GenomeNet

Database: RefSeq
Entry: NC_007272
LinkDB: NC_007272
Original site: NC_007272 
LOCUS       NC_007272            1484324 bp    DNA     linear   CON 18-JUN-2017
DEFINITION  Leishmania major strain Friedlin complete genome, chromosome 31.
ACCESSION   NC_007272 CT005268
VERSION     NC_007272.2
DBLINK      BioProject: PRJNA15564
            BioSample: SAMEA3138173
            Assembly: GCF_000002725.2
KEYWORDS    RefSeq; complete genome.
SOURCE      Leishmania major strain Friedlin
  ORGANISM  Leishmania major strain Friedlin
            Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae;
            Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Rogers,M.B., Hilley,J.D., Dickens,N.J., Wilkes,J., Bates,P.A.,
            Depledge,D.P., Harris,D., Her,Y., Herzyk,P., Imamura,H., Otto,T.D.,
            Sanders,M., Seeger,K., Dujardin,J.C., Berriman,M., Smith,D.F.,
            Hertz-Fowler,C. and Mottram,J.C.
  TITLE     Chromosome and gene copy number variation allow major structural
            change between species and strains of Leishmania
  JOURNAL   Genome Res. 21 (12), 2129-2142 (2011)
   PUBMED   22038252
REFERENCE   2
  AUTHORS   Ivens,A.C., Peacock,C.S., Worthey,E.A., Murphy,L., Aggarwal,G.,
            Berriman,M., Sisk,E., Rajandream,M.A., Adlem,E., Aert,R.,
            Anupama,A., Apostolou,Z., Attipoe,P., Bason,N., Bauser,C., Beck,A.,
            Beverley,S.M., Bianchettin,G., Borzym,K., Bothe,G., Bruschi,C.V.,
            Collins,M., Cadag,E., Ciarloni,L., Clayton,C., Coulson,R.M.,
            Cronin,A., Cruz,A.K., Davies,R.M., De Gaudenzi,J., Dobson,D.E.,
            Duesterhoeft,A., Fazelina,G., Fosker,N., Frasch,A.C., Fraser,A.,
            Fuchs,M., Gabel,C., Goble,A., Goffeau,A., Harris,D.,
            Hertz-Fowler,C., Hilbert,H., Horn,D., Huang,Y., Klages,S.,
            Knights,A., Kube,M., Larke,N., Litvin,L., Lord,A., Louie,T.,
            Marra,M., Masuy,D., Matthews,K., Michaeli,S., Mottram,J.C.,
            Muller-Auer,S., Munden,H., Nelson,S., Norbertczak,H., Oliver,K.,
            O'neil,S., Pentony,M., Pohl,T.M., Price,C., Purnelle,B.,
            Quail,M.A., Rabbinowitsch,E., Reinhardt,R., Rieger,M., Rinta,J.,
            Robben,J., Robertson,L., Ruiz,J.C., Rutter,S., Saunders,D.,
            Schafer,M., Schein,J., Schwartz,D.C., Seeger,K., Seyler,A.,
            Sharp,S., Shin,H., Sivam,D., Squares,R., Squares,S., Tosato,V.,
            Vogt,C., Volckaert,G., Wambutt,R., Warren,T., Wedler,H.,
            Woodward,J., Zhou,S., Zimmermann,W., Smith,D.F., Blackwell,J.M.,
            Stuart,K.D., Barrell,B. and Myler,P.J.
  TITLE     The genome of the kinetoplastid parasite, Leishmania major
  JOURNAL   Science 309 (5733), 436-442 (2005)
   PUBMED   16020728
REFERENCE   3  (bases 1 to 1484324)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 1484324)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR796427.
            On Jun 1, 2012 this sequence version replaced NC_007272.1.
