIARVLAELFARGYRVHHVS
                     TITYAHRGDAFLESNRAAQELLSEFGETDETHTSKHANAHKGGGRQRGVKRA"
     gene            complement(<202018..>204660)
                     /locus_tag="LMJF_29_0550"
                     /db_xref="GeneID:12980911"
     mRNA            complement(<202018..>204660)
                     /locus_tag="LMJF_29_0550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722080.1"
                     /db_xref="GeneID:12980911"
     CDS             complement(202018..204660)
                     /locus_tag="LMJF_29_0550"
                     /note="previous protein_id=AAZ09505.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722128.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980911"
                     /db_xref="GOA:E9ADQ6"
                     /db_xref="InterPro:IPR006055"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="UniProtKB/TrEMBL:E9ADQ6"
                     /translation="MSALMECPPEATEIAQCCAAIKAATPLTLSTPLAVAESQPTGGS
                     TMRPKRPAHHDASVTSQLMGKGGPTTFTHSFLEAVLNGRAKTTRALAPGTPLAHTDTT
                     SGTAISFSGLASHTGSPGNGARAGQRSASPGAATAAKATEKPSAQPSAPKPLGLVPAD
                     TGTIPQLLSVLREIALSCASLDTLDKVAGGSASFLRGADAAPFHTKPRSAASALVTAA
                     AAPGAGTGGAGATSGGRSAAPPMAIATAHPSHDLGITEEERWHRVCAHFEVLRGLVRN
                     EHELTCALDEVLGVEWRGVSTPPYLHAYEEGAAVAPSASPAVSADGLHISPAATLLGA
                     PAAAAARSFAPVTPAPADHETPPTPSFSAGSVPGGAGMPRTSTAGTSSAVTPTPTTTS
                     SHTGTNVTGVVGVKSAASPGTTLSYNTPPFQSRTPPSVQKQRSALFASAAPIPVAHSP
                     AATANDAASSSMKQLSESSSTYSPSQHVAMMLDRGTTPPPASRTQDEGEAGLVNFPST
                     PLSEAAAPYQPSASLMNTSPHGGNASTSNSAPFHLETREEMLRRRSAAPNAFYASVSH
                     RGATRFAGGPPSAATTPGTFMSSSLVPGVPPFSLNGGAGGARSVPVSPLMSYSSPLGA
                     LPCPYEYLLVLDFEATCEEHPPPNYLYEIIEFPVVVVDARLQRVVAEFHRFVRPRYKR
                     ELSSFCKKLTGMRQEDVDTAASLEEVIRQFERWLSHTLPPHARCMFVTDGPMDLREFM
                     YYHSVSRQGIRFPSLFYQFIDVKQTFACFFRCSQGKIKAMLEVMHLPFEGRLHSGLDD
                     ARNIASIVIGLLHHGCSFCEVPINRLPFNGLLLTGANSGSGSTPLLLPPSTAPATSCH
                     TRSSEASPTTISAPYPVSDDDNSR"
     gene            complement(<206621..>208378)
                     /locus_tag="LMJF_29_0555"
                     /db_xref="GeneID:12980912"
     mRNA            complement(<206621..>208378)
                     /locus_tag="LMJF_29_0555"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722081.1"
                     /db_xref="GeneID:12980912"
     CDS             complement(206621..208378)
                     /locus_tag="LMJF_29_0555"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722129.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0555"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0555"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980912"
                     /db_xref="UniProtKB/TrEMBL:E9ADQ7"
                     /translation="MTRPHACAPGAGGVYTGPRRCHSGSAAVVRACKRRPFWSFARAR
                     HLSSAAVALNGLPPSGICRCWPPVFLSGRRAVTFSCSGRCLRAALPPQHTHAWERQAD
                     LGERAKGPCRRRRVAGSRLWRRVQRQAIQTRPSLRWCRRTWKVLRATPRQRRRPETCP
                     ENAGMRALSCAAGVGHCAPARCAGVGGGGGLGGKGANVFAPVNPKGRVCEAGGVLYVR
                     PGGPMQRRRRRHDEDTPGRAAGCSGLGCGGSSAPRCGMPRLGVAGGRGVRVLGSLWPG
                     AGWLLPPLLPPGVPGTCAWAAPCRPHGGRGCFRSRTVPWMRPAWIRACGAARFVRRRS
                     RSACPGKGRGRTGRAGWTRGPRRGQTSCPRRPGFSRGTGEAEGRRLCMRVFANQFAPQ
                     RRLEGKTCALRVARARSRRGGGRKRERGGGGGSLVQFCSVWTWHVATGFLFSSALVSV
                     CASRRTQVSPNISTRLSPSRRCCAAFARLSLPCPFLVHPLRFLKDLRIVIASATGPRT
                     RQEVALRRVRVRVCVLSEVERMGGVTIHEEAGIKRQRQHCYPLPFTCASLLRSSCTAP
                     SCYAQRTTPITACIFLSLA"
     gene            complement(<208588..>209805)
                     /locus_tag="LMJF_29_0560"
                     /db_xref="GeneID:12980913"
     mRNA            complement(<208588..>209805)
                     /locus_tag="LMJF_29_0560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722082.1"
                     /db_xref="GeneID:12980913"
     CDS             complement(208588..209805)
                     /locus_tag="LMJF_29_0560"
                     /note="previous protein_id=AAZ09506.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722130.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980913"
                     /db_xref="GOA:E9ADQ8"
                     /db_xref="InterPro:IPR006055"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="UniProtKB/TrEMBL:E9ADQ8"
                     /translation="MSPHNKRGKAKEAANKQRKANQHQRHSTSKGQHTYFVTRSGGGD
                     SYLSTHTSAKQNKVKHTYDDTDPLDQQLFDYIIVVDVEATCEQNNRNYPHEVIEIPGV
                     LINVRTGQVDRARSFHTFVKPWRNPRLTPFCTQLTGITQEVVDAAPSITEAIQLFEKW
                     YWETIPRGAKTIFAADGPWDFKNFIHEHHILRDHVGFPSIFYEYLDIRTTFAHRLNHG
                     VPIKLDAMLRKMNLRFDGRPHNGFDDAYNIARLAVAMMKAGCVLDFVIAIPLDDAYHY
                     HLDGVPLYRREEGSGHVDRDVVEDIAKQCYGADYFKFGQRHRDAVRAYRLEHPKEFSH
                     AYVVALKRRNDRALARQRKRQWRLAVLFLFAVLLAEIAYVLQLHRAAAAWLASAFESY
                     SLTSYSTSASQTV"
     gene            complement(<210575..>213112)
                     /locus_tag="LMJF_29_0570"
                     /db_xref="GeneID:12980914"
     mRNA            complement(<210575..>213112)
                     /locus_tag="LMJF_29_0570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722083.1"
                     /db_xref="GeneID:12980914"
     CDS             complement(210575..213112)
                     /locus_tag="LMJF_29_0570"
                     /note="previous protein_id=AAZ09507.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722131.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980914"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:E9ADQ9"
                     /translation="MVKQRRCNIPPELRAMARAVSDADTRQFPDLAPAPGRAGPPVSA
                     LRHITTELNDDEPLSTREFKLFRAACEECRQHLHSVTNGIIASGTPIADVLVLAVRID
                     ILCTDLGLSLPAVFPTLREIHTYLLDLSDRLALGRGELQRQGVLLDRLIRALHSVLER
                     GERALRDYETWETQRDTSNPDRGALKTESSMAASSAVANSPREAVRIYSAGNRCRKNV
                     AASDIELVSCRASPRQSSAHESSMGSAAQPKAHRAITTTAAAGATVADAQELIPVSGQ
                     HLLPFHVADAVAGVNADLAVHFTHIRWYVKVADEVPAHFDAHTHLEDNVLRNAWDVHV
                     GRNRAACTTEEFLPFLPLFSSWTQRIIMSVLNFKDCGVISLYSLQRLLSVWGPLQLLE
                     ANLRRELELGAVDLSEPFAYLAFSLAALPDAMAGDYVVGLTDVIGEVRVAVLRRARGP
                     HWHLRAAPGAAPRSTSTKRTGRGVATSIMTSPAQAVAAPRKRLATVSYTLSHATGAWM
                     VKGLAREEFDSVADACAAFAEIFQRPCGQPPSTSCAVPLPPALAHPAQLLPLQGEGGG
                     SVMPAPLVPAIPANPEDAAEGNASALHRACYRNNARYVRTLLHRGGGTVINIALVDPL
                     VSDSFCWTPLLCAVNNPHSDPVELVLQLLEAGAEVEYMDDAGCTALYYAIANGYAETT
                     RVLLEHCPTLSTSPYTVPLLVAIGAHDYHLRACDVQRLMMVVPTAAVLRVIVAYESSL
                     ALVALASTIVEEKLSGKDHSVLSAERYLVAQRCSAPAEQYTSAETEQLKRWVHHHTQC
                     CLRARQDVQEAVRVLYARQYALSWRAWLDALGAAKRDGAASLSLTEG"
     gene            complement(<214343..>215794)
                     /locus_tag="LMJF_29_0580"
                     /db_xref="GeneID:12980915"
     mRNA            complement(<214343..>215794)
                     /locus_tag="LMJF_29_0580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722084.1"
                     /db_xref="GeneID:12980915"
     CDS             complement(214343..215794)
                     /locus_tag="LMJF_29_0580"
                     /note="previous protein_id=AAZ09508.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722132.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980915"
                     /db_xref="UniProtKB/TrEMBL:E9ADR0"
                     /translation="MHATSAPSPLLPALQPASGTMAAPHVAIEEAAVAASAFGYEETS
                     VKAKEYDEDWHRLPSEISYFQDLLASLEGKQQLTSAASSSNAAATSGPSYCTSLQRER
                     ELEEREMADLRLRERQVAIIEARRRRSRRRCDAVDEAFQKALKRRWQAMQHLAADPPA
                     ERLVGQGMTQYVPAALLPDDVVDRRGRHQPGPLPLAPQSAVEARMRRTPNAPAITGAG
                     LTSATVVRALEDCSAGTTAEQDAIVFLTQLDAGGRLVRKDGATGGSHIPTQSPSVSSR
                     VVAMTSSEGMRVEDEALPRTTSAHAASTIGAEALPNADVREDDNEDEGGWIRPATVTE
                     ANRARWQEMGYHVIVVGGKGRCGDAAAREADAVRRAIRSVEALPNERVALRAAEQRTA
                     TSSSALTRRKPPTDQQAKYTSVPRWDWMQLAPLPQVCLVQRRLPEEDMTVAELRERHH
                     RHIPVASSTTSVPRGRQNRGDLPWKVSGKSVPR"
     gene            complement(<216696..>220016)
                     /locus_tag="LMJF_29_0590"
                     /db_xref="GeneID:12980916"
     mRNA            complement(<216696..>220016)
                     /locus_tag="LMJF_29_0590"
                     /product="putative DNA repair helicase"
                     /transcript_id="XM_003722085.1"
                     /db_xref="GeneID:12980916"
     CDS             complement(216696..220016)
                     /locus_tag="LMJF_29_0590"
                     /note="previous protein_id=AAZ09509.1"
                     /codon_start=1
                     /product="putative DNA repair helicase"
                     /protein_id="XP_003722133.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980916"
                     /db_xref="GOA:E9ADR1"
                     /db_xref="InterPro:IPR001161"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR006935"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9ADR1"
                     /translation="MNIGDSGNIFVEKAHPAYAHVIDFLISCCEPVSRTQHMEQYRMD
                     SSSLSSATAEGTYSLAMIENVLRHFRLNAAQELPVDLERCAALERLASALDESTESAE
                     VDGSRVSQEALATTTASSSFDARIPLPRCLCDVDLTGTILASLNRTSADDAPSPAVTA
                     HHVGNDSLETLVKREKVEEEEMGDRLSAGGAAASALKTVSSRSAAPSGSPTSRLLQLF
                     RPLLPTPASAAAPTHSPTTRSQLEQGAPIAARPLISLAVVRPADVRRPLPESLAQMLE
                     EEENASRVQIVLQPRLRRFHQFEASRGASFASTTATSRATVSKERNGAATGALAERDD
                     QQLFYFVQSRERAHLEHVLPALKEFLEPVVICGAERWIVSDVDRTPLGNTKGIGDAER
                     LARDAGRPAVLRLLYEPPRVGTQYEKAEATPSASRFLYKCQVRDGKLREVKECLFSKF
                     DIRADCYYDYMQDHTLYVPNLSLASHVRLRPYQVASLERFRRGRKAHQGVIVLPCGAG
                     KTLTGIGAAATMQTTTIVMCINHMSVFQWQREFLRWTNLAEEEVTVCTAKVKQRPGKV
                     FITTYSMVVAKRGSADGAAAEESRAILQVMTAQPWGLLLLDEVHTALAHHFQDVLNTI
                     KYKCVLGLSATLLREDDKIGDLRHLVGPKLYEANWLDLTRAGFLANVECAEVQCPMPP
                     LFLQEYYGIQRTRALLGAHARRNHRGGCGGNGKRCRESVFQDDEDAGEDGDSDGEDNG
                     ARGGRGRGHDAYGPLTSRSLRLASCNPYKLWCAQALLAFHQQRSPPDKVIIFCDYLAD
                     VRFFAHHLHLPFMDQRTSEAERTNLLQYFQHSDGVNAIILTRVGDVALDLPCASVVIQ
                     VSGLGASRRQEAQRLGRILRPKPPSLDNTCAYFYTLVSQDTADVSTSYKRQSWLRDQG
                     FAYRILHCDRVLSEFARVGGQPCCVGPPQWWYQTHNTASATPSSETAAAVDVGWVHYD
                     GFYWAPFSADAAALIEAAFQHGRATCIVRGSELGRGTPRPSSEELGRYPLLSFESWKV
                     TFSSVDAPQTFGTVLIGEGAPSSPLRERRVRRGCLDRSHRCIPATADQESRCISFARN
                     TVLRARDTRGSDAVTEVE"
     gene            complement(<220936..>222672)
                     /locus_tag="LMJF_29_0600"
                     /db_xref="GeneID:12980917"
     mRNA            complement(<220936..>222672)
                     /locus_tag="LMJF_29_0600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722086.1"
                     /db_xref="GeneID:12980917"
     CDS             complement(220936..222672)
                     /locus_tag="LMJF_29_0600"
                     /note="previous protein_id=AAZ09510.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722134.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980917"
                     /db_xref="GOA:E9ADR2"
                     /db_xref="InterPro:IPR000967"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="UniProtKB/TrEMBL:E9ADR2"
                     /translation="MSASPQLTRELSEDLLAGRYECVVCSEPVGHRQELWACSCCYGV
                     FHLPCIRFWADSQMKARDRQLQSTSGVAVRGELERFRCPLCQSFKDKDSLAVYQCYCG
                     KTAKPPADAMLVPGSCGQPCERRQADPCCPHRCTLLCHPGPCPACTRVREQACWCGKH
                     SKTVGCSSSIHGYECDEACGKLLDCGEHRCKAPCHEGVCPVCTVMVTEKCYCGATVRT
                     RRCGAAPPAFAGAAATAAADDRAAGDAGAGASVSGFRCAHHCEKKRDCDQHVCGMLCH
                     PGLCEKCYRTPQRQKFCPCGKTRVQVERTSCMDPVPSCGLPCELPLPCGHLCWLTCHD
                     ETPCAPCKETVTVPCACGSRHVSSPCFCQYLPESEWEAARVQCGLPTDSLPVSVPPKC
                     NQVCRHMLSCHKHRCTMTCCTDAEHTCLQICIRKLACGVHQCGRLCHQGKCPPCAHVS
                     YERLYCRCRKTWVDPPVPCGMRPPQCNHPCSIPRPCGHPPNHPCHIEAECPKCVVLEE
                     KPCASHQKPMPFHMPCYKKEISCGRKCGKNLPCCGKFCDLVCHIGPCEHDCAKSFPTL
                     ADVLKRGKGAAA"
     gene            complement(<224085..>225989)
                     /locus_tag="LMJF_29_0610"
                     /db_xref="GeneID:12980918"
     mRNA            complement(<224085..>225989)
                     /locus_tag="LMJF_29_0610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722087.1"
                     /db_xref="GeneID:12980918"
     CDS             complement(224085..225989)
                     /locus_tag="LMJF_29_0610"
                     /note="previous protein_id=AAZ09511.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722135.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980918"
                     /db_xref="GOA:E9ADR3"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR022755"
                     /db_xref="UniProtKB/TrEMBL:E9ADR3"
                     /translation="MPPRHRVPRPSHRELENAIHPYDKLVIGLPTAMEGWRCAYGTVR
                     EWCKLAPNPLLGTPVNVLGEEGGNDRSRALTLPSRPASGHLGDATGRPPPSNAPHTHA
                     QRFPHTSAAPAARKDDALYCDACQREFATQEKYEAHMETHMYCTVAGCRFTCRKGKPW
                     RMEEHMELLHNRPDAPNLVDTNAYLEQRKRRFPTQDAVKMKVEELYYKAARGVVLPDE
                     RRRWMQQHGIVIRKRPRTEASVIIRGELPAGSHSPSAASSASASSSRSSRRSSRSSSE
                     HRQRRSPHRNPREPLQPPAPSPASDAEGGQARFIQPPSVPSYQESDPTAAPIQASNAS
                     SRGSPTGAQRTDAVGPAVTAVPLAKQSSPSPASSGVHAARAHPTKIIPLGPNGTLTPR
                     QRVQLVRERYAAAKDVPQFYVCHRCGIKGDHWVSDCPTKGDKTYDRHVVWGEARLSAL
                     EKGDKSHREKADKDNNGSEQPGSGNAPQQAVVETTAPSDSGVEQAVAEQEHDGAPTHP
                     LSSEHRGAAPVAPQEEASATATPPSEGPATAAADASNDQRSEDMPPVPQSAAPPADAP
                     REVTRMMAPVAAARHAQPHRRDPARRPPPPPTLYERLTEEARIDEQGVLLQALRFFVA
                     RDFFEDRPKS"
     gene            complement(<230353..>235953)
                     /gene="ABCA10"
                     /locus_tag="LMJF_29_0620"
                     /db_xref="GeneID:12980919"
     mRNA            complement(<230353..>235953)
                     /gene="ABCA10"
                     /locus_tag="LMJF_29_0620"
                     /product="putative ATP-binding cassette protein subfamily
                     A,member 10"
                     /transcript_id="XM_003722088.1"
                     /db_xref="GeneID:12980919"
     CDS             complement(230353..235953)
                     /gene="ABCA10"
                     /locus_tag="LMJF_29_0620"
                     /note="previous protein_id=AAZ09512.1"
                     /codon_start=1
                     /product="putative ATP-binding cassette protein subfamily
                     A,member 10"
                     /protein_id="XP_003722136.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980919"
                     /db_xref="GOA:E9ADR4"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR026082"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9ADR4"
                     /translation="MTSFWRQYGIQLYGFLVKTFLQRWRMPISTTVEILLPCLFTILI
                     SVAYWMSGSSTVPAQMYDGGAYVPLNMTDFVSYFMCKKMGSTLRVPWHPCPPGMNASS
                     LTCLSLIGNGTEICIQNSFYTVLSYMLYGMYYGSGSFGMNTMDGHLTLSALVTEVTRK
                     ENPTFFGRGGRNSLSHYGNLLVSSNSPALARSFMAFCRQSSGMCGEVLYETAFTSLAS
                     AKEYAAAHEDTVWAIVDLPVTSLTSSDNAEFTISMNFTATAPTVKEPQKSLFTRGLGA
                     NDGSDGYVLYWASGFLTLQTFVHEFYLEQALRMYRIRGPSTYYTEPSSDVEGISAYLT
                     QYGSTVIPMPTPPRYNNAFLTKWAYYIPLLAVMAVLYPTSRLVMLIVVEKYNGIREAM
                     LIMGLHPSCMFVGWYSSTLIMDLVSSLLVALFLKIGFLDKVDYGLLLLLYFSFMQQNT
                     ALCFFISSIFRNPRVASWFIAFVLFVLAIPSFSFPTGMTDIQKIFCCLAPCVGYIQAF
                     NTMLNYVSFGFHFGWPQARTGYFNFSVAVGMMWASFGVLMLLSFYLDRVSCGTVGRRA
                     HPLFFLMPLVNRFRTTRASLIKMWDMGRPIRPGSLVERAINDDDPPSASFANCSLKKD
                     SKGLPQDNSRLIEHYHDVVSTQDPTVAAIFHRLRKVYVGGGILGFLYTYFTGLFRDGD
                     RIVALDGVTFAMRTGEVSVLLGPNGAGKSTIMGVATGMVNPTNGDVYVRGYNARTHLD
                     ECRQNIGYCPQRDIVWSLLTVEEHITFYARMKGSHAVNVQEKVDYVVDLLDLHEKRHC
                     KASELSSGQRRRLCVAIAMVGDSSVLFLDEPTAGMDIKGRKIVYEALNRTRNQRSVLI
                     STHLLDEADRIADRVLIVNKGLLCAEGSAMYLKSQMEVGYVVTCLLESNMSKTEENCA
                     AEGLVNFVRAESYAAQRAGDSDNEGCVVLGVQRRGREVSFRFPMTLLSSAGVTLLSAI
                     QHNSERLRLRNVALNLATLEDVFFTVTCSAPLMSSVTDGELVGGREDEGGVLSIPDTP
                     STNADLYAEKTSYFFVFCRHFRALFLKRLHYAQRDIKLLVYQVVLPIIFLLLSLFISL
                     VRDPSQPALRLDMTMYDDYATHPSQVMTAYSNFSGYVQNMTRYFMNVTNAFCLSANLS
                     DNAWGPHYLTDFRAMPSGLPNVSNGMSRLLLSEIMSHKEPRYISVAPVGAVFQKGAPK
                     KTPTLLHNTSYSHSAPQGVSALYHLAMYQLFGTAVPTPTAVNSPMMLGEFEKTLVTAN
                     KQVMVGIFIILPFIFIPSNTISYIVEEKESGARHMQWLSGVNVLAYWLSSFVFDFASY
                     LVTQILAFIIFLIFNRTEFIGKDNVGAAVVLFFFFGLTSIPFSYFLSFFFRSSFTAQS
                     VVFCINFTFGFLWVTLESMIAEHALQFAETMAYILRIIPAVSFGESMFVLSGTQLANL
                     MFPNRAKKSLFSLLKFSETGSPTGGIGTGLIYMSCVAVACTVALVVLEYLRLQRVDSA
                     FTQCCTKLNIEDEEEHRRLEEADPSVKQEEDYVCADKTGPESTRVAVQHLSKRYLGAE
                     HAALQDISFGVKEGEVMGLLGLNGAGKTTAVSILAGEVVATGGEAFVNHYAVQSMASR
                     PFVGYCPQYDALLSNLSAEEHLWLYARLRSIKEKHIRAEVHVLLKELGLYPFRNQAAA
                     SLSGGNKRRLSLAIALVGRTTSVLLDEPTSGMDAVARAQTCDVVRRLTAQKSVVLTTH
                     RLDEVEALADRVAFVVRGNLRCVGTPQELKNAYNKTAAYTLSVLFPHTVQLQDTDATL
                     VEKVRSYVLDTITATAGANAQQLTRCEVVEVHPCSMQMTVNSDLHSICVAVSHMQMGQ
                     ASGIPAPTYVSVSQPTLEDILLLH"
     gene            complement(<240106..>240525)
                     /locus_tag="LMJF_29_0630"
                     /db_xref="GeneID:12981155"
     mRNA            complement(<240106..>240525)
                     /locus_tag="LMJF_29_0630"
                     /product="putative Qc-SNARE protein"
                     /transcript_id="XM_003722089.1"
                     /db_xref="GeneID:12981155"
     CDS             complement(240106..240525)
                     /locus_tag="LMJF_29_0630"
                     /note="previous protein_id=AAZ09513.1"
                     /codon_start=1
                     /product="putative Qc-SNARE protein"
                     /protein_id="XP_003722137.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981155"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="UniProtKB/TrEMBL:E9ADR5"
                     /translation="MIQPQSTLFRRREGGVGDDGALDSPSSAPAPYQTRPGTAAAASV
                     HTNALQEQENDALMQALLSDMRRAKKSFTKMGEEVREQNAVLERLRTSFLNAQNSLRK
                     TMRNLDKIGWGSFKHMWVLALFVIVFFMLLYLMLRFW"
     gene            complement(<241303..>242532)
                     /locus_tag="LMJF_29_0640"
                     /db_xref="GeneID:12980920"
     mRNA            complement(<241303..>242532)
                     /locus_tag="LMJF_29_0640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722090.1"
                     /db_xref="GeneID:12980920"
     CDS             complement(241303..242532)
                     /locus_tag="LMJF_29_0640"
                     /note="previous protein_id=AAZ09514.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722138.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980920"
                     /db_xref="GOA:E9ADR6"
                     /db_xref="InterPro:IPR001310"
                     /db_xref="InterPro:IPR011146"
                     /db_xref="InterPro:IPR026963"
                     /db_xref="UniProtKB/TrEMBL:E9ADR6"
                     /translation="MWCTRLCREEGLFRFLRNLFEVLDFVTERCRRCLDTSSCLLLLC
                     ASPLSSCSIGGPHTRGCFNEILHRLSRGAQQPAHRRQSATSSHPRTPWRLHRFNDERV
                     CVWGGNPPPQSTTGRHRSLCTPFSLSHTPSTAWAPLLPADKHHMQASPVLAGAAVRRT
                     ATASVGSEPRTNLPFLINVVKKAQKSANTVVASTPALSSMSSTKEPPIQAAAFKPYPL
                     LSPGEVKQAAGSSLLYKDDVCVLVNDAFPKSMVHCLVMPLDLRLQSLNALTKKDAPLL
                     RHMLHVGDEYVRYLKTAVPHTYTARRFIAGFHALPSLPMLHMHVLSTDLDSPCLKNKK
                     HYNSFATFFFLTGDRVLDDLERHGRVTLNQDVTRLRQMEEQDMKCLWCGTALPSVPAM
                     KSHIQCCPQNKAVEKSS"
     gene            complement(<243053..>245182)
                     /locus_tag="LMJF_29_0650"
                     /db_xref="GeneID:12980921"
     mRNA            complement(<243053..>245182)
                     /locus_tag="LMJF_29_0650"
                     /product="putative phosphate transporter"
                     /transcript_id="XM_003722091.1"
                     /db_xref="GeneID:12980921"
     CDS             complement(243053..245182)
                     /locus_tag="LMJF_29_0650"
                     /note="previous protein_id=AAZ09515.1"
                     /codon_start=1
                     /product="putative phosphate transporter"
                     /protein_id="XP_003722139.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980921"
                     /db_xref="GOA:E9ADR7"
                     /db_xref="InterPro:IPR001204"
                     /db_xref="UniProtKB/TrEMBL:E9ADR7"
                     /translation="MGTLSTCKLDVNTTLPLVCICTLLSFLCGVGIGANDLSANFAMV
                     VGSGSLNMKQAIIYCTVFELLGAAFMGGHVSKTIRSGIVDPVLFSQNKDVVVIGMTCA
                     SFASALWLYLSAVFGLPVSITHTVVGSILGFALFATGGLTYVKPSGVVAVVISWLAAP
                     IAACGVTALLFYFMRRDIFKVRGRSFELARAVLPHCLLASLLVDFFFIVLEQPPIMSQ
                     TLAQNVPLHVQYAILLALILLFCWVAQVWVFPQVAAAAMSARSFVWESEALRTEPVSM
                     EDGLALGDLKDLSFFKSRGDVSATAPVSAGRQPPRPHHRHQPPAGATDTAPVAVPAAV
                     ALPPPSLPDDPAPVCTLDSLSLDRRNDGAADHDSSESSFTYGCPTHSRSPTPTPLHQN
                     ASLVLSSISASDSPFVRKGGMVRLAPVHTRGHSPTLQPHTESFATAAAPIQHGAKDAH
                     HFLGCHVASSDRERHEAQQVQSAGVTTYGSTESKKPALVTCRGERGLVQIPYSPALVQ
                     SEDEFGEEDWAMDHPMQPIRFGGILIKPFNPRAEYLFTGLQVVAGSISSFVHGAVAGA
                     NATSAFVILYDAFTNHELQEPGLSSQWSMLPAMLGIAIGMFGLGASLMKTVGMELVTV
                     TPARGWCIQIGGTLVTMVLTGIGIPVSLSQAQVGAAIGCGVLDAKLGGVSWGIVAKVV
                     TGWVVTLLISALTTGVSMWVVSSLLCT"
     gene            complement(<247085..>248857)
                     /locus_tag="LMJF_29_0660"
                     /db_xref="GeneID:12980922"
     mRNA            complement(<247085..>248857)
                     /locus_tag="LMJF_29_0660"
                     /product="putative flagellar radial spoke protein-like"
                     /transcript_id="XM_003722092.1"
                     /db_xref="GeneID:12980922"
     CDS             complement(247085..248857)
                     /locus_tag="LMJF_29_0660"
                     /note="previous protein_id=AAZ09516.1"
                     /codon_start=1
                     /product="putative flagellar radial spoke protein-like"
                     /protein_id="XP_003722140.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980922"
                     /db_xref="GOA:E9ADR8"
                     /db_xref="InterPro:IPR006802"
                     /db_xref="UniProtKB/TrEMBL:E9ADR8"
                     /translation="MHRAMAGIDEHQIRQSALWGHMTQVLAQVIRERPANAMDALGAA
                     SNRLLSGSAVPPMKGNVYADPRPTACAAAPVDSFTNTRWAANTNTALAPPRPPRRPRR
                     ADAEDEQEEDASADAGADGQPQVDLADHPGALSDVVTEQQYFNMVGLGLPRVDAYRLL
                     VGLRQLIRSEPLASVRFWGVVTGSACDYYVAECQADEDRMQENADIIGEGDAEDDMEE
                     EEEHAPVSQIADVLYTVAGGRLARRWPRPSAPAEEAGTGLNAMCYYASTTADPTTWTR
                     LPDVSPHHITVARALRCRFSGNLDAPVHGHPRFMGCEKHYLRAQIARITSACRIAPVQ
                     TFTTEGAVPDVDEDEEETSARPPPTAVPAYAVLPPLLPQEAPDEEDAEAIAAVQAWYK
                     GYTKGELMQAKGWSHIAPSVLNCGRVTTAPVEEEEPADEGDDGQGDGANASEPSPPPA
                     PEMIAPFLSDISLDAPLSYPGHSRTHLAAWTFRKAYEGEGSLTAVYVAKSLRWPGAAT
                     YAVTTAGRPGASYQMMYYGTGLKDMQGAYYAPPLPPPCSREYVEAPGEFDGQRDCTID
                     EELRYAPPPPRPEAEGVDEEEDDV"
     gene            complement(<249922..>250338)
                     /locus_tag="LMJF_29_0670"
                     /db_xref="GeneID:12980923"
     mRNA            complement(<249922..>250338)
                     /locus_tag="LMJF_29_0670"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722093.1"
                     /db_xref="GeneID:12980923"
     CDS             complement(249922..250338)
                     /locus_tag="LMJF_29_0670"
                     /note="previous protein_id=AAZ09517.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722141.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980923"
                     /db_xref="UniProtKB/TrEMBL:E9ADR9"
                     /translation="MTGYSVFSRRRELPRKPIIRRTRSWRGIMQVRFNDSRADRNKIG
                     VQAFFWAPARIFGLGLFATCSLYYLMGHDSFMHTLLGYESEMQYEARVNPITEGQSQS
                     FMILDRDRAWKSPVRNLEKPLHPVREFDVLRDPKST"
     gene            complement(<251059..>253494)
                     /locus_tag="LMJF_29_0680"
                     /db_xref="GeneID:12980924"
     mRNA            complement(<251059..>253494)
                     /locus_tag="LMJF_29_0680"
                     /product="putative RNA-binding protein"
                     /transcript_id="XM_003722094.1"
                     /db_xref="GeneID:12980924"
     CDS             complement(251059..253494)
                     /locus_tag="LMJF_29_0680"
                     /note="previous protein_id=AAZ09518.1"
                     /codon_start=1
                     /product="putative RNA-binding protein"
                     /protein_id="XP_003722142.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980924"
                     /db_xref="GOA:E9ADS0"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9ADS0"
                     /translation="MRLCCLFRCLHSNGFAAHPPTRQPFTLSCPLSALPHTKELSSSA
                     NAKPNMLPGRGRGSFQSRRGGRHAGGGNHGRGGAAAATRKSAPARVKRSVVPAFPVVS
                     CGGEPAQSTTTSARLASLQRTQQRQEPQGRRSTPDDGGDDAPPVAVSARRGPAAAAEE
                     ESRGFIPPGSLKQQRGRGRGVDRGGHGRGDGRGGARGRGGFRGGASASSASAFSSRGR
                     GRGGSLYSPRRGGHDSSASHHDEEEHDSDEEAGLDSNAAKCGPRKNVITTVTASGTEL
                     PKKLNTKVFVDGLPYTYAAEPGKPTLEEEVLQFASAWKVGKPLRLIKKPGQGFGFLVL
                     QSPNSVSTAVRVLNGRKFLGRTLRVEEPKPKDLEKMKDIGGMKDMGKDSFTRQVLLTD
                     LAKVAQPEIIREILRDVAPQLEKKLEAIKMTSQNRKAFLTFATEAEVTPAITFLDGFH
                     LLGRRVSATKAAAPGSLPYSHGATRTSRAAGGPAGRSTAAASPAASGSAAAEADDEEE
                     LTVMPLGLEPAKVASAAIRRCARAENASASATSAGSNVTGRTEKYNLLDDGPKDIYVG
                     NVGEDVTEAMLRQHFAPCGAIRKCEILVHPETHLSTGIAHVEFALPAYAAYAQERYHG
                     SRLRGCVLRVDRGETASAPLVAELPPEEAEEDYDEDAYMERYGVKDKRKYFKGTSVAA
                     EMGADPNADDDDDGSDIEDALTGRAKNASSKKNGKRERVDAKAAAREPAAAAKRQRTE
                     APVSRAKTVAAAVAANDSDDDDDEEHFFDADTVAVAGAGVSSHASGKRTVQKIAADKG
                     RSGKCNHKKAKKR"
     gene            complement(<254056..>254892)
                     /locus_tag="LMJF_29_0690"
                     /db_xref="GeneID:12980925"
     mRNA            complement(<254056..>254892)
                     /locus_tag="LMJF_29_0690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722095.1"
                     /db_xref="GeneID:12980925"
     CDS             complement(254056..254892)
                     /locus_tag="LMJF_29_0690"
                     /note="previous protein_id=AAZ09519.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722143.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980925"
                     /db_xref="UniProtKB/TrEMBL:E9ADS1"
                     /translation="MLLRASASSTLRTRGASCCSGACTGLYGSGSLTVQQRFIEYWGS
                     GVTGRTQPYAQGDMIPRVDNMRYPVNKATSAAASLTGNQSSIAYDTSSIFQVEGFSPL
                     EKEHYQSLRGSTRHKVESLPPHIGKDVMVLLKNMSEEGLLEEHWWARVVKDFPSMKTP
                     CTAEFKSAWEKFYTEASGVADDNEAVKAISRPFLQTQMQKNYIAYAMVWRVAERLCEA
                     FDAVPHVTVYERRGGRLVVERVTKLMLDTIADEPWAHQETTSPLHVDISNFRAWHEAG
                     YW"
     gene            complement(<256405..>258543)
                     /locus_tag="LMJF_29_0700"
                     /db_xref="GeneID:12980926"
     mRNA            complement(<256405..>258543)
                     /locus_tag="LMJF_29_0700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722096.1"
                     /db_xref="GeneID:12980926"
     CDS             complement(256405..258543)
                     /locus_tag="LMJF_29_0700"
                     /note="previous protein_id=AAZ09520.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722144.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980926"
                     /db_xref="UniProtKB/TrEMBL:E9ADS2"
                     /translation="MTSSLATASALITGASPADASFYSLPYVSALRHCTASAYGPTLK
                     SVVSSTAATSLYGDGLAECVVRCRLETEREATECLTAILLQELPQTETCGRRRRNPSA
                     TLDVTGAEREGFSAASHPAGVALHRSTTGASRASSRTSSARALRRLSVKEHNGVSSAP
                     AASLAEPSAKENEAAATPFLGAAAARALCCDASALLLLRIGLCRALGWPAPVKLQLKG
                     DGGDEAGCDEDGSAKNGSGACGLPTQLADALLSRSSYPNLLRSQRVTEPGGVSEATTN
                     IERKSAHMFMHMTDTDLRNSTILEWVEDVLVFAHYQGFTAVQTQCVLLDSLLVLDVVD
                     GHLVDSTDAAGHVPLEQRVTDALQQVLCAQTCLTVTRTVDTVCRYQPVTIKVPDPAQL
                     DEIAEKQRKTTSQKALAALEAAKQSIPLISQTAMRNVEVEVEKDVTLRAVFTMPEAAA
                     IAEYITRSVVTHKRLWGVLLAPVTEEQLPAQPTPAAAAAAPDGLHRPVVHHDICVSIE
                     NVPSIYLPPLSVFRSEALQAVVDAQRRLYEDCKAERTLQFSTDWQEPLLAIAAQELSE
                     RWVLQEAVAQVVAEDRAAALTLQQCARVERAYGLRLEDVMEFNPHVVRGAPFTASEPP
                     AVAAAPLCARASSNKLKKNGPGGSIPSTAAAPVLSTDAAASVVLPADATFRIAEVEVR
                     VDRIAAAVEGMDDAGAASSGASQRVGSRKR"
     gene            complement(<259526..>262093)
                     /locus_tag="LMJF_29_0710"
                     /db_xref="GeneID:12980927"
     mRNA            complement(<259526..>262093)
                     /locus_tag="LMJF_29_0710"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722097.1"
                     /db_xref="GeneID:12980927"
     CDS             complement(259526..262093)
                     /locus_tag="LMJF_29_0710"
                     /note="previous protein_id=AAZ09521.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722145.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980927"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="UniProtKB/TrEMBL:E9ADS3"
                     /translation="MKSAIAPPTLSFRRKTITETASAAHGCLLVYPVSKKSKQRVAVG
                     DSTGLFKVFSVGKRLEPVVAFETPETVAQTGEGGAAKEKKAITAATLFSDQLFYIQGS
                     VLHAYSRKGKPFFTVDTNVTERVHSLAIETPFIFLAGDFMVTTMSERKELGFFLAPDR
                     VNDMCVYVVPSAVMRGGERQLVDYVSCLACNDRVLRLVQANKLVEEVSCEAALTAVVY
                     HSVQRLLFYGTQSGSIGVMAVADNGGVHKVGAHMPDGPRGTISSLGFADVNADGQDEL
                     LVGYDDGTVCVMVVHLSRSVSITGIDAVQLTLVWTGGVGERVMSVAGGIITHTAAQPD
                     VLVHTFSGQVIAFTLDTDEPREDTQAAAAEAAARQAALIAKQQDTQGEIEQLRALIAQ
                     RTRELSEAPVLRKAEEAPVLTVSAGFKMSVTLTPVEAMPMLSLVVSADASLDGMLVQC
                     NAALTFVSTDNAAVRTRAVGGGAASTPPSSQSATAAVGSPTIIATVTPVQRGSKRLEV
                     HMWVDEGMADTLRATVYSAQAPRTAQIKYVPLCALPLYERVPSVDTSVLSGDVVQSMS
                     RLIVLGAFQVQDARMWLRQLVPGMADVPRLAEEQQRFVFTSRFLDSVLTVDIEDDQDG
                     DKGSRAIFACNSLVTLATVKRHIVQVCAERGLNINTREHILCQTVHHQLQQLYPLMSS
                     MSSSQRRWQLLQGLRELQGPETNLDFLPNLFQEVLASAEEVQAEAEAEAQQEGYLKRA
                     VAALYRSFVYFKGHAPLFSEAIRVQLEAASCGLSFNPAALEKIMYPGDTTLQEAAAVE
                     VAAMSTAALASMKPAAYVPLTATTIAHVAGSADAECPALADSSQAPSHIASSPSLSY"
     gene            complement(<263301..>264131)
                     /locus_tag="LMJF_29_0720"
                     /db_xref="GeneID:12980928"
     mRNA            complement(<263301..>264131)
                     /locus_tag="LMJF_29_0720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722098.1"
                     /db_xref="GeneID:12980928"
     CDS             complement(263301..264131)
                     /locus_tag="LMJF_29_0720"
                     /note="previous protein_id=AAZ09522.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722146.1"
                     /db_xref="GeneID:12980928"
                     /db_xref="GOA:Q4FXY8"
                     /db_xref="InterPro:IPR001816"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR014039"
                     /translation="MLHRSLACFAVPADRKAFMELVKTLRYRTEAPISDCSAALKETD
                     GDMDAAMQVLRKRGAARAMKKGDRVTEHGFVVSCVGSTPQSGAAIVTICSETDFAARN
                     EHFQRVCMQVRDQLCKLMDATNGAVLANPEEAVKHLSDVMAEELRVAIAVLGENMRVR
                     SIAPLVPAPHVSERLLIGSYTHGSLNVDNVGRIVGLVALSQVRENEVVPKDVLTSVGR
                     HFVATSGAEGNYAHQNFFGSETETVGKWLKQRGLKFSSSLVQEFGKEPVVHTAPEPHR
                     "
     gene            complement(<266364..>267044)
                     /locus_tag="LMJF_29_0730"
                     /db_xref="GeneID:12980929"
     mRNA            complement(<266364..>267044)
                     /locus_tag="LMJF_29_0730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722099.1"
                     /db_xref="GeneID:12980929"
     CDS             complement(266364..267044)
                     /locus_tag="LMJF_29_0730"
                     /note="previous protein_id=AAZ09523.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722147.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980929"
                     /db_xref="UniProtKB/TrEMBL:E9ADS5"
                     /translation="MLARTSSPGGARPGSRRHNNANALVHNPLNFSVQDRRLNTRLLK
                     ETQRRKAQLLGMTRHDVARQLHRYTVPPSSIMDQGHRGGPSIGKSASHTNLATGGGKS
                     TSRTGADAASAVSFPLGIHSEAGESSSSSRDSYSRLQEQYAQRLQKKKDTVNYSLNSP
                     TSPGEDDERTDSVPPVPPTASYEEWLSAGCPTGSWSVLLQEEVYAPLEAERAFLIAKY
                     NPEERLQS"
     gene            complement(<268462..>269583)
                     /locus_tag="LMJF_29_0740"
                     /db_xref="GeneID:12980930"
     mRNA            complement(<268462..>269583)
                     /locus_tag="LMJF_29_0740"
                     /product="putative peroxisomal targeting signal type 2
                     receptor"
                     /transcript_id="XM_003722100.1"
                     /db_xref="GeneID:12980930"
     CDS             complement(268462..269583)
                     /locus_tag="LMJF_29_0740"
                     /note="previous protein_id=AAZ09524.1"
                     /codon_start=1
                     /product="putative peroxisomal targeting signal type 2
                     receptor"
                     /protein_id="XP_003722148.1"
                     /db_xref="GeneID:12980930"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q4VQ66"
                     /translation="MPSFQMHPGFAGQSIRTNPWKPTQFIISTSQNFGIVGSGKAYVV
                     EAAPGFQAGSPVSLVGCWGTSDGVFDACFSEVDQNIVVTACGDGVKVYNLAMSLNRDG
                     VIPLVHNAEHQAEVSCVTWNSAHRDTFYSASWDTTIKMYSAVKPEVSMVTMQEHFKEV
                     YEVASTAHSPSSILSCSGDGSWKLWDNRSPQRSVLTQMAHQNQIVLSIDFCKSDPNIF
                     ASGGVDRTVRVWDARRPNQPLASFPGHDQACRRVRFSTHNPSMLASSGYDMRVCVWDL
                     SKPQQPLTARYQHHREFVAGLEWSQAAPNALASASYDGSAFFWSVGQAATPSLPTQQL
                     PPAVPPPRVPRPRTKVLAGLPQPSMPMPMAVTSPPRSPR"
     gene            complement(<272904..>274937)
                     /locus_tag="LMJF_29_0750"
                     /db_xref="GeneID:12980931"
     mRNA            complement(<272904..>274937)
                     /locus_tag="LMJF_29_0750"
                     /product="putative U3 small nucleolar ribonucleoprotein
                     protein MPP10"
                     /transcript_id="XM_003722101.1"
                     /db_xref="GeneID:12980931"
     CDS             complement(272904..274937)
                     /locus_tag="LMJF_29_0750"
                     /note="previous protein_id=AAZ09525.1"
                     /codon_start=1
                     /product="putative U3 small nucleolar ribonucleoprotein
                     protein MPP10"
                     /protein_id="XP_003722149.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980931"
                     /db_xref="GOA:E9ADS7"
                     /db_xref="InterPro:IPR007151"
                     /db_xref="UniProtKB/TrEMBL:E9ADS7"
                     /translation="MPSASTSASSPGKAVAVPQLGGQLRSSKHVLERLTSSHLDHLVT
                     SRRSGDTVLRESLAALYSLATKLHSPALRFASNTIETRKERHITTEQVWGQLNMLMRP
                     VLRQLENNVRRAQMLYAGSGKGTSAKAAPQQSRKAEAPSGKCNDGGRRARKPGGDAAE
                     KDILSTRTSELDESDLNEEIEALLAKQAAKRKSRKEAKKGGGGGDDAWRYAFGTDNAG
                     EEDDEEDDWDGEDSDHGRSRRRRREEAEEEDERDGEPPDRRARDRNLRAMADGEDGAE
                     SEEELAALRELYGDDFENDGRGFGEEEDDEDPDMEEDIELDDPANDAAGEAYNEQDGT
                     YFGKGDILNDEAGDFEEEHGGCGGRAGHIGGEDDDGTGAALQGEGEEMDEELLAALED
                     PSLSELQKERLREQHMVRKMEEKRLFATDWSMVGETAASKRPRDALLEVDNLEFEYGM
                     KAVPVITEAFTAKLEDRIKQRIQDENYDDVKRKTTLSTEADIAHPKYDAALDAQKSKM
                     SLMDLYEKDFLERQRLAEEAAGGPDAPKAEPLTEIEKDELRAIQMWQRLAQHLDALSN
                     FHYTPKPVQQDLDARVRAVENQAPAVVIENVGNFATTRENALAPQDLYRGSSHRFADV
                     GTDELTPKERHALRRSKKEAGKKDRERKEARDKQRADVRKRKQQSTEQATGMK"
     gene            complement(<276836..>279151)
                     /gene="LPG3"
                     /locus_tag="LMJF_29_0760"
                     /db_xref="GeneID:12980932"
     mRNA            complement(<276836..>279151)
                     /gene="LPG3"
                     /locus_tag="LMJF_29_0760"
                     /product="putative lipophosphoglycan biosynthetic protein"
                     /transcript_id="XM_003722102.1"
                     /db_xref="GeneID:12980932"
     CDS             complement(276836..279151)
                     /gene="LPG3"
                     /locus_tag="LMJF_29_0760"
                     /note="previous protein_id=AAZ09526.1"
                     /codon_start=1
                     /product="putative lipophosphoglycan biosynthetic protein"
                     /protein_id="XP_003722150.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980932"
                     /db_xref="GOA:E9ADS8"
                     /db_xref="InterPro:IPR001404"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020575"
                     /db_xref="UniProtKB/TrEMBL:E9ADS8"
                     /translation="MANSSLLRVVLVALLLLGSVTVSAGDGRGTPIAFQAEVSKMLDI
                     LVNSLYTNRAVFLRELISNGSDALDKIRVLYLTSPKEPLTKDGEAPTMDLRISFDKEK
                     SELILRDGGVGMTKEELAKHLGSLGTSGTKHFLEKLQEGVGAGGGDQNNLIGQFGVGF
                     YSVFLVGDRVRVASKSDDSDEQYVWESKGDGQYFLYPDPRGNTLGRGTEITIELKPDA
                     EQFLSAETIKKTIHQYSEFINFPIYVQEEVEVASTAATPEPAAEEGSLDEGAVEEDSD
                     KEGGTQGVAKERRWVLVNENRPIWTRPIGNVTEEEYHKFYKAFSGDYRDPLYFSHFKV
                     EGEVDFDSILFVPTTVDPASFSDDNAAPNTNIKLYVRRVFITDEFRDLLPRYLNFVKG
                     IVDSNDLPLNVSREVLQESRILRVIKKKLVRKTLSMFADIAAQDEAIADGKQVENPAL
                     SGHTHLKKPAYTKFWELYGKHLRLGVMLDSNNRNRLTKLFRYKSSRSESEYISLQTYV
                     DRMKKGQKGIYYLSGDSVARIKKSPVLEDAVNHDVEVIFMTDAIDEYVVSQLTDFAGK
                     KLINLAKEGVQFEESDARQRVADRKRKEKYDSFFTHLRVLFGYSEVRKVILTKRMTNE
                     AFIVSSGENQITARLASIMRGQSMSLANQQMTAERVLEVNYRHPLVDEMFKRFTVDEN
                     DEVATDIAWVLYDTANLQAEFPVADVAAYSKRINRLLRSSVDLSADDSLLPPDDAEYT
                     VSDTEAEEEEEQPKVDANADEKAEAVDEGDL"
     gene            complement(<280305..>280892)
                     /locus_tag="LMJF_29_0770"
                     /db_xref="GeneID:12981158"
     mRNA            complement(<280305..>280892)
                     /locus_tag="LMJF_29_0770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722103.1"
                     /db_xref="GeneID:12981158"
     CDS             complement(280305..280892)
                     /locus_tag="LMJF_29_0770"
                     /note="previous protein_id=AAZ09527.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722151.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981158"
                     /db_xref="UniProtKB/TrEMBL:E9ADS9"
                     /translation="MASRHSSGGFSSSSAGDAVKSARATTDSVQGLLRAARQNPEKEL
                     GIPLDEVERRQREACKARQFVSESTSRKFDVKSSARAQQIMNQGVDKYQREKRQRDLR
                     HNLSMLRKLQVVLCVFGAGLFGWLAVSYLLPRYFAVQDRQRCMQLRYERAQRSLGGIG
                     DGGAAGAAATLPVGPVVRIFRVEDEGEGGTKRTIQ"
     gene            complement(<284206..>286011)
                     /locus_tag="LMJF_29_0780"
                     /db_xref="GeneID:12980933"
     mRNA            complement(<284206..>286011)
                     /locus_tag="LMJF_29_0780"
                     /product="putative U-box domain protein"
                     /transcript_id="XM_003722104.1"
                     /db_xref="GeneID:12980933"
     CDS             complement(284206..286011)
                     /locus_tag="LMJF_29_0780"
                     /note="previous protein_id=AAZ09528.1"
                     /codon_start=1
                     /product="putative U-box domain protein"
                     /protein_id="XP_003722152.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980933"
                     /db_xref="GOA:E9ADT0"
                     /db_xref="InterPro:IPR003613"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:E9ADT0"
                     /translation="MASIGELDAYIQSGAAVDDAKLDQWIQMSDISNAGGFYRGDAAV
                     VGEAVRRVSRVVVAQYLNNADVKAVPLRRKTKFCLLLNNFSLHKPVRSVVFECLEDMT
                     SIFEKSIKDEGTMPFDSELGRMSEHVLVLLMRVMDYNLKAAAVHEFAEHNTQFAIQLL
                     LAILLKEPPYEFELRCNCISGLLGFTQPQAFFGAGEKIEEHSCNKFTEKVDFMLNLML
                     RLQAIQVVSDVLGDAIASSDTVPQLAQNAVNNTMQTIMNIFKFSSKESTQWRQHILLS
                     TTLLDGTVMMYVQSLASNLHETMTAQAPRVAGQLLHSLSLSFLFGAFAAYHMEEASQE
                     LRIFCTFFHDLFQLSIRPIVADARVSGQMMVMYINLLHFMCNVDAMGEEPSYPMDDLL
                     PELSSAALRSTVEAFLKKEVGGCGLPFTEAWYRQFRRVTADTLIAQDSTTFQWIDSCF
                     LAMISQLTVQQVPVAAPAAPAGGARLLSEIPPLRPEKKNKISIDKAAAPIRHKVNPSA
                     KQDSVEGVDADLLCALTGAVMKNPVSSPYGQTYEKEAIMNWLEQNGSVCPITGRPLTA
                     AQLSPNTAVATKIMQQIVCQTMAMQVVAEDDMYKF"
     gene            complement(<288015..>292784)
                     /locus_tag="LMJF_29_0790"
                     /db_xref="GeneID:12980934"
     mRNA            complement(<288015..>292784)
                     /locus_tag="LMJF_29_0790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722105.1"
                     /db_xref="GeneID:12980934"
     CDS             complement(288015..292784)
                     /locus_tag="LMJF_29_0790"
                     /note="previous protein_id=AAZ09529.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722153.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980934"
                     /db_xref="UniProtKB/TrEMBL:E9ADT1"
                     /translation="MLHRTRLSRGPAITAGASISVCFKGLGTYDYPSSFTWPPSLEDD
                     GDGRGHGVSRPPAAPSEPPRGTADSAEYRSHRRSPFSVLRSRQCRVGRCASGVLPASH
                     NTVAAPCAGGSSHGLVACGHRLCCCSALFYPALPPYSSSSSAPPSTSASPSSAEEGIW
                     RVRDDFLWALKLAGVERLLRTTISEELYGRLLGVTGTKTTVVLTCNDLLTAAQEYAEA
                     SSAEAALAAPAASLPATIPYVARLLLNADEDNRIKWLQEESAAMEHRDYYARAPSLRA
                     LLVMWSAQQQQQRVCAATLSGGCGGVAAGDLFPGDTTGADRRLATSSTARTPRFLIPP
                     PTMEDIQLILMRMEERHVEVTMADISAIAAIGAASTGTGTSIPSDEFWGATVRYLQPL
                     KLSQALKAYVSTPSPPVSDGAASRDEALVLLHVLILSVLLRYTSVANAEVPPASTAPP
                     PSAWISSSAASSTPGPANSKLLVPMAAFEAASAVIQLRRRLTTSCEGDDAAIRGSAHT
                     PTPPSAVYEALLTLCDEVLKHVYVLAERSQLSATSPHLPALTTWLLREMVTSAACELH
                     FKRLVDRSITEALIALEKSGLVNRSSMNLQVVVRQVLPLVEGCGSEDLYTSVLNDVVS
                     ALEEKARRDRHAFTQEDMLYLAELGTKLFVSGSADSTAGSYSLFDQTARGQMEELHVM
                     DGSPWALCVSSYRSLKEMMQAIIRDQRRLKQQVQEQLRQLSSSSTLSAVMTGSIEAQG
                     CHHARLDGDGAPLSSPSSPPDSETSSVARSDAAVDLGAASAASEAAGEDGFTRAKTAA
                     PCHGASASAPAGPPRISVSPMLRQRFLILIEELVKAQVAESSSDSERPIVVSTELFAF
                     VTRHVPVPNIQDEYRRKIFLLVNVAEAPETTCRRLAERREKRRASADGEGFRRRRRRH
                     VRSDTSASGAAEEEVEADGEDAQAGPGSKRAGAGNDPHGGANDIPAELRFLVSSLPLT
                     LSPWASVMILREVLAESAGRNPRYTYVLNAAIDLQLPMSTTRSRIATTLNMWRFLNTQ
                     AHKLSLKESVMMKQRCAWNLPMSYVLSSYWSLLTWLFLASIIMLNVVGIDFESQLVAN
                     SLFRMFAPWEEICVPRTAADDRDTWSTQAAADLASDYFEQAEIADRRREEHRLSSTDV
                     FLSSASYLILGYDDQRRPMTVIPIGSDCTAPAEERIAEEYAAATAVLRELSLHAPFPF
                     FVDIERPLPMEYVEKRIAERIRRVSFNNTWFLPRMIIRTFPLGRQYTEHKLVLHTCTQ
                     ANLTRRRITFLLYMHDGVPVTPQFIQELSDSFLSRHANLVLVVHESSLLKGGTTPAAL
                     AKVGLSNTVRGPSATIASAAAEMIDAVLPSDLRDCPSPSAAASAAHHMRVLPYCRQYY
                     SGSGSVIAGLQRVAGGETPEGGGGAAEKGWWVLTLRSVRRLWERLQAGSGAASSASTA
                     AASSAHLPLFASTFSSRRTSLHRSRERQCKEAEEVAATNTQRQSSDGRVSAAAVWVNW
                     WWHTLSGVTSATIRMVRVDRIGVWGEEAERDDEAARKSGTTVATNELAPRARAAADQA
                     AIDTVATGTAAHAAEAKAGKGGVSVSFTALRRLMSEV"
     gene            complement(<293692..>295644)
                     /locus_tag="LMJF_29_0800"
                     /db_xref="GeneID:12980935"
     mRNA            complement(<293692..>295644)
                     /locus_tag="LMJF_29_0800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722106.1"
                     /db_xref="GeneID:12980935"
     CDS             complement(293692..295644)
                     /locus_tag="LMJF_29_0800"
                     /note="previous protein_id=AAZ09530.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722154.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980935"
                     /db_xref="UniProtKB/TrEMBL:E9ADT2"
                     /translation="MSFGGFGTGAGAGGFGAKPATTAGFGVTPSTGAGTGAAAPASGG
                     RGFGGFGTGATTTTATATTGGFGAAGATGFGAKPGFGAAPAAGGFGAGGGLGTGATAG
                     GSSGFGSTATSGLGAGRGCGFGMTGGFGSTAVSAAPVAPTAQQYPYPGIKGPGNATSW
                     TRDIDFSQVTEQVRFEALPQPLQQHLMELRSFMHAERDAAKRVYLYFNESDGTDPAAA
                     VTASSATGSSAATASSSSYRKLLAQMAALKGGGNRAVDLVAVHCNQHEGQARRQLQRL
                     EKLEANIRDYERHVWEPLLEQGLPSSLAGSGMHVRGGAYRPAASNGAASPFVSLVEEL
                     SRRMDHVSSALTELEATLVPPGHPLRGAGESGRHGHHNGSAIPNDAIAQINAALLYEL
                     NQLRDSSCVAAHLHSRTDIARKLFTRQYGQAEADVLFADTEQQRNGLALFRRASPSTY
                     FDIPPLPQQPQLPAAALAAVTTTSGAAPITGFGAGTTSALGGGFGVTSGGGVFGAAST
                     AGTAGAATTGGFGAPATAAVAPAGGGTVGGVGFGVAVGGTTSAPATGGFGAAPAAGLA
                     PATGGFGAAPTAGGFGAASPSATIAPAATGAPPSAPSMGPAAPGAAPAAFNLGGGAAA
                     TGTGFGMAPGKSGAGDGGDRPSQRTR"
     gene            complement(<297277..>299076)
                     /locus_tag="LMJF_29_0805"
                     /db_xref="GeneID:12980936"
     mRNA            complement(<297277..>299076)
                     /locus_tag="LMJF_29_0805"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722107.1"
                     /db_xref="GeneID:12980936"
     CDS             complement(297277..299076)
                     /locus_tag="LMJF_29_0805"
                     /note="previous protein_id=AAZ09531.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722155.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0805"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0805"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980936"
                     /db_xref="UniProtKB/TrEMBL:E9ADT3"
                     /translation="MLTSAEEAYTEYLERRVVAGGVDATIVRAALQQMGFDEKTIAAM
                     MGDTSAYSLPFSTTSSASSTTSTSISSVKKPSRASGFSAATSTPSAPSEMADTAQFHR
                     VVTTPAESAADTPTAASATTTQVTPALPSIVPESKRSTSDANHLCTLSSPATAAAAGA
                     APPPSSSTASLSTPSRTLVADTVAGAAEAFFVDRHSGAVLSSRSHAESSVCGTDAKQD
                     CAVTLASGASSPTPSEAAAASADEHAQLTAAERTSLAQWMREYQALMLSSALPRRASH
                     SRADATSPSTAPLLPRETPFDAFHALPSAAACRVRTEGDKRGSAGAALRDKGAAQLLP
                     PWSEAAARVSRKVEDSDSCVPGSDGATSSNGSAFARTEGEYPPYFSEVLCQDGTAVEE
                     QAQDGGANPFSERHYRSAAQPFYRAARSAVPSPVRRAVPKAKSTVFVPTCGIGVPRIA
                     TGCVRCNFDAAQCRHPYREAQDVRIVRASHVAVTNNGEYNRRTIAQSCCQARQVDAAR
                     QAQQTARAQPTSGRLVPVMHAPIGMTVQPRAGLASGRQMSTLPVKAKTDRVRLAQYYR
                     HQWAEQERRSSAAGRSAAWDARYALLSCAGWTG"
     gene            complement(<300035..>301888)
                     /locus_tag="LMJF_29_0810"
                     /db_xref="GeneID:12980937"
     mRNA            complement(<300035..>301888)
                     /locus_tag="LMJF_29_0810"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722108.1"
                     /db_xref="GeneID:12980937"
     CDS             complement(300035..301888)
                     /locus_tag="LMJF_29_0810"
                     /note="previous protein_id=AAZ09532.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722156.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980937"
                     /db_xref="UniProtKB/TrEMBL:E9ADT4"
                     /translation="MFSASSSPALPVTLGHGYAAAVRQTSTTSAVGRSISRIVVVGAT
                     AVTLGVSAVLGGSLLYASLHRAERAASEAGTSPSWWSRVARRLRICSCDEEEDDAFAT
                     GKGAENLFDEEKVKARQRLPRGKAKGAAHSHASATTITAGAGAAAATVSAALPKLAGS
                     ARPVSEAKEALTMLANTEEIREREQYIKLVRGLLQREADIAYDDDDDSSTSSDSTDVS
                     LNYHLATAMEGDARDELLMAFSAYGDFSDGAVYGSSIRDAGDENAADLQLSIMIKTLE
                     YLDMSNEREKLRSRRIAMYREAGHATPVSSIDASEGDRDSGELDEGGDVVVDPMHSRL
                     AAHYATAHYGLTRRKGERDDDEGDGGDYLSAMERHAQRFQSMLLRPSKVEMPADDRMN
                     TDDSVLDRILGEGPAVRANPAMPRTARNGYAALLADRADMMEDGWEAEDDDEEAELMA
                     YLQQADSAQHFYSREEMRRARRDPASDIRIVGMDDNAFGEDDAESEWEDEADDEDMAG
                     TEGEDDAKADEEDDLAAAVPWSRRDKRDFERELFSRIRHLAKSFALTDAMAEREVSEE
                     EARKQAAREQRHQQGTEPSAKAAVDPAPAAAADDLAKGAEEWEDEADWEDA"
     gene            complement(<305795..>306817)
                     /locus_tag="LMJF_29_0820"
                     /db_xref="GeneID:12980938"
     mRNA            complement(<305795..>306817)
                     /locus_tag="LMJF_29_0820"
                     /product="cysteine peptidase C (CPC)"
                     /transcript_id="XM_003722109.1"