            Data release policy www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1484324
                     /organism="Leishmania major strain Friedlin"
                     /mol_type="genomic DNA"
                     /strain="Friedlin"
                     /db_xref="taxon:347515"
                     /chromosome="31"
     gene            complement(<3246..>5558)
                     /locus_tag="LMJF_31_0010"
                     /db_xref="GeneID:5654261"
     mRNA            complement(<3246..>5558)
                     /locus_tag="LMJF_31_0010"
                     /product="5-methyltetrahydropteroyltriglutamate-
                     homocysteine S-methyltransferase"
                     /transcript_id="XM_001684933.1"
                     /db_xref="GeneID:5654261"
     CDS             complement(3246..5558)
                     /locus_tag="LMJF_31_0010"
                     /EC_number="2.1.1.14"
                     /codon_start=1
                     /product="5-methyltetrahydropteroyltriglutamate-
                     homocysteine S-methyltransferase"
                     /protein_id="XP_001684985.1"
                     /db_xref="GeneID:5654261"
                     /db_xref="GOA:Q4Q6R3"
                     /db_xref="InterPro:IPR002629"
                     /db_xref="InterPro:IPR006276"
                     /db_xref="InterPro:IPR013215"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6R3"
                     /translation="MPSLVTTHTLGFPRVGMQRELKKALESYWRGDLTEAALRQVGSD
                     LRKRHLQEQNHRGVALLPVGDFAWYDHVLTTSLMLGNVPPRHRAASDAAVDLDTLFRV
                     ARGRAPTGAPAAAAEMTKWFNTNYHYIVPEFTSASATFSVAWPQLFEELEEAKELFDA
                     ERLKAVLLGPVTYVYLGKVKGDEPFDRASLLPRLVPVYAEILKRVAALGVTWVQIDEP
                     ALVLELDSRWRSAYQETYRGLRAAIGADVKLLLTTYFESVSHHLPLIASLPVNGLHID
                     LSSQTQSAVDVERALPGDWVLSAGVVNGRNVWRSDLLDAYHLLASLRRRSPGRALWIG
                     TSCSLLHSPINLECETELEPEVKEWLAFAVQKCGELRLLADAVVTESEAVVAAYTAPL
                     RARQQTERVVRKEVRDRVAGLTAADACRLDPFPQRWVVQQETLKLPLWPTTTIGSFPQ
                     TSEVRAQRLAYKKGRVDKETYESQLKEHIAYAVQQQEDIGLDVLVHGEAERNDMVEYF
                     GEQLEGFAFTQNGWVQSYGSRCVKPPIIVGDISRPHPMTVSWAAYAQSLTQRPVKGML
                     TGPVTILCWSFVREDLPRQSVTEQLALAIRDEVCDLERAGIKVIQVDEPGLREGLPLQ
                     RSKWEAYLDWASRSFRVSTSGVAPQTQIHTHMCYAEVNDVIKTIASMDADVISIEASR
                     SDMEPLTSFADFTYPNAVGPGVYDIHSPNIPTTQSIVDLLLKATQHLPVRQLWVNPDC
                     GLKTRTWDECRAALQNMVAAATELRRIKPQ"
     gene            complement(<7704..>8648)
                     /gene="AQP1"
                     /locus_tag="LMJF_31_0020"
                     /db_xref="GeneID:5653931"
     mRNA            complement(<7704..>8648)
                     /gene="AQP1"
                     /locus_tag="LMJF_31_0020"
                     /product="aquaglyceroporin"
                     /transcript_id="XM_001684934.1"
                     /db_xref="GeneID:5653931"
     CDS             complement(7704..8648)
                     /gene="AQP1"
                     /locus_tag="LMJF_31_0020"
                     /codon_start=1
                     /product="aquaglyceroporin"
                     /protein_id="XP_001684986.1"
                     /db_xref="GeneID:5653931"
                     /db_xref="GOA:Q4Q6R2"
                     /db_xref="InterPro:IPR000425"
                     /db_xref="InterPro:IPR022357"
                     /db_xref="InterPro:IPR023271"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6R2"
                     /translation="MNSPTTMPLQCHDAETQLYVDKESPEGLPIGNQMHEEEEDQHES
                     KRNFMSQNRWPLYRYRWRLREYVAEFFGTFFLVTFGTGVVATTVFHGGTTAMYQSNSS
                     YLAITFGWAFGLAISLFLSMAVSGGHLNPAVTLANCVFGTFPWVKLPGYFLAQFLGGF
                     VGAANTYVLFKSHFDEAEKRLLLNETMASKYGGIFATYPNVANTYAVWSEVFNTMALM
                     MGILAITDARMTPAVDYKPVAIGLLLFVIGIASGINSSYGLNPARDLSPRILSAMLWG
                     SEPFTLHSYYFWIPLVVPFVGALFGMFLYVFFIIPPSC"
     gene            complement(<9542..>13291)
                     /locus_tag="LMJF_31_0030"
                     /db_xref="GeneID:5653932"
     mRNA            complement(<9542..>13291)
                     /locus_tag="LMJF_31_0030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684935.1"
                     /db_xref="GeneID:5653932"
     CDS             complement(9542..13291)
                     /locus_tag="LMJF_31_0030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684987.1"
                     /db_xref="GeneID:5653932"
                     /db_xref="GOA:Q4Q6R1"
                     /db_xref="InterPro:IPR011016"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6R1"
                     /translation="MSFTELFPCAYGRLSPLPGLITSLSRAPSAAAARLFGTSYPLFL
                     FALLLRPRRGIRCVSPACDGTWKNSQETPKRASSLDGSIEERAGGRPLPLYPCASRCS
                     ATVPETRALVCGMLRGPKVRRRICGPGWGQAPLTSNASAFSPKRNTYTSFSLCPPLLF
                     LHPAQPHGVGFLDRKREAQTRNQRSTFELTSSVGGPAMEHDPTSVCRICQADDAPIIR
                     PCQCEGTMAYAHPYCLAEWIASRGELSCEVCGTAYTLHVAIEDVPPLTSLRGLQLAAN
                     LLVTRPLRRLCGSLCAPLQVLVCCLVVLVASTMMWHSCLTHVILRHRAPAEFPILGGL
                     FYVLGALITAVPVALLWAFEHFRVWVFLHEDYVVGLPPETPMQPPANAAQDDAATCAL
                     NEAFTRCNAGSQSAMRSRYLAATEAQISKDATLQLLKAKVRASRGPAQRLRLWSFGPA
                     RYAAKVLFVHMMGVTAVVLGHVTLRTLLSLCHGAAVLCRRLLPPAYPSLHLHAATAVT
                     SAVVPPYVYWVAASVVGLMEWPLILRAAARCRRVADGRLSRSLFLCSLFTRSAASLLV
                     LFLTWAVVMPVIVYVCLFPFFVEGDLAVLMERRDAWQVLRTEHLLPLRCDDATRASAS
                     AVKPLVQPINVARALFTVLPDVWRGLSPPLFDTATCGAAVSRPFAHPSPASLAEFMWY
                     SAGVLIRISTFSTWLTLIGSMQTTLLWLLTGTFAVLSPYTLVAQELAENEFFFAFLRL
                     HGGGFWRTLLEAPLLVALYTVTVGFGAFASLHHLFPETLPKSLTYLPLYSPEKQDMHF
                     HFLYCWLSILKRLHTFVQRWLSNCFLYSNDTTTEMQGRGSQVVEHAAYAVCLVGANVV
                     VGAAVEWASWSAWFPFFGFAFSIVRVVQHGGNLNAAFPQLRRGAQNLKMKAVVLCFYG
                     VSVDFARADTCMCRRLVRVKSSRMLHELRQRAGEKNDTALSLLLSSLADFPGDGVVVC
                     SRDTLQRLTTETAQCLATLPRLSVAAILAVAAPLVVCSQWHLNYVDRVAADYVAFPFW
                     FCLLLRWATGVLAVAAWVLAEGALLRTPLFHRCLEYAPQLIQGPPSLGAVHAVLLPSV
                     IHGGLVRFVIGALTCLSEGRLLPTFGQMSVLAALLLLGISHRAMQLSNADWGRLARFQ
                     IHHIIIPLLPGHVAPPAPPEPTDTAAQLVARDDDDGVARPPQEPQVQQASQPPPAHEV
                     AAAKPPRTARLRARFARWVASQTASDVVLVAYPRSPAPHSARTGS"
     gene            complement(<14774..>16612)
                     /locus_tag="LMJF_31_0040"
                     /db_xref="GeneID:5653933"
     mRNA            complement(<14774..>16612)
                     /locus_tag="LMJF_31_0040"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684936.1"