                     /db_xref="GeneID:12980938"
     CDS             complement(305795..306817)
                     /locus_tag="LMJF_29_0820"
                     /EC_number="3.4.22.-"
                     /note="previous protein_id=AAZ09533.1"
                     /codon_start=1
                     /product="cysteine peptidase C (CPC)"
                     /protein_id="XP_003722157.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980938"
                     /db_xref="GOA:E9ADT5"
                     /db_xref="InterPro:IPR000169"
                     /db_xref="InterPro:IPR000668"
                     /db_xref="InterPro:IPR013128"
                     /db_xref="InterPro:IPR015643"
                     /db_xref="InterPro:IPR025660"
                     /db_xref="UniProtKB/TrEMBL:E9ADT5"
                     /translation="MALRAKSALCLVAVFALLLATTVSGLYAKPSDFPLLGKSFVAEV
                     NSKAKGQWTASADNGYLVTGKSLGEVRKLMGVTDMSTEAVPPRNFSVEELQQDLPEFF
                     DAAEHWPMCLTISEIRDQSNCGSCWAIAAVEAISDRYCTFGGVPDRRMSTSNLLSCCF
                     ICGLGCHGGIPTVAWLWWVWVGIATEDCQPYPFDPCSHHGNSEKYPPCPSTIYDTPKC
                     NTTCERSEMDLVKYKGSTSYSVKGEKELMIELMTNGPLELTMQVYSDFVGYKSGVYKH
                     VLGEFLGGHAVKLVGWGTQDGVPYWKVANSWNTDWGDKGYFLIQRGNNECKIESGGVA
                     GIPAQE"
     gene            complement(<308144..>309598)
                     /locus_tag="LMJF_29_0830"
                     /db_xref="GeneID:12980939"
     mRNA            complement(<308144..>309598)
                     /locus_tag="LMJF_29_0830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722110.1"
                     /db_xref="GeneID:12980939"
     CDS             complement(308144..309598)
                     /locus_tag="LMJF_29_0830"
                     /note="previous protein_id=AAZ09534.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722158.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980939"
                     /db_xref="UniProtKB/TrEMBL:E9ADT6"
                     /translation="MDGFRAGASLVSVGSYTGATCPAEAKPLKAAADGDTTGSSPDSP
                     PAAGEPHPGGEDEASLADTCGSVGKEADDDAVTGDNGGDTEADDAEAEEDELYPEGDE
                     GEGDDDTEDVVEDVGYAEEEHADEEEYEYEPEDAVADASATTSFSSKPLMITIGTRQY
                     KASAFVKNRGLSYVPGKLKSNPKATFEPCTTNAPHSILDCQKLHLSNRGVLVGDRFIR
                     LNMLVDNPGKQALLRHPGRSLKMRICRRDVEPQKGETHNPATCSDLHLLPDIVFVGIP
                     GLRTAYFEAELRHNLAFGKLKEEAWETQCGTWCRGTRSHVVTTCRFLHYNRGDNYTER
                     PVPPHRPLAAIPDLTPSRPPQATDSNRRGRGRGRGGRGGRGRGSYRGRGRGSHGAAAI
                     PLPAAFERGYVAPSQDSAPQARSIATRASGAANHVKSPHDALAEADWMTDNGDEGSPI
                     DYRMLSVLFVLLGVFVFLLSAALRRKSDLAPTAL"
     gene            complement(<310898..>312073)
                     /locus_tag="LMJF_29_0840"
                     /db_xref="GeneID:12980940"
     mRNA            complement(<310898..>312073)
                     /locus_tag="LMJF_29_0840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722111.1"
                     /db_xref="GeneID:12980940"
     CDS             complement(310898..312073)
                     /locus_tag="LMJF_29_0840"
                     /note="previous protein_id=AAZ09535.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722159.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980940"
                     /db_xref="UniProtKB/TrEMBL:E9ADT7"
                     /translation="MSCERIDPKDFHSPAANQYTLNCLDELTRSPKFKSYVRHVEYKE
                     RFYLTWFLAPFTLFGILYYHLKMFGEEGISLFMGSSTSSSASLPALPAGMVCATVILL
                     LFAVPCISIAPFVGFFEEPRRWQSLITLAFLTLVNVAVVSFGGGPLHYPPFVTTMPPV
                     TELIVSWNPVDVAAVLVRDIFVRRALCLQGFLLAGYTVAFWRSRFWGRVWHPPLPLVT
                     VPIAVGLSGIGWWVVVQKGVPLFFTADGCPTLVAEALHWSAVKSDPAGAASLCFTVGK
                     EIYRQVVRDAASLWQQRQLPMVLQNPSSCMSLYLATASMALVHVFVLLVKPLADFVFG
                     AFFFVLPTDPTLWGLTLVGTIGGAVTLWRMNDGLVYTPHIAGLCAVAFSLLLNGFFA"
     gene            complement(<314351..>315250)
                     /locus_tag="LMJF_29_0850"
                     /db_xref="GeneID:12980941"
     mRNA            complement(<314351..>315250)
                     /locus_tag="LMJF_29_0850"
                     /product="putative high mobility group protein homolog
                     tdp-1"
                     /transcript_id="XM_003722112.1"
                     /db_xref="GeneID:12980941"
     CDS             complement(314351..315250)
                     /locus_tag="LMJF_29_0850"
                     /note="previous protein_id=AAZ09536.1"
                     /codon_start=1
                     /product="putative high mobility group protein homolog
                     tdp-1"
                     /protein_id="XP_003722160.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980941"
                     /db_xref="GOA:E9ADT8"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR009071"
                     /db_xref="InterPro:IPR014876"
                     /db_xref="UniProtKB/TrEMBL:E9ADT8"
                     /translation="MSALPNGSIPADLEKSMLEIMHDVGLSTLSKNTLRRRLEAKYKM
                     DFTPLTAEVDRLVGKLMTTPEIQRELAKIQKEKEDASARRLKRERSPSRAKKSKKDKE
                     SARGKKEKKPDDYPKGALSPYIIFVNENREKLKAKHPDMKNTDLLSEMGNLWKKVSEE
                     EKSRYQKLADEDKLRYDREMAAYIARGGAVFKRGGKKAKKEKDPKAPKRALTAYFFFA
                     SDYRAKHANIPAKQQMSEAGAAWGKMSAEEKKPYEELAAKDKKRYEAECSGRGSKPSQ
                     PKAADSASSSSADSSSSDSDESD"
     gene            complement(<320300..>321862)
                     /locus_tag="LMJF_29_0860"
                     /db_xref="GeneID:12980942"
     mRNA            complement(<320300..>321862)
                     /locus_tag="LMJF_29_0860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722113.1"
                     /db_xref="GeneID:12980942"
     CDS             complement(320300..321862)
                     /locus_tag="LMJF_29_0860"
                     /note="previous protein_id=AAZ09537.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722161.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980942"
                     /db_xref="UniProtKB/TrEMBL:E9ADT9"
                     /translation="MQQDMENSMENNAALPLREVQAAAASSSPGVGNQYSDTSTIRCR
                     GRCYTVPETSLSLQSSTQSVDFLQTKPTTSPSPTEGETVCDLVRYHAELTLELQQSML
                     RCIYQLDSSLVTVSQEDGGACGALTHPRAAQLQWMFLDAVVQSVTHLQQRWREGTVST
                     GSVEAVGEASVVLDRLAQAAQELRHPSHSRQLQVFELSERGSARRSPPPFTSWRSDAS
                     AMRAFSGASPLLCNTSPRVATSAPNPINECLGVAAADYSAKIIAQQLWCAQQLLSQRF
                     PGYAATWEVLEGARFLVESARSPTPTVPRSCSSQQVSTQVAAPSPVTVVDLNCKQSSS
                     HGGCTPPPCVVETQRKCERPCDLQRELTLPSRGLTFIEEQAADVVDDASTAMTGATAS
                     KNDLPTESPGAPPTPPAPHLLLPVARCALWDNFLASNSLSPTALLLAIQDLAARTISL
                     QPEDIVQHAQSGHPTSHRAFLCEVSANRSAVKPSKKDLPRDYRSESEPCRKMGGALGP
                     ALVHGDARSNRH"
     gene            complement(<322862..>323206)
                     /locus_tag="LMJF_29_0865"
                     /db_xref="GeneID:12980943"
     mRNA            complement(<322862..>323206)
                     /locus_tag="LMJF_29_0865"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722114.1"
                     /db_xref="GeneID:12980943"
     CDS             complement(322862..323206)
                     /locus_tag="LMJF_29_0865"
                     /note="previous protein_id=AAZ09538.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722162.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0865"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0865"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980943"
                     /db_xref="GOA:E9ADU0"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR024888"
                     /db_xref="UniProtKB/TrEMBL:E9ADU0"
                     /translation="MDDPKQTLYIRGLPDKSSANEVRRALYLYCTQFGPVKAVLYSKS
                     KEFYGQAFVVFTDVGTATTARRSLHDRMFYGRRIQAFYAHKQAFCVAPGERRRRDLAR
                     EKKRLRALQKKE"
     gene            complement(<324207..>325571)
                     /locus_tag="LMJF_29_0867"
                     /db_xref="GeneID:12980944"
     mRNA            complement(<324207..>325571)
                     /locus_tag="LMJF_29_0867"
                     /product="putative guanine deaminase"
                     /transcript_id="XM_003722115.1"
                     /db_xref="GeneID:12980944"
     CDS             complement(324207..325571)
                     /locus_tag="LMJF_29_0867"
                     /EC_number="3.5.4.3"
                     /note="previous protein_id=AAZ09539.1"
                     /codon_start=1
                     /product="putative guanine deaminase"
                     /protein_id="XP_003722163.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0867"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0867"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980944"
                     /db_xref="GOA:E9ADU1"
                     /db_xref="InterPro:IPR006680"
                     /db_xref="InterPro:IPR011059"
                     /db_xref="InterPro:IPR014311"
                     /db_xref="UniProtKB/TrEMBL:E9ADU1"
                     /translation="MPVQAFWGTVFETPDRHTLNIIRNALVVVHNGTIEQVIDPATDA
                     ATYASVLEAASAAGHLTRLQKGQYLIPGLIDLHVHAPQWPQLGMALDKRLDTWLQQYS
                     FPLEARYKDLVFAEKSYSSLVSALLANGTTTVAYFASIHLEASLLLARICLEKGQRAV
                     VGRVAMDLADQCPEYYRDASPEESVAQSEDFVQQVRGLKGNTEGLVLPSLIPRFIPSC
                     SDAALRGLGELAKNYGCHVQTHCSESDWEHNHVIERYGKHDALALDDFGLLTRRTVLA
                     HCNYLSTEDMQLVKARGAAVGHCPLSNFYFSGAVFPLKKALDMGVHVGMGTDISGGPS
                     ASLFDACRYALAAGRALESGTDPCLSATERSQHSGARVSSVEAFFVATANGGISLDLK
                     VGRIAPGYMFDALVIDTTLPNSSLIIFEGIDTLEDVFQKIVYNAAPHNILQTYVNGRL
                     VSQH"
     gene            complement(<327859..>328365)
                     /locus_tag="LMJF_29_0868"
                     /db_xref="GeneID:12980945"
     mRNA            complement(<327859..>328365)
                     /locus_tag="LMJF_29_0868"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722116.1"
                     /db_xref="GeneID:12980945"
     CDS             complement(327859..328365)
                     /locus_tag="LMJF_29_0868"
                     /note="previous protein_id=AAZ09540.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722164.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0868"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0868"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980945"
                     /db_xref="GOA:E9ADU2"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="UniProtKB/TrEMBL:E9ADU2"
                     /translation="MLNDLLFLSGFKKRWPILSEEEIRMHNTRRSLWIVSGNSVYDVT
                     GVLGSHPGGEAAILRRGGGSKNCEADYTFHSRYARREWDNCKVGEITPEVALRLFPPR
                     TGTHEENTRSVAACTAGSPPVGISRAHMNSGEESHTRTVDTYASTTATPDQQYRRTDF
                     SPCPQRVR"
     gene            complement(<334604..>336079)
                     /locus_tag="LMJF_29_0870"
                     /db_xref="GeneID:12980946"
     mRNA            complement(<334604..>336079)
                     /locus_tag="LMJF_29_0870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722117.1"
                     /db_xref="GeneID:12980946"
     CDS             complement(334604..336079)
                     /locus_tag="LMJF_29_0870"
                     /note="previous protein_id=AAZ09541.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722165.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980946"
                     /db_xref="UniProtKB/TrEMBL:E9ADU3"
                     /translation="MFCAVKHLRAPLATLKPVLADSVATQNVIRRMVGVTTPRKVNAS
                     ALNSIAEKTKGEGLAGTTAVVARAHLYLLSRNPTDAIAEIDAVLPKVQDEALKRFAIG
                     IRLRSHNELLDMKEAALGVSGGATEAEVSDLRSKLQRDYKELVASSPGCWLVELAAAE
                     YSLYTGAREEAYNHFTSIEKKIQEYIKAPIHVSELVATTDNTNEFSLVGFQVRRARPG
                     VKLEGVSAAVAEGMVNVMADPAAAKALQQAKKAFGGQVTDEEALELAVTLQEANVGHH
                     FHDFFPTTPDYYDKWTSEAAQSAQQLIQEALTPHNAGLKAEAIDRIRASVPNKAFYDS
                     EEKLHALLKSAPKDKSIITSIRETFGPGPSTPISSSDQAVADAVESVHLAVVSSDTAG
                     AADYAKRGKEIAKALAKQLLYRTQVQKSVALAEMNRLQEAVEAVTPVINANEYIYMWR
                     ALLARSRAYKGLGLITNADKDLKELNRLKQSLTERTPYEKK"
     gene            complement(<336673..>337212)
                     /locus_tag="LMJF_29_0880"
                     /db_xref="GeneID:12980947"
     mRNA            complement(<336673..>337212)
                     /locus_tag="LMJF_29_0880"
                     /product="putative ADP ribosylation factor 3"
                     /transcript_id="XM_003722118.1"
                     /db_xref="GeneID:12980947"
     CDS             complement(336673..337212)
                     /locus_tag="LMJF_29_0880"
                     /note="previous protein_id=AAZ09542.1"
                     /codon_start=1
                     /product="putative ADP ribosylation factor 3"
                     /protein_id="XP_003722166.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980947"
                     /db_xref="GOA:E9ADU4"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9ADU4"
                     /translation="MGLLTLLRKLKKSETEPRMLILGLDNAGKTSILRKLSDEDPTTT
                     QATQGFNIKSINCEGFKLNMWDIGGQKAIRTYWPNYYDEVDCLIYVVDAADRRRLEET
                     ATELDTLLQEEKLREAPVLIFSNKCDLATALSPESVSTALNLHSLRDRTWSIQKCSAK
                     TGEGLHEGLEWAVKSLKPK"
     gene            complement(<337641..>338690)
                     /locus_tag="LMJF_29_0885"
                     /db_xref="GeneID:12980948"
     mRNA            complement(<337641..>338690)
                     /locus_tag="LMJF_29_0885"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722119.1"
                     /db_xref="GeneID:12980948"
     CDS             complement(337641..338690)
                     /locus_tag="LMJF_29_0885"
                     /note="previous protein_id=AAZ09543.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722167.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0885"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0885"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980948"
                     /db_xref="InterPro:IPR008775"
                     /db_xref="UniProtKB/TrEMBL:E9ADU5"
                     /translation="MRLSLVEHTCSRCGKKLREAAIKKSVHCIKCNRWYHRACFMADT
                     GVVIEKKAPTTDRCVCCLAGTIDMKSKKYSHHMNKYARSFIKDGFCVVPLAETKTELE
                     QITQDLSAWNADLLRYFKALLKTYECQAEMRGAVPSLESGYSNFRQRCPGRFEIIADF
                     ITSKVVPLVANAQTVQQTLDALLCNAHLQTGKKVMSSGCFLSLMGSETQNVHTDGPAL
                     SNVVNLFPYAINVFVPLISVDSRNGTEFFPGSHVVGDRRQRKSVSPPVALGSVLLFDY
                     RVVHRGLRNAKSEPRPCYYVTFSRSWYQDTYNFSERRYKKRLDVDPTLLESREERMAK
                     KSRSDDGGSSASQFR"
     gene            <344824..>346182
                     /locus_tag="LMJF_29_0890"
                     /db_xref="GeneID:12980949"
     mRNA            <344824..>346182
                     /locus_tag="LMJF_29_0890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722120.1"
                     /db_xref="GeneID:12980949"
     CDS             344824..346182
                     /locus_tag="LMJF_29_0890"
                     /note="previous protein_id=AAZ09544.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722168.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980949"
                     /db_xref="GOA:E9ADU6"
                     /db_xref="InterPro:IPR009262"
                     /db_xref="UniProtKB/TrEMBL:E9ADU6"
                     /translation="MASLASCGFGAVREMLKRVVLGQALAFLNSLTGVSTTKLVNSNA
                     SYPVLQSVTAYAFIFAFYLPAFLFILYKYRAQRFSNFRFFNRWWKYAILAVIDLEANY
                     VVVLAYQYTNMISVQLLSCFTVPCVMVLSFFVLRMKFALTHVVGGVIAIGGLVLLIAL
                     DADGLSRSERGSQEVLGDILCLISSSLYATSNVLTEWFVKPSKPAFIFNCCSGNRNGE
                     AKDEATPALPSTDIQEPSSIYLEEGEIYASEDHPKVPVFIPVVENLAMMSSFALLFST
                     MQFFAVEWKTFKPHRSSWTGQDWLFQMVFGVTMLLVYTAMPIMFIISSAAFANISLLT
                     ANIYGIIWNVTIFKVYPTKLFFVSYVIIAVGILLYNLTDIVRIPFCARWNYPCGDPFK
                     ENGIETEADAEEQVHEVAEGHPQREAGSPSNESGDGKQGDATAKSTCGVTSQLDEQQR
                     EH"
     gene            <347246..>347893
                     /locus_tag="LMJF_29_0900"
                     /db_xref="GeneID:12980950"
     mRNA            <347246..>347893
                     /locus_tag="LMJF_29_0900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722121.1"
                     /db_xref="GeneID:12980950"
     CDS             347246..347893
                     /locus_tag="LMJF_29_0900"
                     /note="previous protein_id=AAZ09545.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722169.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980950"
                     /db_xref="GOA:E9ADU7"
                     /db_xref="InterPro:IPR002627"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:E9ADU7"
                     /translation="MEREVLDSFLNRRVDLMFQRGMLGEVKAFWLKNGGKLPRNSLSE
                     AIGCKEFSQFFSSDNPSLITSSDCENAVAQIKSNTRRYARQQERWIQNRLLPLLHSSS
                     LKEAPTHFVQLWAQEGVDALSSVQRTLDTFLGTFPEQPLAESLFPLKQQLASREPVSQ
                     EECKICKILVYGRGQMVVHLKSKRHRGSLRRLALEKEHREKYGRELPPPKRKRNK"
     gene            <348407..>349336
                     /locus_tag="LMJF_29_0910"
                     /db_xref="GeneID:12980951"
     mRNA            <348407..>349336
                     /locus_tag="LMJF_29_0910"
                     /product="putative signal peptide peptidase"
                     /transcript_id="XM_003722122.1"
                     /db_xref="GeneID:12980951"
     CDS             348407..349336
                     /locus_tag="LMJF_29_0910"
                     /note="previous protein_id=AAZ09546.1"
                     /codon_start=1
                     /product="putative signal peptide peptidase"
                     /protein_id="XP_003722170.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980951"
                     /db_xref="GOA:E9ADU8"
                     /db_xref="InterPro:IPR006639"
                     /db_xref="InterPro:IPR007369"
                     /db_xref="UniProtKB/TrEMBL:E9ADU8"
                     /translation="MMKGKSDIALQTDEALSIPLNGSVILFSVYVSLRFIPKEYFNIL
                     ISFYLSLISVFALHMFVKGYIKPNIVTGLICVGTGCASFFAQNWIASNILAFSIAVTA
                     LERLPVNGFTTSFILLIGLFFYDIFWVFGSDVMLIVATSIDGPIKLVFPQTIFGDCSK
                     KSLLGLGDIIVPGLFICQTLVFSKDYVKRGSLYFVTSMVAYTLSLVNTMAVMLIFQHG
                     QPALLFIVPWLLVTFSAVAVYNGDVKAAWSFDILSVFTISSEESAPGDPHAEQEVSLS
                     TFVCEAALDLFGFAKEDSAAESKTAESKEKKEA"
     gene            <349918..>351423
                     /locus_tag="LMJF_29_0920"
                     /db_xref="GeneID:12980952"
     mRNA            <349918..>351423
                     /locus_tag="LMJF_29_0920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722123.1"
                     /db_xref="GeneID:12980952"
     CDS             349918..351423
                     /locus_tag="LMJF_29_0920"
                     /note="previous protein_id=AAZ09547.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722171.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980952"
                     /db_xref="InterPro:IPR011685"
                     /db_xref="UniProtKB/TrEMBL:E9ADU9"
                     /translation="MLRNTLVRRANAQVAKSTAKVSSASTQRVAKRPPKVKYYMGIAY
                     EGLRHVYHGFRLFFINTRLAWKYSRQLKKGVALTRRERLLLESSTKDLLRLVPFSFFI
                     VVPFAELLLPVALKMFPGLIPSTFESESQGRNRLYGDAMKTLRARQRAMDYLSATALT
                     TFDKEQQEVIRRAVMGDSIAPKDIRLVAPYFGHDGPFSVFKVPDNIVVGLGRTVGVYK
                     WYHSLLPTRVLSPIMRRSIIRRYHEAREDDRLIRLEGLDGMNNDELVKANQTRGMRWT
                     EGTETLRVQLEWWNSLAQDDSVPYNTLWWIKPTRYSIRKSMNNLPVEQRRQLLGIQNL
                     PETVRASLETLCETVDTMSSISDEPNSADKLVEKIEKITSSAEKSDSDIGFEGLQEAV
                     GAYLTEENVKRMFEKLSKKKLPEESVVVSDVIECIGQETHNSSHVVSTVFDAFDYGAG
                     SKPITEKALLGIGARCRKAVRPPPAPKAAEEKPKSTSTEEKSIEAAPPGKR"
     gene            <353450..>355618
                     /locus_tag="LMJF_29_0930"
                     /db_xref="GeneID:12980953"
     mRNA            <353450..>355618
                     /locus_tag="LMJF_29_0930"
                     /product="ABC transporter-like protein"
                     /transcript_id="XM_003722124.1"
                     /db_xref="GeneID:12980953"
     CDS             353450..355618
                     /locus_tag="LMJF_29_0930"
                     /note="previous protein_id=AAZ09548.1"
                     /codon_start=1
                     /product="ABC transporter-like protein"
                     /protein_id="XP_003722172.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980953"
                     /db_xref="GOA:E9ADV0"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9ADV0"
                     /translation="MIFESTPLVGNPTAKSYPSADGRLYGRSFNADDYDAEVQGQRMR
                     QYYHSVFRSDGIDVAVRNVAVVQQPWLQHFNPNGRRGRICCQAVSAHFRRGRLHVVAD
                     VDGIAAASLMTVIAGRGTQASGDIWVGDATVDAQTRLRLIAYVGAESLFVPLLSVKDN
                     LWFVVHLHCKEQRSWTRELVLAAANFVGLDLGKKVADLSQSEKFRLQVALELVLDSPV
                     LFFSYPFDAMGLVEQNECTQLLSRLCVDVMKTVVLSTRSMPMPLHSAADTLLLFGAGG
                     VVLFSGKCQDAISYFNSLRIPRHIPQPLWKGVLSHDADAQAAEEDLRTFHAPSLPPSD
                     SSPFSQRGMNAPGSRLYSVICTPPRLSSRVFLMDDLNGTPPPPPLYCRAAERGSASTS
                     AVVEVATSGDLMDLAVEWAESESQTMFYAAKYYDSRVHVALLSSLDPANAGSAATTHT
                     PPPPPRALPHGVWRFGVLLRYTLKQILADAELLLGVAFLSIGLIVLTVAVHSQPENQG
                     GMYNIRGLIFIAFVLVLFSNLAAIESMRDQLRVALGHRKRKLYGSLSFIVCLCVRVVL
                     IRSVYLALFLPFVLFVLRSSYSLAILVGLVTCTHAAFQYLISLLPSRRWVMWVSYAYF
                     GYSIIFSGFLLNLRTLPPLLGVLSILRWGYGAVIYTWLHGKSFQCDGAGNTSYCYTGD
                     DYLAVEGLENESVASSALILAVSGASMMALLLFLWSLRSV"
     gene            <356161..>356688
                     /locus_tag="LMJF_29_0935"
                     /db_xref="GeneID:12980954"
     mRNA            <356161..>356688
                     /locus_tag="LMJF_29_0935"
                     /product="putative A-1 protein"
                     /transcript_id="XM_003722125.1"
                     /db_xref="GeneID:12980954"
     CDS             356161..356688
                     /locus_tag="LMJF_29_0935"
                     /note="previous protein_id=AAZ09549.1"
                     /codon_start=1
                     /product="putative A-1 protein"
                     /protein_id="XP_003722173.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0935"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0935"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980954"
                     /db_xref="UniProtKB/TrEMBL:E9ADV1"
                     /translation="MDAARKRHRGNASEAAAKGDDDDSAAIPRREARHHAHGSKSAIP
                     FTSTPEEACEDDSDYAVLVKRSTALLAKLGQRSVLDNCATQETSSTQKEATQPMTLPC
                     RFENHKLSLYGVSCSAGSLVLPFATAEGIQPTELAHRFTKCTQTESSTTLEARKKLLA
                     TELSELYTLLHVFFS"
     gene            <357995..>360268
                     /locus_tag="LMJF_29_0940"
                     /db_xref="GeneID:12980955"
     mRNA            <357995..>360268
                     /locus_tag="LMJF_29_0940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722126.1"
                     /db_xref="GeneID:12980955"
     CDS             357995..360268
                     /locus_tag="LMJF_29_0940"
                     /note="previous protein_id=AAZ09550.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722174.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980955"
                     /db_xref="InterPro:IPR005532"
                     /db_xref="InterPro:IPR016187"
                     /db_xref="InterPro:IPR024775"
                     /db_xref="InterPro:IPR027577"
                     /db_xref="InterPro:IPR027625"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9ADV2"
                     /translation="MKAVHLRHYRGQEAEERYKLATPRNLILQRMPTVDSGDPVAKAE
                     AIRNYVHNTMELFEKVFDCLAYEESFLVPPIHKLRHPMIFYYGHTACFYINKLRVAGL
                     TERINPRLENMCAIGVDEMSWDDLNEAHYSWPSVETVCEYRRQVRDRIDQLMLSGKFP
                     LKMPLTLANSTDNDANAFWWVMLMCAEHERIHLETVSVHVRELPMKYISTVMSDVWQR
                     CPDAGTRAPINDLVPIAGGKVQMGRMPNSRVYGWDCDYANGCNIVEVAPFKTSKFIVS
                     NAEFFTFMKADGYSVQRYWDEEGWKWVQWKKPEHPWFWVRDETRPSGFALRLQTQLID
                     LPWDWPCELNNLEAHAFCSFKSEQLGKRIRMLTEEEWMLLFDRYIGKDQPDWGEKAPG
                     NINLEHYQSSCPVSKFKHGDLYDVIGNVWQHCETRVHPYPGYRAHPFYDDFSLPTFDG
                     QHACMKGGTWASTGNMATRDARFAFRRHFFQYIGLRYVEGPDVLEPQSKCSCLGLDPE
                     VDAITDTCFRDSFQGLPNGCVAIAEYARRMFAEHATVPAERAMDIACGGGRVAFELTT
                     FFQQVLGVDYTARRLMPCFALRERGECQYSVPNSANGERTAHTVKSENFQWEPTLKRA
                     TFFQSDPTNLHAHLSDLSLVVCWNCLERSYQPSAIPAHLLSRVAKGGLLVIGGDYNWD
                     NIKKNAEDADKQDNTYLTDPLITFKGNYQTEIFHLLGGSDAVEQVGEVVSIPVAFPKT
                     EDTADIRVMELATYRKK"
     gene            <363014..>364498
                     /locus_tag="LMJF_29_0950"
                     /db_xref="GeneID:12980956"
     mRNA            <363014..>364498
                     /locus_tag="LMJF_29_0950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722127.1"
                     /db_xref="GeneID:12980956"
     CDS             363014..364498
                     /locus_tag="LMJF_29_0950"
                     /note="previous protein_id=AAZ09551.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722175.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980956"
                     /db_xref="UniProtKB/TrEMBL:E9ADV3"
                     /translation="MSSDELPPIIDTPVPPRPALYVPPEERDPSDESLAFLKPGSPLQ
                     HLTRRSEEVQLPEGLDRAPSIAERQRAAPIYMDADAARVRSTSVHAGQSLLRSSGIDT
                     SAYYYSVPQAPSAAEGDVSAVGALDASHRSRLHILREHAPHRGSESTPLGADLTAGVL
                     SGGSVGAGSSCSTAKERSMFAASHEFAAVEKTPEELEDERQRAAPKPIAKQLEADIKK
                     LEYYQGTPQYDKLLADFRFKYSAEGTATKGAKGPVYTAEEVKCGLEGQPIDYHHSSTK
                     LQAALLSGPRAYDPVTIMQQQGILRFQGYAFPPTVELGKLKGDGDELKALHNAHKSHS
                     LVAQVRRGMNALVGRKDACDDYVAMEDKSKEDTHLLYRTLGLEAVQRRQMRYMLTDFD
                     YADRSTAFHVMMSYPYTDWLHVFYMVLVGCCLYQLQVRCGAYEFYDEYLGLDLRQVPR
                     LQKPILAGITVVVMIFFFFQPLLVASIATTRAYRIAMKRPIGPP"
     gene            <366920..>368242
                     /locus_tag="LMJF_29_0960"
                     /db_xref="GeneID:12980957"
     mRNA            <366920..>368242
                     /locus_tag="LMJF_29_0960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722128.1"
                     /db_xref="GeneID:12980957"
     CDS             366920..368242
                     /locus_tag="LMJF_29_0960"
                     /note="previous protein_id=AAZ09552.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722176.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980957"
                     /db_xref="UniProtKB/TrEMBL:E9ADV4"
                     /translation="MSGRCFSKSLESDVDSAAAAESSLSATEVSTDGYRTGKQPRHVA
                     FLLEKDLKETDTEEVPRAAFAGRRGGAGARPTEEQWSWSGRAEADALRQRALQCGEDF
                     VRVASGLGYEVVAHTPTAFLKRGMTEKTAALFGVAQPEKQGGTGLAVARSATARASTG
                     AVLLSSPSAAETTVTLAAPFSSGGSSVFPRKGELDSCSSRSSSPGTEDQVGMVPVLSP
                     LLQGSEPGQRRLSTDASLRALEVQTPRTTGAHAGVYRYPATIASLHPLQDSTPNSVAD
                     GNGVHTSPHRSSRTGFGAEHHANDGANPPGPAIANSTRAVHWTPTTRHPSPSRGSPAS
                     HRALTPRTVFPTGNHPVTASLMVPGQQSDAFAVRLSIMDVTSSRTNSNTNTSMSTEHL
                     NGHEFVNVGGSQNTNNRFFTSSTDALNTPAVRMTDDEDWLRATGRLIQ"
     gene            <371627..>376624
                     /locus_tag="LMJF_29_0970"
                     /db_xref="GeneID:12980958"
     mRNA            <371627..>376624
                     /locus_tag="LMJF_29_0970"
                     /product="putative kinesin"
                     /transcript_id="XM_003722129.1"
                     /db_xref="GeneID:12980958"
     CDS             371627..376624
                     /locus_tag="LMJF_29_0970"
                     /EC_number="3.6.4.4"
                     /note="previous protein_id=AAZ09553.1"
                     /codon_start=1
                     /product="putative kinesin"
                     /protein_id="XP_003722177.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980958"
                     /db_xref="GOA:E9ADV5"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:E9ADV5"
                     /translation="MASRPSCSISGSFQPTPSILGAQEEKVRVAVRCRPPNAAHGEHS
                     DDIIVSMNPSANEVYLLDQEAAPWRLDMPLWSCSGVALDGSHAVSQAGVYEAVGRPLL
                     QHALDGYNSTLMAYGQTGSGKTYTMMGDHRDNEGGEGAGLIPRMCRDLFHELNNRSFT
                     APSGERLSWEVHVRYVEVYCEKISDLLNCGASVGIREEITPQSATFALVGARRVKVTA
                     TDDLLQALAIGNKWRRTAATKLNDRSSRSHALFLIDLTEIISFTEPDGTVASAPSKSL
                     SIRLVDLAGSERVSETGVHGQKLREVKDINLSLFTLGCVIESLSDPKRRGIKPPYRDS
                     VLTKLLRDAFGGNSKTTMVCTISPCEAQRLQTVQTLHYAAKAHRVLNKPTVKEDPSAM
                     ELRRANEELVALRRQLDEAQRNGNHYESIEAELREANMRLRREQKEARLRKQVMERRE
                     AELAARMRELEDQREAYEAQMQALEGEAERARAQQEKREEELRRAHEMATEYARDRLK
                     EMEEQCVSAEAALRSREEELVKRQRAIEEKMRAAEASSRCRIDELQRQQKDMENALKE
                     KERLASMHEREMRHKYKQAEADLRAMEKRNFQMEEEWSAKVRALEATAKQREEDVAQR
                     IREAQGAQCRAEAAARRKEEELQRKWIEVDNEARRLQSEVAAKEAELKRCVQEANRST
                     EQREEELNERLRKAEYELSRRERETAQKLLEVEALRQSTELQSETTRARERTMKEAHN
                     VRTESLQALEAQLQQRQEELRTQFDEVMQMKRAWNAQHVEQRQKLQAEHEAALQAVKQ
                     WETDVSQREMELRRQNDELAGKLRAQEMQLEKQQMLLLADKNEFETTMQRERRAMLRT
                     REEIQLAQDRNDVDCKMRHDKLREWETELRDRRAEMEATQREREAMLRQKEMALAALQ
                     DATMAKEVELYQAQERLKAEQADLQRVAKGTETERGRLQANYTRLQGCDMRLGGVADH
                     SVFDSGALDDVRMSAEYMACHGHAESSADVLNRREQRYFCAFESMYRANILAEERIEF
                     RSLVRSNQLEARDIQRCVQVMRMQEVTSALQAKLNAALSESKAAESRATASQGQVETL
                     RGELESLRRQALEVKVQTGSAVAAAQFAEAQVRQLRIEAYEADAKHRDREQECQSAVI
                     KAQSAATAAAHSQGLLHQLAMRVLLACEEEQRSLLERHQTSELQSLHLLQISDQRVLD
                     RESAIRKWQSLYRRCSEGNALTKAKDDAARQRLADEEAQRLRNLQHSGDVLARREDCL
                     AAERERFEQRVLNFESYQRAQMTELSRQEQEVKGYLLELEEMDQRKMREYAERERRLV
                     EMAEHLKMRQACINTNAQELFQSLLQRSVEQQSALAEAHEELERVSLQRTKYMTLERQ
                     LIEQAQRGNADAIQQLVKLHEEHVESEKHQLKRRARRLEEEEAHNKQRLAEQEAEIHR
                     YLLDIEAEDVRRNALSHQGQELMRKAEERLSKAQFKEAALRDLARQIHLEAMESEEQA
                     RTMETTLRRKEKSTREKLKHRKVELEQLQRAASCAAEHNEQTLLDMEADLLAIVNKNK
                     DAEHVIKTREAEIERQKMYYMELSKVLAERDEMLRKEHALRLCGKKNAGSLAKDLLDV
                     NDALRKQVSTWKQKFDVLLSEGKIECEKCSWKNKRDTTMCMCCGHAGLLELSQTC"
     gene            <378753..>380390
                     /locus_tag="LMJF_29_0980"
                     /db_xref="GeneID:12980959"
     mRNA            <378753..>380390
                     /locus_tag="LMJF_29_0980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722130.1"
                     /db_xref="GeneID:12980959"
     CDS             378753..380390
                     /locus_tag="LMJF_29_0980"
                     /note="previous protein_id=AAZ09554.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722178.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980959"
                     /db_xref="UniProtKB/TrEMBL:E9ADV6"
                     /translation="MRCSASTQQLLDELAARERRVLQQLRDLSGVKVSPIAPSRPCAS
                     LSMTPERLNAASTHPASSTPLPQLLPSPLATTEHEEYQVKTPSWCQQGSCHHDVHHPP
                     RGTVGNLERDLQRLQYLLRHSSLTGTQAAIADAGDENGSEATNAQQSQQHLSMTHRDD
                     GAAVAREKRTREARRPNLSASPVTPEVKRDRREMEAYYAPPPPLTPLPSHAEASLQHS
                     GGGSTSPARCSAVLSMDDEPRDEAVALASDALAHFSHVAAGLVTSGVENPFRRANTTM
                     FPGRCSAKTVGGLQASPYREPDDTVPREAHNRQGVTSAVVPSTGEWRRSPVRWFSSFA
                     PTATSISKDAPRCEWREEGEEEVTMLCASALDTWAAHRSAHRVPHETASFDSASIATS
                     PPPARTSRDSRPPVSPSRPGELSDIHATPHPALPSTNSPPRVPARSPSPFGETCQLAV
                     STAGLTFLTPTLDEDGAAQPFAATLRAQAATPQETLHSANGQHGCRVSVEPQTSCVAS
                     ALPSGAMRTTSSTLKAFYARQSSAGALMTPSWEEATR"
     gene            <381784..>384759
                     /locus_tag="LMJF_29_0990"
                     /db_xref="GeneID:12980960"
     mRNA            <381784..>384759
                     /locus_tag="LMJF_29_0990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722131.1"
                     /db_xref="GeneID:12980960"
     CDS             381784..384759
                     /locus_tag="LMJF_29_0990"
                     /note="previous protein_id=AAZ09555.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722179.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.0990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.0990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980960"
                     /db_xref="UniProtKB/TrEMBL:E9ADV7"
                     /translation="MEELPAPSPAASTAPTQVNVEFLSDDALVPSPKVLIGTTDEGGR
                     APRNRESRRIQFLDDGKLFEGHFTVQSRNLKSIIQYLVDRQSEQDVIIHDLQKQVHVL
                     RSRHLKAKQRAGGDGEMWLRAAAASGKSASGRGVEDRVKRIEQFLQLWGVRLGDVAKL
                     VEEYGDPVITPDAYTSYLVDLPAFRFTRRETRAFVISASEQSSISAAAAAASDTATRR
                     RHNSPSTRETGSAGSSSDTERKCDDGATETALEKATTALKKAEMLLEELRSIPARPPP
                     SSSKARRAETSAPNPDKGGSGGSGGAIDHEARADIEELGDYVIRRFQELEAKSMMTSA
                     TVARAAAAPRAEKGGGSSVGGGGAAAAKAATARPKQVPTKKPVANTALPTPALEPPPL
                     PHMVPGEVIDTIAREDAATSLDLLEELEVTMERRFKEVNSALANIALRTASMAKNSSS
                     SAPSVAEPEKQQQQRSGSSSSRNPSSRARSPFSGKRGDSNAEPKPVVEDIEAEVEEAC
                     VSASASHAPSSTSKVLRPPKGKAKQTASNPAEPLIPSVGVDQVAREETAALSDRVGDL
                     EEELLERWQAMEERLRIIGRAAMKQSASNVAAGPGGTAVTAVNRAPVVDRKAREDAAL
                     SLMRLQQLEKELAQLKRQWASADASARSAFGNADPPAGANETILTTPAVSMEPSAPLR
                     DTYDSKVADLEKEVAQRMADVNEAIAQLRGGAMRATPGRDAAVSAARVTNGTGRGDAL
                     SDLNTLAWIASLAPPAESLAILPDQPQVHQSEVTSTSPLPAQNHLTLRAIDADALPGV
                     AAEGRLPEVDTSRRAETYQSVLALGYSRNTDVDLFTAYPMGSSSSGAKRTAISRLRPP
                     DAPTFGTHLVERAMVDLPADTAIAAAGEAANVAGKRTSVQSSAAAAAPLVADGQREAA
                     VAAKSYLENRTFSVSPPPGAPKGGITRVRMSEVRGVSPAAPSVPHQHLREALVHTEPC
                     LVVNCAWCDTEKAAEPTLT"
     gene            <386856..>388733
                     /locus_tag="LMJF_29_1000"
                     /db_xref="GeneID:12980961"
     mRNA            <386856..>388733
                     /locus_tag="LMJF_29_1000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722132.1"
                     /db_xref="GeneID:12980961"
     CDS             386856..388733
                     /locus_tag="LMJF_29_1000"
                     /note="previous protein_id=AAZ09556.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722180.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980961"
                     /db_xref="UniProtKB/TrEMBL:E9ADV8"
                     /translation="MPSIDIDVTSVPDIIEAQLTLSYSRLTDVIRVLVEQGNGHEDDI
                     DEIRDRLGKLTQENIDLRAEIQALKQAKDPGEGVTTALEDLRSTVAQLSEKVAANTEH
                     IAASDAAHKACVADAEKHSTEQHDAMRATFNRHADVVGQRVSATEKSLHALQAFVDLW
                     GALPEQVLEMGRRTDKQEMEHSLVDRTRYVLSLPSFAKIQEEMEVLRALLQRQAADAL
                     AAKTSEAARTSRTASYVAAMAAPAEAADRSGEIETLNGAMRFLEQDMAALQQQRLPAL
                     ESAVRELQGCAHPEKRISGTEKDVNRLNEHLTQLEDRLNTLLGQTGATQEGGVDESHP
                     GLVDLARRVSLLEETVEGCPRGKHTTPTSYGPASGGEAVIADGAAAAAPVRSLSRNRG
                     SIPAAGRPPLGRVSGSGVLPGVAKEAPSGSSPVAEGGLALPSPHRVSSLTCSFNSNAL
                     EQPTVEVLRRQEASQPDVAADRSRISVAVEPDEGLRLRVVQLEENAAILEVNKADRRE
                     LRELEETLRSALESSHHLHQQYQQHQQHLPPLQQALPSSSAYNTPSLVPQRPISASGR
                     YAVPEYALNQQRGDGFSRPTSATAGLGRPMFVGSSSSVYLRDGAQLTNVTVSPTHLYR
                     Q"
     gene            <395150..>396202
                     /locus_tag="LMJF_29_1010"
                     /db_xref="GeneID:12980962"
     mRNA            <395150..>396202
                     /locus_tag="LMJF_29_1010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722133.1"
                     /db_xref="GeneID:12980962"
     CDS             395150..396202
                     /locus_tag="LMJF_29_1010"
                     /note="previous protein_id=AAZ09557.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722181.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980962"
                     /db_xref="GOA:E9ADV9"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR014189"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:E9ADV9"
                     /translation="MQLMRAVTLKGFGDTDMLQISRIPKAVITRGRDILIKVSAAGVN
                     RADAAQRKGHYLPPKGSSEVLGLEVSGIVEEVGVDVKDFKEGDKVMALLPGGGYAEYA
                     VAHEGSVMHIPQGYSFIEAAAIPEAFLTAWQALKYHGDCCKGQKVLIHAGASGVGTAA
                     AQLVEKYFQATALTTSSESKVEVCKNFASINFTRTPDETGMCFSPKVKRLLGEGAINL
                     VLDSVFGGSYISEDAAVLAKDGRIVVLAFMGGATVHLNCLPLLRQRAHVMFSKLRCQS
                     DDYKQNLVDTFEEAVIPYMNERLIVPVANKTYPLEEVAQAHMRLDDSKAWGKIVLTFN
                     SHLSATSTNPPPTLTA"
     gene            <397953..>400148
                     /locus_tag="LMJF_29_1020"
                     /db_xref="GeneID:12980963"
     mRNA            <397953..>400148
                     /locus_tag="LMJF_29_1020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722134.1"
                     /db_xref="GeneID:12980963"
     CDS             397953..400148
                     /locus_tag="LMJF_29_1020"
                     /note="previous protein_id=AAZ09558.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722182.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980963"
                     /db_xref="UniProtKB/TrEMBL:E9ADW0"
                     /translation="MLLSTTLICFRPRGARGVGLCSLRRRLRHLRQTNGAAVGQLQER
                     RRLQYLLREEQRSASATSSSSGGASAPGVAAAQLCALELLPRNDALEAAIALCISENR
                     DARTDLELVRRLVNSTLLSFASPVSRRWDPYDVKPQVFALDNYIALPVFTSLEYLRLF
                     CQRFGFAVRDPSGVLWASGSSTTASAGGEAPIMGLLPDTLLQSEWWQQRHAQRQARPP
                     TEVTMQERDDAADGSAWQGGQPAHEREAKAVPEDGTDAHMPGSACVALKAAELTAPDF
                     SPGSDAAQAALPTPLDGTPINVDALFDAMLMDGLVEKERGTSSASSERCRVAPAKKAV
                     RTRARKRSRGAASKVRGIRRRVASSRHHRFLRERHTGRRQGTAGAARAIASREESVAG
                     AASAKAAADEAKAAADEAKAAYWESVAQTSPFQIKQATPLPMFGPFLHPFLIGYFADV
                     STLLHNASIVPEKVDIVLNPASPLEFVLSRAATDRVLHKEQLLHQAYLKVEKELQREF
                     SAFFAACCPEVISASSACVPLPMNVDEVDAAWQASQRPVNNGRRSCTSAASSPNELQA
                     YRERTRLLREAEYRNGVTYELVLLIQSTSLEETFTKIQQAKHQSALMGHTNLDVLPEI
                     AAAPHVREMAHHFYDGASEREKRLMQREIAAQYERSLGDKSLGDGAAESDSVAAAQVF
                     GHMGVFVRRGAPRTINVAQSADSYFHVPTNAYTEAHAVFTEDLKVNRGQ"
     gene            <401229..>401822
                     /locus_tag="LMJF_29_1030"
                     /db_xref="GeneID:12980964"
     mRNA            <401229..>401822
                     /locus_tag="LMJF_29_1030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722135.1"
                     /db_xref="GeneID:12980964"
     CDS             401229..401822
                     /locus_tag="LMJF_29_1030"
                     /note="previous protein_id=AAZ09559.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722183.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980964"
                     /db_xref="UniProtKB/TrEMBL:E9ADW1"
                     /translation="MTATEYQKLIGERRLSPEEEENLVQRLYFRQMKLTEQREEERRA
                     ILERTRAQMQKHISKDEEGRLVSRMYDQQVERFANSKAERDRKLEEEMHKNDKKMDSS
                     EIDDQVRRIYEEELKRSQARREELYSRYMPTAEAKKIGKKELKGCVERLSHVDWEKRD
                     EELFKKYVYPYDPKTTKISRDDEQAMANRLSTTKGAG"
     gene            <403648..>409344
                     /locus_tag="LMJF_29_1040"
                     /db_xref="GeneID:12980965"
     mRNA            <403648..>409344
                     /locus_tag="LMJF_29_1040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722136.1"
                     /db_xref="GeneID:12980965"
     CDS             403648..409344
                     /locus_tag="LMJF_29_1040"
                     /note="previous protein_id=AAZ09560.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722184.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980965"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="UniProtKB/TrEMBL:E9ADW2"
                     /translation="MLTAVRPGAAGINQHAPQHAGDAARRRQSAWRTSHRRSSAFGGG
                     NTHSSSRDSAIEVHGISIDRLTYISTALDALPGVALREYFVPIVRLKKQLLLRQRNVL
                     QRFPSRDTVEGAAAYAKMVTDALMSLTRALNTAGGDLMLDGGTATLSLEPKDVIACLK
                     DKVAPVSVEAGGVLVYPREPPEASFVYIIVTGTVSATFFQPQTQAQSPAPQHQRHGGG
                     FGVRRERRMYFTSAKDVVRLCGGGLAPEVTFAIDDYPATDSIGYNSSAVAGGGGTNVD
                     GASMSNVTTAIQRSLRRASRTAGQPTLRPTRTEQVCGPAVLGAGEALGLAPFKYVCYT
                     VSTTSVVAPASGSASAASKGAKGDGGATYVEFVDAFRIRTSDVHAAVIDIAAQQRAER
                     LQHSPNLYVPWCAAAPGEVVPRGAARTVADFIVAARHRTLYSDYAATELLVRQSWLLQ
                     DAAAHTIRALMPHMVPRTYMPGEVMACPHTPGSLRQLCFLRRGRLNVFVVPKSGITPV
                     LLMKGESPDVLVTSRFSRDGCGCWCLRETPTAQPAEVVESGASFGELSVLFHEPRHCI
                     LRADTVCDVWCLPRQNFAALMQRDAALRDGLLRKAAVLRVEWMGEQRFTRALAQQLRA
                     GSELLKPLPDIAIRLIQERLEPVIYTPGSLVASTSTRCTEMTFIMRGTVSTICEGVAT
                     YGPGDVLGEGCLIPHRWPLGLAARTMVEGWRIKVKSLIDALRRMDLLYRYSGLVTSQT
                     PQLMKQIFGTPQPEIEVDTVGRQRMPMVGAPPGGSTSYLMYGRAVCEVQLKALCFLYR
                     DYVRWEDISYLSTGRGADRSGAALPQTALDAVAHDVAISRLSGRKGQQVSVALCQLQQ
                     RRGAGEPGGKHRKTVSDISAVTAGSATTTAALPRLNDTPAAAGSERNTARANNGWRQP
                     TRPPRVGGCGVPGQRLANTGAFLVNQAFLGKEVPSKAATLVHGRRSHLALPPRLHRMV
                     RLLEERDRTWTAEQCHEAALAQEINQRDAAIWNRAALRSKATASTSPPESKPSRLETE
                     AATVTAVSVPRTAASVLSDTSPAPVHIFLQGERPRYELALSEAIAVGYVMQMPDIAHI
                     QHSVSMVDPDVALGPLAQRGRRHLMSVTPNDRYTKHNFLFAAADLEDGNSAETQQKAA
                     EVQAEAQLRSKTRKLFSMMRTAVASRMDTEAAATSAEFFHPSAVSDEYSPTAGSAVAS
                     PPDTLMLLNESQVQLLDGDAEGLANSSAAAFTPSPDRPGQQQALRLSPGIAARADSMA
                     TQSSLCGSPSKSSCQKKEEAFQRLVHRDPAQAIELLCKHYGIPWSFAWANPQFDMAPP
                     AQQVRDGRSGSGSGSMTSPAATSAESQRRAQQLQRPGLLERLEAAATASMLSATATGG
                     LSPSLLAPSLQLSGSATDAEAPQRSEAGTEDGGALLMDNRVLSYPQLVRATARDRWHS
                     ANCLTAGSAPPFTSEAPAPLLLQKVADASAATPSVTAKAAVPGAGLVEHFYRGSQRCR
                     APALFVEGYGPLQPVPEYLVEYPPTIHASAVGCGEPYVGNVSIDRAGGNGARFSRPPT
                     SMAAAAALRRSASRQGGLSGSFCGGDGSHQRYPFRCGSSSPSGNAGKMDPRKEEFTMP
                     DAEATEMLIRRIQRDVDGLNEVAKEQRRERDRAHTRDGRAGRYLTALEATLGKPNKEE
                     LELLEAWRMQYRYIGNGPLRRASLPVALRAEAGQDYMKQELEYLADAPAPMDDPVWRY
                     TSGVQEWQDQQAGTEEGTSLFSGALAATGSGADEFGGGAASALDGPRRVVATIGSVSV
                     GFTPAPLQSPAVHLSPGDYEAWVRQREDFFAAYKRLLDRHGEEGTRGGRAAEPAAPLA
                     VPKPRFTPAPPSPRLWSTPTTPAPSQTPPSEAPAEQPADFRIIMDPHSEDSDADEG"
     gene            <411534..>414311
                     /locus_tag="LMJF_29_1050"
                     /db_xref="GeneID:12980966"
     mRNA            <411534..>414311
                     /locus_tag="LMJF_29_1050"
                     /product="putative KU70 protein"
                     /transcript_id="XM_003722137.1"
                     /db_xref="GeneID:12980966"
     CDS             411534..414311
                     /locus_tag="LMJF_29_1050"
                     /note="previous protein_id=AAZ09561.1"
                     /codon_start=1
                     /product="putative KU70 protein"
                     /protein_id="XP_003722185.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980966"
                     /db_xref="GOA:E9ADW3"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR003034"
                     /db_xref="InterPro:IPR005160"
                     /db_xref="InterPro:IPR005161"
                     /db_xref="InterPro:IPR006164"
                     /db_xref="InterPro:IPR006165"
                     /db_xref="InterPro:IPR016194"
                     /db_xref="UniProtKB/TrEMBL:E9ADW3"
                     /translation="MDEFAEWGEGTTGVVAADSTYADGFDLDECHEQLWQRNQRDAVV
                     CLVDCNEGMFGVLPAGESAKTTQSGKNGTGAPTHTRGVTKPALLTTGQEAAMSNGAAG
                     GSNAAVGSSPSFFSMTMQCILALLKEKMVCGSKDVVAIVLYNTRMSAPSTGFRGVYVM
                     QEVTRIGTGCVQKVEQLEAAGAPGSAAYEEFEARIGHWPTASTSPALAAASSASGRAE
                     PRAALPAASAAFPAFKFSEALWEAQRILLSLRSVQAIRHRRLFVFTNRDDPSGGDAQE
                     WNLCRSRACDLGKEGVVLEVFGFGNAGSGGSSASPLFAVSNQRGQSLDPAAATADTTI
                     RQSGSGQSDSPSPAPTGFVQDFFWGPLLREIQTAAAQFRASGDIDDLAALAEARGEAF
                     VSGGEGAIYMHAGAGALQQLLGSVVRRAHPQRPFRHCLLRIGGFSGTSTALSTTAAAA
                     TARDEEEASRVAAVPRMAVSLYAPLMRARLPQREWLDGRTNRMLRRVVHLNARTTAAG
                     QDSDDAGAGHNEGDSGSPTKPLQRLHNEKNCTSESMMRQEDVHPNDLCYYAPIGKERV
                     YFTSEERKRIVEVAATGTEPGFTVLLFKDLVDAVKREHVVRRSSFLHSCVQRGGAHSH
                     RVFVLFVRRLRAKQKVAIAQYCSSITTAPRLVALVPSPDLTAHPEKRDQVPVDGMGLY
                     VVPLPYAEELRAVPELRTCTRVNKHATPVLADSSVDPAHLELAKQLVSALTVSYQVDA
                     VFNPALQRQYRQLQELARRLFPLADNPLHSGGGTALAKAGEEGPSTDGAAKMAPQELD
                     SALPDYEGMQSFAALFQSFNKEVLGKDYDAFRYCPQPRVAGSVTRRPRDSAAGAVEAA
                     GPTAASAEEDGGHVPIEQLICRAAAENAWDGLIIPQLKEYLATANVSSGGARRKADLI
                     ELVKQHFPLPS"
     gene            <416137..>419361
                     /locus_tag="LMJF_29_1060"
                     /db_xref="GeneID:12980967"
     mRNA            <416137..>419361
                     /locus_tag="LMJF_29_1060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722138.1"
                     /db_xref="GeneID:12980967"
     CDS             416137..419361
                     /locus_tag="LMJF_29_1060"
                     /note="previous protein_id=AAZ09562.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722186.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980967"
                     /db_xref="UniProtKB/TrEMBL:E9ADW4"
                     /translation="MHEPRAPNAHTRAASPPPASPHPLPLLPGVFTAQQAEESVELIQ
                     RELSRLLRACEYREQHPYDVFNGRGDSSRGAATPRSTGSSNGTSSRFASALASHRRDP
                     TAPLLSDADPLLQLAQSTSAFSFPLDPHRSDAAEAAFFSVAGAGAAANAAPSVTNLSG
                     ASFSAFERRRIAHLLGRVALEIAAVWTYVRRSEPLCGTSPGDPTAPVSSVRTTRRTAR
                     LSSDRSTAAPAASPLAPASLNADGGDGRAAMTVNVTGEEPGVPTPTVLQSAVLGETAE
                     ERQDACDGDPAPQITALSALIEAAAAIQRALKMAGGGGGGDHVASAESAGAAAARSVS
                     ANTLLGAAQAASLTFSSFPFDGVRAPIQEAAGVGAGKQSRRSSAGVDTSSAVAGVSQA
                     PPSALTGGRTSAREAAEQHSGEGESNPLAMPNATVVRQAPSGGSPVKRGSTASSSIPS
                     YLRAYVFEEGADDCADEMDNFGEGNGVSGNKGARAVLANADKSVSRSISAGSANACSL
                     SRASELPATSHDDGYRTRPSSARSAVEHPARASHLSPAATVTRPSLLGSAGVSLTAPT
                     HAGGSGGAATSVAALVDADPVSHCSSLRIQRALSALSLQSASLASSPLREPQLSTQQS
                     QVCSGGSASSHPNASVSQRSPDSAEMSSAAAAAYLRSTSLFRRPHRLEVPVSRTQSLR
                     RATSISSPMSVEGISLGSAPGAVYYNGTPAMASGACGNSFAASSHMTKSNSGLQLSSG
                     GVGVLGASPGFNSFFPVAMGASATVDSPHSSVAGLHFKRVISLDSEGELWPQGWLADS
                     LEMSPQKVTPLLGRPSASAMEATLSSSPLSQDAGLATATGSHSARHGALKSPSEGQSG
                     GVIPVATSLSGHRSSALPPGRTELPRSRNALSRRGTPKPAVSSASTVTVPSAVLGSSS
                     SQQRPVALLSPVHFSSSPQRRTHRSVAGPTVFAPAPGTAGGGLAADGLTPCLYHVEDE
                     ILKEFLRCVHDLTRTSLTDAEFDSLKLCYFLPGVSLVTSTGTARPPSSSPPPTALPLP
                     LFEGGELVPLHRSSLDVFCSLIRERLVAVCRSLRISTAPYLALL"
     gene            <420463..>421584
                     /locus_tag="LMJF_29_1070"
                     /db_xref="GeneID:12980968"
     mRNA            <420463..>421584
                     /locus_tag="LMJF_29_1070"
                     /product="putative ribosomal protein L1a"
                     /transcript_id="XM_003722139.1"
                     /db_xref="GeneID:12980968"
     CDS             420463..421584
                     /locus_tag="LMJF_29_1070"
                     /note="previous protein_id=AAZ09563.1"
                     /codon_start=1
                     /product="putative ribosomal protein L1a"
                     /protein_id="XP_003722187.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1070"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980968"
                     /db_xref="GOA:E9ADW5"
                     /db_xref="InterPro:IPR002136"
                     /db_xref="InterPro:IPR013000"
                     /db_xref="InterPro:IPR023574"
                     /db_xref="InterPro:IPR025755"
                     /db_xref="UniProtKB/TrEMBL:E9ADW5"
                     /translation="MSARPSVSVYSASSDSVVGTCPLPAVFTAPIRSDIVKFVHTNMA
                     KNSRQAYAVNRLSGMNHSAHSWGTGRAVARIPRISGGGTSTSGAGAFGNMCRGGRMFA
                     PTKIFRRWHRKINLHQKRFAVVSALAASSVPSLVMSRGHQIGNVPEVPLVVEDSIQGY
                     EKTKEAMAFLKAIAAIDDVNRVNDSREIRAGRGKMRNRRYVARRGPMLVMPNNKGTRA
                     FRNIFGLDLANVSALNLLHLAPGGHVGRFVIWTQSAFEQLDKIFGTFTEASAVKKGFT
                     LPAPMLTNTDVTRIMQSEEVRRVLKPKKLQAKKASRFQTPTNGMKNRRLRLRLNPYVK
                     RETAAAKGMRNVANRDARRKAKLARVTKAKKAATKSAKQ"
     gene            422845..423967
                     /locus_tag="LMJF_29_1080"
                     /pseudo
                     /db_xref="GeneID:12980969"
     misc_feature    422845..423967
                     /locus_tag="LMJF_29_1080"
                     /note="previous protein_id=AAZ09564.1"
                     /pseudo
                     /db_xref="GeneID:12980969"
                     /db_xref="PSEUDO:CBZ12445.1"
     gene            <425228..>426349
                     /locus_tag="LMJF_29_1090"
                     /db_xref="GeneID:12980970"
     mRNA            <425228..>426349
                     /locus_tag="LMJF_29_1090"
                     /product="putative ribosomal protein L1a"
                     /transcript_id="XM_003722140.1"
                     /db_xref="GeneID:12980970"
     CDS             425228..426349
                     /locus_tag="LMJF_29_1090"
                     /note="previous protein_id=AAZ09565.1"
                     /codon_start=1
                     /product="putative ribosomal protein L1a"
                     /protein_id="XP_003722188.1"