                     /db_xref="GeneID:5653933"
     CDS             complement(14774..16612)
                     /locus_tag="LMJF_31_0040"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684988.1"
                     /db_xref="GeneID:5653933"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6R0"
                     /translation="MGCCLHANGPAQFPHILRATALALNSSNTNSLPPPFPPTSTAFS
                     GPSRFSHTRTLSLASHGTTTLSNMSHRKSQRENDERRPRPTSSDNGAAAEKSWMSSYW
                     DNLMNEEMDVSHVPIFLPWRIGLFLLTSTITQNMNYVLGSFATTNYFSWTTAQQKQFY
                     SLCYNMLYLGPVFGLIVDLVRVGRERFRPVIIIACIINAIVCFVCFATKNIENQYSSM
                     LVLAWIMQVATMFIYMPMNAVVINYGNRLVESSHETSARIGGLMSQAMVWRTAGSLLQ
                     TIFYQCAYGDAMKPHVNYRWMCLIAGICCCVLIPQVLFLTKRYYYTDYRRAALRTSEP
                     VVFYRNTLNMGKQAISTRKEAFGGRFMFILCFTFIYFMLPDALYNTKFSFEYQYTEAF
                     SLGLRQANSILGSLGALLGALAYALWMYFAQHTEASHGRMFRANPFIICLAGCSAWAF
                     GTFFHFWGVMGSTNGKFNYKVFIPIESVVVSACLRFAFMPTLSLAAMQAPRFYETAAF
                     QLYSVSVSGAGVVSSAVTAAFMSSLGVTEVTGYWKALPLFMLFQFVPMVIAPTLPKFR
                     EDETLPAAGEKDESLDADQAQGREPSTYSIELADVRVACGPETETK"
     gene            complement(<17044..>17733)
                     /gene="CYP5"
                     /locus_tag="LMJF_31_0050"
                     /db_xref="GeneID:5653934"
     mRNA            complement(<17044..>17733)
                     /gene="CYP5"
                     /locus_tag="LMJF_31_0050"
                     /product="putative cyclophilin 5"
                     /transcript_id="XM_001684937.1"
                     /db_xref="GeneID:5653934"
     CDS             complement(17044..17733)
                     /gene="CYP5"
                     /locus_tag="LMJF_31_0050"
                     /EC_number="5.2.1.8"
                     /codon_start=1
                     /product="putative cyclophilin 5"
                     /protein_id="XP_001684989.1"
                     /db_xref="GeneID:5653934"
                     /db_xref="GOA:Q4Q6Q9"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR020892"
                     /db_xref="InterPro:IPR024936"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6Q9"
                     /translation="MALRFSCALVAGSAVHSYLASSCANAAPASKPYLTPYTTNSRNS
                     RVFFDVAEQGGSSFFGMATQEPIGRIEFELFDDTVPVTARSFRELCRGTSSTSPDGKP
                     LTYKGCAFHRIIPDFMIQGGDITKGNGTGGCSIYGTRFRDESFDGKAGKHKGPGILSM
                     ANAGRNTNGSQFFICTVACPWLDGKHVVFGQVLHGYEHVKKLESYGTPHGKPSKTVLI
                     SDCGVVKEMEL"
     gene            complement(<18289..>18690)
                     /locus_tag="LMJF_31_0060"
                     /db_xref="GeneID:5653927"
     mRNA            complement(<18289..>18690)
                     /locus_tag="LMJF_31_0060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684938.1"
                     /db_xref="GeneID:5653927"
     CDS             complement(18289..18690)
                     /locus_tag="LMJF_31_0060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684990.1"
                     /db_xref="GeneID:5653927"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6Q8"
                     /translation="MANFVRKGATGRVNAARLYAFNKTLKKDALRERTYWEENKDTHP
                     INRWSYRRWKERNDELSMFEDKLSKVPVDQKFKIKKLLTVANVSVVGPIVLVVYFTFC
                     YFRYRWWGITPIDGTSAIARGIQNLPRPPGY"