                     /db_xref="GeneID:12980970"
                     /db_xref="GOA:E9ADW5"
                     /db_xref="InterPro:IPR002136"
                     /db_xref="InterPro:IPR013000"
                     /db_xref="InterPro:IPR023574"
                     /db_xref="InterPro:IPR025755"
                     /db_xref="UniProtKB/TrEMBL:E9ADW5"
                     /translation="MSARPSVSVYSASSDSVVGTCPLPAVFTAPIRSDIVKFVHTNMA
                     KNSRQAYAVNRLSGMNHSAHSWGTGRAVARIPRISGGGTSTSGAGAFGNMCRGGRMFA
                     PTKIFRRWHRKINLHQKRFAVVSALAASSVPSLVMSRGHQIGNVPEVPLVVEDSIQGY
                     EKTKEAMAFLKAIAAIDDVNRVNDSREIRAGRGKMRNRRYVARRGPMLVMPNNKGTRA
                     FRNIFGLDLANVSALNLLHLAPGGHVGRFVIWTQSAFEQLDKIFGTFTEASAVKKGFT
                     LPAPMLTNTDVTRIMQSEEVRRVLKPKKLQAKKASRFQTPTNGMKNRRLRLRLNPYVK
                     RETAAAKGMRNVANRDARRKAKLARVTKAKKAATKSAKQ"
     gene            <427249..>428331
                     /locus_tag="LMJF_29_1100"
                     /db_xref="GeneID:12980971"
     mRNA            <427249..>428331
                     /locus_tag="LMJF_29_1100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722141.1"
                     /db_xref="GeneID:12980971"
     CDS             427249..428331
                     /locus_tag="LMJF_29_1100"
                     /note="previous protein_id=AAZ09566.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722189.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980971"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="PDB:3LJN"
                     /db_xref="UniProtKB/TrEMBL:E9ADW8"
                     /translation="MTDFPKLNRIKSDDENMEKIHVAARKGQTDEVRRLIETGVSPTI
                     QNRFGCTALHLACKFGCVDTAKYLASVGEVHSLWHGQKPIHLAVMANKTDLVVALVEG
                     AKERGQMPESLLNECDEREVNEIGSHVKHCKGQTALHWCVGLGPEYLEMIKILVQLGA
                     SPTAKDKADETPLMRAMEFRNREALDLMMDTVPSKSSLRLDYANKQGNSHLHWAILIN
                     WEDVAMRFVEMGIDVNMEDNEHTVPLYLSVRAAMVLLTKELLQKTDVFLIQACPYHNG
                     TTVLPDRVVWLDFVPAAADPSKQEVLQLLQEKLDEVVRSLNTGAGGAVKRKKKAAPAV
                     KRMKLAPSAPVRTRSRSRARSSAVSK"
     gene            <430540..>432417
                     /locus_tag="LMJF_29_1110"
                     /db_xref="GeneID:12980972"
     mRNA            <430540..>432417
                     /locus_tag="LMJF_29_1110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722142.1"
                     /db_xref="GeneID:12980972"
     CDS             430540..432417
                     /locus_tag="LMJF_29_1110"
                     /note="previous protein_id=AAZ09567.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722190.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980972"
                     /db_xref="UniProtKB/TrEMBL:E9ADW9"
                     /translation="MDFNPISIEESGHSQLQNGVANAVASARAAGRGDAAGLLSQHAS
                     FGDVLRACRNAFYYHTSWSVPYPEVPAAPMLYYPDEYKRMVESTMPLGIMQSELDAMQ
                     TGLLDNIPLAYYPLAPNALDEARQALRRAALLKRRAAAAAEADDAASSSSTSAANASD
                     RAHPPHGRLDPGDAEIARIVVDANEIQIRNLPSLTHVQRPLYTDIGLVPPEERHAARV
                     ARTQPTEAKPHDAALTTEEMERQWRIDVQLSFVQASQIDSGFARFIGEVAHAKLGLDR
                     NSASHMRLTRALWALLFQDTTKRQQRKVWYMICHFSSTFNDAPAASETAVAQLLRETE
                     ALGLPQYLTSWRPLLIEYTRAVSDYVAALAGGAEQRRENLQFHDRELDQLYTGNVYTN
                     IELDGKLARTSADRLKNTVYPVEVVPVYPSGYQQAASMGAAVLRLHDSEELDFLAERD
                     ASLHHVILPDAVLPKAAASRPNMLVGGCNLLVADDGDFANVQLGATLRYSVSAENTYQ
                     SLRQDPMNTASYLLRVGQAATDAAASLGANHDGRYVMYDRIGHRDVYQKTNNTDTNAL
                     SRYVVMFTDAQAATGASEAITSAGNRVRVNCVKREREEAPAPEAATESLEPVAQMPRT
                     G"
     gene            <439225..>442533
                     /locus_tag="LMJF_29_1120"
                     /db_xref="GeneID:12980973"
     mRNA            <439225..>442533
                     /locus_tag="LMJF_29_1120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722143.1"
                     /db_xref="GeneID:12980973"
     CDS             439225..442533
                     /locus_tag="LMJF_29_1120"
                     /note="previous protein_id=AAZ09568.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722191.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980973"
                     /db_xref="InterPro:IPR007557"
                     /db_xref="UniProtKB/TrEMBL:E9ADX0"
                     /translation="MSGGAGAADAMSAAENDAAIAGVQQGYSPNVRPFVVSYAQPYNG
                     GAGGMIQSVATACGSSYPSSFNSFELPTITPPLLPQPDFYVAAAAAQANDFYYHSSQP
                     RYADSPLTSAELCGAGARNASPVVGYGPTPSIAGINGYRYMDQAAGSVFSSCSFSGSR
                     FPQWYLPRGYYSISCSNVVGGSCGSGYGLYADCGSSGITPTSVSMGQNSTEEEMLSSP
                     HGRSHYAMVPPPPPRLSPQSSSGTLVPFALPPSYAATAAGNDAHAIGVPPTYPSGVME
                     LSSSASLPTSSPVSRAARTPQFLAYDGRAYDIPPCKAHISSADAAAAVAQCPLVACAQ
                     RGGYSPVDAAQPIRMSTRKSGTPHDMQPYHRATSSLTQRPLPHSHRRSTGAASESAER
                     SCSPEESALLADVHARLMQQHRSSQLLKERSAAQRAGVKPLSRSDLAVPAQASASGKT
                     VGANGFGHEAASISAMAAEEAAVAALSPIPRLPAAGDVDAEASDQSLWEGDGAAAQAP
                     TQDALDRVLTVPGVVWRHDPYSRIVLPQTQATFESDGSEATSTSCSSLPAGSPYVARA
                     TISFSDRGDATASVTQPPRSPDIVAGVNGSSSNSADGVRPSPRRLPTKKVCVRHYVNG
                     GGDLSLSHEHSGVVGALLSVREAAPTATVPAALFASGASAPLRHSAFVDDDDDGAVPA
                     APPATEPITVLTVTASVPAERGKPSVPKPRSKQMGLPAPTRGAKVGATNEDSVVSTDS
                     SSYVSCVSGHLKASHPTSSSTLDVVVPAEAPGNEDLSPASGVVGGTADPAAAAGVWPA
                     VRRPSACFSPLDFSAARSAYQPASRWGWRPRTARVCPLVQPAEMASTKEELLVANLAD
                     LDTSYLLGLWQKLDSSGCFRDALELRRCVIGPGSNSSTRVLRRMLPLSRRLMNRRRGL
                     EVESGDGPRFTVLDESEMKYVCLLQHRFRKSTAVASEHYTPGTMVVVDGDMGVDTGIV
                     TLSMTRDEYEAMTDVQRRAAHLVVHLEFSLAASIHRAALADEILMHGNTQLPLEEATL
                     EFLRYLTTQPHLFQSCRVEWMHFVDVEFQADGQKLYVHYTSDTPVRFLELATFLNHIF
                     HCRIWMKVVKEEDW"
     gene            <446750..>447868
                     /locus_tag="LMJF_29_1130"
                     /db_xref="GeneID:12980974"
     mRNA            <446750..>447868
                     /locus_tag="LMJF_29_1130"
                     /product="tryparedoxin-like protein"
                     /transcript_id="XM_003722144.1"
                     /db_xref="GeneID:12980974"
     CDS             446750..447868
                     /locus_tag="LMJF_29_1130"
                     /note="previous protein_id=AAZ09569.1"
                     /codon_start=1
                     /product="tryparedoxin-like protein"
                     /protein_id="XP_003722192.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980974"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:E9ADX1"
                     /translation="MNYFGQWSNLELLRQDGSKRLAADVLRDVPYVVLFFGASWSPEC
                     EAFMDVIGNFYEAHHEVKGFEVVYISRDYSRAEMLKSFLLSERASASAERQRQRRAHQ
                     ARKEERTHRRLSAEDGQEGEKKPSAASDEQEDANGRHLNGQGTNSCLEHRKVSLRDST
                     SPSSIPPPLKRVAALTANTAASGLAGASANPLMPCGRHGFWAVPYDHVGCVGVPILYH
                     LRVFTYPGVIVCGNKQFSADLTPALLPTLPAVHQAPAERSLTLSPEIWPPEGSETEST
                     QPSPIDRANAPQRRQKTPMVARPECYPDVLTIAGRFMIERDPNGEDFPWDKMNAKTRW
                     AALVFFVIVAVLTVIVLSWALPISRIKRQTALKAQAEL"
     gene            <451038..>451865
                     /locus_tag="LMJF_29_1140"
                     /db_xref="GeneID:12980975"
     mRNA            <451038..>451865
                     /locus_tag="LMJF_29_1140"
                     /product="tryparedoxin-like protein"
                     /transcript_id="XM_003722145.1"
                     /db_xref="GeneID:12980975"
     CDS             451038..451865
                     /locus_tag="LMJF_29_1140"
                     /note="previous protein_id=AAZ09570.1"
                     /codon_start=1
                     /product="tryparedoxin-like protein"
                     /protein_id="XP_003722193.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980975"
                     /db_xref="GOA:E9ADX2"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="UniProtKB/TrEMBL:E9ADX2"
                     /translation="MPLRHKGGPFLSQFPDLKVLRQDGTTVAASEAFKGKKYVLIYFS
                     AHWCPPCQRFTPLLADFYDAHKDRYGFEVLFVSSDREEGRMMDFFQNRSSNYVRRPPA
                     AASSSPPPVASSEALDESCPLSCDITHLLGNQTGAATVGGVGLSEGQQPQAPSSTAAA
                     GGAPTAVGTAQSPRIPKASGHGNWLALPFKEHEVARFLSRAYSVVSIPKVVVVAVDTN
                     CMVTREGKTMVMKDPDAVRFPWRFAEGDMRNRTEGWRESLVLLLFILCGIYYYFWFY"
     gene            <456245..>456694
                     /gene="TXN2"
                     /locus_tag="LMJF_29_1150"
                     /db_xref="GeneID:12980976"
     mRNA            <456245..>456694
                     /gene="TXN2"
                     /locus_tag="LMJF_29_1150"
                     /product="tryparedoxin"
                     /transcript_id="XM_003722146.1"
                     /db_xref="GeneID:12980976"
     CDS             456245..456694
                     /gene="TXN2"
                     /locus_tag="LMJF_29_1150"
                     /note="previous protein_id=AAZ09571.1"
                     /codon_start=1
                     /product="tryparedoxin"
                     /protein_id="XP_003722194.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980976"
                     /db_xref="GOA:E9ADX3"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:E9ADX3"
                     /translation="MSGLTKFFPYSTSFLKGSATDIVLPTLAGKTFFFYFSASWCPPC
                     RGFTPQLVEFYKKHAKSKNFEVMLISWDEEADDFAEYYKKMPWLALPFEDRKGMEFLK
                     NGFKVETIPTLIGVDADTGKIVTTRARNMVERDPEGTEFPWLNVSAK"
     gene            <458086..>458523
                     /gene="TXN1"
                     /locus_tag="LMJF_29_1160"
                     /db_xref="GeneID:12981161"
     mRNA            <458086..>458523
                     /gene="TXN1"
                     /locus_tag="LMJF_29_1160"
                     /product="tryparedoxin"
                     /transcript_id="XM_003722147.1"
                     /db_xref="GeneID:12981161"
     CDS             458086..458523
                     /gene="TXN1"
                     /locus_tag="LMJF_29_1160"
                     /note="previous protein_id=AAZ09572.1"
                     /codon_start=1
                     /product="tryparedoxin"
                     /protein_id="XP_003722195.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981161"
                     /db_xref="GOA:E9ADX4"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="PDB:3S9F"
                     /db_xref="UniProtKB/TrEMBL:E9ADX4"
                     /translation="MSGVAKHLGEALKLRKQADTADMDSLSGKTVFFYFSASWCPPCR
                     GFTPQLVEFYEKHHDSKNFEIILASWDEEEDDFNAYYAKMPWLSIPFANRNIVEALTK
                     KYSVESIPTLIGLNADTGDTVTTRARHALTQDPMGEQFPWRDE"
     gene            <459714..>460826
                     /locus_tag="LMJF_29_1170"
                     /db_xref="GeneID:12981160"
     mRNA            <459714..>460826
                     /locus_tag="LMJF_29_1170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722148.1"
                     /db_xref="GeneID:12981160"
     CDS             459714..460826
                     /locus_tag="LMJF_29_1170"
                     /note="previous protein_id=AAZ09573.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722196.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981160"
                     /db_xref="GOA:E9ADX5"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:E9ADX5"
                     /translation="MITATADAGSAAKAAAAPPARMFDCLDAASKERVTMLLSHYQVL
                     LPVEQASFMQELERYNQEQQTTALERNKAGEVWIRYTNPRLQAVQARDPAYVQRSISH
                     TAASRGSKGDAAPEEATAPCSLEDLVHIRGMFGEPEGVPIRVGKMSLYEKLQQNMRNR
                     RSTACGSLANTTVSSIPTAADAGHGAARVSVPFGPFAEAPAKPAEGKREVGDNASPKT
                     SAQSESGERAVALVCADTFPSHTSSVRPSAPYRNNAYQAVRLAMSSPGYTATTQPTSV
                     AELQTPLDGVKPVLNTTAFPITEEELRDWFDELDVHGRGVLSVEEFQRYMQSLERDLG
                     VPTEYATLELDGAQLAKDGWLSFEAFSYLVLRFVRA"
     gene            <463708..>471069
                     /locus_tag="LMJF_29_1180"
                     /db_xref="GeneID:12980977"
     mRNA            <463708..>471069
                     /locus_tag="LMJF_29_1180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722149.1"
                     /db_xref="GeneID:12980977"
     CDS             463708..471069
                     /locus_tag="LMJF_29_1180"
                     /note="previous protein_id=AAZ09574.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722197.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980977"
                     /db_xref="UniProtKB/TrEMBL:E9ADX6"
                     /translation="MDYVLGVLYATKRYEPLDTSRVHPGGSARRRGQSSLLHSTAFAM
                     NSVAGVPVMPDIVGAGSDNDNDHTTTAAEYLLTPKADSTNRTWAVPVSVTAKATPPVK
                     EANAVESTFPLRRGGNAETEPPSLLLPPRTPTLGVDRAPVMTLPLHLPGSRRRSSSLK
                     ASGMLPLPTAAADHTLSFSREGSVLSPLVPGVSTPVITSDAVHSATGGGGGPTASGGR
                     PAIRPQRLEYSVPTKVIAGKYVLLYLPPPHRAGETSAAGLWGSVGAGSAPFLSSGGAA
                     SGGGGAGASGARAHQTSALLQSPHMDPSKQRLGSSTSSSSSFMTGVSSHTLSTGSGRP
                     NFSAPMSKSVDPSASTSTATVGGHHLSNHHASHSGAGGGPGAAARQAIVRAAAAAAST
                     QQKVLLFYCLLLHGLAHQKPMQEETSEPFLEGRDAMNLAATGPVPVAVLELQYTTEGP
                     VRSNPGGTSSTSTLGGSVGAPAGADGHGGVALISPGATAGGDVGVGSAASPPPSGTRT
                     QVYSPLPVSLSPHSAPDGVRGVSMQPGACFSGGGHLPTTTSGSASPRASSAIPLLHNV
                     GDPFVARSETCADEGSATAAAVLRELLRGSLSNDDVAATQRLSSVLRHLLDGQPDVWL
                     SPDNIAFDSEITQNPYYGGWYSVESNDGYRRVMQMCNIQSWPTVVLVDPAGNVVTVEA
                     LQYMEKELARYIDEVDASVARASALRAAAPTTSPITAAASLATGAGSASTSATARALM
                     SASSPSPQASEASQQAPAVPPLPQYRVDIIELNVTEKSPSSPQPRVLLVAESPALSPL
                     QGVATATGRFNTNPLASHVEVAADDGDASTSDSAHTPKRRSTSLLGSTGRLESSASVH
                     DPQIPTAEPTPVKAVPITARYVADSSAHSATSTATPATASISAVTVSPLLPNASMSNN
                     ELAAGVQQGMMSPGRSEEKDEQGDEQGVLITEQPFDTAMTSLTRFATDDDSDDTRQKN
                     SHKVCKKSISLTTQPLCHLSMPALYWSAATTASSANFSLNNVCMTKGHASFPSWDPKA
                     YGGDVAGVLAVSDLDSEMDIPNQLGKTEGSGTRVSKDSSSSTREEEGRIKAPTIQVPL
                     ASALPLTDAVASSAVAPMKTAEGCIAAAPGAPPISPSSSPAPLPMFSSRFPWNHVLAD
                     PLTVQAPLSLMTASVVTATTAASTYAPEEDENVPKGDKAVSSPPLPSLRPFSRRASAI
                     TSRGERRRGDAEDGREDSSDFDRATGASSAGAAGARCSTTPSRTPAATAVVPSSAVPR
                     HAGLSSASNSISESPAAIALSHDNLSPRSGGIRGAGVAPLTWSGRRLPMHPLHRLAFC
                     SVTGREVRERARQAANDTALSSSELGKANGQSIAAPVMQEAVHQSMADASNESPVFPS
                     LSLADSAEDASARRLPVPRGLSCQPRSPLPSTPAPPQPSLSDAATQRIMERLLENWQR
                     EVAVRLHQCTHLLILFGADWHPGMPKFVRAVRRLCSAINPPPSASAGAPASRKGSHGD
                     GGDVGALRGGLSGLKMQGSDSQLSAGDDDVAPFASWKGFSNSLMDWAGGGLVGFTGGF
                     EDTSSRHDMRSFCSFIRADADGGSASEEGACMASAPPSGEVGAVTDKGAASDAAPRLC
                     VQVIYVSADESLQGVCAAMAEMPADWLCVSPFVARSRLERQLQKHASEMARCIFHVKS
                     FPRMVVVELPSAQQQQQPTNAGCTAAVHTGAISAEDRDEVEDELGDPAGTLTALCDTT
                     VISQQLLGQRLYGLWKVVQLHGETHLCADPEGKGFPWTSESADVLRVKQEDVSAFSRV
                     RRQMFSSFASGCRQPQQDLLHTALSSRPSPPSKVSSPVVFEDAKLLRSPTELLNVSGT
                     STKKVTAVEKDDWVATADTVSLHYPAERLFPPIKPFLVADGELPSLLERGGYFVVLGA
                     FGSVDSQLHQQCVNALDEVRRWFYAEVEARKQRAWSEPAQLQVMAPHGTYATSFTVGG
                     DRVTLSPAVFHATAGGSTGVEEYSLPTRYSPSITAAATLSVAPGGADLGSASASHRPG
                     HSNFSNRSGSAPLFLEDGWSETRAGLSPKLAAMSSPMPGPLTLQLDSPAGLHGLHVSG
                     ARSLASAATAHKPAAAARPLPTVYFYDSILSHPPAPDSPSSAPATHHGGGVPAHDELG
                     VDEEGGLRVRATLLRQASPAPTGTPAEALPQRFGSGDESTAAAAASSPSIAPPPRVLD
                     NTSALRRQHAKDLALLQEYIIAPILEADEKQLPAREGELYLACIRWPQRTSAVLRRRL
                     APEGRPNASAQASSTGSAAGLPVSSVSSSAAGGSVGGGTSSPASGMNPTLRSLTSSQS
                     SGQAQLLPEVITRRSSTPSGASPLPSSPTTTPVPGNVSAVAAAATSGGGSASSHIITP
                     AMAPVVLPPSSSFVAANAGGGSASGNATGLSSPSLGATNPQTSAATSLSNIIIEEEGK
                     EGSPYSDSTPLASVEAIKSFLYDNVLRLMES"
     gene            <472528..>474324
                     /locus_tag="LMJF_29_1190"
                     /db_xref="GeneID:12980978"
     mRNA            <472528..>474324
                     /locus_tag="LMJF_29_1190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722150.1"
                     /db_xref="GeneID:12980978"
     CDS             472528..474324
                     /locus_tag="LMJF_29_1190"
                     /note="previous protein_id=AAZ09575.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722198.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980978"
                     /db_xref="InterPro:IPR009890"
                     /db_xref="UniProtKB/TrEMBL:E9ADX7"
                     /translation="MPLSLVTSQVRQEVHNFFQGVVESFGVVLVWSSALDKRRARDGA
                     EVTDEQGRLSSPPFSSTPLADVAERAAAEGALLTTPTPGSAVPLPRTAVLSGSGPGAP
                     RLAHTFLMPSWSLLERDPKLWMLLRKNLLANLALACLTLMYMGLSRFLASNTPSSLSS
                     AVVGDRNATTASLSADARSCNGTTATRSLTTSLVFLLLLWSVRLGLWMLKYVGQWPFY
                     TLLQIIGLVWFSQLYRETWLVRKGWVLRGTELRETPAAGSAKNKAMAGGGGGGSDASA
                     ASHHAPPTPPPPPSVAAGAALPWLSLIPLYSGAESSGGRADGTPYEARGFSSSLLLMC
                     TALLRSVQPYVRHTTNLVWRMITHKGPTAVLQDWVLGDASKAAAAAAAASALTSARHH
                     QAHASRAASPHQSQRMSTSPDPFATVVLQLEAISEVLFKALATMSFAIFASAIERLPL
                     IGTPLCAVLNAQLYVFYVFDYRYAAQQQPDAVHHRGSALTYQLRHFEQCSMYYAGYGM
                     SSAVLSLWLTHQLGTVVSVCAVSVLYSWQVVWSGFAVPLPSSRPVPLFSVWFYVVDMA
                     QRHYAVLWRVVVIAILLYLPLDCACWLLGTGA"
     gene            <475904..>477727
                     /locus_tag="LMJF_29_1200"
                     /db_xref="GeneID:12980979"
     mRNA            <475904..>477727
                     /locus_tag="LMJF_29_1200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722151.1"
                     /db_xref="GeneID:12980979"
     CDS             475904..477727
                     /locus_tag="LMJF_29_1200"
                     /note="previous protein_id=AAZ09576.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722199.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980979"
                     /db_xref="UniProtKB/TrEMBL:E9ADX8"
                     /translation="MQPLMAYPGFFRLTAAARVALVALCLALAFLSVAAVAAPTFSAS
                     ATAQQYRDRRVAHLRAALLDKAPYHVGALPDPPLEWGLHTACKKFGRGCPDTYVQFLE
                     ELVALLEGEVADGDGCDVAGAVAAKRKGAEHATCQAQPELGSIAVTRVASVVEAPERC
                     INGVDDGVADAAVSLAALLPCDLRLPLQLSWLYEARKRLENLLHLLAIRESELRRDGV
                     APAPLQRLYHVPSAEHIHLVEDLDGAVTARLHTACAIGSASSSAPLPAGWTLQKWEDV
                     YGLWCRHVEQQHRNRRDDSLGATSVIAASPSSLVPLPRKAWYCVALHHATLYLQLLVR
                     ADQLLAWAWDWTFYTAVPSAFLVCVLLWLCVGDAWTEAAEAFVVNASAVTADAAGQGD
                     GVVKEASASRDTTPSATPHECRPPSATTGSPSTLTASSAVRGGEAAPSLSPMASVALA
                     EGRRDTPLAGYGAVPASEHCPHQHQGQLEGQQQRRAALLRRRFAVSALHRSPTLFLLK
                     LRLLLCLLVAGQLLWSLWRVLAASYDVTASAAPLVQFFLPSWLLVCLSAYLVVPLQMM
                     VLGTALKGALNAHEELLSFQAKCAAEQRALLNAAGVLPLGG"
     gene            <478581..>479720
                     /locus_tag="LMJF_29_1210"
                     /db_xref="GeneID:12980980"
     mRNA            <478581..>479720
                     /locus_tag="LMJF_29_1210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722152.1"
                     /db_xref="GeneID:12980980"
     CDS             478581..479720
                     /locus_tag="LMJF_29_1210"
                     /note="previous protein_id=AAZ09577.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722200.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980980"
                     /db_xref="UniProtKB/TrEMBL:E9ADX9"
                     /translation="MSADSHAERFERVTVYVDIAAAANTPEEGRGDVEEAAVLLELIQ
                     ASAAAVTGQLVVVDSRSLVSAEEQARPSLSPEAATGTASEATSLSMSTTLQLLRYWQA
                     EEADVYTRDVNNTVPFMRAWECLITSKNTRDGAVTYALHRRQMPVLSLALAQAGASTR
                     TPKSAVEELLYTCVPSGATQEEKRDAVVRFFTFPPELGAYVVAPSVSAAGEAKPPRYS
                     EAGPASASTAAAAAAATAAAVVVVNKDGYPVHLPWTPSLLPPPPVRFAGVLREWCLAD
                     SAQMEMLRRRNPLLPGALAAFHRYENRGLLRSALQRGYRVEVAEVAESDEDAASAEDR
                     VHRFADLSITNNAEADSQRKQAAAAATLRNFESTWLDLPLPQAQP"
     gene            <480429..>481862
                     /locus_tag="LMJF_29_1220"
                     /db_xref="GeneID:12980981"
     mRNA            <480429..>481862
                     /locus_tag="LMJF_29_1220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722153.1"
                     /db_xref="GeneID:12980981"
     CDS             480429..481862
                     /locus_tag="LMJF_29_1220"
                     /note="previous protein_id=AAZ09578.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722201.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980981"
                     /db_xref="InterPro:IPR007590"
                     /db_xref="UniProtKB/TrEMBL:E9ADY0"
                     /translation="MSKINATYSSGYYIAPDVDFRKLEEQQRQEQRGKRKHGGADDGG
                     DDNVKRQTFAIPFDLICEHCHRRIARGSHVYANRRATDKRYLDSIRIWELEILCRFCK
                     SKYYLRTDPETPKDTGGYICEKGCKRVEGDFYSLNKQNQAAREEWEKAKAEAELNPLA
                     ALERENEAARELEERNRQIEEAVEERAGHNDGDLLTMLRSRPRRTEVRANALDDDEDA
                     DDSGKTGMAPSSTGAEPASSPPSSSSIAFPLPKAFPLGGDSDGGGSGGEDKEDADERA
                     FREFNEDMERRWRTLERQQRARQRQQEQQSTVAETTTPADQDELRRVLARYGGDRRVA
                     AETVTTTLVQVQKPNALQAPASASCPTPITTSAPAVAPKKSSIKQNKFFVYNSDNDGD
                     IDDADAEVSLLSRPRGPLPLKPTFANAARATSAVSITAGATSCAQPASRFAAPAGASQ
                     PHPPPRKDGSSLLRRLVDDEDDEDGAD"
     gene            <483566..>489472
                     /locus_tag="LMJF_29_1230"
                     /db_xref="GeneID:12980982"
     mRNA            <483566..>489472
                     /locus_tag="LMJF_29_1230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722154.1"
                     /db_xref="GeneID:12980982"
     CDS             483566..489472
                     /locus_tag="LMJF_29_1230"
                     /note="previous protein_id=AAZ09579.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722202.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980982"
                     /db_xref="GOA:E9ADY1"
                     /db_xref="InterPro:IPR024880"
                     /db_xref="UniProtKB/TrEMBL:E9ADY1"
                     /translation="MHAMLEHTEPEAPAFPPAPSHPPPAAFSSTSSPAAAPAGPLLAT
                     RVSGATLGRSASSRNSSNDRQSPRDLSEFTGRWVQSRTRKEYHAFLAEVNSPSETAAA
                     AAVGHHSRPSSRGSSILGGVAAASAAALEAGGRRTPSAPGHVPNISSGLRRSVPAFLQ
                     PGGGDSVEQRTVRAASSRVDLTTTASRGRKLLEAALTSRGARHAPLRSTSFSSLAAPP
                     QQHPSASAQESQGAPVRGKEAGSAPAEHSAGARSDMRGRWSSAPTHRSSDNDGSAAAD
                     ASLLVPGLATLCTGSASSGTGNSFSSRSVQPTMGGNGDSLTWDATLLSNAQAGDPKGE
                     SASHDGPQQADALLRRADAEHVSSSGHAGVAAVSSHPSAPPKNPNGLIAGGTTVSGAE
                     APANAHTHTPRFDSRGSLPRPTDEPPQSGLSADDKSAGRQEHSNAFMTSSNHAVAATT
                     LVNPFRAMAGKSGDDATAGSPPPPPTVSREQLSCEQQQWQHPQQQPRQGLLLHDALHS
                     GFHSGAPPSAPSSSYPGVEANLPEKLSRSKDIPTAEDASTAGPPLPPLPQRQQQQLFA
                     AASGDTTIATGPATGFTTPRGSGAGSAPRAPPQRQQYLLPLSDSSSSHVPPNMSRGLY
                     VASPYVRDEDARAVVDESPIPQRPLPFDSVPPLEATPMATAEQDEGELGATDSCALDY
                     THDNDAQAVRRSMQDELSEESGAAGQYQPSPPLRNGLLAAPPLSPAQKRGAANPCSAI
                     FTQVHPKAPHASQQQPPPQPTHEPQAQEQRQEGPTAPSADLIPQPSGPPPPVLPTRTI
                     SKSSALPPLPNPGFPHSTSISESPFSKDGTPALKPSPRKVADTWSCHDCPSSSNPFLE
                     PGENFLFTPSNGLLMDAANTSADSTSRQRPHQAVMGSLCSAQSALAQHKPPPHAQVVK
                     APGYLSISSLEPNGAPPPPKDDPALPLESNSTTAPLLNFAGDEGAPSTATARMPGGAT
                     LVNPFSKSAQNSNCYLSATNVSISGSGALSGGASLTGSFASGAVRKKLRRSGAPCFAI
                     FVGGATLPPGVQGGNSSDRKGFSCIAACFNNSNSCSPLIANSARSPLVQPITSASSRT
                     GSVRSTSLSGAARANTSPVPRPLGVGTLGGSIGICLSFCSVTEALTARGSMVDRKGIR
                     GTEYGRRYVRALTDAVLPCALLADQWAAGDEATGAVVARVMDALKGCVPAPLGEVLEL
                     MLMDSLPQKDGGGFVWKENGGRRLAELLTAAAQADARTRAATARSRSAAVSPAAGAGG
                     TSATEANDALMAISPLNLVASTARCDSKERAAALRRVEDLLCTGQRVEAVEAALEAHL
                     HAHALLISMMCPTKDLYLRSVQAVMQQELSVTSPLAHAYSMFNEMPLPPLVPPPSKAD
                     EEDEEAAALGEGRSMSEAAQHQQQQHKRQQQMFLRDQEMLQQTWRRHAAILLANFTRH
                     SGNGLLQLATTLQQVHLVVEAHTCLLLLHLTPLGMAGPARAGAEPLPPASSLSPEDVE
                     DLLPRPDQRQVMEEIRRRIGVVGGTYHPTQGCRASFLTPVTTLLTQLVQLVSARLDAR
                     APPLSPPESAEPPVPFHGLPHGQPRSDVGYRMMQVLWLRELGLGKESAQALHALLQRM
                     PPPLAFSLRVPPRTLNELVYLFGGVPPSSPQQPPDALDGAAVAARGESVPESEATTQQ
                     PSPHASAGLPSHSREGLPQNTDDEADKVPSTSRSTLAHATSEVHHTGPLPPPNPQQRQ
                     APTPQHPSLLNRALLPSSPPATATSPLTRDRAAALQPPEPSAPPSGGKPGNASAKAAP
                     ASAAGNLKQPAPRRSRSLDVLRNFFRRGNSEAAGEQKSDEAKPMHLDTEKPPAFDPVT
                     GRWLFEETEEEKRLRELAKAGPPKMAPKAAGPTSAPAASAAAWGPSPSESALLQRPAP
                     GKPPQPGNAHPGPGAPAPVHAGGGMPAPRPGGGAPAVAGRDVPPPTMAGRGAARPGKR
                     PQYVDMFNTN"
     gene            <491006..>493174
                     /locus_tag="LMJF_29_1240"
                     /db_xref="GeneID:12980983"
     mRNA            <491006..>493174
                     /locus_tag="LMJF_29_1240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722155.1"
                     /db_xref="GeneID:12980983"
     CDS             491006..493174
                     /locus_tag="LMJF_29_1240"
                     /note="previous protein_id=AAZ09580.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722203.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980983"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR023114"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:E9ADY2"
                     /translation="MDPAKLMPTIIRNALGNEATSTVVSFAANEARSFGENAAARQVT
                     KASETIVDLAPWIFGYTSGEQVPKDTAVSLQVVSPATAMTEAVVLKSRQLGAQEHLTH
                     PAQVAAFYIKSLLQLLPEKGMIRTSPVCLAVPSAAYAASFEALRQATLLAGVPQEQTI
                     IAHSDEATAVYFHHLQYSGLPAKHDGAAVPVVLIDIGQSCSVASLIMASQPRVEKVDC
                     QTLRMGSEYIDALLCSHVYSELGKKFGAAADPLRGDIKSFRKILRECRKAKEVLSTTD
                     ETQVQLEGLSGDIDIIVSVTRAMMEQAALPFLQAVRAMLTAIKEKLPVPSATEDGSQA
                     AAVPPRVEVIGGGWRSVCVMEAIREVFGITRVGVSLDANLSVAEGSAILAEVRQLTIA
                     RQQDEEQTAQATTASSVAEAHQVELIGFEVLDANSPINRPLSEAGVRAVTEWIMLEKQ
                     MEDSDARIHERLAALNRLDSYILQTLAAVDNCAASSEKKTEMRAYIEEVDAYVRSEGD
                     EASSVELNEKLAAVQAHVTEHFSEIEAYYESVRAEEKRKEEELVKLSKERQEDESDLK
                     SDPQRLRMAQKRREQGQGLFREECWAEAQTRFVQALSILGQLYDTSSEENKTKKREIS
                     LSCYLNIASCSVKLGLWKNAVNNCTNALELVPDHPKALFRRGQAYSALKEYEEAVTDL
                     EKAKAVSQDDPVVVAELNKAKAALGAEKAKTKKMFAKMFS"
     gene            <494973..>500429
                     /locus_tag="LMJF_29_1250"
                     /db_xref="GeneID:12980984"
     mRNA            <494973..>500429
                     /locus_tag="LMJF_29_1250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722156.1"
                     /db_xref="GeneID:12980984"
     CDS             494973..500429
                     /locus_tag="LMJF_29_1250"
                     /note="previous protein_id=AAZ09581.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722204.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980984"
                     /db_xref="UniProtKB/TrEMBL:E9ADY3"
                     /translation="MPSTYAHEPDMRALLTITRCVSAMQHSKIQSCAALFSDAHDNLM
                     RDSCASHVRVRREGEPTGYASGTREPLRGKQPSSTMRRTRWPKAARRGLAFEDSPAPP
                     PPSFSKHAAHRECSAFFTSMRLAEEDIRVEEYVLGMNSDRNASGMRHGEAHDTQSAES
                     RAYWSFGSLQQDRDLIRSGTDARGAHFSAFDAPAASRAASLVSPSGAAARTVLQLSTS
                     RSHLQRQPPSPPPSGPQSAAAVATPGLGAHPLRLNISADVCSKNSRASNRRHLTLSSL
                     SVSKVNDISCTTRTDSASAVDGLCHAGGFDLAQTSSARHSSHQALQRQPDCQDKHASS
                     RPTRWMTSEEGEASLALLVQKTVHNGSAAPSVAASLSPPSVTAAVARNGRSVTSSDTE
                     ALRPSALPAGAYSPPRSSSASVASFYSHFFSSAERGGRRSTSRSTSMRREGRMYEAEA
                     TATGSGGTRALLHADPTAAEAGAAGSFALDARGHPADRRADDVNASAVRAASDGPQHA
                     THAVSEKSPSVDCVPSRPAASSSLDLERYTLPVELLPLLSTTVLAVTASKASPAPFSS
                     WSLRFSPPSAAAAVVAGEARVMGASSSQKSTRKSETANVRCRDVSHASASLSRASGLA
                     SASIAMAAKADARLAEAPPTPPDGLSRPEAANTGAARRQYPSPPPLPSPRPESSPGAD
                     MWRAGALVQRSLSLHGSRGAEPVSERVGETLLEPPACAESPSYSLPRRRRSPLEGAAN
                     MPDVVGRDAQSSVSAVAGTRDIAGPVQSVADGGQRKTLIDPAARLGPGEKIVHGFRGR
                     QYAAPQSKTSDAADEPPTAVSEMEDDVPREADTRTAGDPMCCLAREVSEARRNEQQQQ
                     QQKQQKWHHYVMHAPPVRAPGASPPSRSSVVAASTHHRQTGVPLSTSLGVFSATTPPP
                     LAQRGNCSLFLAGCGDDNASVRSPAIAARRGVQEAPDRTGSGCARCSPAASKLEAVEL
                     GHGGATAATAEAPEHSRLKPPALSHAAVASMGRSEVGRGLYRLHSDSGVRANDAGGEG
                     FDNESRTNGTTARRPRRYHGDGESTTRHRVTADPAACHAPFDSLHSASADLDWVANDH
                     AAQQRLQRFTGDAGPLAVPSSIDTAVTGSPSALADLAVREGFVRRGRVMGSQAPAAPL
                     PTCGAVETEDLDQGDPTLSVRRADSCTSHFEVLLCTSFDSQTRYETPPHSPYTPVLGS
                     SLTNRAGIPCMDSFASLEHTPLPQSVTSAAAMEGSATECDAPVMSTFFADDHVADAIP
                     AAVAARQVTGGRDDDVADDVPATQGLVSGVEEKAEVHIRPHYVESDSGPGLHSSVERS
                     SSLGSQNPDQPSCATQPAGRTFGDVGAEAAHPTSPTSSRTRNTLAACSHCTPLNSCLH
                     SNSVSRAWPTHTCHAASASASRGLREAYTGPSSDLGTSEEPGNSDGDGVEDSLDDAPM
                     LWDRHAPYPAPTLSIDGGDVYSSVPSASTRPPPPRGPLREPRQQVHWQRETSLLSSSS
                     AHVNDAEDTVAALKSTVIAHGTGGCRAEAGEGSHRHVAPELSSSIASINAVSSVTTSS
                     RLRRGYHPGERQEEKQEPNDVPETYTQRLQQWQQAQDNDVQPQALCRVLSSDFFASRS
                     CPRRGSESTQPYDAEGGHGRGDMLDGHEHEPNRIVNDGGGGGEDCGDFAASAPSSLPS
                     RAGSMQANALIGSAAAELREGRPSTASYSSTCATASATAVSAATAAKTPECRAPASWQ
                     RTRLSIPVVLSKPPIDAGASRRRRTNGLRRSSALPFSNGDSAVVSQAAGIYPRRQQAM
                     TSAEVDSFSADADEDEDEDGGYCSYGYESDLVYV"
     gene            <501860..>507022
                     /locus_tag="LMJF_29_1260"
                     /db_xref="GeneID:12980985"
     mRNA            <501860..>507022
                     /locus_tag="LMJF_29_1260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722157.1"
                     /db_xref="GeneID:12980985"
     CDS             501860..507022
                     /locus_tag="LMJF_29_1260"
                     /note="previous protein_id=AAZ09582.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722205.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980985"
                     /db_xref="GOA:E9ADY4"
                     /db_xref="InterPro:IPR002921"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:E9ADY4"
                     /translation="MLPASCNNDEPSAAPAGQAPAGHGQLHPATPSCFSAVPDVLPVE
                     LQVETMSTLSSRVFLYVWYVVLVVALVVQSNVRLQWSSRNFCGAAEEVSVYHLDEWNS
                     SACLTWEAYWLRKAYPRRRSQDYLQQQQWMSLKGAGVVADTTRALESGDSAVYQYVAW
                     PPTDGVLRARSAYSSCRGSDAVIPSEQYLSPHPPQEEREVGSASVRQRAATLSSPLDS
                     SVVGSAWAPSGSTMPPSPSLSTGPTMPPLHLKYKLRWTAQALSGVLDHQLNRFLHVFI
                     SLASPLAIETGVSSASATWGSSVKHSLWGVSQRVYEVLVALEETSLAPCENNSASSSG
                     GGWSSDGDSSSKSDQPKYVYTYRASVTCWRDAPRCSNIVLPSSVVIPANHSQLTLTLI
                     DVDAELAEASLRSFMVGHGDDDLNAVPTSRLLACEGALAGAVDSPCTHQGPSVRHIPL
                     ASNATPRPTPSSAVGVMYQRSQYTIGTLVFRYLFLLVTLASMLRFLCSSRQAHRMQFE
                     QKWTLAAQIGLIFYLNPVYLWCIYAGEGTRRGSANGIRGANHGTPTTPPALARFLLQL
                     LRLLLYYIEFHVPTHFAALIVCYIWSIIAGSFRWRVPTNHAAAVESKHALHPPARQTR
                     TSSSASAAQEGDLQPSARSSHESAAGRLAEADAQAVPSSKAARFRARVLLLSFLALVT
                     SLDVAKCCLEEQGAGGNELTCKSPMCLRVDRCIGYLLLCGILSSGVGLYWLRRNLARH
                     PYLSTRPQQLACRIMIFMYFTGGIYSVSQVALLDALYAQLLGVIYYQPLVQLPHLLVL
                     TSLVNHMTYVYTTTQSSLRIPLRPNDPRWKRVGWSSRWYRWLNSHGGSLYVFFSEAEE
                     RLFYDVQVAYQLAKCTCKLERRQRKKSQKSAEPPKTRAGERAEAGGEGNGGQHRRRPS
                     LTQSRRDINEAGVEGLQGGNRFTPPLLPPVDASASAAAVATAAPSTVGREAAEDAGFA
                     DPPSREESGWLPPFDMAGPRRTLSAITTHPSTSSSSRRAHADNGGSDEKIRMHDSSSS
                     LDLGGSLSCEDEARALTVLCNPTDTMPGGGLEVIGTPALPHPSSASDADDAAAGCSFR
                     LSQSGGDPRYVSSRVAGRMQDARHGAESRLVDGTATFLDFLAETSVERPLRVRLRQRA
                     RQSFVFFNLETAIDCLNLSWEAYAVQESRGDDFISTGIQVNAAEVPRAALGFVERVAM
                     ALLGLCFNPSPHVCHALDDSEEDAAAAISFTSGGDRTPLLDERRASRSRSPVRAPLGA
                     EVASSATRATQADLAAAALFPHCGSSSTRSGSCQPFFRQPAPAASATSPCFGGTSSPP
                     GAAAAGASSFSSSPSNRIGSFPTSASAATANAGADAARLPHMNPEQYGYHRVAVLEAR
                     GVQVVVVRMDTSGSCPVHIGKVPRLVIAFRGTDNVANVMEDIRFRQRTWKEMKTPTLS
                     GRASVHSGFLELWMSLKERVIDVVLRELRSQCTPLEGSNAEVSAAGTTGHAGEGASTV
                     AGCSPSQAGHDMFHATVPFSDIWSLRRNGGGRGCADTRQGAFGSEQGGFEGFMRVYVT
                     GHSLGGALASLCAYTLRRMLLLIQYPEPDLVVYTFGQPRIGNFVFKQYYNRAVPCTFR
                     VVNESDAVSGFNFFGGHHVGVQVNIDRHGNYICKPMYIERMFRPTRGRGFALANHAIS
                     AYASSLNAMANVYTHGACPLRCRQPYMGEIVSVSSTNSEKDTRNVETAGEED"
     gene            <509423..>512026
                     /locus_tag="LMJF_29_1270"
                     /db_xref="GeneID:12980987"
     mRNA            <509423..>512026
                     /locus_tag="LMJF_29_1270"
                     /product="putative serine peptidase"
                     /transcript_id="XM_003722158.1"
                     /db_xref="GeneID:12980987"
     CDS             509423..512026
                     /locus_tag="LMJF_29_1270"
                     /note="previous protein_id=AAZ09583.1"
                     /codon_start=1
                     /product="putative serine peptidase"
                     /protein_id="XP_003722206.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980987"
                     /db_xref="GOA:E9ADY5"
                     /db_xref="InterPro:IPR001270"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR004176"
                     /db_xref="InterPro:IPR018368"
                     /db_xref="InterPro:IPR019489"
                     /db_xref="InterPro:IPR023150"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028299"
                     /db_xref="UniProtKB/TrEMBL:E9ADY5"
                     /translation="MTTQQPEWTQAASDLMARMAALARKKANGYLDPVHLAYVMFEDE
                     NSLASRVVRKLGAASVKDGLEARVDAIPTQMPAPTQPRPNSDMMRVMNTAEQERAALG
                     DTLMAADHFLLALHESKEVGRILDAAGAGKKAIRATLLEMRKGKKITSDFQDDNYESL
                     NKYAVDLCKQAEDGKLDPVIGRADEILRTIRVLSRRTKNNPVLIGEPGVGKTAIVEGI
                     AQQVVRGDVPDTLSGIRIFSLDMGALIAGAKYRGEFEERLKAVLNEVKESDNKIILFI
                     DEIHLVLGAGKSDGAMDAANLLKPLLARGELRTIGATTLEEYRQYVEKDAAFERRFMP
                     VQVHEPSVEECTSILRGLKDRYEQHHGVQITDKAVVVAAQLAGRYITNRFLPDKAIDL
                     IDEACANVRVTLSSRPAEIDALERKKRQLEIEERALQRDKDASAKERLKAVKAEIQKV
                     EEKLGPLLAKYEQERGRIDELQATQAKLDEKKVKLERAERMRDMETAADLKYNVIPIL
                     QDRIRSLKEAIEKQKATMLQGTVTETDIATVVSRWTNIPVTKLSQTERERLLHLADQL
                     HLRVKGQDEAVSRVAEAILRSRAGLARSDRPTGSFLFLGPTGVGKTELSKAVASELFD
                     DAKYMVRLDMSEYMEQHSVARLIGAPPGYVGHEEGGQLTEPVRRRPYTVVLLDEVEKA
                     HPNVFNVLLQVLDDGRLTDSHGRTVDFCNTIIIMTSNLGAQYLQNMDTSPKAYEVAQA
                     QVMGEVRKFFRPEFINRLDDIILFRSLGLKEMTGIIDLITEELNGRLKDQSIRVSLTE
                     EAKQYVLESAFDADMGARPLRRWVEKNITTELSRMIISQELSPNSTVKVTLSSNHKKL
                     SFSVKRTAAQT"
     gene            <515663..>521455
                     /locus_tag="LMJF_29_1280"
                     /db_xref="GeneID:12980988"
     mRNA            <515663..>521455
                     /locus_tag="LMJF_29_1280"
                     /product="putative lipase domain protein"
                     /transcript_id="XM_003722159.1"
                     /db_xref="GeneID:12980988"
     CDS             515663..521455
                     /locus_tag="LMJF_29_1280"
                     /EC_number="3.1.1.3"
                     /note="previous protein_id=AAZ09584.1"
                     /codon_start=1
                     /product="putative lipase domain protein"
                     /protein_id="XP_003722207.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980988"
                     /db_xref="GOA:E9ADY6"
                     /db_xref="InterPro:IPR002921"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:E9ADY6"
                     /translation="MPSVSLRSGDAAANLASTQSPFAGRPNAFFSSHGSAEGSGDGRR
                     LARESAPPPPQQQQQQRAPKPSAPISKGEFVQKARERADASAKARGSRPSRRECQPEE
                     KSCKRRKQQSDKEHRQEVALRQSSAHRRRVIPTAPHRQIFLVGDYYCGAGVLGAQEHE
                     SFHAAYSSGGGGGFGNARGVDGGMTYAGASTTVLSNRAATGMSAPKGMSLHASPPVPS
                     GVQPFSNSLGIRNMQTDSPSHSPMAQSSTNTAAFANSHCSHRKRRGPKKLRVMQRFYE
                     PVELQVESISAFAMRLTLVLWHACLIAALVVEVIPKVQWSMVNICGPAYGVDLRRMDK
                     WTSPCVTSPPTVAANGTLTTPAPVSLRWGGLNLTHQHSSMVRYRRVAFSLPPPTDQAS
                     IVQVYNVVAESRISGNGVERVSKYPLSIRCDRTKTRCDVARVPELLLGNTPTFAGEFS
                     FTLTLVPESLAAGAAGGSVGIAYQRSAYTVATILWRYTLMVFSLIHTLRFVAYCKYTS
                     TLYEQSWTLVLQVALLWYMNPLFALNIASWPLSSMLAFMEYRIPTYFMAVSIAYMLSV
                     MTASMMWARPLEAKLNDGAFAKLKAFLARSRNVCDPPMWTKILIFVYMLSICVLDIVD
                     AGVNKYMWQLTSNSEVRFKRLYWFVIILQIAGGLVCLLLLFYLRSYLGKKPYLESRPQ
                     QLACRVFLMVFLSAIAYCVIHCLVFFLLYNRGYPALASQQPLLQLPMLMVASFFVNIM
                     TLVYTSQSRDENVPVNPRDPRWKHMVWPDTWYRWLARHGGSQYIFATEQEETRFYRLQ
                     FQFRRRQYMAKQKRLQSSGGAVARFVPTLAGSTATATLWERAQNAMPSDLFSSMRELQ
                     GDGCRATSSLQRDGSALMSWRTDVCASPQPSRLVSTTDTDDDADDGDSQRDEEPPIVR
                     DNGRGAISPVRCDDPSGAPEARRASHPAIKSSPSRRFDGDSGAGAATTTLDMQSSGLW
                     RSHSHVDSNGLMPVSVAARYIINMDRFSTYFLADGDGAAGGDGGVAESYAGVRRDRSL
                     AGDAYAIEGPARWRSRMRQNASAARGLDGRDGSAACCRLSQRQAALSENALAHTYTGF
                     DHHRGRALSLAPLKLAGWCQHHARSRSDGNALTSSWGDADAESARRSCKTASRHGTPP
                     LAPQSRYRDPSAGADVPGDTEIPIAAFARALQAAAATSAEASISVMPHTKVDEEWHKD
                     DKRRLGESEVASSTNKDTFVRQRDPLPCATLPMQAPTADASDANDGGNLKGMPLVRKD
                     DPPTAACISPLLTTDVSCVAPASDGVNADAQQVSVRDGTGSHLRISRSRDGDALSDLS
                     LRTSGDSDDVSSSDRARGRTRSLMRTLVLARERLGALIGTAERNLLERPVRGLERLET
                     HIFDAAYRPFQAMQYLPFFNLETSIDCFNISWEAYGVEESTGGQAIETSIQMTPQSGP
                     RAVANAIKNRLCGCCPAEEDTGGDDAEDDSESEAEQTVAAAREVAGPIVGATDGTAAV
                     PSAIGDARTGQEMHLSTTPSTRNSDTVIVYIRSDDASGGAAALLPASTPALAGKRPPS
                     RSALSPTETESGVPAPTAAATAVPDSAVLPINVEKYGFVRLLVAEAREVQMLMVKMDT
                     SAREHKGKAPRVIIGFRGTANMSNAKYDMNIHRVVWREMEKTADREAANAAGEEMSEL
                     ASTFDDGSTTAAQHLGCASCIHSCMRKTSWRPTCHAGFLTIWKTLKPTVLSRLRDVLW
                     GDRGTVYRIFTTGHSLGGALASLCAYSITYMLRRMDYPIADVTVYTYGQPRMGNRAFQ
                     RIYNKAVPRTFRVVNESDVVVNMFIFGGYHVGIEVDVDRNGNFIVKPTAIEKLFPPTK
                     GRGLMVVNHLMTSYGISLNAIASRTLCPARGLDFYLTADPEKVEAKTVKMEAIHAAPS
                     SSRESRRQDVCREREREARTGDSKGGSAAR"
     gene            <522303..>522659
                     /locus_tag="LMJF_29_1290"
                     /db_xref="GeneID:12980989"
     mRNA            <522303..>522659
                     /locus_tag="LMJF_29_1290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722160.1"
                     /db_xref="GeneID:12980989"
     CDS             522303..522659
                     /locus_tag="LMJF_29_1290"
                     /note="previous protein_id=AAZ09585.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722208.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980989"
                     /db_xref="UniProtKB/TrEMBL:E9ADY7"
                     /translation="MAATAASTTEVKPSILQTTDALLAVPSSETVWSAWYKESEDKFL
                     EFKSFELAPATGGPGNMSRAGSVRTLSMRQISGQFEEEVAKSWEEDWEDEDVEDTFEH
                     IIGQISQLHATKAASK"
     gene            <523986..>524876
                     /locus_tag="LMJF_29_1300"
                     /db_xref="GeneID:12980990"
     mRNA            <523986..>524876
                     /locus_tag="LMJF_29_1300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722161.1"
                     /db_xref="GeneID:12980990"
     CDS             523986..524876
                     /locus_tag="LMJF_29_1300"
                     /note="previous protein_id=AAZ09586.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722209.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980990"
                     /db_xref="UniProtKB/TrEMBL:E9ADY8"
                     /translation="MAGAAWASLGSEFKSVAEDKFLKPIPDQFLTPRATTDIQPAEEL
                     LSKLVEENAERYKGIDVRDPSSMAIYEGERPRWMTMGGQVRAVSEFISGHLCHHISLS
                     EWKDLFDLEYAEMDLTYWLYVLHVHLVSRRATSIPIEKFNRRREVLEELLVTMFDGWA
                     ATSEDIMGRPPLNKIKYYIRDMYYVTAVNFEEALLHDGPGADMMLMGFLMKFCPLPRP
                     EDVPMFTYYTLVHYVRFHTALFDRIPDEEFAKGNFNFLSPTDPLIFSKYSDIAYDEVI
                     RGWAVEEGEDGAGEAAPAHS"
     gene            <527008..>528891
                     /locus_tag="LMJF_29_1310"
                     /db_xref="GeneID:12980991"
     mRNA            <527008..>528891
                     /locus_tag="LMJF_29_1310"
                     /product="putative carnitine/choline acetyltransferase"
                     /transcript_id="XM_003722162.1"
                     /db_xref="GeneID:12980991"
     CDS             527008..528891
                     /locus_tag="LMJF_29_1310"
                     /EC_number="2.3.1.-"
                     /note="previous protein_id=AAZ09587.1"
                     /codon_start=1
                     /product="putative carnitine/choline acetyltransferase"
                     /protein_id="XP_003722210.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980991"
                     /db_xref="GOA:E9ADY9"
                     /db_xref="InterPro:IPR000542"
                     /db_xref="UniProtKB/TrEMBL:E9ADY9"
                     /translation="MKRISATELQGNVLKLPRLPIPSVAATMDGYRSSLRALWSPEVT
                     APHLAKLDAFVNSSAPVLQRHLVDADMAAAESGKAPFTYVEGLLAQSALKSRSPQEVN
                     MNASFVLQQDIAGADRTQAGVASALTYGIACWIQELRTNGLSVPADPAAQYDVSPLLT
                     EFGRSLIPSKETDLLHTTPLEKLSHIIVLHDGHPYMVRVFDEHQRVLDRRLIQKAFEL
                     ILTITPDQDNTSPVSVLTAGSRAVWGQAYQELLKTPENAEVLRLFHESILVVCLDSMK
                     WGNDESLAEASALHGSKEELENRWYDKHQMIVSEDGQVAFNFDSTASDRVHWAKWIGD
                     VLSILKERGVSGGSTDDIDGAAVSRIVRHLSVTYGKSFVSHIRAARQEALAIVTDTEV
                     HSIHLPCGRAQLSALKVKPDAFVQMCLQLAMYKMRNKLYSTTEVCSTAGFFHGTTELV
                     HTTSEEMLALAKNLAQLQQDGEHAAALDTNGKEMLTKLIRATSDRHVALTAAASRGEG
                     YDRHLMALRHVARINGDKAALAFFEDDLFLKTSRSVLSTSEFSQSWLRYYTFGPMQSN
                     GYGLGYVIDEQEVRISLSAFTNSPTTNVADLKAALMLSCNTLCEVLGGVPAANTAAAE
                     APK"
     gene            <532659..>534005
                     /locus_tag="LMJF_29_1320"
                     /db_xref="GeneID:12980992"
     mRNA            <532659..>534005
                     /locus_tag="LMJF_29_1320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722163.1"
                     /db_xref="GeneID:12980992"
     CDS             532659..534005
                     /locus_tag="LMJF_29_1320"
                     /note="previous protein_id=AAZ09588.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722211.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980992"
                     /db_xref="GOA:E9ADZ0"
                     /db_xref="InterPro:IPR007832"
                     /db_xref="InterPro:IPR016049"
                     /db_xref="UniProtKB/TrEMBL:E9ADZ0"
                     /translation="MSLSSSMTVEQRILQRLSACAEEAIPYERLKRELQLGSSGGEGA
                     VRQLMEQNRVRLRRGNGADTQIYISIVNNINENLSLVLDAVRGSGSSGIDQTQLLSKV
                     RMPKTELGKALAALTAKNLIKEHRSFTNRAKRIYTLFNIDPSTHITGGAMYCGEELDV
                     AFVDEWRRELTRFVSTRRMVSFDQIKRHVEAVQSAASSRGSGSALPTAGLAANHPSGT
                     STQPYNLPVVFTMIDSAMQRHVGGGPSSSTSGMTSAGSSYAFVAKQLSDLDLRTLVHT
                     LVLDGVLEMLIPATTEEVNTPQYQLAHGQSVMRHFTAQARRPRQRTLSTGMEGSALQR
                     VRHENDSALGLSGHPSAAPSSLASTAAAGVGSGCIPDIEDDGLSSSTMEVLRQSSLWE
                     PAPVSQPSSKDAVDGWSYMPAVGFPCLGCPLLDQCSVSCRGVVNPKGCTYLKGWLS"
     gene            <535566..>537344
                     /locus_tag="LMJF_29_1330"
                     /db_xref="GeneID:12980993"
     mRNA            <535566..>537344
                     /locus_tag="LMJF_29_1330"
                     /product="putative serine/threonine-protein kinase"
                     /transcript_id="XM_003722164.1"
                     /db_xref="GeneID:12980993"
     CDS             535566..537344
                     /locus_tag="LMJF_29_1330"
                     /EC_number="2.7.11.1"
                     /note="previous protein_id=AAZ09589.1"
                     /codon_start=1
                     /product="putative serine/threonine-protein kinase"
                     /protein_id="XP_003722212.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980993"
                     /db_xref="GOA:E9ADZ1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9ADZ1"
                     /translation="MSLPCPSSSSPLLGSITSGVRSPSRGPVQQQQLLHQRHASMRLR
                     LHKDGSICACPEKSGGGVSQACAPPLPATSAFARGKEEPSAKRHHAEPSSCPGPGGDS
                     SSVDRSAAATVVTIAAPLLSIPNPSSRAAPSPFRFLCTSVGGCPVVGAKDARVHLPDS
                     SARCDVSGSVAPRDLSTTSAHSKAHSTAAVGRASPSSGVVSPPLSATYPSLVSASHGA
                     RVVCSHPQSASASTVPGATIDTSAPSPVPSPPHRIHQHELRPADFRREEVLGEGSYSI
                     VTLATHRASGLSFALKEIDRSRLRWRPLEAQLRWEINLQRTLRHPHIVRLYSYFITPD
                     CISLVLEYCSGGTLLSRLRAAPQYRLSERQASRYTRHVAKALVHLHGLGVAHRDLKLE
                     NVLIDADGIAKLADFGWSRSVVHPLPSSKSAAAAQTAGDRNDAPCSSAEHNTSNEDPT
                     EGVAEGRRTVCGTLDYLSPEMVSGQAHSAKTDVWSLGVMLAEMLTGTPPFYTESTQET
                     LYAIQRLPPNLTGLHPKGHGPGLTGSGASTSASVCLILDEPVALSAGALSLIHAMLQK
                     DPSARPTMPEVLGHPWLQKKKLARKS"
     gene            537934..538160
                     /locus_tag="LMJF_29_ncRNA1"
                     /db_xref="GeneID:12980994"
     ncRNA           537934..538160
                     /ncRNA_class="other"
                     /locus_tag="LMJF_29_ncRNA1"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460966.1"
                     /db_xref="GeneID:12980994"
     gene            <538237..>538353
                     /locus_tag="LMJF_29_1335"
                     /db_xref="GeneID:12981151"
     mRNA            <538237..>538353
                     /locus_tag="LMJF_29_1335"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722165.1"
                     /db_xref="GeneID:12981151"
     CDS             538237..538353
                     /locus_tag="LMJF_29_1335"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722213.1"
                     /db_xref="GeneID:12981151"
                     /db_xref="UniProtKB/TrEMBL:E9ADZ2"
                     /translation="MPLPFLGSSLFLLSGPQPHIDRLVFFLFLCVCVCVCVR"
     gene            <542136..>544055
                     /locus_tag="LMJF_29_1340"
                     /db_xref="GeneID:12980995"
     mRNA            <542136..>544055
                     /locus_tag="LMJF_29_1340"
                     /product="putative RNA-binding protein"
                     /transcript_id="XM_003722166.1"
                     /db_xref="GeneID:12980995"
     CDS             542136..544055
                     /locus_tag="LMJF_29_1340"
                     /note="previous protein_id=AAZ09590.1"
                     /codon_start=1
                     /product="putative RNA-binding protein"
                     /protein_id="XP_003722214.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980995"
                     /db_xref="GOA:E9ADZ3"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9ADZ3"
                     /translation="MYFVAAAPTPVSPPGVIATSAPLPFGTPMKDMSISFSNSNSSTA
                     VSAAPPSYEAVALDPKGPRSQTNLFVRKLASAVTEDDMRKLFEQYGTIMSFALMRDIH
                     TGESLGTAFVRYSTHDEASAAMAALDGRELYGRPISIQWAKREHDSTPCGDARRKIRK
                     LFVRNIPLDVTARHLRQIFSKFGSISNVTLHSDTAPAAARDNGDNSRPASQMRNIAFI
                     LFQDDDVAEQAVGALHNTCPFDSCEGIPLMVKLAEDNRDRIDRKQRFCEGSVANTTAK
                     AFATAMMQSNHLCTAASVSPLTVPLSTPASATLSPPTLSMDVSHNNPIFIHEGHAASL
                     PPSGQQTLPFTVSAPTATATPMLQTTVDANGNTAYFYVPPSPNNGVAQQALPASAAPG
                     QYVIVSSGLQGFTAANRVVSQPSQPFYAAAAPPSVPQYYQTVTLPQVFADAQGQPLQP
                     QSNVFVSGYYSYSPNPQSSPQTPQQVPIFEVKAAPMTHPLHTGASAPKAASDVFQNQS
                     PLQHQLAHAQPPFSVSPQLSSPGGVREPVPTTVFSATDSPVNGAINSTNTVPLQLQVP
                     MTLVPHSAAAPLSANAKARGHSCLGPTRDGAHAAALMCEVPMPSMVPCIEDDDVTWGN
                     VSAKTPAAAGVSRSL"
     gene            558428..559618
                     /locus_tag="LMJF_29_ncRNA2"
                     /db_xref="GeneID:12980996"
     ncRNA           558428..559618
                     /ncRNA_class="other"
                     /locus_tag="LMJF_29_ncRNA2"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460967.1"
                     /db_xref="GeneID:12980996"
     gene            <565295..>568057
                     /locus_tag="LMJF_29_1350"
                     /db_xref="GeneID:12981152"
     mRNA            <565295..>568057
                     /locus_tag="LMJF_29_1350"
                     /product="putative RNA binding protein"
                     /transcript_id="XM_003722167.1"
                     /db_xref="GeneID:12981152"
     CDS             565295..568057
                     /locus_tag="LMJF_29_1350"
                     /note="previous protein_id=AAZ09591.1"
                     /codon_start=1
                     /product="putative RNA binding protein"
                     /protein_id="XP_003722215.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981152"
                     /db_xref="GOA:E9ADZ4"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9ADZ4"
                     /translation="MKTPQMHSIVTVSPIPIDVEQQQQQSHPRRTSSSSPGTPPMSAT
                     KLRHSSGVAVPTSSQSPMSVHIPVGDGGAHAGFPGLSVGYVQSADVMQSSVMVPAKEL
                     VPRQYTQQQFRTDAIRGRSQTNYGTAGGMAGSRPMPALSVERLGEAVLMPGPPGTTAC
                     AAMAMNFVTPLSGVLDTPSTPPSSTTTPANKNFSMSECPGLISTSPVPTPVTPTEHSS