     gene            complement(<19041..>21893)
                     /locus_tag="LMJF_31_0070"
                     /db_xref="GeneID:5653928"
     mRNA            complement(<19041..>21893)
                     /locus_tag="LMJF_31_0070"
                     /product="helicase-like protein"
                     /transcript_id="XM_001684939.1"
                     /db_xref="GeneID:5653928"
     CDS             complement(19041..21893)
                     /locus_tag="LMJF_31_0070"
                     /codon_start=1
                     /product="helicase-like protein"
                     /protein_id="XP_001684991.1"
                     /db_xref="GeneID:5653928"
                     /db_xref="GOA:Q4Q6Q7"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR006935"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR018306"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6Q7"
                     /translation="MLGRSSCRLQTIGFYVAQHPWLKAAGFVKIGYSTCLETRLDMAS
                     FTTCFTPEWHYVSVFECETSKEALLLEQSVLFCLSAKRVEHRELIRLSEDEVTETAAV
                     LARKLRLSVVQRVRPHYEGTLATAPSAKPRQQPHRHTFTDLKAIVTEEEPDATPLSPT
                     MASTTIAPYREVLDGVKADMHTPPSSPHEDVHPAVSKDEEDEEGLSSGDFSFLSTWID
                     RNDYSLDMLRPYQQEAVTRLMAELRERKKAVCQMACRCGKTPVAYHIIQRTLQESGSG
                     RVLYLVPGLSLLRQTVRKLVAYGLRDAPLLLIGSDPLPVVLRGNNCQSMTTNPDVIRE
                     TILGNPKVVVVSTYHSSPLLKELNIFQLTVFDECHRVCGSDADTAFNTVLKLPLHGQR
                     LFLTATPTYDTPIKMSDTGYFGGIAYRYYLREGINDGYVNPFSVRVVLGGNMSHMNPY
                     LFEAMRMVNKMLVFCRDIAHALKIYEELVAETPPSDVAAFSVLIAHSRMGGAAVAHAL
                     QSFTTAKRCLLLNVRLFQEGVEIPDLNAVFFAAPRYSSRDIIQSICRPLNRMEGKSPS
                     FVFLPAVYDRRYAADHPINLQSFSTLIPFTDALMDEDPKLFEYMIDPHKKSYDIDVVG
                     VRSLRLTSEKLHRFVLPAIRRGVRYSTRDTDRLHRAARLPWKSIFEEMKRIVYECNRY
                     PKTNDAWVVGGTPVSMNMFYQYVRRGYKMYERGESTYLQVHQLRDLESLPQWRRYGVH
                     GPYPWKECLQTLERHLRAHKTVPPLDIHKGGYVGLDATPFERLAGCLMNVNQADSRLQ
                     VGLPPAKQADLDRLCAPYRLRWRKRRAASGAIVKNDVTMITQSYMQFKQLYENADKVP
                     AFQRYLELHFPGYPQKHVRMETLDNLRKGIVPPRRAQQPRQQKKGRKLRGKQVASAAA
                     KGRTVMCRICREHVSVLKWESHLSSKTHLHAQKTLL"
     gene            complement(<23671..>24366)
                     /locus_tag="LMJF_31_0080"
                     /db_xref="GeneID:5653929"
     mRNA            complement(<23671..>24366)
                     /locus_tag="LMJF_31_0080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684940.1"
                     /db_xref="GeneID:5653929"
     CDS             complement(23671..24366)
                     /locus_tag="LMJF_31_0080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684992.1"
                     /db_xref="GeneID:5653929"
                     /db_xref="GOA:Q4Q6Q6"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6Q6"
                     /translation="MMQRPHYDAQGQVPQYNRASYNDGGYNMSRHMDGIPPHAYNQPP
                     VNYYQPPQVYPMGNPMYNVPQGYPPAMPGYRGGRGRGGWYYPSAGSGGYNNMRGGFRG
                     GRGGFPLRRKKPFVGGTLETQREWERQTACCFNLQGSCKFGDGCRFLHDDVKGRACQF
                     GAKCRVHGTAKDAEAEAPAKEDAPKKNEKPDESTPKKSEDQTVAKKEEKSVEKAPEKP
                     VADEEAEDAEKKE"
     gene            complement(<25070..>26548)
                     /locus_tag="LMJF_31_0090"
                     /db_xref="GeneID:5653930"