                     TNLILYNIGPHMTEAALHTLFDPFGAVVSCAVMRDIHTGAGLGTAFVRYSEHMDACRA
                     LEAFSDRTNPVCVHESKPLVVQWARKQHDGAPAGEARKKIMKLFVRNIPLDCSIEDLE
                     ELFGAYGNVRQVTLHKDTSPVQDEAMVRLIAFVIYTEEGAAERAAREVHNTKPFASCN
                     GIPIMIKLAESSQRRRFMKNAEATGPIVSVAGPIGFPAVRTSPMTPGMPSSPFDIAAA
                     AQHHQHLQQQQHLTASQQGMCETHGFEASPSSYSMPVFDGTAAYAPPDPREASTGSYQ
                     GTSQRLQMSVSGGGTPASVTPLASNIVGGSPGRHHQPMPTYAGDREGRVSPHFSSFAA
                     PMLAHSYRQAASLSLDANAAAAHGGLSAPSKSSGQNLSDGMAGAGGTGGCPSGSFLYF
                     SSSPGDTKFTAATAASNGGSPPVSASGPWCETTGDDPNQNSSLVASTQTTRKGTEASC
                     SPPAAGSAPPPGSLRLCSTPSMAFSSTHGSPQQSTGLHRTSPTSMTAPGVVTTNRPVS
                     GAFVPIGVPTNAAPQSATRLSVASSGSTSDMNSTLPSNNFGSGTTPISGAAHNTESPT
                     VRMGASESWRRAVRTHVHNTKRQNERLNVSGSPSSMPSMSASCSVPAPAASPPTAVRK
                     GSMLSISCSEAFAPDTTPPTSPISNSTLSADQAGTKPTNTGTPSSGRMRYYNNPYSSE
                     STKLFC"
     gene            <581341..>583335
                     /locus_tag="LMJF_29_1360"
                     /db_xref="GeneID:12980997"
     mRNA            <581341..>583335
                     /locus_tag="LMJF_29_1360"
                     /product="putative RNA binding protein"
                     /transcript_id="XM_003722168.1"
                     /db_xref="GeneID:12980997"
     CDS             581341..583335
                     /locus_tag="LMJF_29_1360"
                     /note="previous protein_id=AAZ09592.1"
                     /codon_start=1
                     /product="putative RNA binding protein"
                     /protein_id="XP_003722216.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980997"
                     /db_xref="GOA:E9ADZ5"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9ADZ5"
                     /translation="MTRLNSSCGSVRRNRPICESAASPEAVLPSASILPPPTREGVSP
                     GGAYSRPDEGRSNDNVTPQTLNAVSSFVASGKTKKIASDSSRSSDSNLSQPRAAMQTN
                     QAPATNTRSSYGAAAPRKGRSRRASAAAHVTASEESNLHNSNLFICNLDPRVSQAELE
                     TAFAEHGTILSSAVMRDIHTGESLGTAFVRMSSHDEARYTMEAMNGVHVGSRSISVQW
                     ARRSEGGPVGEARKKIMKLFVRNVPLDCTKIDLEKLFGAYGNVRQVTLHKDTSPVQDE
                     AMVRLIAFVIYTEEGAAERAAREVHNTKPFASCNGIPIMVKLAEDLAKHYREHNHQHQ
                     QQQGESTPTAAAAKQRHRRSHSQRNNLTRIASKSPSHKQAISSGNTIMSLSSHTSSTT
                     LSIHAGQSSGADASIADMGVSADVSLCKNYPQLTPPECNVPLLKTPLGAMTSATLPQQ
                     HRMSCVRGAAPPSAAPLSPFNALQFLATTPPNAGGRMPAVSVPPCKDATAMPFVADSQ
                     RPSLIDIPNSQAGQSFFFNRSTPQLSQYAPPQQQQHHHLQLPQLSELPINVPVTPRLY
                     HLPAVHAVPECQDARAAVVVPNLCCEALPVQSRSMNDSQPIVAYSDRGEESDLRIVDT
                     APVAHPVSLRPQSNVKMASPKLPQTYRHNPYTSCSFIRVG"
     gene            <602806..>606960
                     /locus_tag="LMJF_29_1370"
                     /db_xref="GeneID:12980998"
     mRNA            <602806..>606960
                     /locus_tag="LMJF_29_1370"
                     /product="putative RNA binding protein"
                     /transcript_id="XM_003722169.1"
                     /db_xref="GeneID:12980998"
     CDS             602806..606960
                     /locus_tag="LMJF_29_1370"
                     /note="previous protein_id=AAZ09593.1"
                     /codon_start=1
                     /product="putative RNA binding protein"
                     /protein_id="XP_003722217.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980998"
                     /db_xref="GOA:E9ADZ6"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9ADZ6"
                     /translation="MGLRRTDPLDRHRRDCGEEGSSQLNTDAATDGAEDAEDQASIRS
                     EQCGRAKQTGRSTPFPANLSPHALSSQQLLQNQVQQQQRSGKPHDSAQMESSFSSSQI
                     GSLVLNSCSATLPAACSGATGGNGGDRRCGSTPGAAGSGGDGVSPPSLRHLQPPANHS
                     HVNLFVRHLPLELNEEKLRAMFAPFGEIVNSAIMRNIHTGVSLGTAFVRFAKHEEAMR
                     AMEAFAGGRSVTGSKRVTVQWARREHDKAPSGDERRKMRKLFIRNVPKDVTQEMLMAL
                     FTQHGSVKSVSTHRDTAAANAVSQPGGGGATAAVEADPSSLSGHDSVAAGSSTDDRRI
                     AFVTFEQEGVAEQATAAVHNTMPFASCQGIPLMVKLAEDTPVRHNALGGNTARANNVG
                     ILNGVGANGNGAHAPHNSSGGSVGARHSAIMVGVPNNTLSWSDVPVTDYIVTPMTSPP
                     AAQLHSTTGLTLPPGSGRGMSLRWGGASGSGAGRSFPRVPPDGSAVQVLSPPRFFAGT
                     TGSAGSPNETPPYAGLTPVHSNSAVLPYGGQTSGSAQAPRQPVQSPTPFLAPPKSSSA
                     TTATPQHIGVFNTADAVLDGSQTPGSMGLIGGSSGSHPVQAVGSGSPDLMGFAGGDYA
                     GGFPVSSYETQEFYTMLQQCSSNLAAASGATAKSPPSRQLSASVPGAGAAPHSGNGRN
                     HSNSRANAGGLSFHVSGSHTDAVQRDGVTSSSLPQSAQPSSTTPLSNSSFQQSQPKTL
                     VLPQPRSGAVQQAQQQRPVPAESEGGSTLSGGHAPAPYRLIPQPRSNASTSPSVPLSR
                     SAAAAAAAAAAAPSSSASRRANTLPPDACPPSCASTPQKHLPRVLPPSTSASFTAGGG
                     ARSRGNGTFTHRVAPEAGAGAVSGASNLRHGPRATSSPMHAIRGGTSVGGGGSSSANS
                     AGAATVTLAAPLNSALAASFASNNTNDFQFYQATRTLGAGSAASCSVHGAIDTRGNST
                     MKYTAAPPAQPTSLPLPPGRSPAPQSPSRRFSSEPTQPVTAAVAPPTFTTAPLMAAVA
                     KMISTDDAALTPDNTNTFDYGAYTTDDIYAAKSHYSISCATKLMRAVDGVDPPLCGSA
                     SGTGSSENVNTNLKKQSATSAFRAQLSSPAPAATASSGAAASTLRRSGQLGDPSPCCS
                     LSLGGAGLLDNNLLFQWESNSAAMNVASGSTDFASIAGAAAPTVLPFSDAQRSNETTG
                     VFDMMSMLSESRTQDLIVLADAPTAGSVSNMRSQPDAGDYWSAAQMRDTEKLGFGAVG
                     GGDMGATVHHGSSTATSTSKELSRRSTGRTLPGTSAQPPSRIGRSDDEDDEQAGWMVY
                     PDIDLNLGWPLGSTTKSKKGGGVVGSGLNSGSSREDADHLGYSQQLGHAMDNLYNLMS
                     YDNASY"
     gene            <609817..>611793
                     /locus_tag="LMJF_29_1380"
                     /db_xref="GeneID:12980999"
     mRNA            <609817..>611793
                     /locus_tag="LMJF_29_1380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722170.1"
                     /db_xref="GeneID:12980999"
     CDS             609817..611793
                     /locus_tag="LMJF_29_1380"
                     /note="previous protein_id=AAZ09594.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722218.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980999"
                     /db_xref="UniProtKB/TrEMBL:E9ADZ7"
                     /translation="MPRIKKPRNKGVTYKLVPRSYGDADGEDQGPLWVSEAELFRRHQ
                     SAVPAEDEDAARRQFNMYAVAANAEFNDERRRRRAEEGEDDACGVYDDGEADAEEGAY
                     EEEYYDEEGEYHDEHGEEDGEWVDGDWMDEEKPEAPHLRAPTQKAALPPTSAADPALA
                     SSCPPAAAACPRDEEGHGSEVAGEADEEQEEEKLFDGEVEGEVTDDFLRQLVFGSGGS
                     GEGDEDADDWDGLDEEDSEMWRLLTDDEKAAIKASRRRGTARRRRVVAAAVGEEGGLS
                     RTHAADGTEYPTHDTTQRALDRQFTEMMHEFDADARLNDAYTDDPRTHGALPMDKYLT
                     ALEEFVASRAGIDVETAEPHKNKGLIQQLKYLSYHAGAFDSDARGVYMTTILPEKQQR
                     FVEEFQKGTEEIRRAARMRLAIRNAGATAAATAAAVASPSDQVAVLSSPSEGDGTTGE
                     EEEELIVMEMKSKADRLDCETAISALSTYYNQPNVIQAPRRSAQARRVKKAPVSRCGG
                     ELTDAETENTDSHRNGGADTTTTTVVRGDMISAGATPSNSGSGNTATSIISSSAKKGA
                     NAVQVCKPTCASDSEGTAPADRAHRGVDVVLTVRRKDETKEEKMTRRQAVKAAQRERR
                     QAKSALKHTYKEVESEELRRSATSQAARRTVHFM"
     gene            <614609..>616942
                     /locus_tag="LMJF_29_1390"
                     /db_xref="GeneID:12981000"
     mRNA            <614609..>616942
                     /locus_tag="LMJF_29_1390"
                     /product="putative RNA binding protein"
                     /transcript_id="XM_003722171.1"
                     /db_xref="GeneID:12981000"
     CDS             614609..616942
                     /locus_tag="LMJF_29_1390"
                     /note="previous protein_id=AAZ09595.1"
                     /codon_start=1
                     /product="putative RNA binding protein"
                     /protein_id="XP_003722219.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981000"
                     /db_xref="GOA:E9ADZ8"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9ADZ8"
                     /translation="MPQMTENICSVQGAGNTAPQADSPCHSVSSALPATNGLVSNDLT
                     NSSFSEHPLSESSGGVLAQPQISGNVADFQNFLDEPSNWEWAVNALSVEPGHSDRNIF
                     VSKLPPTFKDADLQELFENFGPVVSAKVMLNVKTGISKETGFVKFTSYKDALRARAFF
                     RLRLASSPTTPAMPEVVTQWAQNKHDGGLYGERCQQVRKLFIRNVPARITQADMRVFV
                     SQFGNVSDVSVHSDTYDAPPASPPGRGRRLKQMSPSEGTEGEEAEASRPGPGPEEHET
                     IICFVTFAEAGAAMRACREIHNTTPFDSCNGVPLMAKLAEDNSSRHARRHHGASVAKA
                     VPASWGACAPLCDGSSTYSSAYSSEAHTPLTCTVGYHRISHPSQVSVSQHQQQQYSAA
                     SNCVMQPPPPPTLSASYVNTDLSPVHRSHPSTPQYPSQSAQHASFGIPAPRRTFQQRS
                     AAMSPASAVPPAAVITPSSPSILSTTMSPTAPQQPHSTRTRHVPLPPALSMEATESGL
                     ANVAIPTTTTSTPSSPPHAADVYAHTPLRIGRETPVQTPRRRQSPPSATQMGNYLSDA
                     YTAVHTPYTGHQHQQRRLPMNHGDVQGAYHANGDFYQEYSYSDPMELNMHPISSSASS
                     EAVHEYGNTGGAELSAYRACDNQRDVAPLWQRRMERHIATTVCSAAVAALAGVPHLSP
                     CAAYGAPLAYASAEGALSMGAAMQPEVCETTSSPQTKSAVPSPYVLYPPAVVVNSGSR
                     TKTPRSGVSGSVRYRNNPYSMRLVRTVALDSSPCVDS"
     gene            <627549..>628499
                     /locus_tag="LMJF_29_1400"
                     /db_xref="GeneID:12981001"
     mRNA            <627549..>628499
                     /locus_tag="LMJF_29_1400"
                     /product="putative RNA binding protein"
                     /transcript_id="XM_003722172.1"
                     /db_xref="GeneID:12981001"
     CDS             627549..628499
                     /locus_tag="LMJF_29_1400"
                     /note="previous protein_id=AAZ09596.1"
                     /codon_start=1
                     /product="putative RNA binding protein"
                     /protein_id="XP_003722220.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981001"
                     /db_xref="InterPro:IPR014898"
                     /db_xref="UniProtKB/TrEMBL:E9ADZ9"
                     /translation="MVSFTCSYCQDVVKKPKVQSHANACGCATFTCVDCMQVFDLGTV
                     KGHTSCVTEEEKYQGKWKEKLRSGNKAAKSAEAPRSGIERPPRAPMNDLSSSDDSSDG
                     DWVTQSSGKNSGASNGHQKPSATAYRKHPRPGVCLSSSDDEGMGRSVATTPLVPAQKK
                     AKTVCSASSTPSSTLPAAAPVLTEQSPANGKPGEKKGTASPAASVPHRRPKEVKGEGE
                     CKVTYPGKKDTPLLLPRSTMSRDCMVPTFLLGTSEEVADIVADVLRNSGVPSMRTKAV
                     AKELVERYAKRIAKSVRHAVETAAESGALKIDSEGNVSVA"
     gene            <632710..>635421
                     /locus_tag="LMJF_29_1410"
                     /db_xref="GeneID:12981002"
     mRNA            <632710..>635421
                     /locus_tag="LMJF_29_1410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722173.1"
                     /db_xref="GeneID:12981002"
     CDS             632710..635421
                     /locus_tag="LMJF_29_1410"
                     /note="previous protein_id=AAZ09597.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722221.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981002"
                     /db_xref="UniProtKB/TrEMBL:E9AE00"
                     /translation="MPATDSGASEGNHLLGLLSPHPPALSRPLDTEEVNGGCDGGLQV
                     PPPCLSSRPQRSPSWLISTKDGTEGKSRVDSCVMVCDTQHLPQSDSECFSTSSSTCYR
                     SAYSVNASRNMLEMLPFIDPFVKCVKMPSACIRAGPTRLRGRRTRSGITDLPASFGTP
                     AGTTSSGDSVLEHGVAAMRRDNSAQTRSSTLEPPPTRSSRSASTATMRVAETSHAWGT
                     APPPPPPSLSSAPEEQEDQALEQPPSRDSQKTCNAPALTTPHSPHHPAAHTLTFKAPI
                     SDCDVAQPGIAAACARRKSMEDQQRKKLRGSRSLQHHGRPEVCSAPNSVDSVTATPGT
                     DAASSIATTPSFTCTTSPQGNGTPAKLNSCVSLGASVISLDNSVMGASPGVVAAAAVT
                     TTSESSPATPAAKGELETDARHRSLLRSLERKQVNPFLRSTSILSMRSSSLGRSSLST
                     AAAAGRSGRGGRGHHRSQPLSFVKVPPLGCGAQGLSFCSLTASGVQAWVEEGAVDAPL
                     DVCAMTLSSLLRKTDSQLRTADSSVCGGSNLLRLIPRSECAAGVGGILRPRSSFCCSH
                     LGLSSRAKHSGSSSLQRTPPPPGPPVNVTSFANNVSFRRTIFVNSSTRSVVGASEGDA
                     ASVATTATTMTTTAAHSITRSKARVFPSPVGQSSAYQDEEESEVQRDVMIGFAFAQDA
                     TIATRSVSKEMQPSRLRAMGAMLEHPDAPPFAKAAIQRLHMRSPYQLPQTQSHDTHSS
                     PDLLRSVRDDAAAEAPMIVTMTTSVHSCRCMSPCCMAKPQSSSAAPAGADDPRSQEKL
                     SATPLDEGVRTGQSGVSLVPRIGHDRCHLCDVHKYAKQQQQTTTVLLESVKTIKSQRP
                     NALVPRSVVDASRSVAGCLTATEVHLPKVLPVKRPDPRFSIKRLLGL"
     gene            <640965..>642932
                     /locus_tag="LMJF_29_1420"
                     /db_xref="GeneID:12981003"
     mRNA            <640965..>642932
                     /locus_tag="LMJF_29_1420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722174.1"
                     /db_xref="GeneID:12981003"
     CDS             640965..642932
                     /locus_tag="LMJF_29_1420"
                     /note="previous protein_id=AAZ09598.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722222.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981003"
                     /db_xref="GOA:E9AE01"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:E9AE01"
                     /translation="MVSPADYRISEISRFLILVGGVCASSCMSTFYGFNIISKNLADM
                     FNLTGADLTTITTIGIVIGFITFPLGMLLDHMGPMWVCMCACTLNALGALLYALAFNG
                     NIKGNVPTLAVFCAIMNLGCSSFDTGSLMAVLGSFPLTKGPVVAIMKTFTGLGASILA
                     LINYSFFRNSDAHYMFFMAALIVCLGTVAVIFIRFPPYHILDHEKTRVPEKMQVRRRL
                     TERAYLTQYPPMARFYLGFGIIIALVIYLTVQSFCVAYANPSDTARMGNTVVIMVLVL
                     CLGLMAAPLPFLGGMEKEPSKDLPDYPEDEVMSFENEDEKRVLQPAVKEMAEDENVLG
                     EVYLKDGHCEVDKKGKKVPDSSDEALVHRQVAFEDAVMLEDENKARMMISDQDPQYQT
                     TFWQSLKRPDIWLCWWNTMATWGCGMVMAFNSAQIYQSLSNNKYERKTNTMYSAIISV
                     ASALGRLSMGILEFMVNRQPSETRPVITIAYPVASICMVVGLIFLLALPLESKAIVIG
                     FFFDSFGNGFSWACTALTVRTLFAKDIGKYYNFMYVGAFIAVIALNRFGYGEMYDRQA
                     KANRDADLAAGRVPIYPVCAGKKCVANSFVILLCVNVTAIVGSTWLHLRYRRFILKHR
                     AEKTAEREKCRGFDQQGDGVAQETNLCAAVL"
     gene            <648608..>650128
                     /locus_tag="LMJF_29_1430"
                     /db_xref="GeneID:12981004"
     mRNA            <648608..>650128
                     /locus_tag="LMJF_29_1430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722175.1"
                     /db_xref="GeneID:12981004"
     CDS             648608..650128
                     /locus_tag="LMJF_29_1430"
                     /note="previous protein_id=AAZ09599.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722223.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981004"
                     /db_xref="UniProtKB/TrEMBL:E9AE02"
                     /translation="MMCRAALRQPPRHFLHGQTRRAATVTALSGVCRCLSTAAPRSEP
                     ISTPVSPSSSPSPKQDPPATPRQSVQTASLTLTAESVWETVPHWCELCCEPVNSWHNH
                     LGKRDHICLEMILNSVVGSKGLWESDKVWDSIELFRSHYTKRPHGQPRTPSPIVKRLL
                     KEGLYVPGPDHPLGMFYDAFDRGDPYARREELHLLLLYLKECGMLCLAPDVFPPAIFQ
                     GHLLLHSEVVPVLTRIFPDGEVRGISALSQMITGAYGLAAAYETCGMERLVPVSLLQH
                     RGLNPELISVLSSVEEFDGVAASDDATGGTGGEETLGEGAEGGTSDAPLSTEQSMAMR
                     SLSAAMPRAILGSLRWALAPEDTSPPPIIFQDHKRNAYLTTLAARAARLLMSELIFGR
                     ISEYVYRLEYVLRTDFGREYLHHRYEGHRTADKASGRAASQRWLRKQCITPSLSNEGT
                     VAYTGGGLAAHGLNGTVAAECAVRMHDEARKARMHNRRGLPKAPPSSPLARSVRFR"
     gene            <650889..>651386
                     /locus_tag="LMJF_29_1440"
                     /db_xref="GeneID:12981005"
     mRNA            <650889..>651386
                     /locus_tag="LMJF_29_1440"
                     /product="putative clathrin coat assembly protein"
                     /transcript_id="XM_003722176.1"
                     /db_xref="GeneID:12981005"
     CDS             650889..651386
                     /locus_tag="LMJF_29_1440"
                     /note="previous protein_id=AAZ09600.1"
                     /codon_start=1
                     /product="putative clathrin coat assembly protein"
                     /protein_id="XP_003722224.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981005"
                     /db_xref="GOA:E9AE03"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR016635"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="UniProtKB/TrEMBL:E9AE03"
                     /translation="MIQFLLLMSRQGKIRLSKWYVTLSQKEQAKIIREVCQAALGRSA
                     RLSSMFEVEGRKYVGRRYASLYFIACVDKTDNELITLEIIHHFVEVLDQYFGNVCELD
                     LIFNFHRAYFILDEVLLGGELLLSNKRATLAYIDRLDVAAERSEARLEGSSFVDQMTN
                     AIKGV"
     gene            complement(<656656..>664644)
                     /locus_tag="LMJF_29_1450"
                     /db_xref="GeneID:12981006"
     mRNA            complement(<656656..>664644)
                     /locus_tag="LMJF_29_1450"
                     /product="putative phosphatidylinositol 4-kinase alpha"
                     /transcript_id="XM_003722177.1"
                     /db_xref="GeneID:12981006"
     CDS             complement(656656..664644)
                     /locus_tag="LMJF_29_1450"
                     /EC_number="2.7.1.67"
                     /note="previous protein_id=AAZ09601.1"
                     /codon_start=1
                     /product="putative phosphatidylinositol 4-kinase alpha"
                     /protein_id="XP_003722225.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981006"
                     /db_xref="GOA:E9AE04"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR001263"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR015433"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="UniProtKB/TrEMBL:E9AE04"
                     /translation="MNDIRLPCWIKSSPTLVMASALAQLLTDELAETTSSATAGAPRP
                     PSEVCVLGGRERWPRHNFDEDISSSSSDDGGGVNLSDSAASECEGCYDSGRDAMRTGG
                     GVGTGYLRMVDRLLELNSKELDSLPPPGATATAATYSPPKAVTAPATPMPTAIAGSWH
                     RGSAVLFTGQNGGASMSTLGASPDILRDPRVRTLLRLSRLNDVLTRAETAQRLISRRT
                     AAAMVSFFAFAVSCRYSGLPVDRTKGFFTECSALYTTLLSKLRSLRFGGGVNLEDFTA
                     SLVACGLKLRDDEDVEGDEKDGRGGTNEAGATGAVTAGISCSGRSNSSSAVASGAAAM
                     GSCGGAGVRTPMQLSFGRDKNWGLVGFGHRALDAIFVRCIPSNIDECVHDPVALGVLR
                     GISLTHSQQLFYLGPELVNHLHDLTDAFATSGHRRALPYKRVLSVLLEAISCSRVIDY
                     ERTNNWITAVIQERYVVRGLFQREELHAHIVTATLTMLIRQYQEMAKECASKVVDLGS
                     MPDFTEGDQLIELVWKALQDTIGSWEDAVATAEKHPLTLFRHNIDIVVQHLLRTEVER
                     LRCYYIITSATAAYHQSLVGMSAGTRTTGNQSGCPPAVPQLAPGREEQRGANRRGRDT
                     LRGQDGSTRRHSGAPAAAPYVPSAEEESLRISICSNIIKLLLLPTSIMSALPRTEEAK
                     QLRASLTEAAARVLSVVTAKEFNSRDDTSVMTTASGRAATSAAPRSVSPISAAAATPR
                     IRHADAGAAGTDLLAISRRQAHFSNNFYRCVEELIHELIHTILQQSVPDDATAVANRS
                     VLGGVSDARLSTPSTSDTNSDAILRGMVAAVCIQYMCFTNQHLRSFAISEVMDAVVRL
                     SARCGAEEAATATHGSLERKSSSKTARASGSDSNESPAAAPQGTVVGAAAAAADPEEK
                     RKLATHVRARQLALCFDALSAILVPTVVVEGYHHVAEEQEERAGLARSCTTTSARGNS
                     KREELSRYGQLLCDTYVDSLREHLWGLGEGSVSHHKMLTPVMAVAVKAFVNLVLRVHE
                     RLRGMSSMALALVQEAEAAMEGSKKGTQRSAAAIARDRARLLHAFNAERMSVVLLLRG
                     VIQNMLSVAWPSSGVLYQDRACSWERPLNNKTASAVMAPIALAVLSPFFRPLAMLLHL
                     STLFPARSLRQLCTHYQYARYLTLEDPSTSDQYVFYYYRRLSRALVAVEVDDSGGSGA
                     GSAEQIEFECWALFRSCWMMFSYYKYTAEALMAVRAGGMAPMESANPATATAALARAP
                     ILSTKQCKLLCLIAASAAPLLRMCSSDVQQAMADIAVLLRYTLAGALHCPMVVADVTA
                     KSGIVHASLYKSLKRLCGGRKECWKRLSTGELMLLQCVAELEILRAAAGSVAQLTLYR
                     HFEVREFVASAAIPEALGHILSTACDHYIEAVRSMLPGVAFQVTRTDLMQLVFLVSFA
                     IGSVRESASKLLLCVVRSFPTYAAYASALPLLWCMLDLLEAGTAWQIESLCEHVRFPA
                     VPAVAADPHSVERQQHVLFVADVAKRWAAILQDEAPIALFETAIKFMVVQQQECGEQA
                     TTQAGRHHAGSRLAALASQYRVEEAPPNLDDSAITVMRGAGAAGHVVKTEYAQTLLLH
                     GRAQGAMQASSWYASAEQMHSTVVAQLWAATRLCRRDLASAVAQRLESNLLRPARALF
                     VETGYSVGTVLAPRAFTVADEDAAAREEVGVTSVPLGAPARAETAASFAAAVALLAKG
                     SGTPIVRRQLLQYLVQGAVQTFRSDVLYEAILCWKWLLSQNREAYLLPMLQELDTAFV
                     WTAANRLGLFDGYCSSKNRQVQTGEVPIPHNTVSARGQKGAGVPEEAAVYVADNVDSA
                     SPHKLLFSFLTDMYVEEGSPLCLSPEVLRQLYLVAAHIMQFAKVLSLRDDMFGETMRC
                     FLVVGSIAQLLREANVRQLRAGLLTIVPFPAIGALRERWYKALLRWFTKMPPSWYYAK
                     DPVLAREEAKVVSSLSQLLKEEADLLTRTTLGFLDFSSGVQRERGMPLVHHWESLSVV
                     RESVAAVRQAADGGEAGLRKLIAREKLRLQGLLHLLRVLVEHEALRLSVWRTPRRTLK
                     IPNTTPSVGWAKLIECADHHNPAVVVSMVYRFSSIPAVRLAASQRVVAHPERYSNVAE
                     AVDLYLTEDVLRAGAPRLFLFCSCTIIQALRLLDPRYAAYKAVNSYAICSLLSQRSEN
                     LIFYLPQLLQLLATDESGSIEAFLVRMSAKSTMFAHQLLWSLQTESEGSGALAKKCQQ
                     VERRVKAVFTPNEEAFYKSEFAFVDLMTSVSGEIMKFDKTERKAQLRLRLKDDIFHAL
                     PKLRHLYLPTDPNYRITDVIPHTAGAMQSAAKCPILVQFTCVPRTAEDTLTPDDVDSA
                     AADEHGHGAMNSHGSAVSRQVVKACIFKMGDDCRQDQISLQLIGLMQRILNSIGVPSF
                     LYPYRVITTGKSSGVIECVPRSRSRNEIGKLVESNVAEFFVQTFGHPESAGFRRAREN
                     FVRSTAAYSVVSFILNIKDRHNGNIMIDADGNLVHIDFGFLFDTSPGGDINFESSPFK
                     LTTEMVQLIGMDVSGESTLQSKTLARALVDEENYIYFKTLVNRCYLAVRQYAREICVM
                     VELMLRSGLPCFKPKKTIADLAQRLAVDKNEIEAADYMRRLIHESRQNFRTVLYDYYQ
                     KVAEGIEM"
     gene            complement(<666283..>670416)
                     /locus_tag="LMJF_29_1460"
                     /db_xref="GeneID:12981007"
     mRNA            complement(<666283..>670416)
                     /locus_tag="LMJF_29_1460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722178.1"
                     /db_xref="GeneID:12981007"
     CDS             complement(666283..670416)
                     /locus_tag="LMJF_29_1460"
                     /note="previous protein_id=AAZ09602.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722226.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981007"
                     /db_xref="UniProtKB/TrEMBL:E9AE05"
                     /translation="MRYQRPPPPHGSITDAWRAVSLERFLALFCICTGVAAATPVASV
                     SSSPGAVVQSSTPLGKRQGFVRLCSVKGGCGACDKYAPQVRRALSVSLVAAASAEAPS
                     ALASYARHASIVADQGQQCEAQHVAVYDGGVVRTASGVVADVGGAAEEEYKPERHVEN
                     AEAVLREMFGPLAKLVLHRIPHRRRPAVAAAAADAETRTATEDEQAEADDVVMHDSHD
                     AGEEAPTMNDLESAAALEALPHPHQQEQQFYYRVSATFRQLGFPVELAVAKGLHARET
                     IEACLQQALSSDVKFISVSSNHGHASHHQRRFGRGRGRGRHQQHERGSINSIGFPTHS
                     GSGDGASSRLTPHQQELKAIMSDLRQLCAHFSRTVKFSVKPPLHASMSRSPAEGMGAA
                     TTEVMARSWRCRCYVKEEWSASPQARLAYEACGSSPNDAFVRCVVELRRQYRDEMDST
                     SVTQEGVREVAALVQGHRKTVKATWTEEAAGGKPEATTAERSSEEEAQDGASAIQATA
                     HANSFTSLTQPPTYSTQLQLTDARGNTAVYNARRQASPYVGYQTAAMSAIRSESAWDS
                     EAHLLSERLEPVPLLWRLRWQFDMLVDHICRVTGKPPLEVAWIKLGGTGDGGGDAEPA
                     KQEVNGTAISDSGAAPTRPQLDTLVDLPIVFTGSLFVESNALVWQTAGKGRYRVEFDT
                     YVQAVYYLLDQYGDCLTALPCMAAGQGEGLLFPSAGVLELQVLRHDTFPILNHHRGKW
                     NCYAILGSLTMHLLGCPFHTHYHFDLATKEWVSTVTVNNGRQSSYPLSQRRSKMKGEA
                     WRNACLAAIRDNFPRQYAAVLEKHPDVDLSADNGARGQRYRALPREKRIAHMGGFVPM
                     IMTFAEEDLGWRQPRVRLRNLSGDLGLPQWIAEMEAQVEGEEERRVVAVSPAFLQVRQ
                     ARKSLFFRLAKQYFPKELKVYQSLNRCDSDDPEMDINVRRTRLYDPKSSFDGSMLRHV
                     TSLMERDHATIAPVKVTLEACARQQGPHGTDAMGGQSIAGDDLDDMELDFNYSDGDMS
                     LLLSQQPEMLLRPLNLSYSAQVLGERGNVLIADYDSSRATTPADAEAVPVLVTALKSA
                     SYHLAGADAETLWTEYETYPVTGAGSNRELCLALFGAFFGHNANVALAAATPSASNAE
                     GEQARAGGAPPLGVADLQDVMNDPAAPVNVIVTGVGNYWFGTVVLPRFGMLPIARAVA
                     TSKRRCAREALTLATRRSFPRVLQYIIKRDMASATVATEVLSEPVIEQLPPEVCRDVL
                     AQLAKARRNQPPPPFRLLLRCMKSAYPMRDHRIRVQSSYDTTHGFQYRLYLQRGLIVR
                     EGSTQLVGYGASTSTQTEALYRAAVMALENLFETALHAAETMQPGYRSLSASGPQSP"
     gene            complement(<672775..>674901)
                     /locus_tag="LMJF_29_1470"
                     /db_xref="GeneID:12981008"
     mRNA            complement(<672775..>674901)
                     /locus_tag="LMJF_29_1470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722179.1"
                     /db_xref="GeneID:12981008"
     CDS             complement(672775..674901)
                     /locus_tag="LMJF_29_1470"
                     /note="previous protein_id=AAZ09603.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722227.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981008"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:E9AE06"
                     /translation="MSGAPMSDEQRAALEQRLARLRAAQAAASASGHERAARLPVGAT
                     NGAYILDAGAQQTDQQGPPAPNPRSGAVPPPPQMRYAYEDDDDDEEEAELDSAGQQFE
                     DEFLRLIAQQQRLQGVHAVSSHELNAASVAQVSATSHADEGVKVVATDKSAPCARELG
                     DFEALRLAKMGDSVSMKDFGAACGVVWRTLADNHGRNALHYAADAGSAALIRQVADDL
                     HVPYVADEKRMTPLDIAILNGHSGAESDEVYAALVAAAKASGHADGNPSAAEGGMKTR
                     ESVLEAHAPPPPKFVMSKPVSKAAEVTGTRTFWSSTCTRSVATNVQCSSGADMTDAER
                     QAVSDAVCSLDQHGRLQWLRPVMRGALAPCEHWQVAVASQADATAATTATTTTGVVVA
                     QMLPNVFLKGPAAKKISAATVAVAAHLAVRSDSHHTGVAAALLHALSTRIGDLAGSDS
                     NAAVFFASGTQLSRPPAAMATVKWYRRAFDAAYVYASESAYDVFPDFYNYDEVLRADA
                     VLKGAIPVSLVQQYMADLPSWCNLEVTSDEQCALVLSFMQAKAGSEDSNVDLACVPKD
                     VQEMRRSYIGHPDHRSYVRTNVQGSVTDLVVFRARDTRKSGPSADANAGVFAAEVVYA
                     LFTTVAGKAKADHMMLLASKLLSAKLLLVPTMFGITESELAKANFDEIVADREYIYAV
                     SPATRREVDGLGPMPAAKVSLPLYTI"
     gene            complement(<676085..>676957)
                     /locus_tag="LMJF_29_1480"
                     /db_xref="GeneID:12981009"
     mRNA            complement(<676085..>676957)
                     /locus_tag="LMJF_29_1480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722180.1"
                     /db_xref="GeneID:12981009"
     CDS             complement(676085..676957)
                     /locus_tag="LMJF_29_1480"
                     /note="previous protein_id=AAZ09604.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722228.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981009"
                     /db_xref="UniProtKB/TrEMBL:E9AE07"
                     /translation="MTKGSEYPFAAARIALLYRFKSVVCSSSVMRMSAVSQVPPRLLF
                     FSFPVCTSYRFLSKLSVAPCVSTYVSPSGDGFVAKTKLRARAHTSGLHTAKNCRERES
                     APQPLVRATGSPSISVVMTRRTAAALAMPRSSAARPSYPASLSSQRLLRLAGICSTAT
                     SGLTCCRQVHIGHSTDVHRWRNPEKEEVQRQFRGGVKLGSHIAKVREQQAKEKELIEQ
                     DKFTDWRLVYNYSIGTALLLIGLNVILAFVEPNPSPEYVPYTESVVPASNVSNTMADS
                     SQAPLSEAGPAKCT"
     gene            complement(<679235..>682936)
                     /locus_tag="LMJF_29_1490"
                     /db_xref="GeneID:12981010"
     mRNA            complement(<679235..>682936)
                     /locus_tag="LMJF_29_1490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722181.1"
                     /db_xref="GeneID:12981010"
     CDS             complement(679235..682936)
                     /locus_tag="LMJF_29_1490"
                     /note="previous protein_id=AAZ09605.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722229.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981010"
                     /db_xref="GOA:E9AE08"
                     /db_xref="InterPro:IPR001962"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:E9AE08"
                     /translation="MCGICLLVRQKLVNAAATTTPVLASPQNESQQQSEKSSAAASHS
                     NPLFPPQGEVVQEQHHSHHFNGVSSATSFSSWAGQTHSLTPCLCTQAGLDVMNFLSSN
                     SSETANDLFAEVIRNLRRRGPNTYGITRRSFSTVCQVPTDRGVSLMHPVSPMSYALLT
                     NGGDATASAAAPHAPVPASAAVNVRTEVAGVASVLGLRGRSTVAQPYDVNVETDTEED
                     GPVNSWDYRSSLLWNGEIFGGALCPPPWGSDTVLLASRLSQMELECVNMTQETPSGPK
                     LPPLAQRQRIFLRKCTYLFEQQVEGPYSFIFIATRLRLIIFGRDPLGRHSLLTHVHVT
                     VPPLNAGHKCTATGVGPAATHEFPVELDVQLIVSSVGVQHCPPANSTDPTSALSSSSH
                     ITSSTTSLLPQPGDAAKVNIDGAVKSKRPRHEKAASTTTSLETTPPLPSSPVLRPEQL
                     SSLSAGDEHDDEAGDVAGAGYREVCWQEVGVTGLFAVPLQAPLVYRDTAAAAAQEVEA
                     LSADLAGSEGSAAHQSLNLHPVCFSSATEMNGAGDGYQTTLRAAHVMLLHCPWQRSNH
                     LVHPLLRTVGLPMVPHEPPSFELILAHEEIAVLPEPLLQWARHLMKSIQPEEALDQSW
                     VDWAAAHYMLALAVSMHRRITVSNAGAVDGRDAQELTTARRRPLCILFSGGIDCTVIA
                     ALAHYLLPVETPIELVNVAFGETPEQAPDRVAAFRSMEELLRLPLLHTSGDDAGGGGA
                     GAATVTPERKWRLILVDIPSKSTVDSAHIKDLLVPRHTVMDLDIGTALWYAARASGRM
                     QSLSPSDVAGGGTPATTTARGSPTSASAPVRIGMGSPTVTLDEFSKHFRAYTGATPVT
                     SFPPDDATPDARLPGSSSALLAGNAAHATAATLSTSSSSGSVDPDSVANAQKYQILVD
                     VLVKEGRSGSGPHTPVLLSTLGKEYSLFLHPHIKRYGYKKLGSFLNDAAKAGYVKFAP
                     DAPSKAVRLCRPCDMQRATAVPPSPWFMTEYMKAKEPVRAPDGSMQPPLPCPGTYQES
                     YVSQAKVVLLGMGADETLGGYTRYRRFFQREGMQGARRELERDFARLWQRNLGRDDRI
                     TMDSGREPRFPYLDEGVVRTLEWIVLKRRNNILSTQELLSRQAVKSGAAGADPALPTS
                     PTSSSSLRLGTASNPREAVPPLTSDELLQLALEPVVSFRLNLGEGDKRVLRRVASVLG
                     LSDVTHLQKRAIQFGSRVAERKIKGTSDF"
     gene            complement(<686960..>688978)
                     /locus_tag="LMJF_29_1500"
                     /db_xref="GeneID:12981011"
     mRNA            complement(<686960..>688978)
                     /locus_tag="LMJF_29_1500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722182.1"
                     /db_xref="GeneID:12981011"
     CDS             complement(686960..688978)
                     /locus_tag="LMJF_29_1500"
                     /note="previous protein_id=AAZ09606.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722230.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981011"
                     /db_xref="InterPro:IPR010658"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:E9AE09"
                     /translation="MKLVVDELYRSRMLMAGVYVGLAISSTYGFSIFTEHLRNKYSFN
                     QADITTISTVGNCCGYLVFFAGILFDFAGPKVLFPIAGFLGFLGFLLFGLAFDDIITS
                     KSKEVALVQFCIFNAILYFGCPAMDVATLMPLMVNFPLERGYMVIIQKTFSGLGTSVL
                     MAYFNGWFLNLDAKHASNYSGYAYFVGAQIFFCALLGCYLIDLAPYTPCQFQRNRLTE
                     EQAAERKATLAVYGKQHASSRRLYIGCSVIGANLIFLAISSIVTGYVPTKKSGYLTIS
                     VIAVFLLALFSLMALPIQLLGRYPVIKKRHPHYPSLGYSDDVPEEAEAVRETELADID
                     EVEAAADAGDAAQQRSSVSREPTTVQNPTDRQRASGAGSANPADADAMAVAEGDETAS
                     GIQTYEEDETASPRKSNTVVEEEGAAPAPQTNVAGDPQYHQSFWRNLLTIDLWLFWVS
                     FFGMWGTGTVMQMNAAQIYRSKNFGVYDQSRLSLYVALIGVGSAIGRIVSGTLDMWLI
                     RRKTTSTNEILTTTFLPVGAVLLFASYLLFAVIPAEGLVLPFLLGSIGTGMGWGLGAL
                     SVRIVYANDIGKHYNFMFSSGFVSTIALNRFMFGGMFDKEASRLGTAPNCNQPSCVRN
                     QMLILMAVNAMSTIAAILVHLRFRRFVRQERAKQAEAALALEAKNKSD"
     gene            complement(<693379..>695397)
                     /locus_tag="LMJF_29_1510"
                     /db_xref="GeneID:12981012"
     mRNA            complement(<693379..>695397)
                     /locus_tag="LMJF_29_1510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722183.1"
                     /db_xref="GeneID:12981012"
     CDS             complement(693379..695397)
                     /locus_tag="LMJF_29_1510"
                     /note="previous protein_id=AAZ09607.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722231.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981012"
                     /db_xref="InterPro:IPR010658"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:E9AE10"
                     /translation="MKLVVDELYRSRMLMAGVYVGLAISSTYGFSIFTEHLRNKYSFN
                     QADITTISTVGNCCGYLVFFAGILFDFAGPKVLFPIAGFLGFLGFLLFGLAFDDIITS
                     KSKEVALVQFCIFNAILYFGCPAMDVATLMPLMVNFPLERGYMVIIQKTFSGLGTSVL
                     MAYFNGWFLNLDAKHASNYSGYAYFVGAQIFFCALLGCYLIDLAPYTPCQFQRNRLTE
                     EQAAERKATLAVYGKQHASSRRLYIGCSVIGANLIFLAISSIVTGYVPTKKSGYLTIS
                     VIAVFLLALFSLMALPIQLLGRYPVIKKRHPHYPSLGYSDDVPEEAEAVRETELADID
                     EVEAAADAGDAAQQRSSVSREPTTVQNPTDRQRASGAGSANPADADAMAVAEGDETAS
                     GIQTYEEDETASPRKSNTVVEEEGAAPAPQTNVAGDPQYHQSFWRNLLTIDLWLFWVS
                     FFGMWGTGTVMQMNAAQIYRSKNFGVYDQSRLSLYVALIGVGSAIGGIVSGTLDMWLI
                     RRKTTSTNEILTTTFLPVGAVLLFASYLLFAVIPAEGLVLPFLLGSIGNGMGWGLGAL
                     SVRIVYANDIGKHYNFMFSSGFVSTIALNRFMFGGMFDKEASRLGTAPNCNQPSCVRN
                     QMLILMAVNAMSTIAAILVHLRFRRFVRQERAKQAEAALALEAKNKSD"
     gene            complement(<702834..>704780)
                     /locus_tag="LMJF_29_1520"
                     /db_xref="GeneID:12981013"
     mRNA            complement(<702834..>704780)
                     /locus_tag="LMJF_29_1520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722184.1"
                     /db_xref="GeneID:12981013"
     CDS             complement(702834..704780)
                     /locus_tag="LMJF_29_1520"
                     /note="previous protein_id=AAZ09608.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722232.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981013"
                     /db_xref="GOA:E9AE11"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:E9AE11"
                     /translation="MITEHTYRISEISRFLILVGGLCASACISTLYGFNIFSNDLIEL
                     FNFSSSDLTIITTVGVVVGCATFPGGMLLDYAGPVPVLICATLLTTLGAVLYGLAFNG
                     NIKGNVPTLAVFCAIMNLGCSSFDTGSLMAVLGSFPLTKGPVVAIMKTFTGLGASILA
                     LINYSFFRNSDAHYMFFMAALIVCLGTVAVIFIRFPPYHILDHEKTRVPEKMQVRRRL
                     TERAYLTQYPPMARFYLGFGIIIALVIYLTVQSFCVAYANPSDTARMGNTVVIMVLVL
                     CLGLMAAPLPFLGGMEKEPSKDLPDYPEDEVMSFENEDEKRVLQPAVKEMAEDENVLG
                     EVYLKDGHCEVDKKGKKVPDSSDEALVHRQVAFEDAVMLEDENKARMMISDQDPQYQT
                     TFWQSLKRPDIWLCWWNTMATWGCGMVMAFNSAQIYQSLSNNKYERKTNTMYSAIISV
                     ASALGRLSMGILEFMVNCQPSETRPVITIAYPVASICMVVGLIFLLALPLESKAIVIG
                     FFFDSFGNGFSWACTALTVRTLFAKDIGKYYNFMYVGAFIAVIALNRFGYGEMYDRQA
                     KANRDADLAAGRVPIYPVCAGKKCVANSFVILLCVNVTAIVGSTWLHLRYRRFVLKHR
                     AEKAAACAEKEAKSVEPSCADNLQ"
     gene            complement(<706446..>708572)
                     /locus_tag="LMJF_29_1530"
                     /db_xref="GeneID:12981014"
     mRNA            complement(<706446..>708572)
                     /locus_tag="LMJF_29_1530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722185.1"
                     /db_xref="GeneID:12981014"
     CDS             complement(706446..708572)
                     /locus_tag="LMJF_29_1530"
                     /note="previous protein_id=AAZ09609.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722233.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981014"
                     /db_xref="UniProtKB/TrEMBL:E9AE12"
                     /translation="MADRCDAVSPLPLRAVLRADEVVATGRAENVLQVPSPIYTAIFV
                     DAHHALIGAGGGGRRFGMPNIALLLRVQSLSSASKADPTAKAPATSSAPAAAASPVWS
                     FAAAVDLGSDDIPWCTSSFLPFEASAHDGKARSGASTEPAALDWTDAQRRVLDGLVGF
                     VALSTMASFSLLGVFRGPEPSTSQATEPSASSAASAPANASGDVELRRYLRQLARIEV
                     PNDAKNPDKKPIALVHNLVLVSHDDNGVLAFALTDLVPDSFEDEDFDAYRARYADQTT
                     NGDSGAVLQRRVPRVRTEAAPVASWQLPARVNDLSVSRVCIVQADASNGASSLSQRPC
                     KARLQEHLVVAALLLNKTLVLSTVRLRRRYIRSRSHKASVVQGEETTAEKVQTEAKSD
                     TAAAATVSTALTLTEDMLPLPFKLLTSSLRLVRLFGWGDIDAAQQADMRRRLTWQSLQ
                     AGGAPTHGPLCGIMVVVYNSVTNESYVIHGSVEVTPLTSSVPSSCTWDSIGSLGLKVQ
                     WAREDPAPVLSDAITSLAVYTDGPPGDYASRVSANPLGAAVPARWIAGTVEGWVASLR
                     LSHDSAQPPHWQADQIRPSPNKSVARRYPALHKEPVSCVAVSSENDVVSADIAQNVAL
                     TTLPYAVPRVPSSVAASPSSKILSRDVVVQPRSTSSSPLFPPAGAVSGGPLGSLTDNV
                     ANALPSLRVAWFLLIPLVLLLAGMII"
     gene            complement(<710369..>710947)
                     /locus_tag="LMJF_29_1540"
                     /db_xref="GeneID:12981015"
     mRNA            complement(<710369..>710947)
                     /locus_tag="LMJF_29_1540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722186.1"
                     /db_xref="GeneID:12981015"
     CDS             complement(710369..710947)
                     /locus_tag="LMJF_29_1540"
                     /note="previous protein_id=AAZ09610.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722234.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981015"
                     /db_xref="UniProtKB/TrEMBL:E9AE13"
                     /translation="MQCTSRLLGGYMMYHRKSMSTMRYSKWKGARGGLSHFYNRTAML
                     EKVPVNMPVSIVDRRMMAYVHRSRLRHFQLFRSYQQKSNSTECKLREGEFLRRRWHRQ
                     LQKSFIAFMQFKTMKVLEEQAKLVSQYGQASVNAALGDPQAAAGDVAHERKYAALHRR
                     VQTLPRIQLVPKHVATMKQIHNDRFNYRWRVN"
     gene            complement(<711883..>713310)
                     /locus_tag="LMJF_29_1550"
                     /db_xref="GeneID:12981016"
     mRNA            complement(<711883..>713310)
                     /locus_tag="LMJF_29_1550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722187.1"
                     /db_xref="GeneID:12981016"
     CDS             complement(711883..713310)
                     /locus_tag="LMJF_29_1550"
                     /note="previous protein_id=AAZ09611.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722235.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981016"
                     /db_xref="UniProtKB/TrEMBL:E9AE14"
                     /translation="MDLVPSPVLLADVHKRLGYLRRLHQLQVAYGELMPAFRAASTFT
                     ELRQVFFTHDAVACQMLGRVYQAWRDGPYHEALAADHSGYEHRPPQNNAEVHEVLSCF
                     LGNPLVLDTLLPFVGITARYPQEEALLQSFVATLKDMTAVEAASWGPVAAMASWRCTN
                     GLYVVHHASRVHVLRRLLNEAQFYGLPLFLRSIRAMAGSHASSSFASTAREGGWQRAV
                     ALQRAQSLYADQFFLTPDGLDPDLFSQPDPMQAQLVQEELVALQRAHCAFCLVVGDAD
                     EVLTLVQRHMRHVGSVWQHWVKEEKEELLPGVKAEPLDARDPTGADAAATELSSEDAD
                     KSGTASANAPGGPALPRPRAPTDPLRRYVIRTVDAARRHQRLEASSAGHTAATPLPFS
                     HVQWIEHGSTNRWSPNAHYYGLAYMVVLETEEEWATENGGRLATEGLLPETAIVMNAA
                     TNTAALREARAPAYCVNAILELWRT"
     gene            complement(<715596..>717185)
                     /locus_tag="LMJF_29_1560"
                     /db_xref="GeneID:12981017"
     mRNA            complement(<715596..>717185)
                     /locus_tag="LMJF_29_1560"
                     /product="putative GTPase activator protein"
                     /transcript_id="XM_003722188.1"
                     /db_xref="GeneID:12981017"
     CDS             complement(715596..717185)
                     /locus_tag="LMJF_29_1560"
                     /EC_number="3.6.5.1"
                     /note="previous protein_id=AAZ09612.1"
                     /codon_start=1
                     /product="putative GTPase activator protein"
                     /protein_id="XP_003722236.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981017"
                     /db_xref="GOA:E9AE15"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:E9AE15"
                     /translation="MLPSWVTTKDGADGSFDKRVAAPFPMFVRDTEFIHRVADEEMKS
                     VDDFSGGGGMAHTSVAAAASAEGAARDTPSTPMTEMPSMSSQRPVSARRGSGAAIVSV
                     RQVSSAAGDSACVPCTSDRGAALATASTLLSPPNGKKAVQPTPYPVTSACSVQDWSSV
                     PRLGFPTPSDPAVAHAEVASQPTRDEEERKREDKWYRLCRGVSLLASASPEVIVKLRA
                     VARVRGIPHHLRGVMWLTLTGTALKVDENEYFCAKLLRRNGYVTGPNAVAIAADVQRT
                     FPGHPYFSDKDVGVYKLTNVLHALCWRNPLLSYCQSFNFLAAFLLLVLDDEERTFWLL
                     VHICEELLPNDFYGETLLGANVEQAVLEHLVEKKLPRVATKFREAGLHVKTLVANWIM
                     SLFVNVFPIATALHVWDYLFCRTPNPGERTPAHLEITLATLKYLDDAGLLISDDAGEL
                     LVTLRRQTACLYDAAALVRLAQSMAITPKQLHQLRRQCKPIVVEQMKAREQACAAQLE
                     RRVAQELRCAPENALASANAS"
     gene            complement(<719667..>720872)
                     /locus_tag="LMJF_29_1570"
                     /db_xref="GeneID:12981018"
     mRNA            complement(<719667..>720872)
                     /locus_tag="LMJF_29_1570"
                     /product="putative glutamamyl carboxypeptidase"
                     /transcript_id="XM_003722189.1"
                     /db_xref="GeneID:12981018"
     CDS             complement(719667..720872)
                     /locus_tag="LMJF_29_1570"
                     /EC_number="3.4.-.-"
                     /note="previous protein_id=AAZ09613.1"
                     /codon_start=1
                     /product="putative glutamamyl carboxypeptidase"
                     /protein_id="XP_003722237.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981018"
                     /db_xref="GOA:E9AE16"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR010169"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="UniProtKB/TrEMBL:E9AE16"
                     /translation="MSYPATFREWLAKIISFDTTSRNSNLPMVEYVRDYLKSVGVAST
                     FVYNPEKTHANLWATLPGENGVMQGGIVLSGHTDVVPVDGQKWDSDPFTMVEKDGKLF
                     GRGACDMKGFLAVVLALTPQFLTMNRVKPVHYAFSFDEEVGCTGVPYLIEHLKARGFL
                     ADACLIGEPTDMNVYVGSKGFTQWSVSVQGKAIHSSMALMNTSCNAIEYAAQIITKVR
                     EIAVDLRENGRQDPEYACPFPCITTGLIKGGNAVNTVPAQCEFVVTVRITDSETPDAI
                     ERRVRAYVNDHVLPAMREEYPDAEVTVTRSLAMPAFNGKEAASVTQKALMLRKATQTY
                     KTGGGTEGGYFEDVLGVSTVIVGPGPKAMAHLPNEYVLVDQMEKSTEFTMALVRLYTD
                     PSYCGAGNL"
     gene            complement(<721743..>723101)
                     /locus_tag="LMJF_29_1575"
                     /db_xref="GeneID:12981019"
     mRNA            complement(<721743..>723101)
                     /locus_tag="LMJF_29_1575"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722190.1"
                     /db_xref="GeneID:12981019"
     CDS             complement(721743..723101)
                     /locus_tag="LMJF_29_1575"
                     /note="previous protein_id=AAZ09614.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722238.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1575"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1575"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981019"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:E9AE17"
                     /translation="MPAEDPANVSALVAAEAECRRYVYLFDATSGTCLAALHFCGSPV
                     LALRANSSVLVVAAVDLFHLVDLRTLRYIRQQSMHKPLNPRGVLDLSAAVPSRKAGGG
                     TSYAVAFPQSARGYRGDVTVLTLHCVPPTSRRHARTGDGGRGASGMSAGVGAGRTSPS
                     TTAAAANATTSGAFGAATPPMEQRTIPAHHHAVAHLRFRPDGRLLATASELGTTVKLF
                     DSLTGALLVELQRGHRPAAVLSLAVQQDAHRIAALSANGTLHVFDCAAIVQSWESARA
                     AKVSSSLLAHGARSPTVIGGAAGASKVRAECKHKVNLMPHPAASTTAASAKSTPRRLG
                     SAVMAAAAGSSRANYSGSYAESNSAPPGAGPAVNDGWLHCESGFAADGRKVWVAQVQS
                     TEVQLQHAASTALSKSATPSPRLCVGSLTCFPLPSPNRGRSGGAISPADKGEEGCHYV
                     VV"
     gene            complement(<725076..>726260)
                     /locus_tag="LMJF_29_1580"
                     /db_xref="GeneID:12981020"
     mRNA            complement(<725076..>726260)
                     /locus_tag="LMJF_29_1580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722191.1"
                     /db_xref="GeneID:12981020"
     CDS             complement(725076..726260)
                     /locus_tag="LMJF_29_1580"
                     /note="previous protein_id=AAZ09615.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722239.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981020"
                     /db_xref="GOA:E9AE18"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR015360"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="UniProtKB/TrEMBL:E9AE18"
                     /translation="MKFTVTCLVSSVNSSLLAESEAVTKEITVANPRATVQNLRATVA
                     IQFRLKVVAFEFRFDRHEGDSAAPSSSPSAASAAVDFDDEKKLLTECGLREGDHLTVV
                     PKNYSSLSAAGAAAVAANEASPSEGPAAKRVRIESRGEVDAPVVTANEDEDVEEDESE
                     LDEEDDADDSEEDGDATGQNDLFAALREVVPDLTVLRQEFLANPQAVMERIERNHPSL
                     FQVIVQNQETFVTLMNNEQLTKAAQSMLHDGTICGDEDEEGSLVWSMGEEDEEMDEET
                     AEQMSALFQSYITSAARSGDSGDFDAADLAELEASGMQVEEVGDGDGNASGSARIGKA
                     KRQSDKEFILSRVPSEEDEKKIQALTELGFTYEQCKVAFYVCHRSIDRASNMLFEAPP
                     EI"
     gene            complement(<726872..>727243)
                     /locus_tag="LMJF_29_1585"
                     /db_xref="GeneID:12981021"
     mRNA            complement(<726872..>727243)
                     /locus_tag="LMJF_29_1585"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722192.1"
                     /db_xref="GeneID:12981021"
     CDS             complement(726872..727243)
                     /locus_tag="LMJF_29_1585"
                     /note="previous protein_id=AAZ09616.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722240.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1585"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1585"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981021"
                     /db_xref="UniProtKB/TrEMBL:E9AE19"
                     /translation="MQGAKDTPTANSGGKLQIRTTLLEAVRRYNEDCLNTSTAAAAAE
                     EPLATPTQRVDRFPDALPRMIAQLYPSLTNPSWAMEECVRLCPAAEVWCGTALPKDVW
                     APPGTAECPFGTEPMDFNAHR"
     gene            complement(<728295..>731228)
                     /locus_tag="LMJF_29_1590"
                     /db_xref="GeneID:12981022"
     mRNA            complement(<728295..>731228)
                     /locus_tag="LMJF_29_1590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722193.1"
                     /db_xref="GeneID:12981022"
     CDS             complement(728295..731228)
                     /locus_tag="LMJF_29_1590"
                     /note="previous protein_id=AAZ09617.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722241.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981022"
                     /db_xref="UniProtKB/TrEMBL:E9AE20"
                     /translation="MPPPRRLLQPRFTEQTPSLKAAPELAATHGDTLSLVPPPSASLV
                     WAKTPRVVAEVESLSRAGQAHAQVSPIALLSHNDRHNTRWTSAGSTTETLKSTGASMR
                     CSVPRSSALTAESDRETSARVMPARSSVRARSAEPCPCPSSQTFDRAAALMYATAAFA
                     GESEEALRAPGHLTRATRPASARAHCNARPSAYARPLLSEASDAVVAGRQSRAVCGSP
                     ARDVSYTHSISSPVLHPSGSASFAEAAPHPSRPRNFAASAAPSRKEEGDNKGCASLPR
                     SPSSTAAAGRATRYGTEGPAAVDKPWLAVTPAHGILKERGRMNSTTRIVSSAVSSTGS
                     TSSSHRAHTPSSVPKAVVSDSNARSLSDPESISVQESARQTRHVTFDEDAIEHLDASE
                     NQVVCGDSRLGRHPEKVVCGAAMLPSCTMRDFDIRQPSTTTAAFTRKENADSWDADSE
                     WFNEEFGAQLTLVGATADSAKAAPSPSSAAAASESPPLPPAVLIKRPFRVSIPSSSAS
                     LSLSATTAATALTAVRGARRQLGMPGRKRGEYDSVGNCQSLGTPPSSSLSRTPRSTSA
                     VMNTHHASVPSGSATPASGRSVTAGEASKLTSDDGRDSSPVLAYERASFIGSTCSGNH
                     SAVASSRPRNTVAPAPLLSVSDLRRRSPAASTPLATSAALSECSEASGSRRGGSHGRP
                     SSPRVSLSDVEAALDKVAESGRSARSTKQESSPVSPRTRRVAANQHDGESPTLGAMKQ
                     SMAERRLLQAVMPLNERQRPTDRAAASSVVPSRTKISASPAVMVELPSGTVGSRAGGA
                     LSSNSAFTSSSNGHGVRALRGTAPALGNPHANVLLAEVSQFSRARSTTTPPTATAATS
                     AVNGDRGSTTALRANSTSSALSPSPFPFAEPAVPKAGGLISQVSRKDDTVTAAPSALS
                     SEARRSGTIISDVHNHQLSMPASQLAHPRLDDSDKDEDESKSHMQVPVPIPRTPPSKS
                     SWATQ"
     gene            complement(<735161..>737203)
                     /locus_tag="LMJF_29_1600"
                     /db_xref="GeneID:12981023"
     mRNA            complement(<735161..>737203)
                     /locus_tag="LMJF_29_1600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722194.1"
                     /db_xref="GeneID:12981023"
     CDS             complement(735161..737203)
                     /locus_tag="LMJF_29_1600"
                     /note="previous protein_id=AAZ09618.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722242.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981023"
                     /db_xref="GOA:E9AE21"
                     /db_xref="InterPro:IPR004240"
                     /db_xref="UniProtKB/TrEMBL:E9AE21"
                     /translation="MSASTQHAHSHCSSNGGARPPLLLLLTLLVALQLLAAGATPASA
                     FYVPGAAEKSYKKGEAVKFMVNSLRSSSEMFPIDYSKMPFCQPARQEFKEESIGEIIW
                     GDRVLNSLYTVKMKEDGKCMTLPDCDFIANTETIRRKESKNLTKMINKWYRVYMNIDN
                     LPVFSTNPESTQMSECAKKLGKDIKIYAQRGFPLGLPAKCTSDRAALLNNHLDFTIHY
                     NRDSKTTSTTAEEERKYIVVFIDVKARSIAWSDPLECNSEMKVAPEVLAPMRGLKMKD
                     VMQNKTTVYWTYSVQWKESPNVKWATRWDFYLTAAAAAAPAGHILFIILSLMVVLFIG
                     SAVMGVLLRALHKDFNRYNSEDPEDLQEEVGWKLVHADVFRPPLYANWLAIFVANGVQ
                     ILTTVGVVLIIALMGFLSPSRRGALLTTLLLTAVFTSLISGYVCGVLLQYLNCRAWKH
                     IFMCSFTLPGAMLLIYIFILIINKAHGATTAIPFMTLLEVLTLFVAVSLPLTVLGGSI
                     AFRQQPITNPTRVGRLAREIPTQSWLNKPMFICVFWPSVPLVVIVIELYYIMQDLWEG
                     QIYYSFGFLTVTACIWVLICALVTVSCLYYVLCYENHRWWWIAYLVPGGAGVHMLCMS
                     LIFFMSHISVSSFASAVLFFFYMGMVSYMYGMAAGAVGVIVSIAFVRRIYGSIKID"
     gene            complement(<737673..>737909)
                     /locus_tag="LMJF_29_1605"
                     /db_xref="GeneID:12981024"
     mRNA            complement(<737673..>737909)
                     /locus_tag="LMJF_29_1605"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722195.1"
                     /db_xref="GeneID:12981024"
     CDS             complement(737673..737909)
                     /locus_tag="LMJF_29_1605"
                     /note="previous protein_id=AAZ09619.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722243.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1605"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1605"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981024"
                     /db_xref="UniProtKB/TrEMBL:E9AE22"
                     /translation="MRLRHACVTLTIAFFVLFLPLLFGGRTSSLRCPAPTPQPSLVHV
                     CVCVFLCVAAVCVAPAFRTAIAGLPFHDALSLTA"
     gene            complement(<738726..>739784)
                     /locus_tag="LMJF_29_1610"
                     /db_xref="GeneID:12981025"
     mRNA            complement(<738726..>739784)
                     /locus_tag="LMJF_29_1610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722196.1"
                     /db_xref="GeneID:12981025"
     CDS             complement(738726..739784)
                     /locus_tag="LMJF_29_1610"
                     /note="previous protein_id=AAZ09620.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722244.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981025"
                     /db_xref="InterPro:IPR019185"
                     /db_xref="UniProtKB/TrEMBL:E9AE23"
                     /translation="MAIGLGRTISSPVFLFFQVLHGVSLFFVMLGVTRVLLGMAELSM
                     STTAVEDRTTPQGLHRPDGLGEIAYQHTNMLDLFMDDTLSSTTTTLAPAPPAAPLSFF
                     EKLSYCFHVPLASLFVSTVDVRAGTTVEVQDLRPRDAVAADGVVKKDVRLSVADAPAA
                     GQPREGSECRFYLQHMFAALLCSYPLATLLQRRKLVLDFVVTIYLAYWLLADIVLRRL
                     LGGGLHWWAACALGMTVMYGATYVICQRKELQEIRFSGGGTAGSGAGVPATTTMWLKD
                     CRGEDDIVGEEMRVISRETQRHNGSGGADAHGSSKPHDAAGRSRVPASTQSSNGAKAV
                     AVDVSRASEEATYKHKMV"
     gene            complement(<742419..>748850)
                     /locus_tag="LMJF_29_1620"
                     /db_xref="GeneID:12981026"
     mRNA            complement(<742419..>748850)
                     /locus_tag="LMJF_29_1620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722197.1"
                     /db_xref="GeneID:12981026"
     CDS             complement(742419..748850)
                     /locus_tag="LMJF_29_1620"
                     /note="previous protein_id=AAZ09621.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722245.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981026"
                     /db_xref="UniProtKB/TrEMBL:E9AE24"
                     /translation="MRVQRRFQSSFSSKHSPHADSAAAVRDEDSTDDWSSIEVEVLMP
                     EPEVAACGNTAAASTADAAAASGRSSFASPTDSSRASASVETIDAIDSYAKAKVGNFV
                     RRWLQPSASGGGDAAPTSSTVGLEVRQVQGCGKVTQHHARWRLPLPVEFGERYGEGFA
                     PTPKEAEAVAAMHAERVIDALGFQLFQLSSKQRKHAEAARAAGRWAPMPTATTTATAS
                     SSGAPITTAEVVPPPDTPSPPPLQLLGLSAQQRQEKELRIDRVQFAPVQRGGFTPLAL
                     TLASPHYFDSSSHSRIERFFRVHRTSFRANLRLVLLKSGGHGTTKDDDVGEGVDVRQH
                     ASTPGGLFLAQLMLPLPARFGKRIAMGKAPTRKEAVLLACMHAELIIDAVGFALYPEN
                     CEKQAAHAAECAKMRRWCPQPGDCAYRYTAPSPPPMELVEELSPSRVAAATVVASEAD
                     SAVAGALLHMGAVNKTAHACGDGGSSGVSPSPRLLADVQVGSALSYVESMFLQHQQAV
                     LAVRYFIDEPSLRDFEPARLLLERYVKQFVSRPAAHAETTTCSSAASPTDSSLTELML
                     VEELGQRDRRVFRATITVPLSDPRSEQPAPTAAAAVGPAAAQAVDARSPLPYTQSFVA
                     IGVSYTNHLAELAAAMHALRTLGALNRLCLVSDNAAVAQALESFAMRAQIPLHDATQP
                     LLHPSQLPPESLPAPVRVMEGFVGRIAASGLNLRHRNHLPKDTDSDKVRDRFAARVPL
                     LSEEAGTAVNTLNRDDDLLRELRARQERLPRMHWDTSPDADGRIIVSPDQDATMSRMY
                     NHTLSSVRQPDVRATIRLRDYLERHGKSPEMALSVVRVCGKQERAEERGLYVAKVVLP
                     VTLRHQPKAKRWPPSAANSQTSALSSSAPPSSESQQPRQSQLPEYVAQGEGPTRDDAV
                     LLCAAHAEALLDAAGQPFYDHSLLQRKHADTARALGRWAPLVRGAALPPEPLRRTPPP
                     LRKVTRESGVWARVQEQRRASACEAVTSEPAEHATGVLSPASSTRSRHAGTTALASAA
                     VVDDEALCDIAGLRFVYHTDITQSALRQVAEYFSKNGSDIHRMVRQYVVRHPELGVIH
                     RAIVEMPLPASYGKRYAVGCASTKRHALFLCCSHALLILDALHLPVFTEYGRQRRYAR
                     AAAVRGRDAPLSGKACGKSDTPSPPGLYYLTTCAAAREKPPDIPKLPSLRDRKSLPLW
                     GTFVNHCASYVTRRRETRVTEAVSSVGGPRVPRSNVVAEDATSDIAASTLSDKFARRQ
                     LVDLCRLAGLPDPTDDVPSKSVALSSNERRFFTSKELAGTPYTMRGVSDASPAESRHR
                     AFGQGIQLLLLVVHRNSVSAPTPRRSWWDGQQRTLCIHDRVKNQMTPHGCLWVLRLWA
                     AMHYPPLHVRIMLRKVGLPTEERGKVVACAHDSDGVTNPELTPTLSAPGTPCPPTDYQ
                     GVASIVVSRDGVEKVLYYAACETAGPAATTAADSVHKALRQLLSDVQRMPTMQTLCRF
                     LSQQPQLHIPSIRVLADAEDVVHRLHALVCDSHSSERIVRSAEPLQVGHLAVLLTLPQ
                     HDQRPTASFYTTWPVKLLLKWVGAVNNSAQGWTASRDGEADCGRAQRGCLPSTLESTF
                     VSYGLARAAPSAKSALPTRATSLRLPSPVVPTPLAGALALLCRCLPPLPDVLIAEGDG
                     KNTAAVQGAANTARLAERDRELPLQLAHLILMGLLLGCAPWAVRAAAIVACAEHTLEW
                     YDEQQGLSAAAGGNDATAKTPPLPAPRLAPYVSVDVTEAVLTSLDATAPPLPETVLRY
                     ASEVVRRLEALWAEASSSAAAGKAPPLPWLPPPEAWGTCLGKADASKPSPSPAAGVLT
                     LTERRILRPLLQCAVATSAALHAVWVRATRMERGGGADEVCGDGAGWCLDETDAEEQR
                     LVFQHRHAAHYAAVRVSNRDLTQAEALESANDISAMATCFATFGCAVYPTEPLVASTL
                     EQEQASALFRLSRAEGDSEDEAQANDDDADDAADASNDDEGSKGEEDEKLNGLDDDVD
                     VGQFARVFGTCVSPLAATLVAAAPTRSASLQSHCSIHPKPDDVAAGGALRAVGENLPV
                     LMTAFQETVPLLVHRRSSVPLLSSLSAHLRSRVETTTPFSPEERRAISQLFTMTVRSA
                     ADEEGRGDETA"
     gene            complement(<750375..>754040)
                     /locus_tag="LMJF_29_1630"
                     /db_xref="GeneID:12981027"
     mRNA            complement(<750375..>754040)
                     /locus_tag="LMJF_29_1630"
                     /product="putative Zn-finger domain protein"
                     /transcript_id="XM_003722198.1"
                     /db_xref="GeneID:12981027"
     CDS             complement(750375..754040)
                     /locus_tag="LMJF_29_1630"
                     /note="previous protein_id=AAZ09622.1"
                     /codon_start=1
                     /product="putative Zn-finger domain protein"
                     /protein_id="XP_003722246.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981027"
                     /db_xref="GOA:E9AE25"
                     /db_xref="InterPro:IPR011016"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:E9AE25"
                     /translation="MQEFPRRTARKTRREVTGESLTTVSSTSTATKDEDAQRSERVEN
                     DLSGALPQTSAAAASSFLGSSRNSTSGSVIECWICFDPTSTPLNPIVTHRCRCRGSVG
                     YVHQKCIDRWVIQQRNRACRSCGASYQLVHSEYPSGANLPLRPHERRVFLLKFLIKPL
                     LLESAETLCCVLLRFVVLPLLLGLVYSFHRWPLLWWPMSTTMSTFAASPERNFSYTAS
                     AGVPGSQEVLENEDGTYTLTESFLAWADAILFGLVLCTVMNAVAVGWEKWNHYFRAAR
                     ERLARETARQAEEGGLARAAAMPPVGPLDFHEDNGAAEGVEERAEATEQRVNNDSPQA
                     QLPHHEEALPEGFIVEGWRPEWGPLPAVEQELLPREDARDARQPGARAEARALAGEQR
                     SSSDSDSDNGDSDSGSDTPYRLSFVDGVFDTIDWVKSGAGGGGMKRLLPSSMRQLCYG
                     LALTLLLRTIWGRSVVALAFAGFIVSWRYRHTRNVLTAQKRRLYEVAERVPLLSQEAV
                     KTLFGVYLVDAFFFYGALPELGGMMLHYAVAPYVDSGFDRGFLAFFHGLTVLKVTLYW
                     VVGAVLVMLLTAMELTVVGPLFANGVDLFFVRSFDARWDSVLGYWRCVVTQVFDSDPP
                     RIVRGFLRVAVVELLVLLIFVRVPFWGMLGCRDLLWGDGTVAQTGLPLKMSLSLGVTT
                     GYDISVDASLDEWRRTEVLRVLAERVLLPFGAMYAARVREQLGPMLDSIPLDNIDSLE
                     LTAASSTSMAPAARELWEQVWGNMSDRSVFLFHLIDPHSATRVAAASEGFRHTLERVQ
                     EPIEWLRAATSEDGVCNTMMVLSASAEWLGTPQRQPPVADLEAIVAPPLTVSEQQSTS
                     TARAHQMVLEAWRNMYQDAMSRIASVLHPEAVPTPPSLYPEHDSVQEEPHTVSTIKCY
                     MAALHLSYPYMGMGRWRALAYEWWSLLLLRNTFANYVVDVLKYVAAISTVLSCFAVYP
                     LQRAQLRILFPVVRWIGQSVVHMEDYLFDPEQLRAVEGFVEQEGEDELVLPPMVEPLG
                     FDRREEYVEEAAIPPYLLLRRVVVAVLFLVVASVMVWIVPVLCGTLLLCITRNALPVL
                     VGAASLSFFCWNPTLFARSVIFGTALTIALVFVLPIVGIIYIGPFAQLFWNSYPTLVE
                     ETFERQYDVHQMVGPYTGSAAGGNGSADGDSDDDWESIDSRDMVDGNAEALDQDREAE
                     PDVGDEPHGDVQAVTAH"
     gene            complement(<757788..>759182)
                     /gene="ABCH2"
                     /locus_tag="LMJF_29_1640"
                     /db_xref="GeneID:12981028"
     mRNA            complement(<757788..>759182)
                     /gene="ABCH2"
                     /locus_tag="LMJF_29_1640"
                     /product="putative ABC transporter domain protein"
                     /transcript_id="XM_003722199.1"
                     /db_xref="GeneID:12981028"
     CDS             complement(757788..759182)
                     /gene="ABCH2"
                     /locus_tag="LMJF_29_1640"
                     /note="previous protein_id=AAZ09623.1"
                     /codon_start=1
                     /product="putative ABC transporter domain protein"
                     /protein_id="XP_003722247.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981028"
                     /db_xref="GOA:E9AE26"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9AE26"
                     /translation="MSLTTTARTPATVGKLSPSSGIFSIPDNISPVTAEEVPKSRDSL
                     LTDMSLSELSRQSVLQSEPVVLRLCHVGKSYPIAGSDERVVALKDITLAESKHSNAAT
                     TKQGASTTNCLQRSNLPPPFAPVRRGEFVMIRGPSGGGKTTLLNIIGSIDSCTEGNIE
                     LNGRIIDKDTKESVLADIRLKNIGFVFQTFNLIATMTAAENVELPMTLLGTMSTKAMR
                     LRSRQLLTLVGLRNRINHLPSELSGGEQQRVTIARSLANNPSILLLDEPTGDLDTANT
                     IEVMDLLMRINRRTKTTCIMVTHNPDIECYADRILYVSDGRFAKEVFNALPMCLDLEN
                     YTEYLAAKERAITGFAGVGDVEDDSEPRATAAMAECIGTKGCEIEKPNSSPVLMEPLT
                     EGQSACSIVSPAASRSAVVQPLCPPAAATAPSVNGVTQTVLDTTHHGSASVPPASASS
                     ALLQREEREVPNGL"
     gene            complement(<763576..>763914)
                     /locus_tag="LMJF_29_1650"
                     /db_xref="GeneID:12981156"
     mRNA            complement(<763576..>763914)
                     /locus_tag="LMJF_29_1650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722200.1"
                     /db_xref="GeneID:12981156"
     CDS             complement(763576..763914)
                     /locus_tag="LMJF_29_1650"
                     /note="previous protein_id=AAZ09624.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722248.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981156"
                     /db_xref="GOA:E9AE27"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="UniProtKB/TrEMBL:E9AE27"
                     /translation="MTLEDQKSCDVACRFLGNATKPFAHSVILITVNTNANAEVTALH
                     DIRSLPTFMAYRNGCIVGRFEGSHEDEINKLVDLLAENSTKGSPATDNGTPSPPPQQQ
                     GATSKRVSGD"
     gene            complement(<768307..>769116)
                     /locus_tag="LMJF_29_1660"
                     /db_xref="GeneID:12981029"
     mRNA            complement(<768307..>769116)
                     /locus_tag="LMJF_29_1660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722201.1"
                     /db_xref="GeneID:12981029"
     CDS             complement(768307..769116)
                     /locus_tag="LMJF_29_1660"
                     /note="previous protein_id=AAZ09625.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722249.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981029"
                     /db_xref="UniProtKB/TrEMBL:E9AE28"
                     /translation="MATLTEDEIAPSAIAAERERLQEATQHVAELERRLDALQRELEA
                     ACTRREQLLLSVQWRELMAAVNADEDVYAVAERMMDAFAAFRESLVEPENYLQEQREE
                     VLKEDDIVPYSDTDDYADFSGVEAVVEELLAAVKEQLESHAAAPPSSFRQTKHSSLRG
                     SFASDERPKHPDGESAEAHKVSADARRQALLKLLVITVLMGRVEQYCRFKSISDASNV
                     PQSEAEEMRDGVASVWQWLFHEQPGVLTAEEGAEWKHIAGAFLGDSYTVAP"
     gene            complement(<772021..>772365)
                     /locus_tag="LMJF_29_1680"
                     /db_xref="GeneID:12981030"
     mRNA            complement(<772021..>772365)
                     /locus_tag="LMJF_29_1680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722202.1"
                     /db_xref="GeneID:12981030"
     CDS             complement(772021..772365)
                     /locus_tag="LMJF_29_1680"
                     /note="previous protein_id=AAZ09626.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722250.1"
                     /db_xref="GeneID:12981030"
                     /db_xref="UniProtKB/TrEMBL:E9AE29"
                     /translation="MCVWERSRLLPLVVLCYCVALSCTRALVCLQRSVSVGSFLVCLP
                     LLDLLVGCSTAELQLRVCVRFRRAYQWSAGNSTKHTHTSASSPSPPLLSFSDAQLFGA
                     CHFEAFMLAYLH"
     gene            complement(<774236..>775297)
                     /locus_tag="LMJF_29_1690"
                     /db_xref="GeneID:12981031"
     mRNA            complement(<774236..>775297)
                     /locus_tag="LMJF_29_1690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722203.1"
                     /db_xref="GeneID:12981031"
     CDS             complement(774236..775297)
                     /locus_tag="LMJF_29_1690"
                     /note="previous protein_id=AAZ09627.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722251.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981031"
                     /db_xref="InterPro:IPR006683"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:E9AE30"
                     /translation="MIDPIHVSWTDIAGSDTTPGARLAAGRVLAMLDMCAARTSQKAI
                     DHQDCLTHERYLTCTVGVTNTMFSSPILHGDAVRLDGRLVCCGSSSMGIYIRFYRQSP
                     STRTETPAGHSFFTMVAITPDLKAAKVVPAIELTDPLDIELHNHYVKVRKLQEENKKN
                     TAERLKRTLTTEEVQCSINQQKPIHARINSTRVEANRIFFTSCMNNNNTVFGGELMAW
                     MEQHAVHCGRMFTGNRYVFTIGMHSVAFPEPVFATDWVTLEATVIYVRNTTMEVDVVL
                     KAERKDAGTVITNRASFVLINNDDIGRKCAIPIGLELNGATQEELQQFMEARVRYHCS
                     VARRDDFHASNLCTGTTKL"
     gene            complement(<777106..>780792)
                     /locus_tag="LMJF_29_1700"
                     /db_xref="GeneID:12981032"
     mRNA            complement(<777106..>780792)
                     /locus_tag="LMJF_29_1700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722204.1"
                     /db_xref="GeneID:12981032"
     CDS             complement(777106..780792)
                     /locus_tag="LMJF_29_1700"
                     /note="previous protein_id=AAZ09628.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722252.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981032"
                     /db_xref="InterPro:IPR003409"
                     /db_xref="UniProtKB/TrEMBL:E9AE31"
                     /translation="MPKVTTSSSSAKSHAASSVDPSRAAATAAAPTSATSATTAIRSL
                     WDRTFSNGDTYHGEALYVHDKDRQPVKDGKGRYTWASSGAVYDGDWKGGLPHGTGVMS
                     VPGIDGYEYAGEFKDGKRSGKGRCQFSNGRVYEGDWREDEMNGTGTLCGASNVDNFTE
                     YTGGFQNGMRSGRQGRCVYVNGDVYDGSWAAGKRQGFGEWQLRRPATGAAAAAAARPV
                     RYRGAFDGDTPQASSTGEGEIEYADGSFYTGGTDAQMRRHGKGVHHFSSGVVFEGSFA
                     QDRREGRGVLQGSDGSVCEGHWHNDQLNGEVRVTFAIASSSLATSSTSIVSLLRLSQS
                     EYAAHPMKTYHGPCVAGIFTGAPAVITYMDGSSYNGAVRNGVPHGSGVLRDRSLPCST
                     GTRGIDADSAVRKRIPATCVPHDVLLTLTCYEGTFSNGEADGNGTGEWRTDSSTQQLP
                     PASSSPTEAPVTPHNFMQVLGTGLRCWDPAMYGRLDGTYTGQWARGLPHGQGTWQWSD
                     GSRYSGAVAQYVPSGAGTLTSASSVQYTGDFQEGQVGGNGVWEDKARGLKYEGQWLAG
                     QPHGWGVATLLTAASPSSPQTSKPIWSVSSRVYEGSWANGKPSGQGSEYTTEDRRRVA
                     YEGGYVDGYREGEGTISFSDTDGTTGDTSLSPHYLKYTGSFSRGVPGGGAGCLTLRNK
                     TSIEACFDAQLQPLASRDVSIKSGNETWTFKGVYDAVTHTGCGVMTFANGDVYVGEVE
                     DASFGGGQQQQQPLFHLQCHGRGTYKFVEGNQLHCTWRHNVLHGAGTYTSSDGMQTER
                     NYADGVLAGGGVVATVGGGIGGSAGGAHVEADTGVLRGNVFTPENEFPNTLSAEVLKS
                     RVPELQQQSQSQSRKRQPFSFMRKGEARRASAAGEAAAAAPGGAASVGASSAIPAHRR
                     SSQRDSQDAKRQLAPPPAAANQKCSPRTSVMSSAAPNDTGANGRFGARSPPRAACCGT
                     VPSTKGASPAVSPLRSTAKYTLRRPQRTARNAPPPAAEASSADGASPIATAPTNARPA
                     PIHHAKDGNDGAGATAPTSSGYLSKFQAGIRLLDNIPRANSPTPSAVSRDLKPPAKGS
                     SCPVTAPAQPGSRGRLSSALAAGRAQEIQQRVLKPLKGSLKALMDEASSIRSTREDEI
                     HLLTEEMRELNERIWQLRFTLRSKEEEDSGRGAGKKTYVAAAPPTKTERKRTSVSKEA
                     LDTLVQERRVVMEKLQYVVNEHGD"
     gene            complement(<781977..>785267)
                     /locus_tag="LMJF_29_1710"
                     /db_xref="GeneID:12981033"
     mRNA            complement(<781977..>785267)
                     /locus_tag="LMJF_29_1710"
                     /product="MutS-like protein"
                     /transcript_id="XM_003722205.1"
                     /db_xref="GeneID:12981033"
     CDS             complement(781977..785267)
                     /locus_tag="LMJF_29_1710"
                     /note="previous protein_id=AAZ09629.1"
                     /codon_start=1
                     /product="MutS-like protein"
                     /protein_id="XP_003722253.1"
                     /db_xref="GeneID:12981033"
                     /db_xref="GOA:Q4FXN1"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="InterPro:IPR007696"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4FXN1"
                     /translation="MQRAADGVFENAYERGAVQGRAQLSSNSDCEGDNEDEDDDVDTS
                     VKPPPAEVTALCWCAASVGVARFLCSECRIEVFEVPVCMVAGEIVRRGRGRPATPAAA
                     VQSRAGGAQRISHSTQGSATGSRGDVRIVAHEDIPPSLLWLVRYLQVYQPQVLLPHTG
                     SEALGDLIALVAEQTPVEVIRLSAATAFCGPEALPRLAAMYPAQEQELAARFHADRTA
                     MMCSMAALLQFVAAVQSNVADVVERDVLHALYLDDACAEALQITRTERHPSSGQGRGR
                     AKEGHSLRGLLSAAQSSVGRAMLRQWIALPCCDAAEIETRQSVVAFFVNPLHHDIAAR
                     LRAALHKVYSTTHVFTLMRSGRALHKHYVSLYQTMRGIIAVQELLATVAHEVSRLYVL
                     LQSIRVEPLRAMAASLDSAVVGVAGRGRGGGVGGGAIDARQERQPHYPAVLTTAVLAS
                     FDYGVSNPVRIRDGVDTVLDELRVRFHELRLSLQAKAEAAFAELPWTLRARLSLRCVY
                     TVPHGYLLCVPLAELEALLPVKDAADEDDLGGEGRDDDAGEPASWRSDDADNETAGPL
                     SSDAALHPPRVAATSPSVSPTERVRSVMADSFGWRLHHATEAGECCFKSAAMEELDTW
                     VGDLQRRVQQREEQVRRELDTSLLYNSLHLLRPTRALGELDCLLSFARVSAQEGWCRP
                     EIVAPGAGCAVPDEKTGEDADEGILEIEDGWHPLLSRHVGMQQLVPFSLHLRTSTDRV
                     CLVLGVNGSGKSVLMGAVAQIVFLAHLGCHVPAVTARLSLVNSIFAPSSSVFVPSSSA
                     PSRSAWSAADVAAAAPGSFYGECVALHRVLHFVAGQQRARQAFHSNALDGSRMAGRAL
                     VLVDEFGRGTSPEDGCALLKATLRYFADGGEGRGSRQHGSPGAPLVLCATHLVEMLDL
                     PGQRAAPGFPAFSDVYDCGAAAVVAHSGQGTAAERTDAAAVGVTESSETSAHENQRGA
                     DPLSHTADTPLPLEWVKIYEMETHATYAADQDGLTGTEGLRAGDDKPISPLAASDSGA
                     PLPLDVTPTYQPVCLTPHPGPRRQQDWEQHCSIHLGAGPAIGRQCGLDEELLSYWEET
                     LRVLHRLP"
     gene            complement(<786173..>786571)
                     /locus_tag="LMJF_29_1720"
                     /db_xref="GeneID:12981034"
     mRNA            complement(<786173..>786571)
                     /locus_tag="LMJF_29_1720"
                     /product="putative histone H2A"
                     /transcript_id="XM_003722206.1"
                     /db_xref="GeneID:12981034"
     CDS             complement(786173..786571)
                     /locus_tag="LMJF_29_1720"
                     /note="previous protein_id=AAZ09630.1"
                     /codon_start=1
                     /product="putative histone H2A"
                     /protein_id="XP_003722254.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981034"
                     /db_xref="GOA:E9AE33"
                     /db_xref="InterPro:IPR002119"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:E9AE33"
                     /translation="MATPRSAKKAARKSSTKSAKAGLIFPVGRVGGMMRRGQYARRIG
                     ASGAVYLAAVLEYLTAELLELSVKAAAQSGKKRCRLSPRTVMLAARHDDDIGTLLKSV
                     TLSHSGVVPNISKAMAKKKGGKKGKATPSA"
     gene            complement(<787785..>788183)
                     /locus_tag="LMJF_29_1730"
                     /db_xref="GeneID:12981035"
     mRNA            complement(<787785..>788183)
                     /locus_tag="LMJF_29_1730"
                     /product="putative histone H2A"
                     /transcript_id="XM_003722207.1"
                     /db_xref="GeneID:12981035"
     CDS             complement(787785..788183)
                     /locus_tag="LMJF_29_1730"
                     /note="previous protein_id=AAZ09631.1"
                     /codon_start=1
                     /product="putative histone H2A"
                     /protein_id="XP_003722255.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981035"
                     /db_xref="GOA:E9AE34"
                     /db_xref="InterPro:IPR002119"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:E9AE34"
                     /translation="MATPRSAKKAARKSSTKSAKAGLIFPVGRVGGMMRRGQYARRIG
                     ASGAVYLAAVLEYLTAELLELSVKAAAQSGKKRCRLSPRTVMLAARHDNDIGTLLKSV
                     TLSHSGVVPNISKAMAKKKGGKKGKATPSA"
     gene            complement(<788819..>789217)
                     /locus_tag="LMJF_29_1740"
                     /db_xref="GeneID:12981036"
     mRNA            complement(<788819..>789217)
                     /locus_tag="LMJF_29_1740"
                     /product="putative histone H2A"
                     /transcript_id="XM_003722208.1"
                     /db_xref="GeneID:12981036"
     CDS             complement(788819..789217)
                     /locus_tag="LMJF_29_1740"
                     /note="previous protein_id=AAZ09632.1"
                     /codon_start=1
                     /product="putative histone H2A"
                     /protein_id="XP_003722256.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981036"
                     /db_xref="GOA:E9AE35"
                     /db_xref="InterPro:IPR002119"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:E9AE35"
                     /translation="MATPRSAKKAARKSSTKSAKAGLIFPVGRVGGMMRRGQYARRIG
                     ASGAVYLAAVLEYLTAELLELSVKAAAQSGKKRCRLSPRTVMLAARHDDDIGTLLKSV
                     TLSHSGVVPNISKAMAKKKGGKKGKATPNA"
     gene            complement(<791318..>793105)
                     /locus_tag="LMJF_29_1750"
                     /db_xref="GeneID:12981037"
     mRNA            complement(<791318..>793105)
                     /locus_tag="LMJF_29_1750"
                     /product="putative paraflagellar rod protein 1D"
                     /transcript_id="XM_003722209.1"
                     /db_xref="GeneID:12981037"
     CDS             complement(791318..793105)
                     /locus_tag="LMJF_29_1750"
                     /note="previous protein_id=AAZ09633.1"
                     /codon_start=1
                     /product="putative paraflagellar rod protein 1D"
                     /protein_id="XP_003722257.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981037"
                     /db_xref="GOA:E9AE36"
                     /db_xref="InterPro:IPR007824"
                     /db_xref="UniProtKB/TrEMBL:E9AE36"
                     /translation="MMTPEDATGLEAARKQKIHNLKLKTACLENEELVQELHISDWSE
                     TQRQKLRGAHEKGEELLASVEVGTKWNLMEAYDLAKLMRVCGLEMSQRELYRPEDKPQ
                     FMDIIGVKKVLQDLRQNRNKTRVVSFTQLIDNSIAKMEKVEEELRRSQLDATQLAQVP
                     TRTVKMMEDIMNATQIQNALASTDDQMQTQLAQLEKTNEIQNVAMHDGEMQVAEEQMW
                     TKVQLQERLIELLKDKFGLIGKCEEENAQFKEIYEVQKQANQETSQMKDAKRRLRQRC
                     ETDLKHIQDAIQKADLEDAEAAKRYAGNKERSERAIKENEEMQEEAWNKIQDLERQLQ
                     NLGTDRFDEVKRRIEEVDREEKRRVENAQFLEIAAQHKKLLELTVYNCDLAMRCTGLV
                     EELVSEGCAGVKARYDKTNQDLAALRLEVHKEHLEYFRMLYLTLGSLIYKKEKRLEEI
                     DRNIRLAHIQLEFCVETFDPNAKKHADMKKELYKLRQGVEEELAMLKEKQAAALDDFK
                     ESEEALDAAGIEFSHPVDENNEEVLTRRSKMVEYKSHLTKQEEVRIAAEREEIKRARL
                     LRSGGESAAAQITSGSMNADYAASAQLEG"
     gene            complement(<795354..>797141)
                     /locus_tag="LMJF_29_1760"
                     /db_xref="GeneID:12981038"
     mRNA            complement(<795354..>797141)
                     /locus_tag="LMJF_29_1760"
                     /product="putative paraflagellar rod protein 1D"
                     /transcript_id="XM_003722210.1"
                     /db_xref="GeneID:12981038"
     CDS             complement(795354..797141)
                     /locus_tag="LMJF_29_1760"
                     /note="previous protein_id=AAZ09634.1"
                     /codon_start=1
                     /product="putative paraflagellar rod protein 1D"
                     /protein_id="XP_003722258.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1760"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981038"
                     /db_xref="GOA:E9AE37"
                     /db_xref="InterPro:IPR007824"
                     /db_xref="UniProtKB/TrEMBL:E9AE37"
                     /translation="MMTPEDATGLEAARKQKIHNLKLKTACLENEELVQELHISDWSE
                     TQRQKLRGAHEKGEELLASVEVGTKWNLMEAYDLAKLMRVCGLEMSQRELYRPEDKPQ
                     FMDIIGVKKVLQDLRQNRNKTRVVSFTQLIDNSIAKMEKVEEELRRSQLDATQLAQVP
                     TRTVKMMEDIMNATQIQNALASTDDQMQTQLAQLEKTNEIQNVAMHDGEMQVAEEQMW
                     TKVQLQERLIELLKDKFGLIGKCEEENAQFKEIYEVQKQANQETSQMKDAKRRLRQRC
                     ETDLKHIQDAIQKADLEDAEAAKRYAGNKERSERAIKENEEMQEEAWNKIQDLERQLQ
                     NLGTDRFDEVKRRIEEVDREEKRRVENAQFLEIAAQHKKLLELTVYNCDLAMRCTGLV
                     EELVSEGCAGVKARYDKTNQDLAALRLEVHKEHLEYFRMLYLTLGSLIYKKEKRLEEI
                     DRNIRLAHIQLEFCVETFDPNAKKHADMKKELYKLRQGVEEELAMLKEKQAAALDDFK
                     ESEEALDAAGIEFSHPVDENNEEVLTRRSKMVEYKSHLTKQEEVRIAAEREEIKRARL
                     LRSGGESAAAQITSGSMNADYAASAQLEL"
     gene            complement(<799388..>801175)
                     /locus_tag="LMJF_29_1770"
                     /db_xref="GeneID:12981039"
     mRNA            complement(<799388..>801175)
                     /locus_tag="LMJF_29_1770"
                     /product="putative paraflagellar rod protein 1D"
                     /transcript_id="XM_003722211.1"
                     /db_xref="GeneID:12981039"
     CDS             complement(799388..801175)
                     /locus_tag="LMJF_29_1770"
                     /note="previous protein_id=AAZ09635.1"
                     /codon_start=1
                     /product="putative paraflagellar rod protein 1D"
                     /protein_id="XP_003722259.1"
                     /db_xref="GeneID:12981039"
                     /db_xref="GOA:E9AE37"
                     /db_xref="InterPro:IPR007824"
                     /db_xref="UniProtKB/TrEMBL:E9AE37"
                     /translation="MMTPEDATGLEAARKQKIHNLKLKTACLENEELVQELHISDWSE
                     TQRQKLRGAHEKGEELLASVEVGTKWNLMEAYDLAKLMRVCGLEMSQRELYRPEDKPQ
                     FMDIIGVKKVLQDLRQNRNKTRVVSFTQLIDNSIAKMEKVEEELRRSQLDATQLAQVP
                     TRTVKMMEDIMNATQIQNALASTDDQMQTQLAQLEKTNEIQNVAMHDGEMQVAEEQMW
                     TKVQLQERLIELLKDKFGLIGKCEEENAQFKEIYEVQKQANQETSQMKDAKRRLRQRC
                     ETDLKHIQDAIQKADLEDAEAAKRYAGNKERSERAIKENEEMQEEAWNKIQDLERQLQ
                     NLGTDRFDEVKRRIEEVDREEKRRVENAQFLEIAAQHKKLLELTVYNCDLAMRCTGLV
                     EELVSEGCAGVKARYDKTNQDLAALRLEVHKEHLEYFRMLYLTLGSLIYKKEKRLEEI
                     DRNIRLAHIQLEFCVETFDPNAKKHADMKKELYKLRQGVEEELAMLKEKQAAALDDFK
                     ESEEALDAAGIEFSHPVDENNEEVLTRRSKMVEYKSHLTKQEEVRIAAEREEIKRARL
                     LRSGGESAAAQITSGSMNADYAASAQLEL"
     gene            complement(<802432..>803553)
                     /locus_tag="LMJF_29_1780"
                     /db_xref="GeneID:12981040"
     mRNA            complement(<802432..>803553)
                     /locus_tag="LMJF_29_1780"
                     /product="putative diphthamide synthesis protein"
                     /transcript_id="XM_003722212.1"
                     /db_xref="GeneID:12981040"
     CDS             complement(802432..803553)
                     /locus_tag="LMJF_29_1780"
                     /note="previous protein_id=AAZ09636.1"
                     /codon_start=1
                     /product="putative diphthamide synthesis protein"
                     /protein_id="XP_003722260.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981040"
                     /db_xref="GOA:E9AE39"
                     /db_xref="InterPro:IPR002728"
                     /db_xref="InterPro:IPR016435"
                     /db_xref="UniProtKB/TrEMBL:E9AE39"
                     /translation="MQALDDVQHDQKQQRETQRKLGLPTNYRFEIDKCIKRIKEKDAR
                     RVALQFPEGLLMFAVPIADILEEATGSEMVILGDVTYGACCVDDFSAAALGCDFLIHY
                     GHSCLISIKDCIVANMMYVFVEIDIDVQHFVDTIKALVPADARVACIGTVQFISSMRA
                     GLRVLQAEHFIHPVVIPQNRPLSTGEVLGCTSPKVNPAEVDLVLYVGDGRFHVESFLI
                     AHPGLSALQYDPYKKTLSRETYATAEMRTLRRGAVEKAKAAQSFAIVMGTLGRQGHPR
                     VVDRIIALAQRQGKRVTLLLMSEIFPQKMAMLEDVDCYIQVACPRLSIDWGYAFDRPL
                     LSPYEAEVALGNAQWGEEYPMDHYSREGGNWAVYTDKSL"
     gene            complement(<804419..>807919)
                     /locus_tag="LMJF_29_1790"
                     /db_xref="GeneID:12981041"
     mRNA            complement(<804419..>807919)
                     /locus_tag="LMJF_29_1790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722213.1"
                     /db_xref="GeneID:12981041"
     CDS             complement(804419..807919)
                     /locus_tag="LMJF_29_1790"
                     /note="previous protein_id=AAZ09637.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722261.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981041"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="UniProtKB/TrEMBL:E9AE40"
                     /translation="MEVPATRPEVTTTGIYGEELNIVRQHLLRSELCWCGDLTSRTQV
                     LVVGSALCAASRKLSVARMRGLPCVSIEWATDGACAMEYTHRFDIGHGLTGKEVSTTS
                     LNHLERGRVQAVCGARRATYNSMLTRHCELLVASAAALSLTLSSSSHTTTSNDKVRFA
                     RKHGIPIIPMKEFVLRYATEQLSRHHLPPEDAVPGRAAHDASLLRAFSRGSSADSSNA
                     HTDVACELKHRTRCSSTGASAGSLSSLNGNRVPVCGSVRSATPALRSSIISHGCSITS
                     VRRPRDTDGTFRGCDSITLSAVQPSLSSSQLMPTASTAACASPPGLSRRPLADEFSDV
                     VAYCSPPHRLTTQQHDLLSGMGVTVSPQFTPFTTHVLVLGDRVEECLYPRPGLQVVSW
                     QWVTQCRLEQRRLSCVGFRVECVFHPVVTFTGLAPADRHALLSALQRSGLPGKVQEAL
                     VLGGSGDGRYGSASSLSLEPVSNPYLPCNTTHLVVPRGQLLSSQKVAVLAQHHYQHSS
                     CPRPHLSAPLTLASTCRLVGVDWVYRSIQQAQWLDAELFTLAIPTPEAFALAKTVRAN
                     AARTAVPHNSQTSQESLSVRLCISQPSSASATSTNFAMQTPVLRQPSPSHRRCPRLQD
                     AIEGGLEGGLGKPAVGGRVVEDGEEEEAASSQQHSTDVGRANDTASPPLPPHRARDDD
                     DEEAGGESPLAAAAVRSALQAIHSTSPHPSAAPSRSARSPSATGKQEGGAPYVRDDPA
                     VTLHHHADPPLSSYAYLTTQYTPGFENLLGELEATSSGALFGVSALHASLYPHLPACT
                     TANASAVSAPLGGDREGQVQRSGSCSATPPPTGADLCVEQRAFLRRTSAQPHVIHQQQ
                     QLLGRIMSDESQVIFYQMGLDDDGGIAAVRPAVLHGNPYAITEAVEDKRTVKAAMPSA
                     SCVAGAVTHVYPRSASTSAVFLITKDALKRDFDAFADAFPHVQRTSKPEECTHFITAK
                     PSKTEQFLCCLAAGRWILTPAYVTACAQAGYLVGEVPFEWSAEVAASLGCRSSVASLA
                     RGCRVQREASQLPFASWQVRVCCTSSARTASFLRVLRNGGCTSLEGATAAEVIAASKE
                     RGSVPPSSTELVLADDAVFSERELEDFASRPASIACPIMRLEYLVQFLCAPDTPRSEM
                     NLLHCARPRKRSRAEAAATE"
     gene            complement(<809665..>810057)
                     /locus_tag="LMJF_29_1800"
                     /db_xref="GeneID:12981042"
     mRNA            complement(<809665..>810057)
                     /locus_tag="LMJF_29_1800"
                     /product="putative 40S ribosomal protein S15A"
                     /transcript_id="XM_003722214.1"
                     /db_xref="GeneID:12981042"
     CDS             complement(809665..810057)
                     /locus_tag="LMJF_29_1800"
                     /note="previous protein_id=AAZ09638.1"
                     /codon_start=1
                     /product="putative 40S ribosomal protein S15A"
                     /protein_id="XP_003722262.1"
                     /db_xref="GeneID:12981042"
                     /db_xref="GOA:Q4QGW3"
                     /db_xref="InterPro:IPR000630"
                     /db_xref="UniProtKB/TrEMBL:Q4QGW3"
                     /translation="MTMMSVLANALRTIASAERRGKRQVLIRPSSKVVVKFLQVMQKH
                     GYIGEFEIIDDHRAGKIVVNLNGRLNKCGAICPRFDCATTDYEKWMKNILPSRQFGFV
                     VLTTSLGIMDHEEARSRNTGGKVLGFFY"
     gene            complement(<812546..>814387)
                     /locus_tag="LMJF_29_1810"
                     /db_xref="GeneID:12981043"
     mRNA            complement(<812546..>814387)
                     /locus_tag="LMJF_29_1810"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722215.1"
                     /db_xref="GeneID:12981043"
     CDS             complement(812546..814387)
                     /locus_tag="LMJF_29_1810"
                     /note="previous protein_id=AAZ09639.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722263.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981043"
                     /db_xref="UniProtKB/TrEMBL:E9AE42"
                     /translation="MLDTPAAFIGEFDALDGPKVTYAFEYFDFNRVAKSNSVVRQLLC
                     FIEGRTLLGKHVASGLLHYECKDYLNSVAAHVLTSNESREESLLYQESGCPCVGSFLF
                     SIPDIVARGEKRRFCLIFLHPSYHELVARWDYLSCFVEVLLRRWTQRATARYQQEYST
                     VANLEQLREESRRKPLRSLTELLSLAVTGSDSSSASTAAQEAVMEDMHCQFEVILPQA
                     LSEPIPLACHDKDAAQRDAERILEDRLPFAQSCIDRLNTDAPHLHGDILLPQFAKQLL
                     FVDAEIVVKPLPLWLLQFFADAASKNAPEAATHTLLHALFSGNQIIVTGEDARDCASL
                     AMALAYTLPPTVVKVHIGSETYRMPYESRLLTFSRRALSKYVFVPSPTADLEGSSPHI
                     IKLFDMEADGIVHVRVDNQRISFIQDCDQLRRAAQQRERQAVDSEITVEPTTLESRIL
                     TLLQPYTARAREQSSITVSALQLLTTHLHQLVSEYVVRGRVYGQLFSKQEVEANSTPL
                     APGASAPQGLLAKSPLTGQCLSSFGSGWRSPFRSSASLCSQRSASSCGAAGGGVSAAE
                     RQSAESSSITKSAHLSPVYGKQFQQQHYVFSSFAPEDHAILVFLGSA"
     gene            complement(<815096..>816517)
                     /locus_tag="LMJF_29_1820"
                     /db_xref="GeneID:12981044"
     mRNA            complement(<815096..>816517)
                     /locus_tag="LMJF_29_1820"
                     /product="putative Tob55"
                     /transcript_id="XM_003722216.1"
                     /db_xref="GeneID:12981044"
     CDS             complement(815096..816517)
                     /locus_tag="LMJF_29_1820"
                     /note="previous protein_id=AAZ09640.1"
                     /codon_start=1
                     /product="putative Tob55"
                     /protein_id="XP_003722264.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981044"
                     /db_xref="GOA:E9AE43"
                     /db_xref="InterPro:IPR000184"
                     /db_xref="UniProtKB/TrEMBL:E9AE43"
                     /translation="MTDTMQQTVNICEDDLSAALKMPIRAHVRLVGIEGTHPDVVASD
                     LETIKRCRTMEEAVEAITEIRSRWIAAGIFRNVKYNFEPTADGERNDICVRLDVVEEK
                     PKKSIGVFTTDTSIPEITVALENILGGRYSVKGNYIPPASRVHSISFSFLSNVPLIGQ
                     SAEYYIGRKTENKTYHLANSERVEEVKATTTNRKGKLASEFSVGLQRRTLLTKHMKSI
                     PLEDAVDFSATDKGYARHQLTITDVAHHANPFLYNMYPLPIYGSQVSLCNEFAGGPMG
                     GDFTFLKSEFQGSKYIPLGPFFSLQLSAKLAGIYPFFGSRIPLNDRLFLSNSHVRGFK
                     SVGPSTLDWEGNVSRFAATGGNALWATSLSLNFPFLFFPNNGIASMHLFANAGHVRMI
                     ESLDALKDSYRWLRDCACSVGAGIVITRIPIFGVAPSGRFELNMSIPLGIDKQGNIVC
                     RNGRKSLFDRFRFGLVWSSNFSF"
     gene            complement(<817063..>818589)
                     /gene="GCVL-1"
                     /locus_tag="LMJF_29_1830"
                     /db_xref="GeneID:12981045"
     mRNA            complement(<817063..>818589)
                     /gene="GCVL-1"
                     /locus_tag="LMJF_29_1830"
                     /product="putative dihydrolipoamide dehydrogenase"
                     /transcript_id="XM_003722217.1"
                     /db_xref="GeneID:12981045"
     CDS             complement(817063..818589)
                     /gene="GCVL-1"
                     /locus_tag="LMJF_29_1830"
                     /EC_number="1.8.1.4"
                     /note="previous protein_id=AAZ09641.1"
                     /codon_start=1
                     /product="putative dihydrolipoamide dehydrogenase"
                     /protein_id="XP_003722265.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981045"
                     /db_xref="GOA:E9AE44"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR004099"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR016156"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:E9AE44"
                     /translation="MKRTIVAWTRKFDVCVLGGGPAGIAAAVRAYELGKKACIIEESR
                     IGGADFWNGALQSKTLWEMAKFARYTMGNTSHRFMKSVIELPKIKHSNLIKAITNAAE
                     TRETQTLEVLANAHIEVLSGLGSFKTPNSVAVTKKDGTEETVEADYFVIATGAHPRPH
                     PTAVADGKVVFTSDDIMMQPLPKSIVIIGAGVIGCEFASIFANFGVTQVNIIEKSGRI
                     LPMEDEDIALFVQTLLEQKGVCFHHHSAMESSSINDGKFHYTLRDVRDNSLHQHVTDS
                     ALVSIGRVPAISKLNLEAIGITVKGNRIDRDEFLRIEPHKHIYACGDTCTRVALVNVA
                     ELEGRACIDHMYTPYPEEQLKLKLDNLSTIMFLDQEVAAVGLNEQQCQKMSISYKMAR
                     YSYEYVGRALAMGNTRGFIKLVVTNDKKMQVLGVRAVGPHASSIIELASLAIHNRDSA
                     YDLRNLHAVYPAITQGFQECLHMLLGSSILKPDVFPKLVVREWNPPHFQHGRAYAHTK
                     "
     gene            complement(819673..819754)
                     /locus_tag="LMJF_29_TRNALEU_01"
                     /db_xref="GeneID:12981157"
     tRNA            complement(819673..819754)
                     /locus_tag="LMJF_29_TRNALEU_01"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:12981157"
     gene            complement(819813..819893)
                     /locus_tag="LMJF_29_TRNASER_01"
                     /db_xref="GeneID:12981153"
     tRNA            complement(819813..819893)
                     /locus_tag="LMJF_29_TRNASER_01"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:12981153"
     gene            complement(<820590..>821588)
                     /locus_tag="LMJF_29_1840"
                     /db_xref="GeneID:12981154"
     mRNA            complement(<820590..>821588)
                     /locus_tag="LMJF_29_1840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722218.1"
                     /db_xref="GeneID:12981154"
     CDS             complement(820590..821588)
                     /locus_tag="LMJF_29_1840"
                     /note="previous protein_id=AAZ09642.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722266.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981154"
                     /db_xref="UniProtKB/TrEMBL:E9AE45"
                     /translation="MMEYADAYVGGGGRLRPGAQGSTTATGASRPYLEQRTVAPVTSA
                     LGQELDRLVGGTLAAQEYRDRLEALTRSVQASDEKVLNLTRLVKLSQSIQEEKEADLR
                     RQNDELRARLKRQEQLTAQLQRQLEGMQGAVDAQALHHVVERLEGQMSACRGKQEEQW
                     VAVQQRIGELEDRLQRASTCTAERCEERLMQLDERLQQVTQSTADATNQWAKRNFVRF
                     KEQVDSLRADLDDVRGGQKELKSTVQSASCRAEIEYKKVLLLLQQKTKEADALTSLVE
                     KELQHLQKVAHRHQILASKDITPAFEFDEKPYDALKFAAGEGKRRGAEAAAERRRR"
     gene            complement(<822519..>823352)
                     /locus_tag="LMJF_29_1850"
                     /db_xref="GeneID:12981046"
     mRNA            complement(<822519..>823352)
                     /locus_tag="LMJF_29_1850"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722219.1"
                     /db_xref="GeneID:12981046"
     CDS             complement(822519..823352)
                     /locus_tag="LMJF_29_1850"
                     /note="previous protein_id=AAZ09643.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722267.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981046"
                     /db_xref="InterPro:IPR012981"
                     /db_xref="InterPro:IPR026697"
                     /db_xref="UniProtKB/TrEMBL:E9AE46"
                     /translation="MTLNASDLENLASMLDSNRAFQRPEGQVTGFSLEEHASPTGCAG
                     CASSSAVVASANDPGGASLQPQGNPAGIALPPTAVDHQLRLPQPSHGKEAERKKQLAQ
                     PARPSGDEIWTQAELATLFMRQRRDGPAAAARAAAQQASLQSADGQSRAATFWRPSPS
                     DAGTFEEPVHTVLYQQNVSAEDVYLGVDFTRDASSAASDGVTVRVELPRVTSVSEIAM
                     EVDAYELRVSVTGVYYLAAPLPRRVQKTAADAAWDAQKKVLTVRLKADRSSDSDVKIV
                     A"
     gene            complement(<823869..>825539)
                     /locus_tag="LMJF_29_1860"
                     /db_xref="GeneID:12981047"
     mRNA            complement(<823869..>825539)
                     /locus_tag="LMJF_29_1860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722220.1"
                     /db_xref="GeneID:12981047"
     CDS             complement(823869..825539)
                     /locus_tag="LMJF_29_1860"
                     /note="previous protein_id=AAZ09644.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722268.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981047"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:E9AE47"
                     /translation="MGLVSSKHAGGGDGKPLSLDVISSRPKLEPHEVSLLQLTPHGVY
                     ATLAAHVYCAAAPETAMQVPLPDGWEVLLQCSSLHLDKEGYFAVAYVHRGSRHCIISE
                     RGTSEVLGLRAGIWMYFEQPTIQFFLAEQFSKAVRHKLKVMDKVCSGSWFVSYTGHSL
                     GAVIAGCRAVMEGTLAVTFESPGARVFIEKTLDASSGTDEHLITYLRAPNPINTLKPQ
                     CGYVIMIPTQQVVLPSGTLFLAPSNPAAAEDDDEDERQSPRSGSGNRASRKPSKVPLS
                     STSSTNPSGCAGLVAASVTTAASTGTTAAATLAARSPTPPSVPASNSNNSGPGAAVAS
                     APARWRIPSFRPQEYLRGYLFGGVGMGVPELQQYVGKVEPMIREMLEHTQQVHSIHSL
                     RSHFQKSDEPGDEEVVLRWPSHLLQFMEFYNTTRALEDPENQDAGVKEAYLGLMRRLY
                     YTEPRRRDCIPTKYLDPRSLLLVRMWWSMDAAQRKQWPLSLMDHKALNVIQIKDRYLC
                     SYVMTAMQAKQYLMRLVARPEMRAMIDQWRRERNDGSTGAGSPQRSKL"
     gene            complement(<827826..>828152)
                     /locus_tag="LMJF_29_1870"
                     /db_xref="GeneID:12981048"
     mRNA            complement(<827826..>828152)
                     /locus_tag="LMJF_29_1870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722221.1"
                     /db_xref="GeneID:12981048"
     CDS             complement(827826..828152)
                     /locus_tag="LMJF_29_1870"
                     /note="previous protein_id=AAZ09645.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722269.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981048"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR026939"
                     /db_xref="UniProtKB/TrEMBL:E9AE48"
                     /translation="MGGKAKPTKHTAGETARKNHLATTNMGGGSAGLADRKGGVAGHS
                     KFICKVCMAQAPDLKSMRIHFESRHPNETFNEDDFEDLHEKYGGTTRGVAVHGSLKKD
                     KNKRNE"
     gene            complement(<829565..>832504)
                     /locus_tag="LMJF_29_1880"
                     /db_xref="GeneID:12981049"
     mRNA            complement(<829565..>832504)
                     /locus_tag="LMJF_29_1880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722222.1"
                     /db_xref="GeneID:12981049"
     CDS             complement(829565..832504)
                     /locus_tag="LMJF_29_1880"
                     /note="previous protein_id=AAZ09646.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722270.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981049"
                     /db_xref="UniProtKB/TrEMBL:E9AE49"
                     /translation="MTQATHISDSSPSATAPQPAWTVEQVYAILRKHESLCNRILLLS
                     SAPLSMGLVASPRPAAVETAVESLDTVSHSPHHVSTRRGPRANAAAVRDIRVLLDRLS
                     QAPQRLGALHEKQRRRLVTKVCCLGYAVGLYSRCCALYADTVLLARGVSDGGRNREPG
                     ALPESSPSHEHALRSSEALLPTVAVGAPSSVPDFIIDAAGKAADLTTLRLCCPHDAHA
                     SPTEASAAASPISVTALHVYAQCVGVLLRHGWGGCLASTATDMGVRTAVADGGVSHES
                     RDADEGIPADPVIISSTAVTRNATTAAAAVASLTTRTPSTIAPAEASGEQAWRDFALT
                     VLRHLRIDDADAADFLHTSLRRASYRYVDTGGDWAAAQSSVYAQIFRYWLAEEEAAAN
                     TLLAPQGLPQHDSEVDGAADGERRHISVRTTSSEKLRVSAPVLLTVPALLTLLRTAVV
                     AHQHDIAEWATLCVDACLEEWTRASKVAAAGASKGRQHDGFDTAAHRIAAPLPPMDNP
                     SAQSLPQLDILLAWYLRHLQQSSQRPRAVRWLSRLRRRQPTVPILSSALATLSVAREA
                     ARLAGDELNAELAMWCLQLCLGDTTPALSPGHADIFQCLCAYARCGLPNFDMVLQSLR
                     MNQLLAPTPEEALFLRLLHARRSVNWRTEWEHCVAPYIVEEEEGDELKKPDGEGVDVK
                     VNGETQGGVRATRRPPSRRVTLRMVEPAESREGTPSTSPMCTGVDESLEESGGGRVPS
                     SESRVSSTRRHTALSSVFSSRVIYQLLLILQEGEHPAFMSYYRTLLLTFSEHVTPQDR
                     ARWVVLALMWAIQLHGSARSEDVVYIAREVEQLTELQRTHTHAATASSLPLSPEVWHS
                     LSRKWTTLYQQYPLSLWHRAAAAGADSGSDTRHGSPLRQLQCTPSSGILATTPALTRF
                     AKRRHLLPSAVVSATELLRTSRRVSAEVTVAGRYSSGDAAVAHWPPQEDVKFELWANY
                     VEAVRRF"
     gene            complement(<834661..>835848)
                     /locus_tag="LMJF_29_1890"
                     /db_xref="GeneID:12981050"
     mRNA            complement(<834661..>835848)
                     /locus_tag="LMJF_29_1890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722223.1"
                     /db_xref="GeneID:12981050"
     CDS             complement(834661..835848)
                     /locus_tag="LMJF_29_1890"
                     /note="previous protein_id=AAZ09647.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722271.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981050"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:E9AE50"
                     /translation="MLARGCVLRWHAVSARRVLGLHDGQSYTPADIKKAFRERALTAH
                     PDAGGDADGFRQLQRAYEVLLHEHSVGKKGSEAAAASDDSEGGSGFYAHPHAEWCNDM
                     RSQRAYWRDMYTEMNMNPNSCGSHRHASNTHYQARQHYRTYGEGLGEDFQKEFKSSSF
                     AGGGQRGSQMNFSTWYFYRPYYSNYRNPFGTGFTPEEIRRAEQEQRRGFARAVARHAC
                     LWSGLAFVVYLHERNNRVWRAVEARDKGYKDPEYWEQLRKDEEEARRRSRAPLRLEQH
                     WLDAPLMRSLMDLTEGGHSGGCGKNGQDAEDNISGAARAGTAWATQQARMAQERRRQA
                     MSSTRGMRRGASGDVGGPRVVSYQGRPFTPNGVRGMRNTAPKTPKTYADDVTYEMDDD
                     DDV"
     gene            complement(<836546..>837889)
                     /locus_tag="LMJF_29_1900"
                     /db_xref="GeneID:12981051"
     mRNA            complement(<836546..>837889)
                     /locus_tag="LMJF_29_1900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722224.1"
                     /db_xref="GeneID:12981051"
     CDS             complement(836546..837889)
                     /locus_tag="LMJF_29_1900"
                     /note="previous protein_id=AAZ09648.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722272.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981051"
                     /db_xref="GOA:E9AE51"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:E9AE51"
                     /translation="MDLDTQRKEEWCISLQFFLASRLRTPSYAVASRQHPFIRVPPMI
                     PRTQFLLDGIVWAVNDHPSWVESAWLTIQNHIKDTATRLAEVSDELARATAAAASAAS
                     SSSTITNAISSMIAPRGSALDRGRTYQAHAAVQDVYLAFCVMDALVKGVRADVAGKLH
                     EVVGKELPQLVAYYVPVFAPATSYWVANAVDEYRHLFHALLDSWIMQSTFNSDVHRRL
                     QEYLQHRLQHTREAEEDEQKQLQQDAAGSSTAKANGSRSGVNGADVWGTSVQRIIDSA
                     AGVSAEVMATTPTTNLAGSGVRGKGGQPAAVASAKNAALRSFERGVRTPDTVERTLRS
                     FLNSIFPPRNTPAARHRCPHCGAPFRDDKSKNAHYRCHFYARNFLKPEEKLVRLMYPS
                     AADFAEHTGDLKCEGHFTRTVEVLEEAYKGGNRGAVKIRRLEAPPADSNDALSLA"
     gene            complement(<838562..>839941)
                     /locus_tag="LMJF_29_1910"
                     /db_xref="GeneID:12981052"
     mRNA            complement(<838562..>839941)
                     /locus_tag="LMJF_29_1910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722225.1"
                     /db_xref="GeneID:12981052"
     CDS             complement(838562..839941)
                     /locus_tag="LMJF_29_1910"
                     /note="previous protein_id=AAZ09649.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722273.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981052"
                     /db_xref="UniProtKB/TrEMBL:E9AE52"
                     /translation="MSPVAAQQFKSNALFRVLAFLDNTGAQAFALDAEVDEAGSFRNP
                     ESVFAADAAITGVLTAALDALRANVRRLFTDAAEQHALLAVLGTDAPEPSKKASLWIT
                     ATPAPLPLEEGGAAPAGLSSDEALQQQESSSIPLSSAPVSTAWSEAVLHPTSLLNYAD
                     DVENEIPIHLLVRLREVLGIPTAPLCCCSCSPFVEQFLIDGLDEWLRRCRVDEVKRMI
                     LACGVQPTVLNATFMRQQQATDAQYAALPDALADFVVDVVFPVPAQAGEASANASSAA
                     AAEALQDWLILSFEMNHEAVDIDEENASTNGQNGSRDNSSTNSQGERKRTRTDDTCPS
                     AVDHDARGSWEPTEGEEVLTAENIDRYMLECPQRIPKQILREKRKHISDASITKFELD
                     HHYTAAELKKLVKKGLGAMTASEATDFMKCPVTEAQVQQAARMTRKAQFVAWILSVHK
                     AAVYQQSRE"
     gene            complement(<840703..>841530)
                     /locus_tag="LMJF_29_1920"
                     /db_xref="GeneID:12981053"
     mRNA            complement(<840703..>841530)
                     /locus_tag="LMJF_29_1920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722226.1"
                     /db_xref="GeneID:12981053"
     CDS             complement(840703..841530)
                     /locus_tag="LMJF_29_1920"
                     /note="previous protein_id=AAZ09650.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722274.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981053"
                     /db_xref="UniProtKB/TrEMBL:E9AE53"
                     /translation="MSSTAVAKALPDIQPVHICVQDVRVHEVQMPHQTHFTVETAGTW
                     RCEEASISVMRSVARHRPEEQATQQRTPLGAHKAGTVHIVAEGQVPSPAAHDTSATSS
                     SISPSAGTAVFPVPLYAARVSYQRPNRYKEHRSLCIVEGPQNPTVLSRPQFHGGAHRH
                     SRSRGLECSGDKPTRVLFIDVASLTPDARASLRCTSTGEISIPTALYFRCASASSSSP
                     TSASTKDNGKLQVRHGPGHSAWDGSQQRRRRVILLPPTAAGKTFELVCISVKRGRDE"
     gene            complement(<842312..>844126)
                     /locus_tag="LMJF_29_1930"
                     /db_xref="GeneID:12981054"
     mRNA            complement(<842312..>844126)
                     /locus_tag="LMJF_29_1930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722227.1"
                     /db_xref="GeneID:12981054"
     CDS             complement(842312..844126)
                     /locus_tag="LMJF_29_1930"
                     /note="previous protein_id=AAZ09651.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722275.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981054"
                     /db_xref="GOA:E9AE54"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:E9AE54"
                     /translation="MSLASPSSLPPIALATQRLRTFAAQEEQAHGLTTSTALEEWATQ
                     SFEAETERINRELVQRRSQASVTFLPALYMRGRDPAADETTRLLHSTCKAFELDLRFK
                     EIEKLDEMHAHLWTLLSAGDRTSISMEAYEQLLHDFNEWAAEHYGAQLLPPPSTVWDV
                     SEDEDECILCRREVKEDDHEKSGGGNSSPSMSPLRPPVSLARPLSASTPPVLAATKAA
                     PNDAPFTSGTRGASWDAVLQHVKRYRDQQRSDTSASASSFMRSHAHFEHLLRLAEDQP
                     ALGNVLYLCSVPPPRPDVQLFLSCPRNAERAVEIAAIYQTFAKQVSLVKCEAELIMWD
                     SNNDGRLSEDEVENYVRDLAPRIAALQAMSKDMLPFYCCTVSRRLFWDLDPGNRGVLR
                     IHSLLHSGIMDEWVSLQLMTEDDTQNWFGALVTQQLYNKFVLLDTRNTGTLNVENLRG