     mRNA            complement(<25070..>26548)
                     /locus_tag="LMJF_31_0090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684941.1"
                     /db_xref="GeneID:5653930"
     CDS             complement(25070..26548)
                     /locus_tag="LMJF_31_0090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684993.1"
                     /db_xref="GeneID:5653930"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6Q5"
                     /translation="MSRAHKDHTWMKNHPLEGDDIVAGLYNILSKRNPKTMKACRGIR
                     IPDTVVFEHNFPRGWYTTDMKAKEVVRKQGKDLDANTIEHGFTQDLYDGSPIAATYLC
                     TVEQTTDDGETEVNTLVEVFTRDTLAAFLARKVKPDGILQKFVLPKGYQNSVIKVVWS
                     PRVCMVQRRTNKYRIFDRKRAECDPFSITVTYDGPTFLSDEGSVSGNIAIEVKQLCGN
                     IVQHFYYTEHKYITRMVLYFKGDQRDRLWLLWCGSLRVSDRNTPSEMPVNLITNFGEP
                     SMAGNAFDEEELLRSADEAYLRLTNDEMFYETYMKRMGCRGAAYSAAATQGDKPSSSS
                     ADGQQEGRANSADAADAFDWGGLPPLVVETRDRLLLEKKSMSCLFEDLFYHARNHFLT
                     RRKEPYNMEIPKDAADTLTENGVVDLMRTLRLPSKVQESTNAAPMCYVIDSVSRQPLT
                     QLADKAQVWIQTYFDTKLRRLQQAVREFTGDEDALRSDVMEL"
     gene            complement(<27077..>28171)
                     /locus_tag="LMJF_31_0100"
                     /db_xref="GeneID:5653935"
     mRNA            complement(<27077..>28171)
                     /locus_tag="LMJF_31_0100"
                     /product="putative O-sialoglycoprotein endopeptidase"
                     /transcript_id="XM_001684942.1"
                     /db_xref="GeneID:5653935"
     CDS             complement(27077..28171)
                     /locus_tag="LMJF_31_0100"
                     /EC_number="3.4.24.57"
                     /codon_start=1
                     /product="putative O-sialoglycoprotein endopeptidase"
                     /protein_id="XP_001684994.1"
                     /db_xref="GeneID:5653935"
                     /db_xref="GOA:Q4Q6Q4"
                     /db_xref="InterPro:IPR000905"
                     /db_xref="InterPro:IPR017860"
                     /db_xref="InterPro:IPR017861"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6Q4"
                     /translation="MKRTLSLGIEGSANKIGVGVVDQSGTVLSNVRETYITPPGSGFL
                     PRETAIHHSQHVLQVVQRAMHDAAVTPADIDIISYTKGPGMGGPLSVGCTVAKTLSLL
                     WGKPLVGVNHCVGHIEMGRVVTKSENPVVLYVSGGNTQVIAYADHRYRIFGETIDIAV
                     GNCLDRVARLLNISNDPAPGYNIEQKAKKGKCYIRLPYTVKGMDMSFTGILSYIEQLV
                     HHPQFSDSDVREMSKKRHKAAPSLTSMPVPPGETLNTDDICFSLQETIFAMLVEVTER
                     AMSQIKTSDVLIVGGVGCNRRLQEMMQLMAAERGGRCFGMDQRYCIDNGCMIAYAGLL
                     QYLSGSFTTMAEATVTQRFRTDEVYVTWRD"
     gene            complement(<29328..>31685)
                     /locus_tag="LMJF_31_0110"
                     /db_xref="GeneID:5653936"
     mRNA            complement(<29328..>31685)
                     /locus_tag="LMJF_31_0110"
                     /product="putative intergrin alpha chain protein"
                     /transcript_id="XM_001684943.1"
                     /db_xref="GeneID:5653936"
     CDS             complement(29328..31685)
                     /locus_tag="LMJF_31_0110"
                     /codon_start=1
                     /product="putative intergrin alpha chain protein"
                     /protein_id="XP_001684995.1"