                     YKKGLPTVLDDGLPPDVSPLCSLFIDRYFETNTLMTRSEMDYRKFVDFVIAVELLPQC
                     SRPYFFWNILDMEGTGVLTPMIVNQFFRETHAKLVAAGLDVPSRETVVQEVFDLIEKA
                     ESLLITRDEFVRSPQAGLFVALLIDCLSFWTYENREQR"
     gene            complement(<844939..>845493)
                     /locus_tag="LMJF_29_1940"
                     /db_xref="GeneID:12981055"
     mRNA            complement(<844939..>845493)
                     /locus_tag="LMJF_29_1940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722228.1"
                     /db_xref="GeneID:12981055"
     CDS             complement(844939..845493)
                     /locus_tag="LMJF_29_1940"
                     /note="previous protein_id=AAZ09652.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722276.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981055"
                     /db_xref="UniProtKB/TrEMBL:E9AE55"
                     /translation="MSLHGHRGRSYTSPGYTVYTNGAPDPRSPGLLPGSAAPFHHIPL
                     EDTSHGGGSCASTHTDDSGEPRDREGLTEVDLNSPQMPSPQQYANYGEYLDAYDQYLK
                     DTTQFLASARAFLQKQLRHFRHAHAGLAEAVRREYFWTFIPFICALCVHVVDSQHHVN
                     ARITRERLKQRAKEHVKNVKWVSV"
     gene            complement(<849986..>852268)
                     /locus_tag="LMJF_29_1950"
                     /db_xref="GeneID:12981056"
     mRNA            complement(<849986..>852268)
                     /locus_tag="LMJF_29_1950"
                     /product="putative protein farnesyltransferase alpha
                     subunit"
                     /transcript_id="XM_003722229.1"
                     /db_xref="GeneID:12981056"
     CDS             complement(849986..852268)
                     /locus_tag="LMJF_29_1950"
                     /EC_number="2.5.1.58"
                     /note="previous protein_id=AAZ09653.1"
                     /codon_start=1
                     /product="putative protein farnesyltransferase alpha
                     subunit"
                     /protein_id="XP_003722277.1"
                     /db_xref="GeneID:12981056"
                     /db_xref="GOA:E9AE56"
                     /db_xref="InterPro:IPR002088"
                     /db_xref="UniProtKB/TrEMBL:E9AE56"
                     /translation="MGTAGAMQRSSSTSTPSSVSSWTAASSACSQNSEDGEWLYELAC
                     VETFMPLAADVTPADESPGASPEHPVAKINYPPNFSCIYGVYRSLRGQLEYTPALPAR
                     GERCGGGELPPVIHAIRTSAARWFLLLAFALRQCTSNYTVWKDRRDVLMSPAVLEQAT
                     RDALPELPVPAAILSCTASEADKQEALRELDEKQTKLRLTSQHWLPARADIAWEGRLS
                     PWRAVRWELTAVGCFTRLYHKNFQVWHHRKELLTYALQQSPSHVRCGVDAAATDEKLE
                     QQVEDSSPFVPLLASEATFSDYLRRHDGLDFAAVDERPTLRAVLCNEDGKNYHAWLHL
                     SWYLHVFSFLLTPPSRKALDEHATVATAAAADQGLRFTPQPDWITTRENAAVAALRPT
                     LPPSPLTEEMQFTAQLIYQDCRNNSAWCHRFALFREALLRPLWQQLCSEACTSSVGAP
                     TNSENWPGTLRGICAVELNYSLQWLYVDPTNEAAYTHARSVALLFHTLITRRHVWAAE
                     HASTDGSEELQRYLTNAPLLPPVALANSEMCADADAGTVSPSTPLARLLRGRHRCVPW
                     VTYVESFALLRHMQRVLHTVIRLRVTELEAQAARVLRLAAASNTRSTSGQAPKSEAIA
                     ELKTLYERSSQYMLDSFHQVDTAQYLACHAILEEMWLSYMDAAQRRRVQQLRPSEAYR
                     EGLQPEWLKPCPWDEPKTSTMDAGKQEDGQDAVVLDFLAYEAAALSKAKQLTVADPIR
                     LKYWKNEVLNVIYRGYGMSV"
     gene            complement(<854881..>856587)
                     /locus_tag="LMJF_29_1960"
                     /db_xref="GeneID:12981057"
     mRNA            complement(<854881..>856587)
                     /locus_tag="LMJF_29_1960"
                     /product="putative fumarate hydratase"
                     /transcript_id="XM_003722230.1"
                     /db_xref="GeneID:12981057"
     CDS             complement(854881..856587)
                     /locus_tag="LMJF_29_1960"
                     /EC_number="4.2.1.2"
                     /note="previous protein_id=AAZ09654.1"
                     /codon_start=1
                     /product="putative fumarate hydratase"
                     /protein_id="XP_003722278.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981057"
                     /db_xref="GOA:E9AE57"
                     /db_xref="InterPro:IPR004646"
                     /db_xref="InterPro:IPR004647"
                     /db_xref="InterPro:IPR011167"
                     /db_xref="UniProtKB/TrEMBL:E9AE57"
                     /translation="MSLCDQCEIGCRRVGIKDIEDASAVNADFHFSAIFQPTDPHHHQ
                     TEFAKVEGSEKYVEEVEVFGRQALKVNPEALTILAHRAFSDVHHFFRKDHLEGWRRAI
                     EDPEASDNDRYVATTLLKNACIAAGRVLPSCQDTGTAIVLGKRGELCWTGGEDEKYLS
                     KGIWNAYRYHNLRYSQTAALDMFKECNTGDNLPAQLDLLAVPGSDYEFLFIAKGGGSA
                     NKAYLYQETKALLNPKSLRAFIEEKLKTLGTAACPPYHIALVIGGTSAEMTMKTVKLA
                     SCRYYDSLPTTGDKYGRAFRDPEWEKIVMEVAQKSGIGAQFGGKYFAHQARVIRLPRH
                     GASCPVGLAVSCSADRQILAHINKSGIYIEQLEQNPAQYLPDIPEVHLSTTSVKVDLK
                     RPIDKVRQQLSQYPVGTRVMLNGTLIVARDIAHAKIKEMMDNGEPLPEYMKTSPIYYA
                     GPAKTPEGYASGSFGPTTAGRMDSYVDLFQSHGGSYITLAKGNRSKQVTDACKKHGGF
                     YLGSIGGPAAILAKDSIKQVTCLAFPELGMEAVWKIEVEDFPAFIVVDDKGNDMYSKT
                     LA"
     gene            complement(<857852..>858280)
                     /locus_tag="LMJF_29_1970"
                     /db_xref="GeneID:12981058"
     mRNA            complement(<857852..>858280)
                     /locus_tag="LMJF_29_1970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722231.1"
                     /db_xref="GeneID:12981058"
     CDS             complement(857852..858280)
                     /locus_tag="LMJF_29_1970"
                     /note="previous protein_id=AAZ09655.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722279.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981058"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="UniProtKB/TrEMBL:E9AE58"
                     /translation="MSLLSDRAVVEHQLQRQGGEVLANPTRIRSLLIAKNVSKTKLAH
                     WVPLRESKPVYVSAKYVSAGVAHPQWLVDGVEAVAVLLWAPRHMRYGSRSCKAKLTQL
                     LDTDEDARHDPLHGDEPTLLPLHCRACPPEGGTRACTFRC"
     gene            complement(<860412..>866228)
                     /locus_tag="LMJF_29_1980"
                     /db_xref="GeneID:12981059"
     mRNA            complement(<860412..>866228)
                     /locus_tag="LMJF_29_1980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722232.1"
                     /db_xref="GeneID:12981059"
     CDS             complement(860412..866228)
                     /locus_tag="LMJF_29_1980"
                     /note="previous protein_id=AAZ09656.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722280.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981059"
                     /db_xref="UniProtKB/TrEMBL:E9AE59"
                     /translation="MHASPRSAQRGRSPTGVVAATEGATQLHTARLLGRSNKLLHASR
                     AFSAWAAAIRQRRLQMHLKRCSTMLKHNSLRQEYTRCFMRWLAFTQMRTSENVRSAMC
                     LRQDVPLRSKADFLALARRYFAKWRAHVRERKQRTVTNVELLEALNKERLRNRTLLRW
                     WRFHNMQTRKHRAADITELADANLKLQQELQKAVRETKGLRDQLHAALQQQSGLQNDL
                     EVSRGDIGASEQQRQREVNELREAMQQAVKLLEGPSSLRLRSLHKYSIVAANPCIPSD
                     ASKPPPPQPPSSETLLKSARQSKDTAEALLQAVGDTLVSLSLIAKMPTPPASFEECAA
                     HLHERLSEEMEATTIKAQRDELASAAQTARATLAAVSSLLQVVSPADSDWESSRGPSL
                     TTSRVGDGPSKPDPQSAFRSMGGGRRSGAAVVTFARSSSEAPVVRKATSPSTRPPASP
                     ADATFDYQKLPRLLVEDAKAAVGAIQAMRQDGERSADEVANLQGAALRALDAFGGRGA
                     TSTNFMAKPQESVKERASRSANIADSLRTLCENVDAVLVQTSLWSGKGASEKVSVALE
                     RLWHRTQDLEATRADDLQHIAQYAAVVHTSVAILRPPPATPPSTMSQRTAALLARRQH
                     RAPPDDAVATPEQVEVARCSAGQLATKGDRKPTELIELCLQAQQRAAAAPSSVPTNEF
                     DGLAKSAREIIEVAIGKSRCGENGVFFSAAHRSRPDTSTVAPETSNLEVGGAEASRSG
                     SIHPSTAEAVARALTAAAAVAAETLRGSERVVDNSLVDAIVRARAQVRQLQEQLKALA
                     VSELQNEEAKKRLQAELKETATRAKASERALKKHLDDLGKGRSVAEKDLQRQLRELQR
                     EAAQSAHDCRHLEKERKELEEDNKAKEVALQSQAEATRMLREEVESLRRQLAAATSEN
                     SLSDERREVLRRHLDDLQRQRAGYDAAVAELEAQLRSVHDAIETAAVAHHELTRQLSA
                     VEEANRRNNAISVFLRDVLRDCLTRLNHLTRNVGTAAARERSPQMSLTLQQVPDRPPP
                     TLTRGSEPSEYVEYLLQLDGNDAMGKLLVRQHLRENMAVQRLRELSVDGGAAGAPRAV
                     SAATSVGHSVRFDGADPSTWEVVAELHDRLVLLYDLIARVDNSAVEQRARIDKLTVVK
                     NQLTADVLEALVELKPWSSAAAAAAPEEHHLPPSSSEDGAEALPVDRALRASCAEVAQ
                     ALEEMEKVAALTRPLMEMRSSGSPLRRANVQGPLDMPSTDAAATKRLLSLVADVQDMA
                     DCLRHLSESVIHGIVALGGTPDEGEMHMSNSMERRDSSRLPMDAAATGNTAVKRHTQA
                     GRVDSRVLATRLEAICKETGTSAQELKQLLGVGDGASDASCESSIKGVGKPLKLSDVL
                     PLIRAKMQELQEVKQESERILIGLNHTFSDDDSLSTTSSTQRSLKRKQKPLPALQCTP
                     EKGLRLMQQEMKGRKKKTSRRPGDSASVLQETMATVRERIGDLQNLRFTCCGILQVLE
                     GRLVKGNEAEKPPKYGEALMALLTTQIVDLKQVLPETEEALKGYRSTLLNVTVGTRLH
                     MLCGVVRSLKLERDSLKEDLARRSLQSNMLLSNFREEAKVLRAMIARREEEQVRLASE
                     MASASGEADAQKRNVAQLTAKLASLEHERNVLCDALVHTLRSLPGTPYRRVPLAAMQR
                     NLLAALKEQGELLTAYVEAALQRANAHQQHLQDILHGSLGELRCDMAALRAQVTNSWD
                     LYGRHMASGAVQQLVETTEVLTLENSMLRPRAIEREQLKLEKAELEAALVDAKAARVD
                     VLARLEHAEDENTQLRRAVRDAQIAQALTNRDDNDQVDDRGNRSGGKVLSTHSVDWER
                     RMINGATELTMDMIHSMSGTSMSSVFGSVVEETLRIYAGVRHGLQVMMAACEAARGKD
                     ERHVRIAVEEQLQELRELAESADYLRSRLPVLFRVPYQ"
     gene            complement(<867872..>869482)
                     /locus_tag="LMJF_29_1990"
                     /db_xref="GeneID:12981060"
     mRNA            complement(<867872..>869482)
                     /locus_tag="LMJF_29_1990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722233.1"
                     /db_xref="GeneID:12981060"
     CDS             complement(867872..869482)
                     /locus_tag="LMJF_29_1990"
                     /note="previous protein_id=AAZ09657.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722281.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981060"
                     /db_xref="UniProtKB/TrEMBL:E9AE60"
                     /translation="MSEANFETPPSYTNWGLVLDGDVQQDTVSRGGYCTAQQLRFRRT
                     PRLSDRAGSATSTAAAVAIRQANSSNSGHPYPGSVAVLDDWERSAVDLYREIRRHRSE
                     RPQQARNGAKLRDSTQAGRPLHTSEGSSPSPYAALMGTAFPQLLGGPFAPPVPAPADL
                     AGDSTAGTPQLTSSSPLLLQYFLSIGYPLRLPYNTESAAASHSVALVAVAQETVAWFE
                     DSGVAVENTAPSRIAAPLHRFSVRLLPDVVQQMVSAHRMMPATAAAWLLRVYVGLLTP
                     WEAKEYSIQAEIMADHGCENGTLDPGMPPAFCMEGVWRWANAMCTAVYHLQTSTHPES
                     ETSLHESEKRSSDAVSSSGSDKTAPLQRMQSLASERRTEDVGWRLFALTVLQKTTTLI
                     LRGCFTTSTGDATNASQDSTSAEIKEERDARGGLKQDAVGAQSWSPQASETVMPPVPT
                     TRVVVEGLVCFALLVRLHERFPKRGEMRHDAGGVHARTAATHVADAAQLMVEKHWEGH
                     AQLAVQQLPHLPPHYHHLVHMMDFVLTN"
     gene            complement(<870049..>871164)
                     /locus_tag="LMJF_29_1995"
                     /db_xref="GeneID:12981061"
     mRNA            complement(<870049..>871164)
                     /locus_tag="LMJF_29_1995"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722234.1"
                     /db_xref="GeneID:12981061"
     CDS             complement(870049..871164)
                     /locus_tag="LMJF_29_1995"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722282.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.1995"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.1995"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981061"
                     /db_xref="UniProtKB/TrEMBL:E9AE61"
                     /translation="MPVSRIAGRCVAVQRRFMGLSALSPSNSNSTLAHTARFTGTAEA
                     DRDQASSILPNDVCADTSFEGCRGRDSSGGNGRGNRCNGIPKRGEETATGLERPQGCS
                     KVHVFSRPAQQLNAAQLAHFTHLRRLLRRLSSLRQASSNAVEAASRAAAAHHLLSREG
                     ESGSQSPQTRTSTAPVDSPHSELFVVSRVVASPHHHVPSAERGAAACGDEVFTGVNHA
                     FHKRVNPTGATLRGILKGCAEQNALGAAAASGCIYADVADVFLLAARCSPMTSYHALE
                     SGQKTATPASATCSSCATACSDAGPAAAQAVAIFPCPECWRHLCHVARARLQEERTPL
                     RLFVYAASPAVTVHLFAVAQQRIKLMEAPVDVCIVSG"
     gene            complement(<871553..>873685)
                     /locus_tag="LMJF_29_2000"
                     /db_xref="GeneID:12981062"
     mRNA            complement(<871553..>873685)
                     /locus_tag="LMJF_29_2000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722235.1"
                     /db_xref="GeneID:12981062"
     CDS             complement(871553..873685)
                     /locus_tag="LMJF_29_2000"
                     /note="previous protein_id=AAZ09746.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722283.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981062"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9AE62"
                     /translation="MAGGATGAAHSNYPHTFSAELIRHCEDGCIPPEVFADARTLLDD
                     EHRRRYVRINPRSEERVLDAGAEAILRLDAHSTAARMGTSTLLSPEEQRMGATLHASM
                     RAGPTKAPPTATDEAVASQRRNRNARDDAPRAGVLRLGLAALTGLPLKSVEPVAWLPC
                     GVFALPWSYAMGGNPLFLDGTLLAMDAASIAAVVALHPRKGDRVLDLCCAPGMKLGLL
                     ADAVTRGHAGAAGVPLSVASPSLDDGLVVGVDVNLSRLYMTRSTLKKQQQQQQQQLGG
                     TADTQSSLPVCLFAGDGCHFSMESAAAALDLTGSAVDAGTGLTKVERRRLQRQHNATT
                     TTVGSKRGRLASGAAACVVSHETDSSPPPTVVYAPAHMRAIVAAWLHEKACDSQAADA
                     LTTSPSQPQPQPLLFDRVLVDAECSHDGSVAHMQLGAPHANTADTVHNSAPGACSASS
                     AVSTIRKGRGVGNEYRMHHMNLGIAEGEVRSQTEKAPSASSQPLASSHAGGGEHSKQD
                     ALSPSAASIFALQSKLLDNGYRQLRPGGTLVYATCSYSYVQNEYVVHRFLERANAVNE
                     KVDQGDVRGRPTANEVPRRPTAVLVPAFSYAHEAGGKSVPGVASDDAVAACVQMDSEE
                     QRRDVQRLLDAHVFDYGTVQRGQDRYAYVEGANHGAPSADERATLGSRFWPRLFRSSF
                     LYVAKIWKRPPDVTVSVEGGSRGVVSEE"
     gene            complement(<874317..>876413)
                     /locus_tag="LMJF_29_2010"
                     /db_xref="GeneID:12981063"
     mRNA            complement(<874317..>876413)
                     /locus_tag="LMJF_29_2010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722236.1"
                     /db_xref="GeneID:12981063"
     CDS             complement(874317..876413)
                     /locus_tag="LMJF_29_2010"
                     /note="previous protein_id=AAZ09658.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722284.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981063"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:E9AE63"
                     /translation="MRRTLALYKQGRSREPNVGRLLYGKRKNLVHHASEAKPSVTAVL
                     AQTPTERLPVAVKHALQVKELHREQIATLLKQHRALRRFDRTEVIVQALRDAKQPLTS
                     QHYCVLMAHANDERQTRRALQFWKDAVSEGKVNERLHGALMSTYRNAGNWRAAMRHCE
                     RMWRDQQVLDPLAAHAVMNACRRYGPWQMGLKVFSDAVQHGTKPNGVVYLELLRLIAQ
                     SKMPARWMYGLAILRALEASVEVTAGHYNAVLATMGGRNWEKGIELFHSMQVHNVQPS
                     TETLNTVQQLHPHSVSHCIRCVAEAHALGMPITDTMYRNVLLNLFRMQLNNEATQFAE
                     REYKLDCVDAGNPLTHTLSLSVAMVDALLSHPRPHDALLVYESFQDKIGDVVAAATRQ
                     LGTSGSLEQRWLVQGRVAVVDHNVLLSTTFESLIHHYDSVFVPFASVRLLVRRARENG
                     HSVQGLHMKTTLRRIGLLLKREEWRMLRVLPYAHQLLAHTYLSEGGPASPEALKALRE
                     EAETQSLLPESPQTPTAVAKAVSAYGQALLRRLTPVGEAAEVAGAVRADQSGERGTED
                     AAKNLVIREAAGGAADTGASSLVSSKAWPAATAPFPMVLHSPRRITSVERVTAVAAML
                     KSLNPDAEVHVLSTNASQLAAVRHWNAVRVGVLLVPVHYPDQLRQMAPPALPISEGAV
                     AAAMAAPGFRGPKPRL"
     gene            complement(<878623..>881067)
                     /locus_tag="LMJF_29_2020"
                     /db_xref="GeneID:12981064"
     mRNA            complement(<878623..>881067)
                     /locus_tag="LMJF_29_2020"
                     /product="putative serine/threonine protein kinase"
                     /transcript_id="XM_003722237.1"
                     /db_xref="GeneID:12981064"
     CDS             complement(878623..881067)
                     /locus_tag="LMJF_29_2020"
                     /EC_number="2.7.11.1"
                     /note="previous protein_id=AAZ09659.1"
                     /codon_start=1
                     /product="putative serine/threonine protein kinase"
                     /protein_id="XP_003722285.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981064"
                     /db_xref="GOA:E9AE64"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR028375"
                     /db_xref="UniProtKB/TrEMBL:E9AE64"
                     /translation="MAQAAYPPSREGSYPHSRSGGPPANPMLPEQMIGSYVIRETIGR
                     GSFGKVKKGRHVHTGEYVAIKILNRQKLKSANMDKKIHREIEILQLFSHPNICRLYEV
                     ISTPTDMYLIMEYVEGGELYDYIVQKGRVRESEARYIFQQIVCAIEYCHHFRVVHRDL
                     KPENILLGTGLQVKLIDFGLSNITKDGEFLATSCGSPNYAAPEVISGKLYFGPEVDVW
                     SCGVILYALLCGCLPFDEDSIPLLFSKIKKGKYAIPSNMQAGPRELIQQILVVDPLVR
                     LTIPQIRDNAWFNQRLPMRLSYSESIFSVKEDRILSVLVSETAKRLGVRDRDVRKELE
                     LGYGAAFVAYNILLDARRRREIAAEVRELGMSGDESRGVNHVIGAQQTKFQPKATERE
                     LNMGLMLTQSPAMVVLLDEEDATRNKWAYNRGCFVPASVATLGDPTKVSDTSLSDGSG
                     NGGPGGSIAVGSFRITSKMCSGSLVGSASVGSSSYAPGSLRGAAGLTGGSSSYRRAGM
                     QCSTGGTAASQLGANLSDQPRVGSVARKHAMYTAEEEQFIVENNYGWRIGIMTDWRAE
                     QALSAIYDVLRTFKMQWKVVSPFRLLARSTAETWSVVADSTQSRNASTRRNTLSTYSV
                     ESSAPIRIGCRSGAPGSGSSDDHEDGGIAGSTQRDEECIHSHITRTRRPGAAARRFGS
                     APGGGFTSSSQVARGNYFGGLQGGDEEAAMVSGSAASGILQSAHVIESGSESTSSPRD
                     PRSASPPASAAVSTSAVAEPASPPANPVVLSLYFFRIHERHDKGYLVDFKVVRNAMVA
                     ADLVLLLSDALVRKLG"
     gene            complement(<883005..>885671)
                     /locus_tag="LMJF_29_2030"
                     /db_xref="GeneID:12981065"
     mRNA            complement(<883005..>885671)
                     /locus_tag="LMJF_29_2030"
                     /product="putative UDP-GlcNAc:PI a1-6 GlcNAc-transferase"
                     /transcript_id="XM_003722238.1"
                     /db_xref="GeneID:12981065"
     CDS             complement(883005..885671)
                     /locus_tag="LMJF_29_2030"
                     /note="previous protein_id=AAZ09660.1"
                     /codon_start=1
                     /product="putative UDP-GlcNAc:PI a1-6 GlcNAc-transferase"
                     /protein_id="XP_003722286.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981065"
                     /db_xref="GOA:E9AE65"
                     /db_xref="InterPro:IPR007720"
                     /db_xref="UniProtKB/TrEMBL:E9AE65"
                     /translation="MPLSSTTEICMLVWPLSAAMKILGPNDSIAWVLGWNDRSLYIIV
                     TWFLHNCTLPEAKAELQQIRCVLQNYKGHMPEIPYSNLNILGCVRPNSAPSRCNVCSV
                     AEEEDIRGARKGSYLWLELLEGPVLAELWCCGARVQPCQLHVVRCDPSKELSIRPTIF
                     SATALYGVSGVRQLQSGVAPVCAPGANSNLEGVLLPQVMRKEAEPRVLKRHQQRRRHT
                     SVVNDSITLAAEDSCFSDRDTGEQSSVLADKRWATSFNANLSFTVQASSFAQDASVTT
                     EWHRNSSLRDHLPVTQEESLSLSEGDGSATAAPLGVATLSDSEMDQLDSNDRRGMGQS
                     ALQFEKLLAQSTPAPSQSSAQPPPAGVPPRLDFPSTTDRAEMSVFLATMRAGRHVRRV
                     MQNEQLCDYFKEDTVEPLTGVLKYAVDFISTYVVGLLKHLRFSKTAEVLLYRTSEFAH
                     FLCAVSFANDSCGLHPVLPHQVSSSINHRYVCIFGYVSRCAVDLVLGVLVYLCLSACG
                     PSLYAALQYMTRHWLYEVHASYMDWFDGYPAGLKVNEDLNMALCFFAKCVLEVWDALL
                     RWSPATLPSLVSFQAASVSVEGNVCSTVAAVTTAASSSTWFSPASEDQQQAVYEWVSM
                     AFHLRIFCLLGCSTAAALVSDVTGLVSLHLRFLHHAIALPYCFARVLLTNLFRQFYGV
                     KYNPLRKRYDIYHFQVDQMLAATFLFVIIIFLFPTLIVYYLYFSFVLATIWYMETCLE
                     SIAYLSLHVPIHPIVYWLCAQHRLSGGVALSNPVITSVRRFIGCGSRPGHDEEELASH
                     TVEVTVEALPLPLTAMLTDFFVVVDIIMTRLWPAKVVLLVLRGRVEYLPKMTDILGPH
                     LLTSCVSPRCTLCTPSPEKDTTKPQKGPVGST"
     gene            complement(<886505..>890347)
                     /locus_tag="LMJF_29_2040"
                     /db_xref="GeneID:12981066"
     mRNA            complement(<886505..>890347)
                     /locus_tag="LMJF_29_2040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722239.1"
                     /db_xref="GeneID:12981066"
     CDS             complement(886505..890347)
                     /locus_tag="LMJF_29_2040"
                     /note="previous protein_id=AAZ09661.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722287.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981066"
                     /db_xref="UniProtKB/TrEMBL:E9AE66"
                     /translation="MDSIDSNPLADDEEVLASLTPVDAAQPLQPASRQPVSATPATTT
                     VLTSTSADGHVQYEAATTATNEQGSLRRENFLEHAMAKTSATRAAEVQLAAPEAGNEE
                     AVDEADDEDDSNSGDGDDGAYAAEYRSLLFRVAEMEAQEQQRARQGGFALRMAQRETK
                     LMTEVAAQQQAYLASQTWSASCLHASGRAKAPANASAESEKQVTISSAGAWPSAEDVT
                     ADAATDARLACLAHRMEHAQLQYRRCTEAAGLLRSHARWMRAEAERQERWTAETEELL
                     CRLHEDAGLADAVSTAAAGQRQEGPDRARPLDASPLVASPLNDTWQRQTSGLTTLGGT
                     LAKVHTLFRDPECRTSMSVVATALTEVGRRCQCLLQELQALTEAALQTEADLQQRRVH
                     ALEWSLFAANAQQALELRDLYSPVTLAEMRAMGLRKILLRRRQELQTALTLVVLRNAE
                     KAVTGADRAAAASCSALVPQSSCIFSSPPHEVTPEKMKAVADTCARHEGLRDRLLREL
                     LYLKKCARRVLGAAWVSQTETTAIASLAATADTRRDSRMLEAVLLDNLRRASYNGLAR
                     LIAFVAATPKPPDERDDAVKGDISDPHEDVDDEGKVQNEGDGLAPLPRFHSSAPAAPL
                     ATRVQVLATLEAVQTRANSLLSLLAENAKHWQRTQDVVADAEVCAHSSDDAWCRTAEL
                     LLRRCMDADAAEPLSSDTHSDDAALQNPRTAPLLLQEQQLLDSLHTSQAAIVEAINAA
                     LAQVHHSCTGPLEREKRDVALLIRLLQLSDEAGESERQRSDACRADILVTSTTPALER
                     AMQLLTCAEDDERKSDAAGKDLLLSQVRVPQLPLRVDAVQGTISALSANWKDRLVAET
                     AETRAKFTETQVRLDQYAQYSMAEVPSLLEKALAEAKALQERATECAARSSSAASLAA
                     RIQQQRKLLTDTTTTERYALSAAMQEARLEVEALQAQVAQLQKQTNLSATESLHRCEL
                     GEAEAVAWKSLLLDDPGQHQAVNADGADDGAIKDEGSVDIKQEASNSPPEVATDVKAG
                     EDERDREVGGGAAKFEVASAKRDDKVEGLEITREEETEEGADAAEGGGEQEQQLGDEP
                     AEEVAADSEPEERDGDALSCAAKRSNEEGADEEAHPLQMRDGTGAEGEDVPEEEQGDA
                     KPRRDERTTQDRVDEAPHCTTAAGTNELAEVVPQVEVKGKKKSRKRSSKKSAQREVQQ
                     WPGQHAHQQQQQQQPSILGESILGDAEAGQRPPVFDSAASNLFSHYPPPSAFPTEPAN
                     RPVYDDNPFYSGFGFEEE"
     gene            complement(<894795..>897026)
                     /locus_tag="LMJF_29_2050"
                     /db_xref="GeneID:12981067"
     mRNA            complement(<894795..>897026)
                     /locus_tag="LMJF_29_2050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722240.1"
                     /db_xref="GeneID:12981067"
     CDS             complement(894795..897026)
                     /locus_tag="LMJF_29_2050"
                     /note="previous protein_id=AAZ09662.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722288.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981067"
                     /db_xref="UniProtKB/TrEMBL:E9AE67"
                     /translation="MGGALCMHQPHASNHRAQPVASQPFAQESDDTSNDVPRLGSSTP
                     PDEPAVPGPPALKNVGAAARAHSVELRSDAATCKNSASSYPRSAPQGFVRPLLSSSSS
                     SIANPQSTRAPSHVTSIGMGEATTTAMPHSVPSMPEMERSVNSSCSAFSLYSADSSTH
                     ELPLPPPPLLERATPLQAVATTAAASAARVKASNNAALYPSAIPSASLMMTSLLLDAA
                     TPPTTLPDTSMSARSYFVPQNVRKHSGCTASKSHGKTPESDPAQAAAGSFAASSSMTA
                     AAAAAHIVSSALLDVSFDSRVFAVNDAATSTEIQRLGVRLQELQRGHHELGVARGVAA
                     LLSRNSGGNSASSTQNLFLDASKGINEALPGASTASLESSRKSVESSVSEQELTRKQL
                     HDETVKFVNLIQEIHEERAAGQAGYTWFRWGAVPPNTSSSSGSSGPGEVRAGSGDRTG
                     ASPPPVLEKAPLSGNWCADVPVGSATNYLRHRTLLRRRDRASTRVHWLPFEMRESDFR
                     AGTSITPVYFCGYQATAVPADGAAATHGREHYPTTDVDVLTPHSQHFLEVGASSAVTL
                     SVTDTPPLPSITPLARRTSTLGADVDKDSTHCFSDSKGPLSSSSGTIPSTSSHSLSSD
                     SISFCPMHVAHRPTSILVPAKGKQGASTICSSVPRRPLLEPTQVDVPATVTTGLVPAK
                     AASAHLPLFDPWRPTGDGSACEPGRRPIINAGVPHRKQLAKRALEDNQLFFEVFSQRK
                     SFS"
     gene            complement(<901688..>904993)
                     /locus_tag="LMJF_29_2060"
                     /db_xref="GeneID:12981068"
     mRNA            complement(<901688..>904993)
                     /locus_tag="LMJF_29_2060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722241.1"
                     /db_xref="GeneID:12981068"
     CDS             complement(901688..904993)
                     /locus_tag="LMJF_29_2060"
                     /note="previous protein_id=AAZ09663.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722289.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981068"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9AE68"
                     /translation="MPSVDVLQLLQLAYHGSKDERTQATTELEAVMQSPETGPTCLLT
                     LLRTGVEPSLPAEQSLSALLFAKNAMLHLIGDDVVTNTPGFLAEIESLLFAGMFRVSE
                     RHRRVLRACIMNVTSGFEWNYLGELMPLIDRDLNAIGVDESLGALELLYAYAKRFKTP
                     GLEPTPLKVQVCAVLVRKLPEYVGYDDMRVYRLVFKLGECIVESGLQLTSSKEMSGDA
                     LDGLFQLMLAFPQQHYEAALAAGGTVYGEYVKCLKRIAMVSYSIINDATRRKKPAPVA
                     KRFLQAHSAAFLSTWRQWLQLCVSSTDRRTHQKSEMFALRYVKLCTLDETLYTQHLRP
                     HAMELVEQLLFPYICFNEVDEAVFADEGDLADYVKYMVEESVGNTELSTRQAASNTIL
                     ALLGSKKKFHDSAPLLQALLGILTAGFESADLTTGAGNARLFGFLHLLSILRKFLKEV
                     PAIWEGQMAQVLVRYVAPFLQPSTPCVGVRCKAIVVCQRYSKVLMPSEADFASFIQMM
                     CGLIQDADMRVRLAGIDAMCTLLELKRARQYLKPIVVPLVEECLAFLSKVQTTFVPLV
                     ILHLTTHFAPEMTPVMGKLAHTLVQHFLATMHDMELQEADGGGGLGDDEVGVSVYEQA
                     AFSADALLDAVLTVVTSCGESDAAFTSVRVDALRLVKHVLQQPDNFEMMEKTLSILLH
                     VLYFSKPIPPECWELLPLIYALVDSGIGVDFFNSIEEVLDNFVSRAPVEFLGDTALMT
                     ATYKTCEKMLIGGVVCVAECQMAPAQLIEAMLHTAKAETEHPGLFDPYLSQFVGLLLQ
                     SLLHPDIQGGDVRVRIWIIAALLDCFYYDAAATFNAIVQVNAYPSFFDGLLFLFRGCI
                     DDGASFSASGASSAGRRTKKVKKDDAREVVENLSLLTRKVIILGLSSLLAFATDLHLT
                     TPPQQEQRADFAFRYLDPLTRLVQYCIFTNEATYAPRCATSEANLEKIRLGVEDDMED
                     CEISDEAVLGVDGGDDTMEACEDALEDLDDDLAAAQAGLEPDEGDDYESPIDDINEVE
                     FFLDWVRLLPQLSPAAQAAAHAVLRPESDYVRASHTAGRYRQLCKELEAAMKEDFQKR
                     AELTAWSMEGEAQ"
     gene            complement(<905957..>907276)
                     /locus_tag="LMJF_29_2070"
                     /db_xref="GeneID:12981069"
     mRNA            complement(<905957..>907276)
                     /locus_tag="LMJF_29_2070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722242.1"
                     /db_xref="GeneID:12981069"
     CDS             complement(905957..907276)
                     /locus_tag="LMJF_29_2070"
                     /note="previous protein_id=AAZ09664.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722290.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981069"
                     /db_xref="UniProtKB/TrEMBL:E9AE69"
                     /translation="MVLLPALIATEAAAGRVLDAVHAPPLKSLNRKMAAHRSSLLPRL
                     SVTTASSLRPARVKSTTAAAAATAPTTVTAAASASRSADAATAHPLLSQLLRVSVPAA
                     SVELAQPPEEVTLAEAVEALGGSDAVEALLSQLNGVAHSVDVNDDRAFANAIEACVRQ
                     TLGVSEVSIDVIEGLETAVTGEEGGESGTRASPPVNVTIPLTISDFHAATFTPLAARQ
                     RRHRVSNSAAASAPRRTYSSCLVLRVQRCRGVLALRTVNVRFSGTSGRILCGVALGAE
                     GHKKKCKVREIKQRQRRSARRRRRRPASCKERASTTGVDGVTSCGPPSPSDAEGVVAG
                     TGVGEVEPFSSGSAEKSPWSSPITLAGGTNGRASAASTTHSQRKPKGKASLRRGSRKT
                     AAVRHIVTESRTNAVVFNPCCPEDTTPFNAQHRPVTYNAAIAFQAPR"
     gene            complement(<908174..>909529)
                     /locus_tag="LMJF_29_2080"
                     /db_xref="GeneID:12981070"
     mRNA            complement(<908174..>909529)
                     /locus_tag="LMJF_29_2080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722243.1"
                     /db_xref="GeneID:12981070"
     CDS             complement(908174..909529)
                     /locus_tag="LMJF_29_2080"
                     /note="previous protein_id=AAZ09665.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722291.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981070"
                     /db_xref="GOA:E9AE70"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:E9AE70"
                     /translation="MCHLHDILCRVSWAWEFFLFLLRSVLIAIADHYIMYIRTGRVWL
                     GKRNRAPSLMRGDLVMQLAASSPRHSTVNEKTIFLQLNRSFIDRRLWAGLNEVGAGPS
                     AIVTGVSYGGIGFYTALNLLLSGVNVHGVARNGRQAERARYLFASAVDRQLMLHKEWN
                     GRVGRMFVHACDMSDMAAVCNFSDAVAADPALRIIICNAGPMCSPPRLSQQHLEEQFA
                     THHVGHSLLMLRLLQSRLQSSRSQSMAVTLLPPWRMVVLTSAAAATANPTAASTFHEW
                     SSQEELEHYFSRFDGYSNAKMSELLFAFSLARFVERHRILAATCTVNALHPGPIRSRI
                     IPNSQLPLQWLLDGEAAALLRMTPVIASMYVVDLAISRRHEHSNGHFFRMGEDQTIYY
                     RDMVNDARQRSGLKNTTLFPGIPGPAVSLSHAKQQWMWTETVDYFATKELIDARLFSL
                     S"
     gene            complement(<911615..>916423)
                     /locus_tag="LMJF_29_2090"
                     /db_xref="GeneID:12981071"
     mRNA            complement(<911615..>916423)
                     /locus_tag="LMJF_29_2090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722244.1"
                     /db_xref="GeneID:12981071"
     CDS             complement(911615..916423)
                     /locus_tag="LMJF_29_2090"
                     /note="previous protein_id=AAZ09666.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722292.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981071"
                     /db_xref="GOA:E9AE71"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9AE71"
                     /translation="MPLLSEWTEEKNACVDWANPEEVLCNGFTFLQLLAAHPRLRQHY
                     EAADKQSERYAVKDTFLFGSGEEKVAWLTRWHAQHLLYLRSERWCRFCGESGHTRLHC
                     SQRLRSASAAAPEGPTTLTATRGAGPAASPAASSSDAPRSSVLKKYLEHLQRVELRRI
                     LEEKQKPRAEPTALHRSGAVVAHASAAAATNLFTADERRRGAVCRLDEANNIGFITVA
                     SMGELKFFVDCVDVGVKAIAVGDSVTFKLDSSRDYPIAVDVRHERPVITLEDVRKFLH
                     RCRAARHPIKVMATLLMHTHEWFVLLRWLHVLREQDVSLYVEAVHALVELTTFVGNHE
                     PIHVPVLSAFLALLCTVPPSTPAAAAATVPGGGAATFTPATSTAPTATAAAPPLRLPR
                     FYPDMVLDALERHTATDKFGASASAATAAETRLAEDRWVEVAQFVILVRCYNPLSDAG
                     STAKDSTGEAVVTDLDAGADPEAAVVRQLQAFFAERLTRASGTAVRRLQLVQARLSQQ
                     VRPPASSRTLDTTTGAAVPGCGSSGVALIPTVEEFSVPPPSPASVFAAANLPVSGATT
                     YTDRDAFIRDQCRLLRADTFEAVSRVLPAVCYSLPSYEPSQETISDVQHARVYSRVRC
                     LGKVMTTDRDYSHPESYLLEVHPHSPKANLRAQLHEGTTVCISTALDPTTMRNNELFW
                     GVVSSCDAALMDVGVIVVSPCKGSLSFELMRAALDRNAAAGRLDRSFLLETTIFMAGY
                     ESIMRALEAFCGPLAMPLPLVRQLVSPEAAASMTATAALDIMANHSAGAAAWGNDGDQ
                     LVEYIPPHCAVTFQELTEEIRSQFALDEGQKAVMRQLSVSKMILVQGPPGTGKSFIGC
                     RVVEAYVRYKQLVASGDILQKVSIDMLRSTRLEDLLPQVGPMVVITYKNHALDEFLLD
                     LLDCGLWEMNRPRVGQQLTAAMSATAAGISLSSSASTFPGGKRVVRIGGRSREARLDG
                     YNLGALLHGSMDRVAINSLKNRLLVLNQRLERLTKEIHYLENGRVPRVYFERWLTAEQ
                     RRHITFDDREAWLAGEKYIGTLDEAEDVVLPAHYQSLLQTRMAELLGARRTEASSPHA
                     DATAKAGPATGATEAETGEEEDVSLSVFQEMRREEERREFNNQLHQTYLSAEALLLAS
                     QPPSRPAGVPEELLSLWSLTPRLRHEYYAYLIASTIAAKARDCLTIMETMKSVIRVRR
                     HAMDELKLSLLQGADVVGLTTTGCAMNQNLLRSLRPSVLVVEEAAEVLESQLLACMTD
                     SLKQIILIGDHYQLQPKVETFQYEKINHLNLSLFERLAQKMQPIRLTEQRRMHPDISR
                     LIRPFYSPQPLIDHVSVLTRPFPSASGVAGADRVPGLATRVFFWRHRHPEEEAPGSRS
                     KVNTREICMVQQAVAHLVSQGVLQKSITVVTPYLGQRRMLRGVLRLRSLADVRVSTVD
                     LYQGDENDVIILSLVRTEKLTDFIRTRNRLIVSCSRARFAMVMIGNDELLRQCRHWEQ
                     VLNQLQAEQCIGESLPITYRGQPSKVEHMTVAGSVSAAALEAELTAQQQQQQRKTHQR
                     RPPAAADTADGAEGVRSDAAGGGANINDNGGAEDGADGDADPDSGAEDDA"
     gene            complement(<919741..>921663)
                     /locus_tag="LMJF_29_2100"
                     /db_xref="GeneID:12981072"
     mRNA            complement(<919741..>921663)
                     /locus_tag="LMJF_29_2100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722245.1"
                     /db_xref="GeneID:12981072"
     CDS             complement(919741..921663)
                     /locus_tag="LMJF_29_2100"
                     /note="previous protein_id=AAZ09667.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722293.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981072"
                     /db_xref="InterPro:IPR011935"
                     /db_xref="UniProtKB/TrEMBL:E9AE72"
                     /translation="MQAAAPATSLPAGAGALPLTLHVTPRVDRATIYQNKSLQRRCAP
                     LSFSTPVNEVQVMVPMPKKCDGQRGFDRDSVQVDFGASFDGKVILAGVLVDEVERHCL
                     RSDGTVAVEATRVAEVASASDSDADGERAGDTSSANARRKLESQLRAVAQKLQLNEIA
                     QAEAAAVRDYTVDLVTSAVEPCKAAPLMCTAALHDPEMWGAHLDALENATREHAKAKR
                     ELLRAKAALEAEKSELEMKLCVANGGQSPRGGRSDEAGTTVDVVVLTLKVLNPVPAGP
                     EAAVYVSYMVPSGRWNAAYEAHLNTVTNEVVLYYNAEVVLNYGDDLKDVSLTLSSAVP
                     RRNAALPPNMTIWRCGVVQPSPPTPQLMMSPNAAMADCADDEACFTLVERAPVRCAAP
                     MIKRAMAQVEQAGTGAIMNFSIPNLQTVMANGKTTRLPLAELRMPAAISYTSVPEKSL
                     AAFTHAKIKNTSDFLLLPGEVAVFLDGNYVLRSQIDKQCASGTKLDMYFGADPSVEVT
                     RVLLRQANKVRSSYLKGKTSQVKTYAYRITIRNKKRATGSVDGAVRIKLVEHIPISSE
                     ELLQVRLVSPAKPHEDVCIYDDEEDRVEQERRKSRLLDNEGIVEIERRVRAGESVELV
                     FAFEVEAPSNATIYGL"
     gene            complement(<923638..>928911)
                     /locus_tag="LMJF_29_2110"
                     /db_xref="GeneID:12981073"
     mRNA            complement(<923638..>928911)
                     /locus_tag="LMJF_29_2110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722246.1"
                     /db_xref="GeneID:12981073"
     CDS             complement(923638..928911)
                     /locus_tag="LMJF_29_2110"
                     /note="previous protein_id=AAZ09668.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722294.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981073"
                     /db_xref="GOA:E9AE73"
                     /db_xref="InterPro:IPR009448"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:E9AE73"
                     /translation="MLLILGPTAQTTLGKGIWAAVEASWNETSLYQEGCEWVARSFGD
                     EAFYSCLDALWLPSPSQDCGSSSADSEGAREATSARFLTQQLQYMRLLEVLFRLPETR
                     GANRALFEAEMAARVYSPAVEAHYALADKALRETTPPPSLSERDDSDQGERGSGNRLT
                     CGDPFAVVYTRTAPGAPLRALRVKTPAALKRAAGGAGPQHRDAVVSIDELAFASFDHR
                     HPAPLLAAVREVPAVVVLYGLPGSPAAHALHRVAVELSNPSDVASATVSGAPAYFWRH
                     LPVSVSRLCAAAGVREQSLAAAMTSLWDSPLAVQGYGVTVDIKNMEYKVLDEKAAAQQ
                     RSKEQSSTAADKGSSHDGTDAPAAAKRVPETQVGRIAGGFHVGRLKERYPGLAASLDE
                     FAILLDEEMGSDDVKVNFDVRELQKIGLAATQYISEVENHSRRLHVLTDMVMRFPTYA
                     AALSRIAALPGRLVEVQKTLLILHQRMRPGQSAFFVDGWRVEEKELTLFGVLQALHEE
                     ERLIRRMKTVLTTCAVAAADADSAAEDAVHEARTVPLAPAVLEKVADYVKRTTHRTIV
                     SLEDNADTEAAYAIPSEHIIWINNVETDPRFKRLPPVLSILLARGYVKTPLPRRNVLN
                     FVFLWNPVSRSSLQMIFHMFRFHQEGLIARYGLALADQTWSPVFEAGVQGGGGGFKGE
                     SAGSQAALQVFALVYHLVATGKTNNVLVFLMELLEEAKQARADTIPDAVISRVCTRTA
                     RAKLNSDIGELTSKANFLSHYHETQAALRRFRVPEYPATFLNGVQLKNSMAGMSTALQ
                     REMTLLRAWVASGALRDGMKDMYSAILKQRGAADHLQPALVRGPVTMRWSDTPTTVAY
                     IESLPYVYSASYAEEVPALTQLVTLPCKFTTAMLQQLQTVMEALEECGVAAKSQGAIH
                     EVCGTLRLSLVSCPAATSLFHRHIGALQQQLARSSTPKAARYTTLRRYLSHIAEAMTS
                     ANVGVNAVLGTETVAAALAAAPLPADLQALVGVSRSTDANTSPQWARAKVQFWSVFAD
                     AYHGSAGNVALVTNGRIVAMDASFSAADVLSAAGLVAPITKAVQRAVMSVRFDEMSTA
                     DGGYAADELDNNFFASKAACLSSVFGDDISQHMAKQSSSAPALMREESILGPENDWKP
                     LQAVLFTVSNVARNAGEEAGTASGAVAQPLHHVTVVVDPSSRDAQVIVSLAHYLVQSS
                     LHIRLTFLLNPSLDVKFPIRNFYQYVGSPALAFEETSGRVVAPHATFSQMPSSTLLTL
                     GVDEPPSWTVFSQDAEVDLDNIMLSSLPRSTLFVTAVYRIHSVLVTGGTTDVQTGVAP
                     DGLPLSLLHSSRARGALEVASAARTTDTQVMANQGGYYQLQANPGLWYLSIKEGPVAA
                     AFCIKAIEGHAVRGCAEGANGSLLTNWTQGQRIPLVIDSFRGRYLSLQVGHTPTSDAT
                     ADLHTILQQMASDVRLEWPPSHSVRDATPALPEKPTLNIFSVASGHLYERFLRMMMYS
                     VHKTSSDQHGANTTRIKFWVIENFLSPQFKRYIPLLAERLGFEVGFVTYRWPWWLPRQ
                     TEKQRKIWAYKILFLDVLFPLDVDRIIFVDADQTAQADLHELYNMEIDGKPIAMTPFC
                     LKFKNKATKSFRFWERGFWKDHLRGKPYHISAIFLVDLRRFRAMLAGDQYRGTYASLE
                     GDPNSLQNLDQDLPNYLQPSVPIFSLPEEWLWCETWCSEKSKSKAKTIDLCNNPRTKM
                     PKLENAKMIIPGWEELDNKLQNLSDSVLASL"
     gene            complement(<932312..>933205)
                     /locus_tag="LMJF_29_2120"
                     /db_xref="GeneID:12981074"
     mRNA            complement(<932312..>933205)
                     /locus_tag="LMJF_29_2120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722247.1"
                     /db_xref="GeneID:12981074"
     CDS             complement(932312..933205)
                     /locus_tag="LMJF_29_2120"
                     /note="previous protein_id=AAZ09669.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722295.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981074"
                     /db_xref="InterPro:IPR008217"
                     /db_xref="UniProtKB/TrEMBL:E9AE74"
                     /translation="MIDYGNDRQYQARCAYGNPEKSIEIHGAKMETFNVDIRKNGAMR
                     NRAMVLSGLAGLCTAAGAVAVAVGAPQMLGRVRGVRDAPCMILWTVAGGLCLAYVSTS
                     SFYFERAIYDLEFRREMWEIENHLSGEVQEMLSIYKSQGLTEEEALIVTRIFARQKTV
                     FANLMMVEELGYSRLEPPTTSEAVTNVGVPAVMGFVIGVATPLLCLAGALRARSCGQG
                     SSMSAAGGGAICGQSAVTTHAKLLGAGIFCMCTAVLSYVQTEVFFGAYAHAPALLHTT
                     VSNAAGIGSVFGLSYVAARWA"
     gene            complement(<935388..>936818)
                     /locus_tag="LMJF_29_2130"
                     /db_xref="GeneID:12981075"
     mRNA            complement(<935388..>936818)
                     /locus_tag="LMJF_29_2130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722248.1"
                     /db_xref="GeneID:12981075"
     CDS             complement(935388..936818)
                     /locus_tag="LMJF_29_2130"
                     /note="previous protein_id=AAZ09670.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722296.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981075"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:E9AE75"
                     /translation="MNPAAVRMARGPVTPHRRLSGCTSALCCAIAIALFCALCCEVSA
                     LEVGKFFPGKAHMSAKNRYESVQALQALQRAIDDPELQKEVESALKDTTRGFDMCRSA
                     LYRCNRVTGALEEAVIKGMRGGTVKWDEYPKSVKRIRIGDSRLRQPLVLSSLPANLEE
                     FVATNVEWESDSILRVPQSGEGGVVKGPLAHLRVLQCYNCALVKAEVTATTPQLEQLQ
                     VLSLSGNPDLVIDLRELPRNLQSLQLSYTQLAHSTVREVLETAPAFLSLLNISFTGVA
                     LTLDMLLSARNQLKTLDVSGLESSKPVSPLSASQLQSVCSESGFSLAELYLARCSLTG
                     TLPDLRNCTKLKVIDLSHNLLDGAVFTQLPENIELLHLNSNVIQGGLRTSELPRTLRR
                     LDISENHFTGEVDLSALPQQLQYLDIGHNHFSGKVNLTQLPESVKFVYMEYNDFTGAA
                     DLVDLPLGIRFIMVHHNNWDYLMPAP"
     gene            complement(<939757..>940428)
                     /locus_tag="LMJF_29_2140"
                     /db_xref="GeneID:12981076"
     mRNA            complement(<939757..>940428)
                     /locus_tag="LMJF_29_2140"
                     /product="C-8 sterol isomerase-like protein"
                     /transcript_id="XM_003722249.1"
                     /db_xref="GeneID:12981076"
     CDS             complement(939757..940428)
                     /locus_tag="LMJF_29_2140"
                     /note="previous protein_id=AAZ09671.1"
                     /codon_start=1
                     /product="C-8 sterol isomerase-like protein"
                     /protein_id="XP_003722297.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981076"
                     /db_xref="GOA:E9AE76"
                     /db_xref="InterPro:IPR006716"
                     /db_xref="UniProtKB/TrEMBL:E9AE76"
                     /translation="MTSFKCTTLFLIGVVAVVIAFFAYVDQPSHWVYDPVRLQQIVQQ
                     SIATANAANGGNATAKQVTGETIRLILENYPKTTRYTGRWLWNNAGGAMGSMTVLHCS
                     FSEYLIIFGSSVGTEGHTGRFFWADDFFNILVGEQWAALPGVEEREVYRPGDQHILPR
                     GAAKQYRMPDECWALEYARGNIVSMLFFGFADMFSSTLDVVTIYQTVMESAGNMIANT
                     LMGKI"
     gene            complement(<948352..>949638)
                     /locus_tag="LMJF_29_2150"
                     /db_xref="GeneID:12981077"
     mRNA            complement(<948352..>949638)
                     /locus_tag="LMJF_29_2150"
                     /product="putative protein kinase"
                     /transcript_id="XM_003722250.1"
                     /db_xref="GeneID:12981077"
     CDS             complement(948352..949638)
                     /locus_tag="LMJF_29_2150"
                     /EC_number="2.7.11.1"
                     /note="previous protein_id=AAZ09672.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_003722298.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981077"
                     /db_xref="GOA:E9AE77"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9AE77"
                     /translation="MVLKRMDNTSIEDGLQAATLREIMVLDEVSAGTSNRDRVERDAF
                     RCGRAVFRPTTAAQSNTHVQESLPSSFVDQNRYFSSGAADDEWDDAASSSSGPLRKGA
                     FDALSAQQRRRISRGRQHLIGLRDAILRPREQLAYVVMDYCEGGDLWHFMRDLKVSMR
                     SSSGKFGDIMSTRVFRRWSVELILALGFLHSHNIAHRDLKPQNLMLAKRTDAILSSFF
                     AVDSANSSELCDIAGAPAGELYTLKVGDFGLSRLEGIPYKKYVHEAVTLWYRSPDVLL
                     GNTNYTYSADAWSLGCILVEMASGSVLFKGKDEADELRHIFTRGCRPSPSIFPRMRDY
                     HYCERYAEVLNRYQEADTENMTSEELMQMQLERISRHLRAFLRDRHALELLGDAGVDL
                     VARLLILDPEHRLTVLDAMNHRFFTNAYAEVYGADG"
     gene            complement(<954775..>956112)
                     /locus_tag="LMJF_29_2160"
                     /db_xref="GeneID:12981078"
     mRNA            complement(<954775..>956112)
                     /locus_tag="LMJF_29_2160"
                     /product="putative rab-GDP dissociation inhibitor"
                     /transcript_id="XM_003722251.1"
                     /db_xref="GeneID:12981078"
     CDS             complement(954775..956112)
                     /locus_tag="LMJF_29_2160"
                     /note="previous protein_id=AAZ09673.1"
                     /codon_start=1
                     /product="putative rab-GDP dissociation inhibitor"
                     /protein_id="XP_003722299.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981078"
                     /db_xref="GOA:E9AE78"
                     /db_xref="InterPro:IPR000806"
                     /db_xref="InterPro:IPR018203"
                     /db_xref="UniProtKB/TrEMBL:E9AE78"
                     /translation="MEETYDAIVCGTGLVECVLSGLLSVNGYKVLHVDRNAYYGGESA
                     SLNLEQLYQKFNKGTPPASMGRSHLYNIDLIPKVLMCAGELVKILRATVVDRYNMEFM
                     LLDCSFVMKDGKIAKVPATEMEALSSSLMGFFEKRRLRNFLQYVSSYNVKDSRTYKGY
                     NLQTMSMQQLFKEFDLGNDTISFVGHAMALQNNEDYLHKPAIDTVMRCKLYENSFLMY
                     NRSPYVYPLYGSGELPQAFSRLSAVYGGTYMLQTPVDKVNFDANGAFESIESGGKKAF
                     AKLVLGDPSYFPDRVRSCGQVVRCIAIMDHPIPNLKVAANACQIIIPQSELRRKNDVY
                     ILQLCEEDKVCPEGKFIVMIGTVVEHPGNPKADLEAGLKLIGPTLETFISVSDLYEPL
                     EDGSTSRCFISKSYDAATHFESAAEDILNLFERIHGKPYSFEAIKRAGEEVHA"
     gene            complement(<956895..>958736)
                     /locus_tag="LMJF_29_2170"
                     /db_xref="GeneID:12981079"
     mRNA            complement(<956895..>958736)
                     /locus_tag="LMJF_29_2170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722252.1"
                     /db_xref="GeneID:12981079"
     CDS             complement(956895..958736)
                     /locus_tag="LMJF_29_2170"
                     /note="previous protein_id=AAZ09674.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722300.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981079"
                     /db_xref="InterPro:IPR005636"
                     /db_xref="UniProtKB/TrEMBL:E9AE79"
                     /translation="MIDSLPTASAHVQQIDESLVSSCRATSNPYKRSMLRLLEYVGLQ
                     HYGTPRATMPPRTSEEAARIAQHLDEVKEAVARHQESVRRRNIRINKRKLNSEVVRAM
                     RCAVAASGATESDGACSTVSSDAAAGASGRLAEMPTIYLSLEESVEWKAFLASVVPED
                     RHAVTVLRRLSVALWRAHQRDLCLWCWFPREVCMCAELDAYRGTLPAAVLDEHVEVTM
                     LLHSEELMRSTNSGHIAAYLLGAPLRVWGLVKDDTYLQQLPPVEHRQAACAAERPAVV
                     YHVSLYPSSDAVSIHHHIRNAHLYPSQRDHGSSKDRGRGEGSTPEEEVDSDGGDSGAC
                     ANTANTMPRAPAPATESSSEGVAVYPVPPLTVGGSGSHSLRKVHLILLDSTWNQALSL
                     NRHITRSIPRVSLEIADDYESLFEALRKRTRETCVSTLEATSMAVAQCVRAMGYAAEA
                     ACTSKTLSDAMKKFVDARCLLKYANAQFSTSGDALDAFCNRRDDARRRDAARRQEVLA
                     AQMQADESARRLRLPPVLNYCYVCDCVIGWHRMAEHVMGSSHRTALEHNPSCTPSAAS
                     RRVVVPDFSRPRRPAENTKGTATAPRFSGAEAAGEHLPVELTQHPRL"
     gene            complement(<959856..>961250)
                     /locus_tag="LMJF_29_2180"
                     /db_xref="GeneID:12981080"
     mRNA            complement(<959856..>961250)
                     /locus_tag="LMJF_29_2180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722253.1"
                     /db_xref="GeneID:12981080"
     CDS             complement(959856..961250)
                     /locus_tag="LMJF_29_2180"
                     /note="previous protein_id=AAZ09675.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722301.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981080"
                     /db_xref="InterPro:IPR025487"
                     /db_xref="UniProtKB/TrEMBL:E9AE80"
                     /translation="MGRVGQARGTREATKTNKEAGAADGKAAASLSRRVQPTAASVQQ
                     KSASSLPTSVNADEQLKESVAFFVRGSSSQEEAAESVENEGKRDGGDLCPSPSAQRKR
                     ASLRAARFRGSARRLEATEARDAADETDAVIGGDSDVFSEPPTEDPVGATLEEAFGGN
                     DEPERESGERCSGRGTETRLDGITQAEEGDGTAVTRRARRRNLKASTVDAAAGEADAT
                     GTSSLPEDSEECAADTAAVDEEMANRYLALAFPELAAEYAAAGDGANAIPVNDVMTDS
                     AVVAAWRCVKCDHVWRSGVFVRCILKNGCPQCTANRTSTLAKARPDLLQLWDYNRNNP
                     FLKPEEIAADSKESVFWNCPMCRESYAARVKDRALDKVRCPSCALLRSQSAGVLAAEE
                     SVVLQEWHPLKNGDLHIEQLSPTDTKTKVWWLCAGCGHEWEASLAARLARWRRSRRSL
                     CPVCHGKGVTDLVQ"
     gene            complement(<965119..>969429)
                     /locus_tag="LMJF_29_2190"
                     /db_xref="GeneID:12981081"
     mRNA            complement(<965119..>969429)
                     /locus_tag="LMJF_29_2190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722254.1"
                     /db_xref="GeneID:12981081"
     CDS             complement(965119..969429)
                     /locus_tag="LMJF_29_2190"
                     /note="previous protein_id=AAZ09676.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722302.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981081"
                     /db_xref="UniProtKB/TrEMBL:E9AE81"
                     /translation="MLRHSTSLRHSAIMAVMAVALLLMTSTARGHGADSATPLLCDDN
                     AAFYTTSSDGTALGILLYEGVISCASNEATFITVAKDPASPNAVVALSGWSYLVSVND
                     RAPATFTLYAMCGDTVKCQSNVTYALPQPMASSSSSDELPLTSLSSSSTDSVLPSPTY
                     PLCSHASKSCSYSVGEVYHGIFPMDIQEGGCVYTTRITGEPTVGTVVVATSGLSYTYS
                     TPQTAAVGYHISLGYTVQCNGITVCADTVDVVLGPASVTTAPPTSTPAPTPAPPETLP
                     WCSHQTYVQTYRIGEVYFGDLLLDVKDTECRYTATIEDPSVGAAVVAEPSDPLGYVYS
                     TSDDIVPQNTSIPYTIACNGVNICRGLVAIHLTYDPPACPNSVAAFLLEPGGSVTGTI
                     SSGAVCSSGATPSPSILSPVPGLSLDADGNFVFQAPDAEMEVVAMVLMKCSEEVLCQM
                     KVMFLVAHTTTAPPTTSTTTTAAPIVMCPKLFRYEVPTGQAISDTIDPVPTSSCNITT
                     CLLVNSSSDISGSLLLNLLGEFYYEAPMSQAVDYAAVDVYCAKVFVCRTQLVFIAYTR
                     LPTTSTTMPPLPPCANVYYYQTTPGVAISASLNNMPGQDMCAHGRYFTLNTSPQAGSV
                     NVSLIGDFVYVPPTYEGQFSFTFTMHCMSQQYCTGTAYFLVSNEWTLVPGPTDSPVDP
                     DRNASITNEQITCRGTCNASAWKTYPNRKVWDTTPGTGYARKDGRPVDGMTVTWRNKS
                     LVVLVYSLIGNLGVRFPTFEPITTTQRAYMEPKDFAGSVAPGSPGFEMSCLANQGRTG
                     MGEDVWKWFSLSLDSGTGGVGAYYNSGQSWYQKFGGKHVNCDIFTDPCRYAPLLTPAN
                     HTNTSLGRWTVDVDDCDATWTGVFAYSSMGKMVKYDGSPVWSFVGNLQLQGTLYSEAV
                     QARSWLEPGQFDALCSSHNILINLHQIVAVSKTSMQEPLISVDAEFFTYLDNETQDQA
                     FGINMLIYPFVDSYMTTSYARDRHVKGFKWILQDWISPSDEHCPTCTGSKMKCVAPLQ
                     GADDSYTGPSFPEGNCANGEGRVHLFKGPATMPGDCPNSKMHVFNHTGFSPTRNCNTA
                     YQNVTLRGIVPGSSGLNETLSRAFHYEGTVQLVLLMDDHSYKRLNLHLSMYVSRLSKD
                     SPRMKGGLSTCRSGSYWPVLDPLGSSLASSPFPLSVAAATPLCIDDLSSSYGPNDWAL
                     FAVNMPGVEPSEVTVRSVYVQHNNSRIYLIYKDPRTGVVSIPDSDADGDWWQYKYPFL
                     AFRDLAAHVKNNSITYSALMASSAAAADVVYAFTFIPGALGVDTDIEVVVEALIQSSM
                     AAESTTEFRRMLHIDPLLTQLSRQGPPSPHSSSKREQNKTDFYARGATAGVAVVLVVT
                     AIFFMLADNSRPLPKWVPRGKLIKETVLSLLPAGLRGKKKPKRTVHKDMYDAMSSGAY
                     "
     gene            complement(<973437..>975527)
                     /locus_tag="LMJF_29_2200"
                     /db_xref="GeneID:12981082"
     mRNA            complement(<973437..>975527)
                     /locus_tag="LMJF_29_2200"
                     /product="putative GTP-binding protein"
                     /transcript_id="XM_003722255.1"
                     /db_xref="GeneID:12981082"
     CDS             complement(973437..975527)
                     /locus_tag="LMJF_29_2200"
                     /note="previous protein_id=AAZ09677.1"
                     /codon_start=1
                     /product="putative GTP-binding protein"
                     /protein_id="XP_003722303.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981082"
                     /db_xref="GOA:E9AE82"
                     /db_xref="InterPro:IPR000375"
                     /db_xref="InterPro:IPR001401"
                     /db_xref="InterPro:IPR003130"
                     /db_xref="InterPro:IPR019762"
                     /db_xref="InterPro:IPR020850"
                     /db_xref="InterPro:IPR022812"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9AE82"
                     /translation="MNQLISVINELHDAFAGVKMNIKLNLPQIAVVGSQSCGKSSVLE
                     SIVGKDFLPRGSGIVTRCPLVLQLVQLPKSNEEEWGEFLHIPNKKFYDFNEIQNEITR
                     RTIEIAGPSAITDKPINLKVYSSAVLNLTLVDLPGLVMNAVGDQPKDIDRQIKDMVTR
                     YVLPKNTIILAISPANTDLATSQSLRLAKQLDPEGVRTVGVLTKIDLMDKGTDCFDVL
                     QNRVLQLRHGFVGVVCRSQQDINDCKSMEDARRSEYEFFANSPIYSPIAEEAGTAYLS
                     KKLNFLLLEHIKAVIPDLKHHVDQLMEATKKQMEKLGMFEQDITEPTAQLLYLIKVFS
                     DALNQTIDGGITDATKELLGGARLDYIFHECFATYVTSLSATKDLTDDYIRINTRNMA
                     GMHATLFPSDQVFVALSKQQINRLEEPCIKCVTFVYEELGKIVEICAGKVDRYPNLKE
                     AVIAICKKMLFDYRLPTSTHVRTIIKAERGFINVKHPMMDELAQRALSNIYGTTSGES
                     SSPPRNSSGPNASAAGGTQADPKQSGKDIKKDDKRGVRDEKRPEKPKEQGNTDSAISP
                     GNKSDMNDVPSRIMLGKTMTMHEQFMNSAIREMVEGYFSIVKGNVADQVPKAITLLMI
                     TRLREEVYARLVSELYSDKTAKALLSEPPGIATQRKAAKEMLEALTKAQNALNSVRDY
                     QLTKEPASSMQAGT"
     gene            complement(<977324..>978790)
                     /locus_tag="LMJF_29_2210"
                     /db_xref="GeneID:12981083"
     mRNA            complement(<977324..>978790)
                     /locus_tag="LMJF_29_2210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722256.1"
                     /db_xref="GeneID:12981083"
     CDS             complement(977324..978790)
                     /locus_tag="LMJF_29_2210"
                     /note="previous protein_id=AAZ09678.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722304.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981083"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR003603"
                     /db_xref="UniProtKB/TrEMBL:E9AE83"
                     /translation="MARITVELLRRRAEHNEGCLSNLKEIALHQQDIEKIDLIGDACR
                     QLEIIYLCNNYISRIEGLRHLKWLKYLNLAVNNITVIDGLQGCEALERLDLTLNFIAE
                     PTSVQTLLANPFLESLHLTGNPCTKTEGYRAYVIHSLPQLKELDGDEIIRAERITARQ
                     AEDVVIEVAEEEAVRVREAERIKQEMLAKGIDPFPPKYNDKGERVYGHTPEERLQILH
                     EQQEMERKKREEQSTPQPGSIAALHQELKRQQQPSQRLTAEEERSKFGRLLLRNEPRV
                     PFHMNQDDAAEFVLTVDPGKFISTTLLSVQVEVDVVRVFIKGKLLQVPVEDELAADAA
                     QVQRSTTTGQLKVMVPYAPEVQERRGGARARLRGLREVTEKASSATGTSAASTTPPPT
                     ASPPKVAEPPTRSTLLEIEGRMRGSSSPSLSINQPGTTGTLSSSGKNTTTASSGIVKS
                     VKDISPVPSTMKVSADAATLASQSMTAVLTPTTAASSH"
     gene            complement(<981680..>982687)
                     /locus_tag="LMJF_29_2220"
                     /db_xref="GeneID:12981084"
     mRNA            complement(<981680..>982687)
                     /locus_tag="LMJF_29_2220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722257.1"
                     /db_xref="GeneID:12981084"
     CDS             complement(981680..982687)
                     /locus_tag="LMJF_29_2220"
                     /note="previous protein_id=AAZ09679.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722305.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981084"
                     /db_xref="UniProtKB/TrEMBL:E9AE84"
                     /translation="MSTTSSPDEASCDVEKEGKGISPVTRTGKRFAECALMDLPDKYS
                     SAFPYLRGARLFFFDVVSKLNRIGARNKRVVFVTDYTIGVASKRGHVSRCAKVEDISE
                     LICDAQTRALGVRMRSRPFAIVPKDFSRWNCFHEMPVDLLLHATSAAQYEALINVLSF
                     VHHTSTHEALLCRSLKQYETWKASLVLAPDGSRVKKAVQYYAIPVTPSERSTDAATLS
                     ATRSQETSASLSAVRAPRQVALLSAGDSASRFTSGPDVSATAPKLRHWSSLGASSSFT
                     PSGVGGHRTALGLSPFSLSPSPAPPLVEFSRDIEAVPTSATRRGVNPLLKADRKAPNA
                     S"
     gene            complement(<983980..>985602)
                     /locus_tag="LMJF_29_2230"
                     /db_xref="GeneID:12981085"
     mRNA            complement(<983980..>985602)
                     /locus_tag="LMJF_29_2230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722258.1"
                     /db_xref="GeneID:12981085"
     CDS             complement(983980..985602)
                     /locus_tag="LMJF_29_2230"
                     /note="previous protein_id=AAZ09680.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722306.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981085"
                     /db_xref="UniProtKB/TrEMBL:E9AE85"
                     /translation="MRRPVDMRTATVLGAGELGKACACALAANRSVDFVTLLTRDAAM
                     AAPEKATATLPSMYSGGLANFSGAEGSSAGASSSPAAPSSITATPWPSVVHMQDLKQF
                     CRDAASAINRKRAQHPLFLCTPCASYLPGHDAWARAAFGNEHCPATHDVLTRWRSAPA
                     AIASLQSEPAPFNGFVAVFTRGFAANGAVPAQLADALLNGPLVEHASSAAPGSLSEIE
                     TPVLVASGPVLAKEWSLQSTPLASSGASATLSSPIPSRPPSALSAATGADGGASEIGT
                     KAALPSASGRELPHAFSGVALTFASWTPSIAADTGRQEALAEQLRLFFPRESVTYLTA
                     PDAAAILAIVNGCVPLCSFGAGLVSSVYTGTSVTSLAAYAQHAVAATEQLVNKLLGRA
                     AGTPLPLPAVSTLWCACTCLVSREFALGRKLDFYFRKQDAAEAIFRGHEHHLFAATVD
                     GLHERMQASGVASPFYEVLMDTYNTMIRASRTGEGLVKEGYYGYRDTLGEESGELLGQ
                     VTRVDQAMLSGDEARFTEAKERIMKAFAGSTF"
     gene            complement(<987764..>990370)
                     /locus_tag="LMJF_29_2240"
                     /db_xref="GeneID:12981086"
     mRNA            complement(<987764..>990370)
                     /locus_tag="LMJF_29_2240"
                     /product="putative aminopeptidase"
                     /transcript_id="XM_003722259.1"
                     /db_xref="GeneID:12981086"
     CDS             complement(987764..990370)
                     /locus_tag="LMJF_29_2240"
                     /EC_number="3.4.-.-"
                     /note="previous protein_id=AAZ09681.1"
                     /codon_start=1
                     /product="putative aminopeptidase"
                     /protein_id="XP_003722307.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981086"
                     /db_xref="GOA:E9AE86"
                     /db_xref="InterPro:IPR001930"
                     /db_xref="InterPro:IPR014782"
                     /db_xref="InterPro:IPR024571"
                     /db_xref="UniProtKB/TrEMBL:E9AE86"
                     /translation="MSMTKSVKLENPYVPSGYHLRVAVDLSTWSYTAVETVHLQRCPA
                     FPDGDTIQLHAAPSIEVTSVKGATLERRDDTAHTLVLKLDAETMALADPTLHFEFTHV
                     IQKELRGFYQVNFKHNGKQHRMASTHFEPVSARLFYICHDEPAQRADFTLTVTLPKSE
                     EHYVVLSNGPLKSKTVEGDTVVHAFQTVPRCPPYLTACVVGELEHISTVVKGIPVSVY
                     ATLGKVGRAQFALSITVFALEFFEKFFQCKYPLPKLDVVAVPDFPIGGMENWGCITCA
                     EAILVDPQQSSVEAKRGTSNLVCHEVSHNWFGNLVAINWWEGLWLKEGFASWCGYHAT
                     HAYAPQWNALDAAALQVVSALNDDIYEHSHPVEVPIHDPGDITQIFDSISYNKGMGLV
                     FMLQAFLGDRWESAVAHYIRKHQFGDTKTAQLWEALEESSQLPITEALTSFTTQMGYP
                     IIHVARKDENTIVVTQEACRFVTASEKSMRTWCVPLVVEGIDAAAGRATPMLRGDKPM
                     EVTLPAGIAKGAFANANPRRTGFYRCRYDNAIFDAWLANYSQLSPADRRSLFSDTLAA
                     IRIGYDDIPRLARIAKAVSAFEKDIYVLREYMQTMGTFLRSFDDTSLTKSLNKELHGF
                     LTPVAESFIGVSPQDDNASLRRNFYLDASISTLLNSWEPAEVSAHPVIQWALQQAQGF
                     LSGEGFNAGTLSSCLRAWVRMTDPADLPARNAQLYAKLQEVDGNEELCRSLVVAMTSG
                     ASVDFALGIMKKCIENDGVRSQYGGQVFWSLASNPAISGAEVWQAFQNNFDAVKAQWG
                     GGQFRIQAIVSFLGEALSGDAAADEFETFFETHPLPNARLAIGRAAEELRIRSWLNKK
                     WKASLPHVFCCH"
     gene            complement(<992818..>994941)
                     /locus_tag="LMJF_29_2250"
                     /db_xref="GeneID:12981087"
     mRNA            complement(<992818..>994941)
                     /locus_tag="LMJF_29_2250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722260.1"
                     /db_xref="GeneID:12981087"
     CDS             complement(992818..994941)
                     /locus_tag="LMJF_29_2250"
                     /note="previous protein_id=AAZ09682.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722308.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981087"
                     /db_xref="UniProtKB/TrEMBL:E9AE87"
                     /translation="MSSKEELAALMASDGDFEKKISLLKKAVVTVTKQKKEVEARQTQ
                     LQGELSTATQQLAEAQRANAALQRKVKSLEAQQEQERSSGSAFGQNMLKGLSSIMGNS
                     DSANRGGARGERGSAGDRLSLSPEDVERLISENEQLHRQIYAFKTKLEDVQHSSAKDT
                     ERLKSEVARLQRETQELRRSLEANTATGDRLRADYLTERALGDFCRHFFVATLLRPQQ
                     ERESFLTGTTVEVRWPAKGPSSNSAAAAFSDSLPAVVSERVTLALQSAAGTVKTLLRG
                     VSVLAVVLQEQLPSRERATVGDLECLRDRLSVFLEAHTAKKDSLMYLLEQLDSQLSAV
                     QHADEEGGSAPVSADAFVEAQGNIVQLVLEWVGLLRTQLPLLVESCVAILPHGNSYTM
                     YTAHVSAGTGDGAAEPRKTTTERGEFVEEVTRHGYATLASIEGSLTAMRMLVERSPTA
                     YYRCYNNGNRGGALPEPPTTKETLNFTSSLEATQPPMDLSSLLALQQFWWEGCTSVRS
                     LRASILALNSGLVNVAEACNKSEIRDALNYLCKCLEAIAAASEEMYGSPRLAPADADA
                     AIAALVPDALAPRTPAHAPPSEASSWALRPRTAIATSSTLTAEGVRDTAYADKYEELL
                     VALSAADRAAASYYTQMNYLYVEMAEKEDALQTALEAVAHLQQLIVAERAEAKHTRQA
                     LQSQISLLSTQLVEMAGAPAAQTPQ"
     gene            complement(<996001..>996963)
                     /locus_tag="LMJF_29_2260"
                     /db_xref="GeneID:12981088"
     mRNA            complement(<996001..>996963)
                     /locus_tag="LMJF_29_2260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722261.1"
                     /db_xref="GeneID:12981088"
     CDS             complement(996001..996963)
                     /locus_tag="LMJF_29_2260"
                     /note="previous protein_id=AAZ09683.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722309.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981088"
                     /db_xref="GOA:E9AE88"
                     /db_xref="InterPro:IPR008591"
                     /db_xref="InterPro:IPR021151"
                     /db_xref="UniProtKB/TrEMBL:E9AE88"
                     /translation="MFFEENLNDTVEYESLLHAGGAPMRPLSQVSDGGASSGAPSMSG
                     ISATFGVDGLPLEPTESGGGAAAKTQSASAAAIQLLIEATANERFSPEVLPYPATTIS
                     TVVHLIQRTQERVEAMVAEEKREGAARSLLPFRPSDIMGLEMQRIQFFLCELLRCRLR
                     KIEHLATSIYYEGLRAGQSSMPQSGLGQADETEAFSSASAAAALPEVRVPQRQNLSLK
                     EKWVADRLAKSAHAALMASGLQSMPAALQYLVPYPSEAEGLEILPEPDLGAYVFGVAL
                     EDLGVVNLGEGGQDASRAINAGELFLTPYHNFRPYVMSGQVRLV"
     gene            complement(<999910..>1000866)
                     /locus_tag="LMJF_29_2270"
                     /db_xref="GeneID:12981089"
     mRNA            complement(<999910..>1000866)
                     /locus_tag="LMJF_29_2270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722262.1"
                     /db_xref="GeneID:12981089"
     CDS             complement(999910..1000866)
                     /locus_tag="LMJF_29_2270"
                     /note="previous protein_id=AAZ09684.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722310.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981089"
                     /db_xref="GOA:E9AE89"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="UniProtKB/TrEMBL:E9AE89"
                     /translation="MLLLLLTVFMPLYGCFLWLLHQRMLSVLLMRVWFSLHLAIAVIA
                     THIACRIISFFAYTLHIIPASTAQALSRFCKHVAFKVYFSANVPHVHTVQMPGSLPYS
                     VMQRGAICSCHCSFFDPFFSMSVIPYSVLWNGRTFLKNSLLNLPLFGYALRCAAHFPV
                     YFSDENSASFSVDKDKQAAVAADVENWVKQGKSLCFYPEGMVNRTPEVLKDFRLGSFK
                     TILAHKMPLYYCVTYGNHEVWPPSLKGLPGYPADVYVYIGKYQYCADKVDALALATGL
                     REEMQKHLDEMVLKGKRLECKPRHVARHAGHGGERGRRVIIE"
     gene            complement(<1002587..>1003510)
                     /locus_tag="LMJF_29_2280"
                     /db_xref="GeneID:12981090"
     mRNA            complement(<1002587..>1003510)
                     /locus_tag="LMJF_29_2280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722263.1"
                     /db_xref="GeneID:12981090"
     CDS             complement(1002587..1003510)
                     /locus_tag="LMJF_29_2280"
                     /note="previous protein_id=AAZ09685.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722311.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981090"
                     /db_xref="GOA:E9AE90"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="UniProtKB/TrEMBL:E9AE90"
                     /translation="MSLLSWIIFAALYGGFLCLLRERKVPLIVMRVWYTFHLVLCVII
                     SWLCGVALSLLGKVQLLDTVTSQSLVKCVCATTFGYWLRFNSPHIRVEHLPGSLSFSS
                     ITEQHNMCLCHSSLFDTILFLWYVPYRYVDKVKTFFKASLCNLPLFGTVIVLCGHFPV
                     YFSSTDANSFSVDKDKQAAVAADVENWVKQGKSLCFYPEGMVNRTPEVLKDFRLGSFK
                     TILAHKMPLYYCVTYGNHEVWPPSLKGLPGYPADVYVYIGKYQYCADKVDALALATGL
                     REEMQKHLDEMLALREKRGYKPWWKRFAAKA"
     gene            complement(<1012983..>1014221)
                     /locus_tag="LMJF_29_2290"
                     /db_xref="GeneID:12981091"
     mRNA            complement(<1012983..>1014221)
                     /locus_tag="LMJF_29_2290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722264.1"
                     /db_xref="GeneID:12981091"
     CDS             complement(1012983..1014221)
                     /locus_tag="LMJF_29_2290"
                     /note="previous protein_id=AAZ09686.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722312.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981091"
                     /db_xref="UniProtKB/TrEMBL:E9AE91"
                     /translation="MFNPYDPRRVFIDPNPSSASISFPYASATDSAQVPHGPLPEGNI
                     LYLTPPYPSQVSRTPSASNSITEFSNSQLLGIHSAKHKTGETSTAATIGTPATNAASV
                     SLVNLMQPPQPPSNVSYDPARMSSSTATPFSRYPATQPGFSQPNTPMQATQPQMLQQP
                     FVLQAHSPSQPFTASSAAATPPARQRLMLISGPAPATSMNPFYPYQAAAGTTAAMQSG
                     SSHQPPSTTTQLISPLPLTSPTSQGHSGSGNFAYVVESGSPAPLLAYSVSQPSFVRVA
                     SQPWPPAAAVPMLSSASGTPTMAPRESTLGVDAASLQSPTQQPFATSAAMGSQSHCPG
                     SFLASPEAGPTSTSPARAGGTTAAAGGSPDGMQPAALGVRNFSAPEPVGSCLLPNVPL
                     DPIIPPLALPCPRWGKLPRS"
     gene            complement(<1018994..>1021240)
                     /locus_tag="LMJF_29_2300"
                     /db_xref="GeneID:12981092"
     mRNA            complement(<1018994..>1021240)
                     /locus_tag="LMJF_29_2300"
                     /product="putative ubiquitin hydrolase"
                     /transcript_id="XM_003722265.1"
                     /db_xref="GeneID:12981092"
     CDS             complement(1018994..1021240)
                     /locus_tag="LMJF_29_2300"
                     /EC_number="3.1.2.15"
                     /note="previous protein_id=AAZ09687.1"
                     /codon_start=1
                     /product="putative ubiquitin hydrolase"
                     /protein_id="XP_003722313.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981092"
                     /db_xref="GOA:E9AE92"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR001607"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:E9AE92"
                     /translation="MPFPVTQEACPHAWSDSAIVTPFPGKTVHRDECAYCCRTCRQGD
                     GVYVCMACHTGLCCEHLEKHMRVHGEHAMYTTVKKLAAKETDEVKDVNYLGVVAPAEY
                     ETAVCCADCQVQFAQVPDLAVEAYSGIINAPEPGAQDSAADGGVGRLQKPQCPHLVCL
                     EQLASPFAVCPPTSDDICSVEMCGCNVNNWMCVTCGAIGCPRPEAGGQGHALQHYKLT
                     GHPACVKLGTITAQGADYYCYACDDDVDDVHFAAHMAHFGIDVQTAKKTAKTMGELEY
                     DYSSQFDFNKITEAGVSLVPSYGPGHTGIENIGNSCYLASVVQCLMSLGPFQRSFFPA
                     KSTPHQAQCTADPYNCHHCQTERVAAGLLSGEFSREGHELTNGICPRLFKKVYAHQHP
                     EFSTGAQQDAQEYLLYLLEEMHRHVRLNSSGSTSAGHVPQQIHPSGVMEMVIEQRMQC
                     SKCQRVRYTYETDKCLSLPIPIDPVPASSAAAAASEAEMDATRPRCSLEDCLQAATSP
                     SGIECRCEACLESAVYYTVTRLASFPDVLPVYIRRTYFDMTAHNTKKMDAYVEVPQKL
                     DLEAYRGTGLQPGEVLMPASSVSPARQPTVDALAGAPQQEVDEVALVSVVSMGIEMDV
                     ARYALLQTNMNVERAIDYIFSHPHIADEIKSVPPLHAEEQQQRLAPTHNATSVRAPQP
                     ATDGAASYELTAMISHMGASARTGHYVCHIKDGATGKWLLFNDEKVGESQNPPFSLAS
                     LYFFQRKA"
     gene            complement(<1024153..>1024956)
                     /locus_tag="LMJF_29_2310"
                     /db_xref="GeneID:12981093"
     mRNA            complement(<1024153..>1024956)
                     /locus_tag="LMJF_29_2310"
                     /product="enoyl-CoA hydratase/isomerase-like protein"
                     /transcript_id="XM_003722266.1"
                     /db_xref="GeneID:12981093"
     CDS             complement(1024153..1024956)
                     /locus_tag="LMJF_29_2310"
                     /note="previous protein_id=AAZ09688.1"
                     /codon_start=1
                     /product="enoyl-CoA hydratase/isomerase-like protein"
                     /protein_id="XP_003722314.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981093"
                     /db_xref="GOA:E9AE93"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="InterPro:IPR018376"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:E9AE93"
                     /translation="MFRYSHMIRCAAQPVVKACQVGPVVTLTINRPTQLNALNRAVSE
                     SLMENLEKYDKDPSCSAFIITGAGRAFVAGADIKSMKDRTFSESVLSSDFQALTRIRT
                     IGKPIIAAVNGFALGGGCELAMSCDIIVASEEAKFGQPEIKLATIPGLGGTQRLTRMI
                     GKARAMEWVLLGNTYTAAEAERAGIVSRVVKHEELMPTAMLMAEKIASYSQIAVKLAK
                     MAVNESQETLLAAGLAYESMIFNSTFSTHDRKEGMTAFVEKRAPQFQNK"
     gene            complement(<1027469..>1028587)
                     /gene="MKK"
                     /locus_tag="LMJF_29_2320"
                     /db_xref="GeneID:12981094"
     mRNA            complement(<1027469..>1028587)
                     /gene="MKK"
                     /locus_tag="LMJF_29_2320"
                     /product="putative mitogen activated protein kinase"
                     /transcript_id="XM_003722267.1"
                     /db_xref="GeneID:12981094"
     CDS             complement(1027469..1028587)
                     /gene="MKK"
                     /locus_tag="LMJF_29_2320"
                     /EC_number="2.7.11.24"
                     /note="previous protein_id=AAZ09689.1"
                     /codon_start=1
                     /product="putative mitogen activated protein kinase"
                     /protein_id="XP_003722315.1"
                     /db_xref="GeneID:12981094"
                     /db_xref="GOA:Q9Y077"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q9Y077"
                     /translation="MKNRPALALDAAVVEKFQQDSKSYQINSNNSLQFRAFLFNEAGM
                     YTKDGRELPSTVKKDDIDYSSKRNVGAGASGDVFFARLKKGTSIALKRIPISSKAHRD
                     EVDRELQVFMARGDSPYVMNNYGAFWDAEDDAIVIPMEWMPYTVKDLGLFWGGLNEAL
                     LKAVFFQVVSGLVYLHDVKRVLHRDLKPSNLLISETGHVKIADFGVSKLIQTLAVSST
                     YVGTMCFMAPERLEQGMYGFSSDVWSLGLTMIGAVTGKNPWAPPEEMNLYQLLGKMAN
                     GSTPTLPESGAFSDDVKDFVKQCLERDPDTRPTCAELLQHQFFDGVTTESAVAMVKMA
                     VEQMTRLINNNAQKETEVARSQESLEKDVKAQLDKMVL"
     gene            complement(<1029177..>1030418)
                     /locus_tag="LMJF_29_2330"
                     /db_xref="GeneID:12981159"
     mRNA            complement(<1029177..>1030418)
                     /locus_tag="LMJF_29_2330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722268.1"
                     /db_xref="GeneID:12981159"
     CDS             complement(1029177..1030418)
                     /locus_tag="LMJF_29_2330"
                     /note="previous protein_id=AAZ09690.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722316.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981159"
                     /db_xref="UniProtKB/TrEMBL:E9AE95"
                     /translation="MLCTFYICCCFSLDKENRKQIHLQSGVEPLASFQYILLNAPQFE
                     TMNLQQTTRGIQDLLYTLGTSLERFRGANGLQHLLTTGKLSLLSLFGVFERTRDEEYK
                     KRSAAVNETRRCLLQFVDDFEGITESTENLVRKIDRLLGTLEQFHRCCDMEVDDRSNV
                     GDSDAPPLGQYFRQIREASSRLKGFLDDFSASKITCVDVTRTAIREIEKVNADMSCNV
                     AAALTDFDRQRRRLQMKENELMHAMSRATSGENPAVRYAELNYVKESEALESLGRKYI
                     DSLGNAMTATHFALEQSSMTGWASSNVFFVQLGQLFSELSAIGKAIAANLLSIKNSQK
                     VSHQLSEEKRRILREQRAAAAAAGVATSNVTYLFNGGGGVSPGASSPLATPSPAGLSA
                     RVSSPTEGPGRGSVNLDDLFH"
     gene            complement(<1030684..>1031238)
                     /locus_tag="LMJF_29_2340"
                     /db_xref="GeneID:12981095"
     mRNA            complement(<1030684..>1031238)
                     /locus_tag="LMJF_29_2340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722269.1"
                     /db_xref="GeneID:12981095"
     CDS             complement(1030684..1031238)
                     /locus_tag="LMJF_29_2340"
                     /note="previous protein_id=AAZ09691.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722317.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981095"
                     /db_xref="GOA:E9AE96"
                     /db_xref="InterPro:IPR002164"
                     /db_xref="UniProtKB/TrEMBL:E9AE96"
                     /translation="MELSQCATQAISKFTDDLESIDRKCEEETTALRLEYRSKMEPLL
                     MERRELLKGVTNFWSGVLSSPETPIAALLNGTIDPKIIRAVTDFQVVTRISENKLYRK
                     IIFTFRQNMFVEEGEISREVDTDMETTSLHPVKWKSGTERARTDSFFAFFTENFSSDP
                     EDVMEVTEALDTIYQNPFLAVEAD"
     gene            complement(<1031639..>1032481)
                     /locus_tag="LMJF_29_2350"
                     /db_xref="GeneID:12981096"
     mRNA            complement(<1031639..>1032481)
                     /locus_tag="LMJF_29_2350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722270.1"
                     /db_xref="GeneID:12981096"
     CDS             complement(1031639..1032481)
                     /locus_tag="LMJF_29_2350"
                     /note="previous protein_id=AAZ09692.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722318.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981096"
                     /db_xref="GOA:E9AE97"
                     /db_xref="InterPro:IPR009078"
                     /db_xref="InterPro:IPR011566"
                     /db_xref="UniProtKB/TrEMBL:E9AE97"
                     /translation="MRCTGTALLRHGSKALKCSPSRYTLTLTCGERATRLYSVSHSFF
                     PQLWCRFHSLLLSAILSSSFSFSNNAQSSSMKSLFHPSLAVLGPVFAIPLKQQKIDEV
                     VRVDHAGEVAAVRIARHQLEWMSPLDDAFPITQEILDDELVHQRVMSELAERHGVRTT
                     SLDPLFKLGAFALGAGTAALGKCAMMCCHAAVEATIFEHYNDQLRELQVLEDKCSDIK
                     ESEAEKTAWADVKNYIVKFRDEEKHHQELGEQNGADQAPVYPLLYNGIRLACKVGVAC
                     AKRI"
     gene            <1033812..>1035173
                     /locus_tag="LMJF_29_2360"
                     /db_xref="GeneID:12981097"
     mRNA            <1033812..>1035173
                     /locus_tag="LMJF_29_2360"
                     /product="aspartyl putative aminopeptidase"
                     /transcript_id="XM_003722271.1"
                     /db_xref="GeneID:12981097"
     CDS             1033812..1035173
                     /locus_tag="LMJF_29_2360"
                     /EC_number="3.4.11.-"
                     /note="previous protein_id=AAZ09693.1"
                     /codon_start=1
                     /product="aspartyl putative aminopeptidase"
                     /protein_id="XP_003722319.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981097"
                     /db_xref="GOA:E9AE98"
                     /db_xref="InterPro:IPR001948"
                     /db_xref="InterPro:IPR023358"
                     /db_xref="UniProtKB/TrEMBL:E9AE98"
                     /translation="MATIMSEHVVKMAKEFVNFMNQAITPFHAVQTVAKMLKDAGYTQ
                     LHEEKVWPELTPGGKYYLMRNGTSIIAFSVGGKFDPMNGVKIVGAHTDSPNFLLKPRT
                     KSTAADYERVAVQCYGGGLWHSWFDRDLTVAGRVMISRERLEQKIIKIDKPIMRIPNL
                     AIHLTSAKDRESFSPNKESHLIPIISTQIAARIAECDDKDASNPNHCVSLIKAIASVA
                     ECNPDEIVDFDLSVIDTQPAVIGGIHDEFIFSPRLDNLISCYCAVKAIIEADALENDT
                     MMRMVCLFDHEECGSSSSQGAAGSLVPDVIEHIVSNKTLRATLVANSFLLSVDGAHGC
                     HPNYADKHENAHRPALHGGPVIKYNANARYATNGLTAAVVKDVAKKAAIPIQEFVVRN
                     DSPCGSTIGPILSSLSGIKTADIGNPMISMHSIREMCGTVDVYYMTKLIESFFINYQN
                     PHE"
     gene            <1036099..>1036254
                     /locus_tag="LMJF_29_2370"
                     /db_xref="GeneID:12981098"
     mRNA            <1036099..>1036254
                     /locus_tag="LMJF_29_2370"
                     /product="putative 60S ribosomal protein L39"
                     /transcript_id="XM_003722272.1"
                     /db_xref="GeneID:12981098"
     CDS             1036099..1036254
                     /locus_tag="LMJF_29_2370"
                     /note="previous protein_id=AAZ09694.1"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L39"
                     /protein_id="XP_003722320.1"
                     /db_xref="GeneID:12981098"
                     /db_xref="GOA:Q4QEQ0"
                     /db_xref="InterPro:IPR000077"
                     /db_xref="InterPro:IPR020083"
                     /db_xref="InterPro:IPR023626"
                     /db_xref="UniProtKB/TrEMBL:Q4QEQ0"
                     /translation="MGRFKPLAVKKKYAKKMNQNKPVPYWIRLRTGNRIKWNEKRRHW
                     RRTKLNY"
     gene            <1036744..>1038516
                     /locus_tag="LMJF_29_2380"
                     /db_xref="GeneID:12981099"
     mRNA            <1036744..>1038516
                     /locus_tag="LMJF_29_2380"
                     /product="putative kinesin"
                     /transcript_id="XM_003722273.1"
                     /db_xref="GeneID:12981099"
     CDS             1036744..1038516
                     /locus_tag="LMJF_29_2380"
                     /EC_number="3.6.4.4"
                     /note="previous protein_id=AAZ09695.1"
                     /codon_start=1
                     /product="putative kinesin"
                     /protein_id="XP_003722321.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981099"
                     /db_xref="GOA:E9AEA0"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:E9AEA0"
                     /translation="MSAAADPTSRVQVSVRVRPLGKGDQKSGKIVVRGAEGGSVVVDD
                     EQRTKRAYHFDHVFSGDQAEVFEAIGRPMLREAYKGFNVCLFAYGQTGSGKTYSLLGD
                     LGCEERAGVAPRFVRCLFDEAQRMVDEDADLTIKVSLSMIEVYMEKVRDLLAPRQRGQ
                     EPESLEIHEDPSRRVYVRGASVHQVLSAERMMELLRKGNANRQTAETRMNETSSRSHA
                     IMQISLSQEFACVKKKDLECVVSLVDLAGSERQTKTESSGQQFEEAKKINHSLLMLGR
                     ALNSFSDRKGSDAFISLRESKLTRLLSESFGGNSKTWMLATVSPTAFNLTESISTLDY
                     ATNAMAITNKAKVNKSSKDLEYSDLVRLRQYLGGSVAREKCLVESYESQVAELRADIA
                     ALNRELLTLNNSQMEVELQEALTERDALVSEMVSQLAGVGVGGARAPLVCFCGTCKTS
                     LRSIPLGSYEVNTLVVPLYDLVGPPPLLQCNLHVLLTEANEVMVVVELVELHHLPDFA
                     TDGVRVSIWFEGQASSRVVTPIVSANGGNPKFNFKQVYIFGPMTDELRRFVSADVLYL
                     QVEGITSAADDSLERDDAEVRCLS"
     gene            <1040261..>1042030
                     /locus_tag="LMJF_29_2390"
                     /db_xref="GeneID:12981100"
     mRNA            <1040261..>1042030
                     /locus_tag="LMJF_29_2390"
                     /product="putative kinesin"
                     /transcript_id="XM_003722274.1"
                     /db_xref="GeneID:12981100"
     CDS             1040261..1042030
                     /locus_tag="LMJF_29_2390"
                     /EC_number="3.6.4.4"
                     /note="previous protein_id=AAZ09696.1"
                     /codon_start=1
                     /product="putative kinesin"
                     /protein_id="XP_003722322.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981100"
                     /db_xref="GOA:E9AEA1"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:E9AEA1"
                     /translation="MSDDAKSRVQVSLRIRPVKKGVRHRTKVVVRGAEGGSVVVDDEQ
                     RTKRAYHFDHVFSGDQAEVFEAIGRPMLREAYKGFNVCLFAYGQTGSGKTYSLLGDLG
                     CEERAGVAPRFVRCLFDEAQRMVDEDADLTIKVSLSMIEVYMEKVRDLLAPRQRGQEP
                     ESLEIHEDPSRRVYVRGASVHQVLSAERMMELLRKGNANRQTAETRMNETSSRSHAIM
                     QISLSQEFACVKKKDLECVVSLVDLAGSERQTKTESSGQQFEEAKKINHSLLMLGRAL
                     NSFSDRKGSDAFISLRESKLTRLLSESFGGNSKTWMLATVSPTAFNLTESISTLDYAT
                     NAMAITNKAKVNSIVKSLELKELKAVVSSLEKQLESLAAARDANEVDVSILQEEREAL
                     RLAVHTARSQGTAVQRLQSTLQHIQLSNIALRRRVEAAEKRIIWSLDNEASFLFYKGR
                     CAISLRGVLCGEKRAYRLALLAENGQATSTTLHVQVFSLSNDLTVREDPMELVGRSIK
                     FCLRIVGAEGLPPQFCRHSFCKLSLLFDQDNRYFTTSTAEDTANPRWDLIKRFELPHL
                     SPEVIAHFSTHHLFTFEVFGFST"
     gene            <1047493..>1048170
                     /locus_tag="LMJF_29_2400"
                     /db_xref="GeneID:12981101"
     mRNA            <1047493..>1048170
                     /locus_tag="LMJF_29_2400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722275.1"
                     /db_xref="GeneID:12981101"
     CDS             1047493..1048170
                     /locus_tag="LMJF_29_2400"
                     /note="previous protein_id=AAZ09697.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722323.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981101"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:E9AEA2"
                     /translation="MVTVPSASPKPKRAESIDAATTLLYVPLTFSLTLIPPPRPQDVG
                     KLVVVLDLDETLVYSRDNTVYKRPGVVQLLRTLKGKCEVIVWTAGTREYALDVIRTID
                     SVCAVQYCVYRHPMWWTGDIGCTKDLRLLGRPMDRVLLVDNTPSVFRANPLNSLLVED
                     FIVPHPRAYNAQEKTLLVLADIFEHVFRRFTSPCIADVLASKRISRQAIRLERGEFVD
                     LNVLTPI"
     gene            <1050575..>1051822
                     /locus_tag="LMJF_29_2410"
                     /db_xref="GeneID:12981102"
     mRNA            <1050575..>1051822
                     /locus_tag="LMJF_29_2410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722276.1"
                     /db_xref="GeneID:12981102"
     CDS             1050575..1051822
                     /locus_tag="LMJF_29_2410"
                     /note="previous protein_id=AAZ09698.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722324.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981102"
                     /db_xref="GOA:E9AEA3"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="UniProtKB/TrEMBL:E9AEA3"
                     /translation="MAQYKPMKSTVVATPYLFHGVAEQYLRIPCAAFLWYAFLSGALA
                     PFLRTADEAAVASCHFIAWRLLRWAHAYLCANGVFIVTLFLVWNIRCLIAPGPRQLSL
                     ADDYEEGNPAKVDKMAAFEYDTPADTYERVKMFCFMATGVAFVRIFTATTSIFLGLFT
                     ASVAGYLDRYTHPWWFGFWSRVTAFISIVAFSVLGVYNVQQYGQFATRSECKILIANH
                     SCVIEVIWVYIMGGFPSFVSRKENLSFFFFGNVVRGSSSILVDRDAARSREQAMATIL
                     RRAADPTAPQLMIFPEGTTGNQQALFMFKKGVFEAAVPVQMVCIAFPYKHFNPAWTGR
                     GVGGNGLWDILLRLSCQFVNYAEVRLLPVYHPTEEEKRDPKLYASHCQRMMATVLREN
                     ISHASFSDYKEAFRRFAELKKNR"
     gene            <1053941..>1055875
                     /locus_tag="LMJF_29_2420"
                     /db_xref="GeneID:12981103"
     mRNA            <1053941..>1055875
                     /locus_tag="LMJF_29_2420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722277.1"
                     /db_xref="GeneID:12981103"
     CDS             1053941..1055875
                     /locus_tag="LMJF_29_2420"
                     /note="previous protein_id=AAZ09699.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722325.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981103"
                     /db_xref="UniProtKB/TrEMBL:E9AEA4"
                     /translation="MPHCLQSESQGDAPLRMGFMSERERTGSGTATERSLHSSQSPQR
                     NAAASTMRTLPIYEALLQKGRLMQEHRERLRQEAIEREMREAPRSARRLPPKGQRIED
                     RLLQRAKEKHALEKKAEQVRVEREAEDLAVIAPFHPHISTRALETKSRYKEPPPDRAA
                     WRVRRLAELAQMCQSSGAEVLEELQDVPSINPRSAKLAALKKVREGLDGVPVPDALLL
                     SEDRRRLAQWQTAEAEREARSHTGPSITRRAARMRRVGSVGDRLHAESYEVAIRHLQR
                     EVAWREVHAPFRPLVTPLGAVTAPRYQREGGTDAHTRTLKGSRIFSRQSSAPRDSFQP
                     SINPVSAAIAQRLPETAMERLCRPSAVHSLASYVDPASFTDASGVSPSPSVAARSQTR
                     CCLLRTPSAHQQHGAVSNTPSSTSGALPSSVVASLDAYERRRQRQLEALRKEQAEHEQ
                     RECTFQPQINAQTSSLKDAVASGSGQRGPSAVARRSGEWQRQRERHLETMRQWQAERA
                     AAAEQTMETHVGGGARTAAASSSPLSYSVYGGDGTPWGVEEYLARQQLARAMRQRMQE
                     ALERHSVSVDGRGHPSTLSVPPPARKQMGLDHRVHSFSMLGRRSSLIRSLPPAVPTSQ
                     EAAIAHMFASAEEVSSGGCW"
     gene            <1057205..>1059490
                     /locus_tag="LMJF_29_2430"
                     /db_xref="GeneID:12981104"
     mRNA            <1057205..>1059490
                     /locus_tag="LMJF_29_2430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722278.1"
                     /db_xref="GeneID:12981104"
     CDS             1057205..1059490
                     /locus_tag="LMJF_29_2430"
                     /note="previous protein_id=AAZ09700.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722326.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981104"
                     /db_xref="UniProtKB/TrEMBL:E9AEA5"
                     /translation="MSTHFSSSKLASQKAAASLLVDDDAPYHDSRPIARLPLDDDGMA
                     VLPLPQAVQYATDSGSVSPLLSSDADEEPSNEIGKNATWMELRKCSYSTQPANHSGTH
                     TSQHDSHHGTRRSSASWTDGGSPQDRRTPLTHCTTSVDKRHIERLAQPRGAQGSLVRP
                     AEPNYGRLLNFTEEEEQARGRAQQHCRKSLRAPSSPITPSLEQTQSMGSQPPPSRPES
                     KHHAAVANAALLASQRAYYEKLAAPKKCPAAFAVGGAPPPSQTSSTTDAGTPTSLTSS
                     TAAAPRRGSSSIFDRLAVPKKPVAACSEEAMPLPERRPRSHSFYARVLTPPQHDLYLQ
                     CLSRPKNRSASSHRDPRAPVESNLHIPQKRYYGGTTAISVSPGTPASTGLPPPSSHAG
                     GRRNGRVPSASWEAVASYAERRPLSTAASCFPPSGLCAECGTALQQQTCTVSSQPTLS
                     GAAALHGVMVKQVAVLPHQPLPTAPATNGDGLVQVQSAPAKSTGSKPPIVVRTRRYVP
                     PSEEQGAEAAGQLASRAAKQESPAAPAPEPVEAVRRRTAIPTAPTEAKTTPASEKEQP
                     KMADTTPLEMPARAMPAPVAVQAVKRVSPAPAATAVTPASQRPIMPEASKRHTPAPCS
                     APVAPGPSRPEAPPQPTQVKSVHIHPSPSSVSVTASPSPKVVIVTPQAVAVAENRTVD
                     VASASAMKDVHAIPTPPSSDKKHLRKITHRKPNSVKLEVLRDADFACQLEVLPGTRQA
                     VSIAKKPYTMAKPTVKALSPK"
     gene            <1060903..>1063071
                     /locus_tag="LMJF_29_2440"
                     /db_xref="GeneID:12981105"
     mRNA            <1060903..>1063071
                     /locus_tag="LMJF_29_2440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722279.1"
                     /db_xref="GeneID:12981105"
     CDS             1060903..1063071
                     /locus_tag="LMJF_29_2440"
                     /note="previous protein_id=AAZ09701.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722327.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981105"
                     /db_xref="GOA:E9AEA6"
                     /db_xref="InterPro:IPR002073"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR023088"
                     /db_xref="InterPro:IPR023174"
                     /db_xref="UniProtKB/TrEMBL:E9AEA6"
                     /translation="MGSGNTKQPTAALTPTPSSSNEIQMHPGCKKTVDIFSSADHAEA
                     FTAAARLPAEAAPRPPPAVAPPHSPLTQTVVNTTTSGNAPKLLGKDKYVKEYGALAMS
                     NRARAVLLGTLFLFCDPETENTVVSYHDKSTGSVYARSYTDEELGQAKQAAGVAFSWA
                     PFFKSIATAVIKSKATVTSLDPTRKDANFTIFNSKEPSQTYPFVVPMDMVSDGSSPNG
                     REVFRFVVHPLTRALQYNRASGGSSVREACAEKLECELTVHTAVTKQHTAYVDKLLPT
                     VRPLREESALHSHRAMVVGREVRSLERRLKAREEHIVTKHPLDQLYDEGGAQSFQHTL
                     WSPEHIPHEEDPDEVLSFCIRCAFPLSPGMKLSDISGVLQRPEIRKQMETNGNGQVIA
                     EAFEIFKGIDRWDYDTIQLEIITDGNALFYTTYLLIYKLDLVRYFNLDDTVLRRFLVA
                     VQSAYHPNPYHNAMHGADVTQINYYIMMVAGLSEKCRLSKEEIFAGIIAGAVHDFDHP
                     GLNNNFHSRTRAYLATLYNDRSILENHHLACTFELLRNPRYNIFATLSDEQRLLVRET
                     ILEMVLATDMGNHARIFKNFQVRMSETSDWHSKKEDVRLALSMSIKMADISNCARPNH
                     IYAEWAKNISKEFYLQGDAEQKLNLSISPFMDRTKEAEEFPKGQVSFIMYIVQPMVEA
                     ISALLPFMTFAVNMCIDNKEYWRRKTEEAQEADSLEEVRD"
     gene            <1068270..>1068737
                     /locus_tag="LMJF_29_2450"
                     /db_xref="GeneID:12981106"
     mRNA            <1068270..>1068737
                     /locus_tag="LMJF_29_2450"
                     /product="putative heat shock protein 20"
                     /transcript_id="XM_003722280.1"
                     /db_xref="GeneID:12981106"
     CDS             1068270..1068737
                     /locus_tag="LMJF_29_2450"
                     /note="previous protein_id=AAZ09702.1"
                     /codon_start=1
                     /product="putative heat shock protein 20"
                     /protein_id="XP_003722328.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981106"
                     /db_xref="InterPro:IPR002068"
                     /db_xref="InterPro:IPR008978"
                     /db_xref="UniProtKB/TrEMBL:E9AEA7"
                     /translation="MWSPSNKRDSLINSDDTFFPFLFHFPGSHPRQMLSSFFASRSRG
                     SWIPAVDISEQDDGYILVADLPEVKKEDLRVYTESSSIICISGNRKHILKQDEHQLLV
                     AERGAGRFERCFDLPTSVDSSKIKASFNDQQLNLSIPKLRNSKSGASNSVTID"
     gene            <1071545..>1072207
                     /locus_tag="LMJF_29_2460"
                     /db_xref="GeneID:12981107"
     mRNA            <1071545..>1072207
                     /locus_tag="LMJF_29_2460"
                     /product="putative 60S ribosomal protein L13"
                     /transcript_id="XM_003722281.1"
                     /db_xref="GeneID:12981107"
     CDS             1071545..1072207
                     /locus_tag="LMJF_29_2460"
                     /note="previous protein_id=AAZ09703.1"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L13"
                     /protein_id="XP_003722329.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981107"
                     /db_xref="GOA:E9AEA8"
                     /db_xref="InterPro:IPR001380"
                     /db_xref="UniProtKB/TrEMBL:E9AEA8"
                     /translation="MPKGNNAIPHVHQKKHWNPCSSQKGNVKVFLNQPAQKHRRRRLR
                     LLKAKKVFPRPLKALRPQVNCPTVRHNMKRRLGRGFSPAELKAAGLNPQYAATIGIRV
                     DSRRKNKSEEGMNVNVQRLKTYMSKLVLFPMNHKKVQKGEASEEEVKAATQDRSRFGD
                     AAVGAVVYPSAEAPRAVSAEEKSMCVYAFLKKNHSAVRFFGTNSSRAARKEAAKEEKT
                     GK"
     gene            <1073615..>1074277
                     /locus_tag="LMJF_29_2470"
                     /db_xref="GeneID:12981108"
     mRNA            <1073615..>1074277
                     /locus_tag="LMJF_29_2470"
                     /product="putative 60S ribosomal protein L13"
                     /transcript_id="XM_003722282.1"
                     /db_xref="GeneID:12981108"
     CDS             1073615..1074277
                     /locus_tag="LMJF_29_2470"
                     /note="previous protein_id=AAZ09704.1"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L13"
                     /protein_id="XP_003722330.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981108"
                     /db_xref="GOA:E9AEA9"
                     /db_xref="InterPro:IPR001380"
                     /db_xref="UniProtKB/TrEMBL:E9AEA9"
                     /translation="MPKGNNAIPHVHQKKHWNPCSSQKGNVKVFLNQPAQKHRRRRLR
                     LLKAKKVFPRPLKALRPQVNCPTVRHNMKRRLGRGFSPAELKAAGLNPQYAATIGIRV
                     DSRRKNKSEEGMNVNVQRLKTYMSKLVLFPMNHKKVQKGEASEEEVKAATQDRSRFGD
                     AAVGAVVYPSAEAPRAVSAEEKSMCVYAFLKKNHSAVRFFGVRSARAARKEAAKEEKT
                     GK"
     gene            <1075716..>1078250
                     /locus_tag="LMJF_29_2480"
                     /db_xref="GeneID:12981109"
     mRNA            <1075716..>1078250
                     /locus_tag="LMJF_29_2480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722283.1"
                     /db_xref="GeneID:12981109"
     CDS             1075716..1078250
                     /locus_tag="LMJF_29_2480"
                     /note="previous protein_id=AAZ09705.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722331.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981109"
                     /db_xref="UniProtKB/TrEMBL:E9AEB0"
                     /translation="MQRFSHFLIQDSDSDTAEEAAPRASQPTNAADGSSHGSAVHECA
                     SNDTLHSLPRNTENEAPTATQAAAPQAAPPLEHTMERDGLPTFPPHVLPPTSPDPHML
                     DGSAAYQDSLLSSSHQYASASAAARGAPSSQQRDAADAEAHDSMRSAHASNVPPHADE
                     VVAPPTQKKASACCGIFFCCKRRKACACCRLFSICKRKRTSATVRDSEAQSAQASAEE
                     TISIEAQDSPAHLVAARATEGSSEGALSIPVAEGAASPKHSSSQSSKTNCAQSKEEEE
                     VEGEEASLQRSRHESSAHAFAEHSAPNAAEDGGASEHSTLPVPSVLQGPDAVHKEPDD
                     PATAAAGSGDAEKPATKGRHVKRVKALVRRRRSNLAKGSGDSAGPAGSDKASDNSEGE
                     QRSAHSAEARVAKASEALSAPLDRAKMSSAAATSASSFKAKRPSPHSHAAVTAPDSPT
                     HTGSGSYKGSGSYSYSYGYSSSYSASNSLAASRTASSSIGSAQKPVASDAPRRRSAQA
                     SSARSGVRSAHVASSASKRSHKPTSILLQEELPLSMPAYRRRVLLDLRARERRDAEEA
                     AREWRDLTFRPQIHNPYNDCLDASPAVTTDRSHSPFSESHGFPMHFSPSGFSEPSPGC
                     YRIRRVSPRLLQSRRAPQQPAPPPFKPVISEYAKNSVVPKFNVFTRLYKPRSSSPPAP
                     GDTYPHKPEISKLTCELYTRRRAEGDDATPPRRSVFDRLYNVRRSPSSSPTKSPSRSA
                     MRQPPFKPQITERARRLSAMLPKEPFGDRLYRHSRLSRCVNHSPLLAREQFRGDYGTE
                     QVMTNDRSKDRSSWSSESSIEVRGTATASADLDRRFSQTQATLEEM"
     gene            <1079976..>1081331
                     /locus_tag="LMJF_29_2490"
                     /db_xref="GeneID:12981110"
     mRNA            <1079976..>1081331
                     /locus_tag="LMJF_29_2490"
                     /product="putative protein kinase"
                     /transcript_id="XM_003722284.1"
                     /db_xref="GeneID:12981110"
     CDS             1079976..1081331
                     /locus_tag="LMJF_29_2490"
                     /EC_number="2.7.11.1"
                     /note="previous protein_id=AAZ09706.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_003722332.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981110"
                     /db_xref="GOA:E9AEB1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9AEB1"
                     /translation="MRSTMSRYQCFLCQLQTLENDLNFCVCCRAAVCAKCTQACYPNR
                     KCVGLCVRCTPPDYGFACGRCRRHISYGDIEFFCDMCAVPICFTCVASGTSFECGQLK
                     CSLCCECPMSQAPRNLVIRREVDDAMLRQLPIPLVSSATPLAVPPPQARVAAAAVAAT
                     KCTKYRKLFGREKLGEGAQGVVYKCHTEENEVVVVKEMVFNDTDVTAFEAQARQVERM
                     RQLNHPHLIRYLDVSVQKDPLRICVVMPFYSEGDLKKFIERQRKPVTEIKLCSIVLQI
                     AGALNYLHQQEPPLVHRDIKPENILLLNHEEQVLLMDLDLCRTVNVTSSVIKRRELSP
                     TYEYRAPELEKSHGDTKADVFSLGVVMFVLATLPDFPCVRTDSGEMLVFSASKWSPSS
                     LKRAIQREIRRVQRYTYSEEFIRLVVAMLVHQPAARPTSMAVIHRLQKIMEQRLMEGK
                     E"
     gene            <1083192..>1084529
                     /gene="VPS4"
                     /locus_tag="LMJF_29_2500"
                     /db_xref="GeneID:12981111"
     mRNA            <1083192..>1084529
                     /gene="VPS4"
                     /locus_tag="LMJF_29_2500"
                     /product="vacuolar protein sorting-associated protein 4"
                     /transcript_id="XM_003722285.1"
                     /db_xref="GeneID:12981111"
     CDS             1083192..1084529
                     /gene="VPS4"
                     /locus_tag="LMJF_29_2500"
                     /note="previous protein_id=AAZ09707.1"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 4"
                     /protein_id="XP_003722333.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981111"
                     /db_xref="GOA:E9AEB2"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR007330"
                     /db_xref="InterPro:IPR015415"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9AEB2"
                     /translation="MSVDFTAKAVELFKKAATLDENKEYEQAYRWYMETIDVFLTAIK
                     YENKNPTKREYMRSKVSDIIARAEKIKEFLDRSKDGDGANQGGSGATAQKTASASRKA
                     KEDDEDKQRMRSSLGSAIVKVKPNVHWDQIAGLEAAKQALKESVILPMKFPQLFTGKR
                     KPWRGILLYGPPGTGKSYLAKAVATEADGTFLSVSSSDLLSRWLGDSEKLVRSLFEMA
                     REAYKTGGKPSIIFVDEIDSLVSARSDSENDASRRVKTEFLVQMQGVGYDDEGVLVLA
                     ATNIPWSLDSAIRRRFERRIYIPLPELQARVQMFKIHLGDTPNTLVDEDWLELGRRTE
                     MYSGSDIENVVRNALMECIRTLQVATHFKRVVGPDPHDPTRMVKNRLLPCSPGDPDAF
                     PMSAVEITEPELLMPMPVTKEDFIKALRTSKPSVNDEDIERHVKFTADFGQEG"
     gene            <1087351..>1088811
                     /locus_tag="LMJF_29_2510"
                     /db_xref="GeneID:12981162"
     mRNA            <1087351..>1088811
                     /locus_tag="LMJF_29_2510"
                     /product="ATP-dependent phosphofructokinase"
                     /transcript_id="XM_003722286.1"
                     /db_xref="GeneID:12981162"
     CDS             1087351..1088811
                     /locus_tag="LMJF_29_2510"
                     /EC_number="2.7.1.11"
                     /note="previous protein_id=AAZ09708.1"
                     /codon_start=1
                     /product="ATP-dependent phosphofructokinase"
                     /protein_id="XP_003722334.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981162"
                     /db_xref="GOA:E9AEB3"
                     /db_xref="InterPro:IPR000023"
                     /db_xref="InterPro:IPR012004"
                     /db_xref="InterPro:IPR022953"
                     /db_xref="UniProtKB/TrEMBL:E9AEB3"
                     /translation="METRHHLNTKMVPSYQAPLSKVTAADLTVERLPGCKYMNPSKKH
                     ILRKEYRDKVEHIMYDPRPQEDLDAEYPVSCNKLVCELAAARKHLHFNPSETSIGIVT
                     CGGICPGLNDVIRSITLTGIISYRVKRVVGFRYGYWGLSKEGSKTAIELSRTDVRQIH
                     RFGGTILGSSRGPQSPKEMVDTLVRMKINILFTVGGDGTQRGALTIYEEAKRRGENIA
                     VFGVPKTIDNDLAFSHRTFGFQTAVEQAVNAVRAAYAEAVSLNYGVGIVKLMGRESGF
                     IAAQTTVASAQANICLIPENPLPKETVMRLIERRLQQSRNCVIVVAEGFGQDWETGTG
                     GHDASGNKKLVDIGFILKKEVEGWLRANKEKFPQGTVKYIDPSYMIRACPPSSNDALF
                     CTNLATLAVHEAMAGATGCIISMRYNNYILVPIKAATSVRRVVSLRGALWRQVREITV
                     GLSDDVQQWNEQDLRRHLESLNVERERIIARLASKV"
     gene            <1092841..>1094049
                     /locus_tag="LMJF_29_2520"
                     /db_xref="GeneID:12981112"
     mRNA            <1092841..>1094049
                     /locus_tag="LMJF_29_2520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722287.1"
                     /db_xref="GeneID:12981112"
     CDS             1092841..1094049
                     /locus_tag="LMJF_29_2520"
                     /note="previous protein_id=AAZ09709.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722335.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981112"
                     /db_xref="GOA:E9AEB4"
                     /db_xref="InterPro:IPR004181"
                     /db_xref="UniProtKB/TrEMBL:E9AEB4"
                     /translation="MSADAGHDVHHAYDVLRGIRRVRTTAQLQEACDGLLAFVRTTHQ
                     LVEAQAAKNAAPGMKDTSEAYLQVSSNPSAEAQAAMSQLKQVSLLCGAFCRRVEHVLR
                     TTYTYADVDDASHGGLSTVHVSAYMAQLTKELQRFNTPAVNHFLAAATKTDALSTSTL
                     YVSSVDCVLSYGIGDLCDYRLCRRKRAQAYLQQLLAQPQWNAAAITQIIVSLNETLST
                     PVDPFAVCTSDESVEATCVVTPLRDPISQTVIRIPARGEKCVHLELFDVESFVQATQQ
                     RSFNTVDVGAPCPLCSRTVHLLSIRVDTRALEAMRSYERAATAAVSSSSSSDAPPPLT
                     ADCALEWNTDSRTVMVVRGRRGASAEESAVGEDQEEPATPSRGQRADASDTVTKKRRI
                     EIGGHVLYAD"
     gene            <1095274..>1095477
                     /locus_tag="LMJF_29_2530"
                     /db_xref="GeneID:12981113"
     mRNA            <1095274..>1095477
                     /locus_tag="LMJF_29_2530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722288.1"
                     /db_xref="GeneID:12981113"
     CDS             1095274..1095477
                     /locus_tag="LMJF_29_2530"
                     /note="previous protein_id=AAZ09710.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722336.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981113"
                     /db_xref="UniProtKB/TrEMBL:E9AEB5"
                     /translation="MKKSISLKEFSTTPTVSYMLSKDGHNVAAAADAQSRSMNLPPQP
                     LRVERPKQQQPVPDSDDTMYEME"
     gene            <1098157..>1100073
                     /locus_tag="LMJF_29_2540"
                     /db_xref="GeneID:12981114"
     mRNA            <1098157..>1100073
                     /locus_tag="LMJF_29_2540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722289.1"
                     /db_xref="GeneID:12981114"
     CDS             1098157..1100073
                     /locus_tag="LMJF_29_2540"
                     /note="previous protein_id=AAZ09711.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722337.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981114"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR023267"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9AEB6"
                     /translation="MSRNQNRKGGSKRGRADEWMTDVRDPAALQNTAFEAYYKGNVIP
                     ASEWEAFMACLQTGLPMSIRFNCAVPQVDAVDAFVTQHLSEVFESTRIPFFPAQRAIQ
                     FGVSRGDLKRKKANRTLKKIVSAMNEGGYLTRQETVSMLPPLLLQVESGMRVLDMCAA
                     PGSKTSQVLELLLAGESGRGVVVANDVKASRLDVLHHQTNRAAGAHLHLIITNTDATR
                     FPLLPLAERFDRVLCDVMCSGDGTLRKSIDMWPRWDSLQGANLHHTQMRVLLRGMASC
                     KSGGIVVYSTCSLNPVEDEAVVSACLAQTEGTFELIDPTPLHHGLCASPGMTSWTVTT
                     RDLTTALRNYEDAKAFMEAQTDRRTFQYAPTMFANTELLVDQHIERTRRILPHTQDTG
                     GFFVAALRCVAAVPEDARARAESAADAKGTEAPLKPLSAGMRATLQKALALPETFPYD
                     NLIVRNEEARNQKVYLANSDAISLSQQLGCRVVHVGSKVFESVLKYSNEKLRFCTDGV
                     ADLVPFLPANFLVSVTPSLLLELAAETPMPYADFSAKTGQLIEELPPSFVLTTSWAVG
                     GPIYVAAEKSTKLGKLVAHVAGWQVTVCKLALGLPLVESVEEEQEDAAEEGDAARENA
                     SALTADAATHYKDG"
     gene            <1102676..>1105297
                     /locus_tag="LMJF_29_2550"
                     /db_xref="GeneID:12981115"
     mRNA            <1102676..>1105297
                     /locus_tag="LMJF_29_2550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722290.1"
                     /db_xref="GeneID:12981115"
     CDS             1102676..1105297
                     /locus_tag="LMJF_29_2550"
                     /note="previous protein_id=AAZ09712.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722338.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981115"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="UniProtKB/TrEMBL:E9AEB7"
                     /translation="MTAVAATTSITTTRALDEFRSGNVDTAQLILEEAAKSEHNVNEL
                     LSIHCMRATLAAMKGSMDVTAITAQLAPGEPVRVPVQSYLEGIAAMARGDLTTARRRL
                     ETAVERCEGFGAAMVCLAAVYYLTSQYEKSYAQYCCTLKMFGSEKTPPVVRVGMGLCA
                     FRLQRLVDARRILERAIEVHPDDELAWLGLLAVYIDLRMLPQIHTAVMRLKQLMPQNT
                     TVLLKVCDLAYFRSLEDGRLKSSMGRLRSLLRYVRQTASPEEMALVDFHEGRLLLACG
                     EVAAAQPLLESAVRANPNLLAARIHYARLLMHANRHVDAETLLMEVNRTWPNEKEVLQ
                     MLAILATRAGRHNEALRYSHTLTMTVAQGDVNSWALAAVCSRLDTGHCGRICAHVRAV
                     QRELKLPSSWKLSANLAILSGDVEALQGIVDAELGAAFLMSNTAVDVSYVPLLYNLAL
                     LLEKREPVRARQLYVYLVKHHSTFAAPYYRLHFLAKEAGQLQQAMAWLQWLLKVHPME
                     AAAQTCMAQLYMETSSAKEALAIFKKVNASELQLPVALAVGATSLQACQQSSSQWPKL
                     LASARSFYRKALAKDPRNILAAHGYACCDGLERRGDAAEAMLNSVSEVTPLSTVPTSN
                     VDAHRANVKMLSHGYKQAADYFARMPTRTSEQDAMYSYCIATEGRYAEALELIHTASI
                     KAPGEDPMLVYNTALLHFMAFVDGLKGTRALTAAQGESLLAHLEAGQQGTTFLDGIKG
                     KYELMSRAKRYLRSISAYCERHRATVHTLVEAGQQRAKELAQAEEGWRRVFALHKAEQ
                     ERRQEEEELAEHQKAEERKLTEADVYARFRQSRIQQPAVLLNADLLAATMADAMQDTM
                     PVDEPPAALGEEEDGMP"
     gene            <1106309..>1107550
                     /locus_tag="LMJF_29_2560"
                     /db_xref="GeneID:12981116"
     mRNA            <1106309..>1107550
                     /locus_tag="LMJF_29_2560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722291.1"
                     /db_xref="GeneID:12981116"
     CDS             1106309..1107550
                     /locus_tag="LMJF_29_2560"
                     /note="previous protein_id=AAZ09713.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722339.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981116"
                     /db_xref="InterPro:IPR029358"
                     /db_xref="UniProtKB/TrEMBL:E9AEB8"
                     /translation="MPANAGQRCSHARKLYLYFLLHLPHTRVFPPLPLTLPPPTHTCV
                     YVLLQFSLLHSPAFAVGLPFLESSTAAKMTDKSVYGGLFQDPPYLSSDPDPKKTDPYD
                     KKDAIPSRYLGKNMTIGGRVPPGQHPDAYFDKRFLTLASSEQNGGKPVDYDESKQRTA
                     ASRTNTKNAISDKEFCYSSYPEKSTGPGSYYGCFQNRPYEYMTEPWDDGKSKKKKRAP
                     KPKEEEPTHLPNIKTNPAKKGTYGYPGLLLSNPSYNDDWKKDYAAAEANRARRERKQG
                     PAPKALGPPFHIPGVSHSYIDEMPNTGVSAVYAAYEAPADSAAEKRKAKREAAAAPTL
                     VHERAFYGSANRSGEPGCLNPFPNLWVHPDETQPSKIALRKQAQKEKEEAARQPKRTE
                     VWRPNSFGKTSVVSSCLRRFY"
     gene            <1109576..>1111081
                     /locus_tag="LMJF_29_2570"
                     /db_xref="GeneID:12981117"
     mRNA            <1109576..>1111081
                     /locus_tag="LMJF_29_2570"
                     /product="putative serine/threonine-protein kinase"
                     /transcript_id="XM_003722292.1"
                     /db_xref="GeneID:12981117"
     CDS             1109576..1111081
                     /locus_tag="LMJF_29_2570"
                     /EC_number="2.7.11.1"
                     /note="previous protein_id=AAZ09714.1"
                     /codon_start=1
                     /product="putative serine/threonine-protein kinase"
                     /protein_id="XP_003722340.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981117"
                     /db_xref="GOA:E9AEB9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9AEB9"
                     /translation="MAQVAEESRALESHVFRNKYRQIKSIGKGSFGEAVLVRSKLDGK
                     RYVAKAIDSISMTPKERRDVQNEIRILAAVDHPNIIRYHEHFEDDTLIFIIMEYADGG
                     DLSFRIKEAKKQDVPQPFDPNLAMFWFLQICMALKYLHDNHILHRDLKTANIFLTSKN
                     VVKLGDFGISTILQNTMACAKTVCGTPYYFSPELCQSKPYNNKSDVWALGVVFYETLT
                     LHRPFNAKTLKDLLKKILAGNYDPIPTTIPVEMRSLCASLLQVNYMQRPSINRILESP
                     YVQSTLRSFSEDLARQVEKDRSDFEAKKLSEREKHAQSSPLKEEVARMPQEPAKPQLS
                     EREQMAMLRGMDREKMKAMLAKQAAEEKSAPKTATAPEQMGHPDVDDDGDYIAQKKAM
                     VENTKEIVGKSNLGGHPEEFGDGPADSAPQVETITMANGRTVLASRVRDHLEKEMGFE
                     LLNRAVELYNSGMMSGLTNSEMQHELTELLGPAFAHNANAITKLAVWEGKQ"
     gene            <1114337..>1116370
                     /locus_tag="LMJF_29_2580"
                     /db_xref="GeneID:12981118"
     mRNA            <1114337..>1116370
                     /locus_tag="LMJF_29_2580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722293.1"
                     /db_xref="GeneID:12981118"
     CDS             1114337..1116370
                     /locus_tag="LMJF_29_2580"
                     /note="previous protein_id=AAZ09715.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722341.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981118"
                     /db_xref="UniProtKB/TrEMBL:E9AEC0"
                     /translation="MAHMGFDGADVPFCDLRAAAPRPAESAFAAPNNHAWSAPSPSSP
                     YDANESGEGWRYVRRIANLAYNTVSGVLGVLHARPPGEANASTDNNASAKAFPHPTVH
                     PNTPHISAATPAQSYSGAPRPSEETRVADTIELRRPRRSTAQYHVPPPQPPVSEPALQ
                     ARGAPLTYPSAREAPQCQITVNQYFAAPERSIYPMVFAHADEAATYRGAPAYPSRASL
                     LTAPSSLQVHAKRPRLASPPAATAESRMRKAPKTATDNDACDASLSNAPSAIPLGSQE
                     NSLTVPIGSLATVRLFGKAKAFSNDDASVAAKPAAPLADVPTAKAPPFGGTATPTAAA
                     AAPNLFVFGSKSAEMIPARSVPAAPAFGAPKTNSFVKAGPPAVIPDDGTFAPNADSDD
                     DDKGNDKGTKPSKESSAPARAPFSFNPVGVKPAFGATPPLSTGAPANPFSFSAKPAEK
                     ADAPAAPAFGAPKTNSFVKAGPPAVIPDDGTFAPNADSDDDDKGNDKGTKPPKESSAP
                     ARAPFSFNPVGVKPAFGATPPLSTGAPANPFSFSAKPAEKADAPAAPAFGAPKTNSFV
                     KAGPPAVIPDDGTFAPNADSDDDDKGNDKKAKTESATPVGSSGAFSFNLNSNCAKPTF
                     GSGLAFGGSSSLGASTGVSGTAANPFSFPNHPKPIGSFGTSCSPSFSFSTSKK"
     gene            <1118442..>1120529
                     /locus_tag="LMJF_29_2590"
                     /db_xref="GeneID:12981119"
     mRNA            <1118442..>1120529
                     /locus_tag="LMJF_29_2590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722294.1"
                     /db_xref="GeneID:12981119"
     CDS             1118442..1120529
                     /locus_tag="LMJF_29_2590"
                     /note="previous protein_id=AAZ09716.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722342.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981119"
                     /db_xref="GOA:E9AEC1"
                     /db_xref="InterPro:IPR003533"
                     /db_xref="UniProtKB/TrEMBL:E9AEC1"
                     /translation="MSTAARREEIQRQLQQLRDTRERELAAFDAVAAAHPELSATEIT
                     ALAQKKAEAEVPQRISVGGVEVSVGARVSVKDDVHLLHRADRGYFAADPLKAVYLGEQ
                     GQVMRVMKSFQGKPAVELRFADGVIKVFFVECLALSQESEDTGAGTSGRATARHTDPT
                     RGVKSVSSAKVLLPPPSSPQAEALPGWGHLRMPHRRPSAPSSAAVAPAFIPPPPPPTV
                     QEALGTAAKRAAPTPARASSSFPAPAAPATSQAAEQPAKKVISEARKKPTAALPTARP
                     IVKKEPPRGPCRPSPVVHVSSHPPTVTVDLAQLSLLPAVAIDAVADEGLGSPLSCSMQ
                     DNVPRRTSTATDSEGIPDLRPTPSSSMCDIDALVDAETAADSAGAAAAKAACLHKAFT
                     TPNQTSPYLRDEVTTLTRRRSSGADNSGTRLCWLAGLTEPGGNLSEPLRISLQAQCTT
                     MFAVFAVVTRKLRWDKQRLTATRLFTDKGVEIKSAGAVHDDMRLVATTGCAYKCDGVT
                     SHFATVGYARPSFTAQSRATKTPCTRPTPAAASVPVPPAAASSSAPSTTASSSTPASP
                     SRKAAAVPQQSTTATVSKRLAPSPLTAAKPIHIRVYENGVYDDNIYRTVTVRPTYKTL
                     ATLKTVITRELQWRDGKRVSLLFDASGTEVVDLRDLLDGDAVVASAGDRFVIPYPNTA
                     IHREAMKLSERLR"
     gene            <1121651..>1124021
                     /locus_tag="LMJF_29_2600"
                     /db_xref="GeneID:12981120"
     mRNA            join(<1121651..1121913,1122782..>1124021)
                     /locus_tag="LMJF_29_2600"
                     /product="putative poly(A) polymerase"
                     /transcript_id="XM_003722295.1"
                     /db_xref="GeneID:12981120"
     CDS             join(1121651..1121913,1122782..1124021)
                     /locus_tag="LMJF_29_2600"
                     /EC_number="2.7.7.19"
                     /note="previous protein_id=AAZ09717.1"
                     /codon_start=1
                     /product="putative poly(A) polymerase"
                     /protein_id="XP_003722343.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981120"
                     /db_xref="GOA:E9AEC2"
                     /db_xref="InterPro:IPR007010"
                     /db_xref="InterPro:IPR007012"
                     /db_xref="InterPro:IPR011068"
                     /db_xref="UniProtKB/TrEMBL:E9AEC2"
                     /translation="MERAAEVTLIRDAFPHFNFAADAAASTALRRATDAFSMENTDEV
                     VRLVRQLLEKMLQAEPSAAAAWTQVYVFGSSGLDAAITGSDIDLIALCSASVNTSLFF
                     QTFPRSAEGRLQNVVVVTSARVPLIKFSYNGVHVDLLFASVDMRTAPDTNELLRDDFL
                     SLVSLPCRATVNGIRTILEIRRRLPLLLAAYACVLRAVKYWAAQRQVYGNLYTFPNGV
                     CLAIMVARACQLCPVADSGVILRFFFSLYVWWLLRDTRIAPVSIVPMDENAAIARVPG
                     MPPPWDAVWDAADLFPVLNPARPTVNAAHAVGRSGLQLFLKELLRAEQLCALVPMSYS
                     ALWAPYNILDEHRFFVGVHISSEHQSLAACEEAINAWKGYVESKLRMFVYALECVAEV
                     RPFPRPVVDEPPRAVTRRGVTVHCRSRAFFFGVRNGNNDVAHSDVEAAFREFEFAVTE
                     GTTGKNPFEWNRSVMLGPRLSFFSIYDPLTADSPCQALYSACAEMMGSSV"
     gene            <1124684..>1126840
                     /locus_tag="LMJF_29_2610"
                     /db_xref="GeneID:12981121"
     mRNA            <1124684..>1126840
                     /locus_tag="LMJF_29_2610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722296.1"
                     /db_xref="GeneID:12981121"
     CDS             1124684..1126840
                     /locus_tag="LMJF_29_2610"
                     /note="previous protein_id=AAZ09718.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722344.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981121"
                     /db_xref="UniProtKB/TrEMBL:E9AEC3"
                     /translation="MSFFANPLADEEEVVPPDYPLEQYDELKREDDFNELLVRSTKLE
                     CRQSGGDDASTNPELEACLGRTRQLRASLENSWLRMSELQVEATGGARSSPTVETSSL
                     STPASLLGALDSAITQVHHHVTQRERLSQHLSALVEKEAAQLCSSASHLLTATAPHGT
                     GASMLRALDAPNLAWPPETGSSPHSSEVICERAAGAVRALEALLPSMSMEEAALASAA
                     AQQLSYGLQSLSTLKQRCDALRITVGVKSQEEAEAHCAAEAFARWTAQRQLACSESAA
                     SSASSPVAAVPSFDIATAECLNKEISEENGRLEAVLARLVATQSLDRAQRDAFTGSAL
                     VQYVALATYARELEEEVDRLGRAVLYLRGILAEPSASELWGERRDGSPAAASTQSASH
                     EGEERLARRLSRIHAVEKELRSLQAADGGAATANDTVATILSFGLNRLLEVHNVCLHA
                     MALLSTYFEKQSGSAAFLSHALRGGGAVEDATVERVLDVQLPDAELVRQCCADMRGAS
                     VDLGATLKSIVDQSIVTSTAHFTRWQAVRGLLTELLQYSLAAMPDVHAEFSALLADYA
                     EPKTPSATAASANSAATSQVHVDLDWATAVLTEEAKAFADEKRAQLELIKAFWAEQQI
                     EVNKKMAWLAKQPNTPLLMQLCDVERGNEQLRRQLASMQEASEDVSVLHNTLAELERR
                     TSEEARLNAGLRAELEELEAARGELELQRDMLLSSL"
     gene            <1127366..>1127734
                     /locus_tag="LMJF_29_2620"
                     /db_xref="GeneID:12981122"
     mRNA            <1127366..>1127734
                     /locus_tag="LMJF_29_2620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722297.1"
                     /db_xref="GeneID:12981122"
     CDS             1127366..1127734
                     /locus_tag="LMJF_29_2620"
                     /note="previous protein_id=AAZ09719.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722345.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981122"
                     /db_xref="UniProtKB/TrEMBL:E9AEC4"
                     /translation="MPCQIGQNNWILTDSPVCYVTPNLRLHQCSCPLTTCTPTAAGYG
                     CHLTSSVMILSGVLVVVWILAACAYVYVLNFVGELELEARAEKVVSLSRNYYYHKLFG
                     TGSPMLPSSVYVPDRKFHSE"
     gene            <1131003..>1134701
                     /locus_tag="LMJF_29_2630"
                     /db_xref="GeneID:12981123"
     mRNA            <1131003..>1134701
                     /locus_tag="LMJF_29_2630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722298.1"
                     /db_xref="GeneID:12981123"
     CDS             1131003..1134701
                     /locus_tag="LMJF_29_2630"
                     /note="previous protein_id=AAZ09720.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722346.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981123"
                     /db_xref="InterPro:IPR001660"
                     /db_xref="InterPro:IPR013761"
                     /db_xref="UniProtKB/TrEMBL:E9AEC5"
                     /translation="MSPPFPSHALANVAAVAAAVAGAAALTWGVLCWHRHQQGHEGTG
                     TPTGTWTIQQVAAWLRENGVSKSSVAVCCRYKVDGDTLMRLTAHDLYHMGVPLRDSRV
                     ILAAVEDVKGSLVLLSSASPRSVLRRQSSLSPRTAQVTVPSAAEQFEAAWRALMRTCA
                     LPASGTSPAEQQQRLAVYTGTLLESFQVLTASEQAAALSLVAEAEKVHVIPPAIVSQE
                     AQPGPADTEAPVDASFPVQAVEEKLRPLHGMLDGFLDFLRSPDLDAVAPAEFEELGDR
                     VAAQVKRILRVAEQLPPKLSGPLLRKCDGVFEALSSRQRTALGASGGEAAGKAKLMQA
                     LRGVLSTVEDPKLRELPVAQRVQALSSLAKRAEAIEAVAAGSVSGVPKDVEVLNMVQP
                     LLRIIQEAICLSEREAEADEEDREGQAPAAEDADAADGPIPVIVGTVQDIQDTLQSEA
                     FQHAPSAVKVELCTTLLQRVAALEDKLVEVPAPAQAMVRDLLLNTKNVLAVVIAATKT
                     EGDDGGEGPPADDEKPETEQDGDGDAEAAQAEGEKRETQSSDTSIDAHVAQLEKIFDF
                     LTSDELDQATMEERKKVAVKLRQRVEAIKADVAARDPQCTLVTELIAPLQNLLSEMGS
                     NHAASREFLEITAPLSDVRRLLTSTSFQQLPHAGKIRIARNVVPQLHQLTSAFSSLSK
                     SERATAEELLRPINEVLLHLMHPRGAATGSAQEVLDRLQAVMRTIQGAEFTTMSPTER
                     SAWATNTVTDLGRLRADCAALGAEGEALLPIIERLRSQLTGLLPEHANAGGGEGRDDS
                     GDAECSGETQREQEEDAAHLVWAAARDMHAELLAAERTATPVPPERLQRMLHVMGEAA
                     ELPGMSTQQEAELQQFGSLLRRHVEGVGGKVNNGSTSARVDGAEQDFDEATAALHAFR
                     RSLQVLMDAVQGENAATATELSVVASKTEELLASADAAKINWRADSWCTGAVRSISET
                     LQHLRGSGGGASRAKVPSKVEAVLQSSIAALIAKPPTSMEDFEPYLRLLQLAQPSAEQ
                     MTNRELMLLKSLQESVIEAMRRIPDQPRQNGERNRQGTDDEGAGSAQAVLGVPQKMSH
                     KRREGSSLAEQLDDSENVQQDLERLLAGERVTVEDAIEALREQICLQPGALDRGKAGD
                     EEEVERAGNEEDDACVSQSEAQRADKQTPDPLQPERTDAFNEDDDDGVGSSGAAAMSG
                     PSSGSARHIGYDDEFDGEDKTHSSTSAA"
     gene            <1136575..>1137900
                     /locus_tag="LMJF_29_2640"
                     /db_xref="GeneID:12981124"
     mRNA            <1136575..>1137900
                     /locus_tag="LMJF_29_2640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722299.1"
                     /db_xref="GeneID:12981124"
     CDS             1136575..1137900
                     /locus_tag="LMJF_29_2640"
                     /note="previous protein_id=AAZ09721.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722347.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981124"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9AEC6"
                     /translation="MSEAARTTRHYVSDCLEERYPYDASKGFAGIRQREAGRVFNGYG
                     SAAVDDMMNSLTDPSVPTEEKTRAVHLLYARSASQETKIEMLTKGMVPLLVATLQQCP
                     DLLLKHQCLLLLRSLGVLPQGCFAVVREGAIPVVVGALHTVSPSSGSSEAAQACCIAA
                     AHVLFQVSSNMSGLRWMLSLAHDRAFEGIEAAWVGDPMAPKTLISFIADSLAREATPA
                     KATTYLIQTLARLTSLARGAEAFLAVSDAVDVMVEYLRHLPSPSTQDSELCAATLEVM
                     WNTTLGHAGAAVMEERGVPDILFELLVDTSGSAAQVPVCVQRQLTGALSAVSQLTSVK
                     QRSTHAVSMAEGRTRIVVLLDYLREWNKLIATQYTNASRPIPNDAAAIVTNLVQCIRL
                     ASELKPVRDVTHAIVEAMEQEDTTEAFYFRRQLYFHTRWEAEYHASVEV"
     gene            <1139011..>1142130
                     /locus_tag="LMJF_29_2650"
                     /db_xref="GeneID:12981125"
     mRNA            <1139011..>1142130
                     /locus_tag="LMJF_29_2650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722300.1"
                     /db_xref="GeneID:12981125"
     CDS             1139011..1142130
                     /locus_tag="LMJF_29_2650"
                     /note="previous protein_id=AAZ09722.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722348.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981125"
                     /db_xref="GOA:E9AEC7"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR025977"
                     /db_xref="InterPro:IPR027165"
                     /db_xref="UniProtKB/TrEMBL:E9AEC7"
                     /translation="MGTHKKAAAVSSTDTFGEVGRIFQQVHQSAAHAQKCKKKLISLG
                     QESAPQLCRDVCGVVLLILKQVAQIAPEAMRRHYAFVTELCKAFRESFESDQLAIELL
                     KSVSAFHNAMDKAVRLAVVSTFEALLKTVDQSNVSEERQDFYQEAAELLKQRAHDKCP
                     QVRAKAVASVAAFQSGKKDCDVTQQLIALLCCDTNADVRKQILHAIAPRKEFLEGYFH
                     GIIRCIRDVVARVRAEAWDVLGRFPWRYITAYANAKGVKMPELLAAGLDDANASVVIA
                     CRAAITNSWVHRDCKDLYEDFMNSIACGYVLPSLSPYERISAELLAHARKRQANTHFL
                     LKLDDINTAGLLLWKADCRVSCDTEGEDETQLLLPLGQFSTVLQDTVYAYARPDAEPK
                     TVKFRSVEDADNMLRILLSVFDIYDDNAYLAHADNTTRASLLRLINFILKVVPDEDPS
                     LFVDVAVRALKSLTARTPEEATKTITSALDSLFRSLKLPQRHSLGFDDVEAIGRKSRE
                     RQQELVKRKVLWRAGELTEESYTELKEEMDRDEKFLLRMQLIVLAFLSHSQRGDAIPM
                     FCYHIIQMGRHLDNEKVRVAATKSLCLQCLINPECVHTFMPLILADSQENAGGAVEAD
                     MSLPIAAIGVIFDLIMEYGLRFFDVAKRPPNEARALYNSESETEARLQHEQELAEEDV
                     HKVGSKRLLATLQSYLQSGNEAKHIVTASGFCKLLSCNRLPAEVVPHVVAVLLIHYTG
                     AMASKKESTTAAYMMDYLGTFFRSYAASHPKRQAQICEGGITAFRVVLERNIAMASRL
                     IEFVARLTDAYTLTAIRDIDPQAARRATRDVVDEAGGAAEEVEAQRKSNRANATRSSM
                     QSGRLFRELSRHSLHERLSQELLIVLASSELAESRAACMDALEKCMYFYSLEPQPFLL
                     HCTAAALEATRHAAPIVHDRLEAWQTKLCERCTAAAAAPQSNGTTSDADSADSLEQRW
                     CEGLKAHEEKRDALLEAGFGGFASIPPQLDVASPVMVKAETAELKRERHSDVFDVESI
                     VGPSKRSRY"
     gene            <1143317..>1146178
                     /locus_tag="LMJF_29_2660"
                     /db_xref="GeneID:12981126"
     mRNA            <1143317..>1146178
                     /locus_tag="LMJF_29_2660"
                     /product="putative helicase"
                     /transcript_id="XM_003722301.1"
                     /db_xref="GeneID:12981126"
     CDS             1143317..1146178
                     /locus_tag="LMJF_29_2660"
                     /note="previous protein_id=AAZ09723.1"
                     /codon_start=1
                     /product="putative helicase"
                     /protein_id="XP_003722349.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981126"
                     /db_xref="GOA:E9AEC8"
                     /db_xref="InterPro:IPR006555"
                     /db_xref="InterPro:IPR010614"
                     /db_xref="InterPro:IPR013020"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014013"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9AEC8"
                     /translation="MVAEVDVSGITVSFPFDPYPAQVEFMRSVVKCLQNGFNGLLESP
                     TGTGKTLCLLCSTLGWLSATSQGAVLRHASDQDQKGRGKHNHKVVYCSRTHAQLTQVV
                     RELKRTSYAQRFTMAVLGSREHMCLNKEVTRLPSSQAQHAMCSALRLERNCRFFSGLQ
                     SAAAGASLLPPECAVHDMEDLMREGSRSGFCPYFHERDAAKDADVVLMPYNYVLDPSL
                     HKQLPFELANCILIVDEAHNLPSVLSSSGCQTLSPLEVTTAIHDCSRAIAMHRITTKK
                     AELDEDMAAEEELELASLKILLRRLEMCVYAEPMAEGTATPTPTQCDVVRDGSYMFAF
                     LEKALITREVFGVQSDGVTSASGLAGTMGKCVTLLADSERPATSMARVQEFLTRVFAF
                     DMAHLDSTRFVLQQHLVAAKAARTLGFWELDNTRLMRQVVSPLHSVLLTSGTLSPLDQ
                     FAAELGMEFQVRLKGKHVIQADQVLGGVLCRGPSGEKLNGGFSFRSSVDYRVGLGMSL
                     ANIARNTPGGTLVFFPSYASMNSVVELWRAGSGRAGDTKTVWGMLSELKPIFVEPNNS
                     NDLPTIVQGFQKEVDTSPLRGAILLAVCRGKISEGIDFADNHGRCVLVAGIPYANHTD
                     LFVRLKRDYITSVAPQRPLVHGKPFTGDDWYRNEAMRAVNQCVGRVIRHKDDYGVVLL
                     ADERFEGLLESVSEWVRRRTRVFSDFRGAYAAVAQFFGARRHRATETAAIPYVLIENN
                     ATAAAELPSSATLARLYADAQARQREEHVQETRRRRFEEVREAKASACNDAVASATSP
                     FAPASFAVSSTTGCAGGAPAISQRTFAEAPEVTVVLAERETADMRDTVPIRRSDGPPK
                     LGPTSREFCEFLKARVPVEAYHRFKMVLAQLAALRPLLRTSPTAAADGLARLFVPLRS
                     IFGATDVAYHHSLFAEFGRHIPEEFRPLYADLLKSNGLM"
     gene            <1147409..>1148974
                     /locus_tag="LMJF_29_2670"
                     /db_xref="GeneID:12981127"
     mRNA            <1147409..>1148974
                     /locus_tag="LMJF_29_2670"
                     /product="putative serine/threonine-protein kinase"
                     /transcript_id="XM_003722302.1"
                     /db_xref="GeneID:12981127"
     CDS             1147409..1148974
                     /locus_tag="LMJF_29_2670"
                     /EC_number="2.7.11.1"
                     /note="previous protein_id=AAZ09724.1"
                     /codon_start=1
                     /product="putative serine/threonine-protein kinase"
                     /protein_id="XP_003722350.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981127"
                     /db_xref="GOA:E9AEC9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001245"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9AEC9"
                     /translation="MPGKAAAAEQRMRDYEVFEHLGSGATSDVYRVVNKTNNRTYVLK
                     KMSLANMSDEEQLRAKQEIIVMDNVDHPNIVKFRESFMDPADNSVDIIMEYCEFGTLE
                     DLIERQRHESRPFPTDVLLEWMAELLCGLSHIHSNRILHRDLKTSNIFVTSKNHLKLG
                     DFGVCTILSNPNAKAESMIGTPLYFAPEVCNSDPHDERSDVWSLGVVFYEMCTLRRPF
                     EADNLFTLVQLILESDIEPFGNGVDSSLEGLVRQMLDRDPSRRPTAQELIDVHLEVPV
                     SHPSHPSQKPSRGRLLQQFSGPELQYTKKWPPPEGTVPVPPKSGKARATGEWIHTGSA
                     LDVFVELQRTLHRIPTAAKAKDGAAFTPASQSAPGAALNVSSAVTKPKPEKSAKKSTG
                     AKGTAGTTTASSPLSRTKAIEHAGVQKEDAALGSLLLSFTMRELQLDVQRRRTSMFGE
                     EKSLNSDDIPLVIEVQGESFSEATATKDTVSFLADIAAVIDRHTANGGQITLEALDGA
                     ACLLSEYKHLKYA"
     gene            <1151847..>1155101
                     /locus_tag="LMJF_29_2680"
                     /db_xref="GeneID:12981128"
     mRNA            <1151847..>1155101
                     /locus_tag="LMJF_29_2680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722303.1"
                     /db_xref="GeneID:12981128"
     CDS             1151847..1155101
                     /locus_tag="LMJF_29_2680"
                     /note="previous protein_id=AAZ09725.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722351.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981128"
                     /db_xref="GOA:E9AED0"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR002073"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017455"
                     /db_xref="InterPro:IPR023088"
                     /db_xref="UniProtKB/TrEMBL:E9AED0"
                     /translation="MSLMPGYPVPRDQWVESAEACAACSKRFTFFAFKENCPCCGRLF
                     CSSCLSAQCTLFPTAPPKAVCLDCFRKAQDWRLSQLEQQQQQQATTQADVGAAAAPLS
                     TSMEVLESKLSALEEEFDRAKANARHLREENDSLIDLLAAKDSCIAKLRDKLMETGVS
                     AGTVAQSAEKLQAELQEAKDEKESFERRLKEAEQIAASAAQANEAMKAQIQEHMQAKA
                     EWESLEAKLKSEARKAEDMLAQSLEEVSELRTAMKSTNAHSEEQIKQLTAQLQSTVEA
                     NAHLQRDYDRNVVALRTAEETRIASDAHHDEELQRLREHLATATAALAQAQERYERQP
                     MGAMKASDDAATAIAAEKQREIDTLNEQLTLSSAAAQRLQGELDRAVKEIARLREEAA
                     LKAEAASTLTSELRTQLEAEGRAAQQEVLRQQEANARLRADLEEKGRLVTKLQRDCLR
                     AATTARAQLDDLHGKLAETKVTYEEGQRSWQAWLGELRAALEVVMQQGAVEVAATSAS
                     STGAGMNGGGTTKSRWAQPTIIEELQYPCVADLDVRAIEPVPGLELWEFDTVAEAQRG
                     GEADVLLRVGHQIALDLHLFPDRTSLHRWACLLATVQANYRANQYHNRVHAADVLQGV
                     YAMICSCPGLLPHMTTVEKRAVVFAAAVHDIRHPGRSEVFLKNTFDATYVHYNGLQVL
                     EQMHTATAFHLLATPELDFTRGNMDDTEALEFHGLVAALIGCTFMGRHASLMEQWSRP
                     LQDGKTYDMAVTADRQQVLSLFLHAADIGAQARGLTVARKWLGIVEEMRAQGDDEAAR
                     GLPLSPGSSRSASLERGQIFFMEMFVVPLFDLVHQMFPSIESPMRNLRTVHAHYCAAL
                     QETRAFPPPVQYRTATQPASHTTETSRAEALGIREAAVRKQEKAVKQSINQLREATAA
                     VAGREKLLREREVALMRAEAALKSPRNEKPSVTTPIDEEELLRAIAAVMAREAEVQRR
                     VADVETMTAALEERETIASRLSEQLAAIAEKINRRRRVLRYREARVRELEAAFRGERG
                     ADLSSSDYITGHMCRAVAKPLSTAAPLERMSPSSVKVVKLESALEKLTSALRYM"
     gene            <1156013..>1156939
                     /locus_tag="LMJF_29_2690"
                     /db_xref="GeneID:12981129"
     mRNA            <1156013..>1156939
                     /locus_tag="LMJF_29_2690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722304.1"
                     /db_xref="GeneID:12981129"
     CDS             1156013..1156939
                     /locus_tag="LMJF_29_2690"
                     /note="previous protein_id=AAZ09726.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722352.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981129"
                     /db_xref="UniProtKB/TrEMBL:E9AED1"
                     /translation="MDSTDRKADKALVAPPKMDSAVKGAKPGSFALSDVVTGYAGAED
                     GPLVQQLPMPSHIMPYYGQYPAMCALPPGAAPMGFPMPPQTGVGSPQMWMPGMVPPPP
                     GANPNATLTPHPYVSQYGAGAQPVMYMPMSYSYPPCMAATAVTPAAAMGASFNGQQPA
                     KPAPQGATPPYTSTMAAPPHPHSNAAETPVLSSPFMDASSANSTAPALPVAPVPVPVP
                     SMTPIEFSVMPLMPNTKLPPGDPFCPAGATVPSQYATASAACFSDAAAVDASLSPRPH
                     PSNGVTNDFPTMSQQGESQTIGVAAAAGLSVS"
     gene            <1157939..>1160917
                     /locus_tag="LMJF_29_2700"
                     /db_xref="GeneID:12981130"
     mRNA            <1157939..>1160917
                     /locus_tag="LMJF_29_2700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722305.1"
                     /db_xref="GeneID:12981130"
     CDS             1157939..1160917
                     /locus_tag="LMJF_29_2700"
                     /note="previous protein_id=AAZ09727.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722353.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981130"
                     /db_xref="UniProtKB/TrEMBL:E9AED2"
                     /translation="MWFSKARRAFCLSAYRRSPSFLELYGRARSTEVAAAPLAPQPSC
                     STAPVDEGWERCQALLQHFQAHVYIHPGHVPVQLCRETLRGIEQVLASSPARRSTAAR
                     RLWMDALALHSHLPRHDVRAAADVASVLLFSDQAQLGCRVCLQAASHPQFLQALRSEA
                     ELTGCLRLLSVYSMCACDSRAGFSAHWAAVLADSLGEAKRVIAAADKSKRAPMAHAME
                     VLAWSLDWLHHHSCTSDRDALEALKTTLPRWLPFLFDECDAATATPSWQSLAVLPPRW
                     LLAMATHAESDSDAATLERLLRHALGREEQCHGYAVFQLSSRVASLLVRRFPHHPSAA
                     HAVAALGTALQCSSLIPYGTTREGFDKALGVLTRMSGAQPYFAMQELLRSHSVEAAAK
                     IQEQHGDRLTGNADLNWSTALTFTMRQVEAANPHWRVYLPETLRLLSDAGKSKQFWSL
                     LQEYNAADAAANISVAASLSRTMQLSGRWWHAMEVLDLLAGALPPRDATEDQLMTSAC
                     AETLRALLQAKRWQEALRVFLVVGDALPPTESAVVSRLLTSMSMSAPWRAALAAAAEK
                     GLASDTTRIILRCLHAGASTAVLSYYHQQKMAAPIFAQHGRWDLVRTLVEQRPTDVSL
                     WRALVQAMEHCADAVDEPTAATVFPVPLPQGHWDDMSFVNAFARLCVQRGWLSLLSSH
                     LSCLLAPGVSPATPVSRLRVEYEHLLRFLQLNRLPPAQFAFTDSYVVHQFISCVTSRR
                     VSVVAKLPAASASTKRQASAHLRVPYENLSAPRLEGDGTSTVRATSTRASTCLKEHCV
                     CSSARGLIVGYKVPASALFASASGLLKVLGNSGVYCLAYHMSVASSGLFLLYPASASL
                     TWYSVKLRVRLCVAVVPAAPYVPLLATSFFDRYAMRWRSGEGDRHEVEALLVAASGQE
                     VPRAWRSLKMDLNAEGWGPVEPEAGAGDMYHILELQVSHRAPTNEGDAIPADVQVFAC
                     RERSLRPLSADASEAAEWGL"
     gene            <1161642..>1162478
                     /locus_tag="LMJF_29_2710"
                     /db_xref="GeneID:12981131"
     mRNA            <1161642..>1162478
                     /locus_tag="LMJF_29_2710"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722306.1"
                     /db_xref="GeneID:12981131"
     CDS             1161642..1162478
                     /locus_tag="LMJF_29_2710"
                     /note="previous protein_id=AAZ09728.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722354.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981131"
                     /db_xref="InterPro:IPR006626"
                     /db_xref="InterPro:IPR011050"
                     /db_xref="InterPro:IPR012334"
                     /db_xref="UniProtKB/TrEMBL:E9AED3"
                     /translation="MPSQTIVVGPQADAHATTLAAALEHAAPGDTIVVSPGVFEETVH
                     LPFNVTITAAPVPEDSDDTNAAHATIIGTVIISANVTLDGLEVRGMADVRKGHAILEK
                     CDVHHGSDGVRVHLGATATVRNCRVHHCIAGGDGVYFMAGSFGEVTQTDIFECRVNAL
                     HVQSSEAVLRENRIRDCTFGVYYEKKASGLCEQNTIEHVRKFGLYVTDGSDPVIRDNT
                     VRWCGILCFFASKGGRGTCSGNTFEGSLHVLADCFVHLTENHVSGTADIDVAASSVKV
                     AG"
     gene            <1163609..>1164580
                     /locus_tag="LMJF_29_2720"
                     /db_xref="GeneID:12981132"
     mRNA            <1163609..>1164580
                     /locus_tag="LMJF_29_2720"
                     /product="putative serine/threonine protein kinase"
                     /transcript_id="XM_003722307.1"
                     /db_xref="GeneID:12981132"
     CDS             1163609..1164580
                     /locus_tag="LMJF_29_2720"
                     /note="previous protein_id=AAZ09729.1"
                     /codon_start=1
                     /product="putative serine/threonine protein kinase"
                     /protein_id="XP_003722355.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981132"
                     /db_xref="GOA:E9AED4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9AED4"
                     /translation="MSLRSAMHASDVDDAGRALQSTQRSVVSISRLTNEMSEVCDMSE
                     GSFGVVKCYRHDSDKLEYAVKQTKRPICGESNLQQQLQEIYALSSFPHRHIVRYFDGW
                     VEDRAVFVRLEKLDDCVASLPPPVSESVLTAMLHQTSTALYELHSHGVLHMDVKPENI
                     LTRQLDADTFIFKLCDFGLARPLNGRDSVTGEHFLGLNDDDGDRRYMSPELLKNLQDV
                     VGPPADMYALGKTCEAMMTATEDPSNTSARHLESYSPAFTALIESMLREDPARRPSAF
                     QVVQATLPERLLGDGRLLELQCRLDAIRCEISELDASDNDVMSSPRS"
     gene            <1167252..>1168352
                     /locus_tag="LMJF_29_2730"
                     /db_xref="GeneID:12981133"
     mRNA            <1167252..>1168352
                     /locus_tag="LMJF_29_2730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722308.1"
                     /db_xref="GeneID:12981133"
     CDS             1167252..1168352
                     /locus_tag="LMJF_29_2730"
                     /note="previous protein_id=AAZ09730.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722356.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981133"
                     /db_xref="GOA:E9AED5"
                     /db_xref="InterPro:IPR002913"
                     /db_xref="InterPro:IPR023393"
                     /db_xref="UniProtKB/TrEMBL:E9AED5"
                     /translation="MDKDGERYVECKGTRYALMTLPHFRKFRDLALSSDSAWKTHYSD
                     SVLKVESKPPGDGSTNLNIIRATRIMKNVPPGVLYNQLHDAQYRATWDTNMLEGYNIV
                     QLDKHNDIGYYAVKFPWPLSNRDFCNMRSWMEFANGEYIIFNHSEPHPDCPVKKGFVR
                     ARSILTGFYIRPILGERGTQLVYVSHSDPCGSIPHSVINFAMTKGARMILDNCEKYSE
                     KYPAYVAKMYPADHVYPWRTLKMDWDSPYLYPEDVPPSTEPATEHQQPEAGGSGGEKR
                     EGDERSGEENAVPFLSSTPGPLGTSLPLAPVAPYRITDLLSVQQYRSIMQDAMSAVDR
                     SFLREGRVPTTKEYILRLKYMIEGIRQTTVDV"
     gene            <1169535..>1170506
                     /locus_tag="LMJF_29_2740"
                     /db_xref="GeneID:12981134"
     mRNA            <1169535..>1170506
                     /locus_tag="LMJF_29_2740"
                     /product="putative actin-like protein"
                     /transcript_id="XM_003722309.1"
                     /db_xref="GeneID:12981134"
     CDS             1169535..1170506
                     /locus_tag="LMJF_29_2740"
                     /note="previous protein_id=AAZ09731.1"
                     /codon_start=1
                     /product="putative actin-like protein"
                     /protein_id="XP_003722357.1"
                     /db_xref="GeneID:12981134"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="UniProtKB/TrEMBL:Q4FXC8"
                     /translation="MEATYIVDCGHHTLKYAGLSKWNRKTVEVLVKERRNECDAFVAD
                     DERLRQCVPQLLSGELRADEELTLILLLDTFHSQKSKAALLYSCFEQFGCKKVCLHYT
                     ASAGLYAAGETSGVVVDLGYAGAQLTSVQQGTVQTAMSTRLSSVGTRSLDGELHRLLR
                     GDMTEATLHLVKTHCCSLMERDELVPELTLPDGSVFPYDDRTRSELHRATSALLYSTT
                     SSIPDTLRTVYQKHSIRFPDSTSWVQLGGGSLISGVDEVLTTAMAHPLFRHAPKQLHL
                     KDVTHAPVSGGIILSQLNVFKSMCIGVSDYEEYGPDGCLRMQVVDAR"
     gene            <1171276..>1171497
                     /locus_tag="LMJF_29_2750"
                     /db_xref="GeneID:12981135"
     mRNA            <1171276..>1171497
                     /locus_tag="LMJF_29_2750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722310.1"
                     /db_xref="GeneID:12981135"
     CDS             1171276..1171497
                     /locus_tag="LMJF_29_2750"
                     /note="previous protein_id=AAZ09732.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722358.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981135"
                     /db_xref="UniProtKB/TrEMBL:E9AED7"
                     /translation="MMKVLSVLKHRARARLELARSRMQLRNVCDFEVIGRSCGLLLFP
                     FIVYVCVGQMQGYGESQIRDRIASRKDVP"
     gene            <1172418..>1174124
                     /locus_tag="LMJF_29_2760"
                     /db_xref="GeneID:12981136"
     mRNA            <1172418..>1174124
                     /locus_tag="LMJF_29_2760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722311.1"
                     /db_xref="GeneID:12981136"
     CDS             1172418..1174124
                     /locus_tag="LMJF_29_2760"
                     /note="previous protein_id=AAZ09733.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722359.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981136"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:E9AED8"
                     /translation="MITTSGRVVRKGGNAPSSRKAPPPKQTPQEQIEDALQARDFSKA
                     TTILEFYKTSGQSLGYLSLNEWLGYSAFHANDMEKAIEVYKGILALDDCAPINHTYLG
                     CCYYMNGSFKEAEECALRGPECPLQTRLMLHIAQKTHDEEKLMIYHGKLQDTIEDQLS
                     LAAAQYIRNHYTEAIEAYKPILAQTREYKALNVYVAMCYFKLDYYEVSVSVLNVYLQS
                     YSNSAVAINLKAANHYRLFNNRAAKSELKLLIDLQRTTYYVETDIVKHNLVVFNNGEG
                     ALQVLPSMLDVGIPEARLNLVIYHLRHECITEAYELMADVVPLTTQEHILKAVVNAYV
                     GQNMESQEHLKVCKEIFNYVGSSASDRDTIPGRQCMASYFFLLRDFPNVLIYLRSIKP
                     YFSKDDTFLYLYGIACAGIGDYAEAEQSLLAVSSEKIKAEFSYTSWLVRSHIINKHPK
                     MAWDIYLKKEMGESIGILRLLANDCYRTSAFYYAAKAFDVLERLDSDPEYVEGKKGAC
                     IGVFQQVFANEEPAESLFDVMKMIEASLQRHADEPPVMQQFSNMLALMKDWAKDAKLK
                     RR"
     gene            <1175105..>1175719
                     /locus_tag="LMJF_29_2770"
                     /db_xref="GeneID:12981137"
     mRNA            <1175105..>1175719
                     /locus_tag="LMJF_29_2770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722312.1"
                     /db_xref="GeneID:12981137"
     CDS             1175105..1175719
                     /locus_tag="LMJF_29_2770"
                     /note="previous protein_id=AAZ09734.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722360.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981137"
                     /db_xref="GOA:E9AED9"
                     /db_xref="InterPro:IPR009003"
                     /db_xref="UniProtKB/TrEMBL:E9AED9"
                     /translation="MRTHGLAVVPSIVQPSPFLIRAICALYWKDTFLGSCVAIAPSIV
                     VTAGHHYNAVRDDVGDFSVLTRPGHWAAVEYASKDSTYDVVVFWLCEEVTTHTSLRGY
                     LPAVGAQVATVWLSPKPPHDAIVSPGVVIESEAERCVARGTVSMTGSSGAPVVDVFGE
                     HIVGLHLTSNTRDGSRVSGFIPSRKLVSLFAEMWVEHARVLSSA"
     gene            <1176105..>1177208
                     /locus_tag="LMJF_29_2780"
                     /db_xref="GeneID:12981138"
     mRNA            <1176105..>1177208
                     /locus_tag="LMJF_29_2780"
                     /product="mitochondrial carrier protein-like protein"
                     /transcript_id="XM_003722313.1"
                     /db_xref="GeneID:12981138"
     CDS             1176105..1177208
                     /locus_tag="LMJF_29_2780"
                     /note="previous protein_id=AAZ09735.1"
                     /codon_start=1
                     /product="mitochondrial carrier protein-like protein"
                     /protein_id="XP_003722361.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981138"
                     /db_xref="GOA:E9AEE0"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:E9AEE0"
                     /translation="MVSAVSLLVQILVICWPRRLGDHLPNRSNADLNKLSLYLLPARF
                     TQRPQQRIWQQYTICVLFACPSVTAYLFAVRCMSDSTSPTTSAAQHGALQFSLEELAA
                     GGIAGFAEHFVMFPCDTIKTRMQCGGARSICHVVRHLWSHERLTHLYRGCVPVLVSAI
                     PAHGAYFSVYEALKRLFGDDTNMGIAAAASFSTVAHDTVSTPFDVIKQRMQMDKHRCF
                     SSSVECAKRIVRTEGVGALFASLPTTVIMNIPHFSAYWLAYEGFLASRGHGNVRNHQD
                     EMTVDYMAAGFVAGACAAVVSFPFDTVKTYLQLGHGMGFRHTLRELIQLRGMRGVYSG
                     VVPRILYTAPSGAIMMVTYETVKSALASDKSLF"
     gene            <1180469..>1181047
                     /locus_tag="LMJF_29_2790"
                     /db_xref="GeneID:12981139"
     mRNA            <1180469..>1181047
                     /locus_tag="LMJF_29_2790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722314.1"
                     /db_xref="GeneID:12981139"
     CDS             1180469..1181047
                     /locus_tag="LMJF_29_2790"
                     /note="previous protein_id=AAZ09736.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722362.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981139"
                     /db_xref="UniProtKB/TrEMBL:E9AEE1"
                     /translation="MSGSFALRKLLFDIDDEEDVNRRGYHYAGAYAPLLHSVAVLQPA
                     AVLPKSGLPFACLCLFSSFATCLTMKVRNKERWWMGVFAICAVYYNGVKAHKVNNGLV
                     GHQSGFFAAGMGAIGCVARLMAKCGSARMNAGCLGLFTALMWYEIGRYHLWAEHVTEF
                     RRDVTPERSYDLLGDYVPQSLEVEFLPYRTVT"
     gene            <1184172..>1185173
                     /locus_tag="LMJF_29_2800"
                     /db_xref="GeneID:12981140"
     mRNA            <1184172..>1185173
                     /locus_tag="LMJF_29_2800"
                     /product="putative inosine-adenosine-guanosine-nucleoside
                     hydrolase"
                     /transcript_id="XM_003722315.1"
                     /db_xref="GeneID:12981140"
     CDS             1184172..1185173
                     /locus_tag="LMJF_29_2800"
                     /EC_number="3.2.2.1"
                     /note="previous protein_id=AAZ09737.1"
                     /codon_start=1
                     /product="putative inosine-adenosine-guanosine-nucleoside
                     hydrolase"
                     /protein_id="XP_003722363.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981140"
                     /db_xref="GOA:E9AEE2"
                     /db_xref="InterPro:IPR001910"
                     /db_xref="InterPro:IPR023186"
                     /db_xref="UniProtKB/TrEMBL:E9AEE2"
                     /translation="MPPKPVIIDHDGGHDDLVALALLLGNPEAVKVIGCIVTDADCFV
                     DQAFSVSGKLMAMMHAREATELFPVAKTSFKGVNPFPSEWRWSAKNMDDLPCVNIPEH
                     VAIWEAVRDENDALVGEEVMAQLVMSSPEKVTICVTGPLSCVAWCIDKYGEEFCKNVE
                     ECIIMGGAVDVKGNVFIDGRTDGSAEWNIFWDPVAAKTVLTYPHLKKIVFSLDSTNSV
                     PVTSEVVQKFGAQNKYLLSQFVGSAWASCTHFELIRPGDMYYAWDVLTAAYAIEQRLA
                     ELEAVPLDVVVEANAPNEGQTRRAAEGAAVKNTYVAKNTNADMFYRMVMDTARCCPV"
     gene            <1187858..>1190074
                     /locus_tag="LMJF_29_2810"
                     /db_xref="GeneID:12981141"
     mRNA            <1187858..>1190074
                     /locus_tag="LMJF_29_2810"
                     /product="ribonuclease inhibitor-like protein"
                     /transcript_id="XM_003722316.1"
                     /db_xref="GeneID:12981141"
     CDS             1187858..1190074
                     /locus_tag="LMJF_29_2810"
                     /note="previous protein_id=AAZ09738.1"
                     /codon_start=1
                     /product="ribonuclease inhibitor-like protein"
                     /protein_id="XP_003722364.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981141"
                     /db_xref="UniProtKB/TrEMBL:E9AEE3"
                     /translation="MDAAMDSEGFALGPVAASRHANPAVAASLPRLTATMVKQSSQSM
                     RDSYEAELYRFKSTKSQAFLQDRQAYTTNLPRLLPEGIPYTANFISFDHLRECGALSE
                     MLQNQVSISTEDLRLLYEARCLDQDLPPSWQREMRFMELISAKCKGRFFCLPENGFGV
                     CSAEALAAVLSRNSHYSVLDLSGNRLRDDGARFIAHLIKRNRTLVHIDVASNDIGHVG
                     GVLIARALLENNTVISLDIGARAGVNGNHIGTPGAEAIGEVLRSNEVLARLNVSSNGL
                     GAGGVAFIASALERNSSLTRLNLSSNNLGLEGARVLASALEAAHVTHWELQRNHLDDK
                     GGACFLNALAGAIRNGYDVVEYLDLDNNALGEGSAEAVGKVLAVSGSLTTLRLSGNPL
                     GAGVKAISTGLNENHSLSSLHLSMCSIDHIGAAALGAVLCVNHTLRHLDMSNNRVKDG
                     GAVELAKGLAVNKCLTSWNLSSNRIGHAGGLEMAKAVQKNRTLRHLNLRRNLMLEATG
                     EAISDSFRANNTLERLDVAYNNFSYVCAMSIERALERNRASNKTLLVPKLQANIDALA
                     PKENELERAGEDIEVEKRMVRDRGEELIRRGEEARVVSEKLRREIADLERVFEKASAA
                     SDAAENLFRLTEDRVTNSLTELKMKRTNMDARIQQEKDRLDRLHRESEKIRRQIKHLE
                     EAENERLAPLLRDLDGTERDRTQEMADAKFEGEKLAALELQRKELQIAAGRRAKKK"
     gene            <1190827..>1191561
                     /locus_tag="LMJF_29_2820"
                     /db_xref="GeneID:12981142"
     mRNA            <1190827..>1191561
                     /locus_tag="LMJF_29_2820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722317.1"
                     /db_xref="GeneID:12981142"
     CDS             1190827..1191561
                     /locus_tag="LMJF_29_2820"
                     /note="previous protein_id=AAZ09739.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722365.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981142"
                     /db_xref="UniProtKB/TrEMBL:E9AEE4"
                     /translation="MPRLLHGSQRAGEEHEAEKLTKSLPRTASDLAAQSLANLWRRLF
                     QSYVHFTQPGCLPFVADVATYSEGVDSVADSDTALDALWAAGFDASSTPDALIVHLFL
                     ANKHLDAVSWIIAFCLVDRLQLSHYVRQRLRELSFLQQREDSSNCFLRLAREHVPQLL
                     FTAYSLAFKWHLDYTVSVKYLTNLLPHTRSARGRILRCTIKEELVILETLEFNCAVSH
                     DHLLQLMDHFLTASERRYVLQVVHRV"
     gene            <1192663..>1193295
                     /locus_tag="LMJF_29_2830"
                     /db_xref="GeneID:12981144"
     mRNA            <1192663..>1193295
                     /locus_tag="LMJF_29_2830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722318.1"
                     /db_xref="GeneID:12981144"
     CDS             1192663..1193295
                     /locus_tag="LMJF_29_2830"
                     /note="previous protein_id=AAZ09740.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722366.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981144"
                     /db_xref="GOA:E9AEE5"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9AEE5"
                     /translation="MYLPNTNSSSQMMQFPSNQSQQQFSAISSYTPQQQFIVQHPQQQ
                     GVYQAQNPQLVPMNIPSQSNQQYVGGPPGTIYEGGVQGSMNQSSPDQNALRHNRTQMV
                     PVPSNDERYRKQLIVNYLAQDVTSADLHTLFARFGPLDGARIIFDRQTSMPRGYGFVY
                     FRYPDSAKQAVDTMNGYEFHGKRLKVGYSTNPLNIISSASSNQYPAGQVK"
     gene            <1197959..>1198894
                     /locus_tag="LMJF_29_2840"
                     /db_xref="GeneID:12981145"
     mRNA            <1197959..>1198894
                     /locus_tag="LMJF_29_2840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722319.1"
                     /db_xref="GeneID:12981145"
     CDS             1197959..1198894
                     /locus_tag="LMJF_29_2840"
                     /note="previous protein_id=AAZ09741.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722367.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981145"
                     /db_xref="UniProtKB/TrEMBL:E9AEE6"
                     /translation="MSNSNAGILKDVIGRSCPWWISRLLAETRVTESTLKLLTTSAQR
                     LQLCGRLSRNGGNRALFSPLHIPHLHASTSIAEAQVIMTHGRRLRMVSRNNGDVKVHV
                     DLSDFLSCSGTCLTEVEEEVERLAELTGRNSYTSPFWLTQPQLESHFRNALAGHSTGC
                     PHAYSAHDCEVYENPNMFVELSCGTATTARYANLGEFRIHPYLQLSLISCISFLRVFS
                     PINVQTRRAFDACVEWRLRWECQQSGCWCSVWGTVQDYASCGFATLDGAIGVDVFDAL
                     GNPLFLIHALCTTAPLDVYSRCYPYDSIVTSADTF"
     gene            <1199317..>1199694
                     /locus_tag="LMJF_29_2850"
                     /db_xref="GeneID:12981146"
     mRNA            <1199317..>1199694
                     /locus_tag="LMJF_29_2850"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722320.1"
                     /db_xref="GeneID:12981146"
     CDS             1199317..1199694
                     /locus_tag="LMJF_29_2850"
                     /note="previous protein_id=AAZ09742.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722368.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981146"
                     /db_xref="UniProtKB/TrEMBL:E9AEE7"
                     /translation="MQTMAKPATSDPERGFSDDGYSAFRRLLLIELSVLRRRYGLLSE
                     DHHDGAGGHALPTSAAVRGAAPFSAFQTSSVDEETGVLCQSDRDAIEALFHSIDDFTR
                     EFNEGKGEVEREDIVSRIMRDIV"
     gene            <1200219..>1200704
                     /locus_tag="LMJF_29_2860"
                     /db_xref="GeneID:12981147"
     mRNA            <1200219..>1200704
                     /locus_tag="LMJF_29_2860"
                     /product="40S ribosomal protein S19-like protein"
                     /transcript_id="XM_003722321.1"
                     /db_xref="GeneID:12981147"
     CDS             1200219..1200704
                     /locus_tag="LMJF_29_2860"
                     /note="previous protein_id=AAZ09743.1"
                     /codon_start=1
                     /product="40S ribosomal protein S19-like protein"
                     /protein_id="XP_003722369.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981147"
                     /db_xref="GOA:E9AEE8"
                     /db_xref="InterPro:IPR001266"
                     /db_xref="UniProtKB/TrEMBL:E9AEE8"
                     /translation="MTAPRNKIHRIGKRKGATLKDVSAWRWIKTAARHFKQEGKIFVP
                     NCTEIMKSSHGRERAPQNPDWYYIRCAAVLRAIYLRPGVGYGGLSKRFGNKKNYGSRP
                     EHTVTSSTGPLHWACKSLTKLGLVEPGAQSGQRLTRKGHKFADSLAFQVQIRKFGQSK
                     A"
     gene            <1201342..>1202499
                     /locus_tag="LMJF_29_2870"
                     /db_xref="GeneID:12981148"
     mRNA            <1201342..>1202499
                     /locus_tag="LMJF_29_2870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722322.1"
                     /db_xref="GeneID:12981148"
     CDS             1201342..1202499
                     /locus_tag="LMJF_29_2870"
                     /note="previous protein_id=AAZ09744.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722370.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981148"
                     /db_xref="UniProtKB/TrEMBL:E9AEE9"
                     /translation="MPHLRTLFRATAIGVVASALASAHYAQRAPALASSVFEGPDAGT
                     ADAVASMRLQDQAIPWEMECDDFRHGYQTNTVQLQILRLCAEYAASSGEKSPVIRIVG
                     FFPGVPSKTVYEHLTNVTLRRGWDCNYTNFEQFSGECPSTLAEVDPLRRPLAAVAKMR
                     PCCSGDVCTLVPDVAGVVLDDHGWFTHRVGGPLLRRFGLADRLFQYERLSYAYCFAES
                     AAVMSKDATTASKMYDVLYSGSKRTREVASTAAPSLRAWLQANREAVPCAEVDMNFQH
                     ILLLPIADAEAQLFRNSDQLRSLCTMGSMFDMTSTKLVYNVWKDTQQRVLDGTVSSPG
                     TLLVMSSANNVGIPALLPRWAQKTILSTMSHKAYGSLLKACREHTSHEDSV"
     gene            <1206662..>1209001
                     /locus_tag="LMJF_29_2880"
                     /db_xref="GeneID:12981149"
     mRNA            <1206662..>1209001
                     /locus_tag="LMJF_29_2880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722323.1"
                     /db_xref="GeneID:12981149"
     CDS             1206662..1209001
                     /locus_tag="LMJF_29_2880"
                     /note="previous protein_id=AAZ09745.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722371.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.29.2880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.29.2880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981149"
                     /db_xref="UniProtKB/TrEMBL:E9AEF0"
                     /translation="MRENACLLFSTPVSLYTFRSDEKSLARFLLRLQGQLSSYSCALT
                     RVVNGFSCCKACLRCLLRFASTGEMDHVTDAVQHAHQSLLLTEDYRISGSKGFRLLAA
                     FSYDPLALALCSLSGRASFTVAAVSPSARLYSELLFGAIGNSNPTLDLSGNRVFHTLE
                     YGRVPYDLRQALYFSSWWLKKSALPLKARGASALYTLLAAPADVSSKVEAVELGLKEY
                     YALNPYALQPERVDARVTGEIDNALCTALASPTLRLRSLHVGGCSNTTLQLIWQLPQL
                     TDLSINGMQGEQLSVDRLACACCLKRLSLVGAQVEQLAFSEVCRALVDVSLLYCRDLR
                     SLAPLARATQLRYLTVSNSDVENIEGLDECVNLESVRFTECERLTSLAPLAGAPRLRI
                     FSATRCAVRDIHGLHTCPNLESVDFSCCAELLSLAPLSGSLRLKAINAAWSSVEDIEG
                     LNLCPQLETVNFTELKQLRSLTALSGAVRLRVINAMLSGTETVDGLNRCLQLESVNLT
                     DSRRLTSLAPLAGAPRLRILNARGCPVRLIDGLGTCPQLEHVSLQCAKELTSLLPLAG
                     AAQLRIVDASWTGLQSVDGLDRCSRLESVDFTGCRGVVSLAPLSGSPRLRIIKASESA
                     VNNVDGLNTCAQLEHLHVSRCAKLQSLAPLAGAPRLRSINACWSGLQNVSGLNRCPRL
                     MFIDVSHCRHLRSLAPLSGAPRLRRIEANHSALQHLDDLDISAKVHFDYVWRRLSRRG
                     RQPATAAQCDAQTMGGGSKPHIIPKGPITGCAETPEDRD"
CONTIG      join(FR796425.1:1..1212663)
//
DBGET integrated database retrieval system