                     /db_xref="GeneID:5653936"
                     /db_xref="InterPro:IPR027295"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6Q3"
                     /translation="MFAPFYLTLCALFLIAVSRAQDAEQLVPNSTSQCYPSIDLGWSA
                     HVGSSVYATPRIVDLAHDGHKEVLIPTFSQFLEALDGPTGEDIPGFPFMHPRMKTYAS
                     PLPVDLNGDGQVDWLVALYTGELVVFGQDGKVQGYLQVPPLAMKRNWVKDNLPPQQAA
                     TVRPGTPLKTGTVLEDILKARRMDDLTLTSAEVLDQRHRSSIAQRHHAPTAAAVKRVE
                     YDTHAKDAALRATDDEQESWDDNDVLDIDEDEMQLPWEKAEVEVGPNSHLSPEARASL
                     DLLFHPELYQTAKRATGAEEATFQGRNLRQATNITFGEDEIKVDAHILSTPVVTDVDQ
                     NGDLDVILHVSYFFSEDVIAEQPERFAGGVDPHDFVATAVVCLNLVTGETRWARLLHT
                     STKNSTNAAYALSTPLVINADEDRSMEVFVSTSLGFVFGFTADGNILDGWPVLLGPLS
                     ASPTAEDITGDGTLDICIGDTEGKVRCYNASGSVTLEKDVIGGVADRLTFGDVDGDGA
                     VDIVFGTTSGLIYALRGTDGAVLPSFPIVTGGSIVAPVLLLNLNGMLYSNNLDIVVPS
                     HNGCVYLVRGSSGCIQTIDIDEKSSSMVLADDVLGNGQMDLVVTTIKGGVYVFQTSTP
                     YTAMNAWPSKTKGVNGFSASGNYIGIVISPNFRTFRDIHGDTFNVEFTIYDSRPVSPK
                     RSYTVEITVGTRIRLYRGRFHKPGTHIVKVRAPLERMYSSLNVALTLPNGQSFTDSIS
                     LSFNMHFMAAIKYTLIVPFLAVSAALMLVHKRHEVVEKEAVQYLF"
     gene            complement(<32125..>32508)
                     /locus_tag="LMJF_31_0120"
                     /db_xref="GeneID:5653937"
     mRNA            complement(<32125..>32508)
                     /locus_tag="LMJF_31_0120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684944.1"
                     /db_xref="GeneID:5653937"
     CDS             complement(32125..32508)
                     /locus_tag="LMJF_31_0120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684996.1"
                     /db_xref="GeneID:5653937"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6Q2"
                     /translation="MLRCLSLLLAKPQAAPRRSTIHATSSHKKGKDRFDLLHALQKDR
                     QRIQHNRTLPWRQRLGQLRVYPWKLFLAFMMFWSWLGTYAVPYLKGMRAGELPSVGQG
                     RPIPAEVRATATPTPQFAHLKERQL"
     gene            complement(<33044..>35524)
                     /locus_tag="LMJF_31_0130"
                     /db_xref="GeneID:5653938"
     mRNA            complement(<33044..>35524)
                     /locus_tag="LMJF_31_0130"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684945.1"
                     /db_xref="GeneID:5653938"
     CDS             complement(33044..35524)
                     /locus_tag="LMJF_31_0130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684997.1"
                     /db_xref="GeneID:5653938"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6Q1"
                     /translation="MSKAAARVKRFDEVDSDSDFEFREESSSVKVMPTVSFKTATATT
                     DSDSISFHSDHDRSQHLENVVAPATNRQEGSPRPTVHPTKSLASVLKQASSVAVAKRA
                     PPAPVVNGKQGATEQPPQQQQQQQQQQQQTSAPLVSVPEHQRSAAAPAAALAVPAAST
                     PIERPSYASLPSQPTPLAKPPKDSVPSPSVIPFCVTAHASRVDPAPDHDDDDDDPASD
                     EFVQHVLPLPPRQAAARQPPPTSSTSQVWANSTNGVANTPRPRPSAADNATEELLVRA
                     QLRLEERRRMSMPSQRGSRQLSPWRSAAPNPVNTLFRESLPRPSVNRISPARSVDPRI
                     RRLQQENARLQDEVAFLGRENEKLRGVQRSADASEAVRLQLTVDMLRKELESKQLGFQ
                     RTLDATFAELKGTQRQIEEAAEQCEGYQCAAEQYKQLYSDKQKEMEKVKTQLQSLLYD
                     VNAMEQHQRATESEYADKAASEREKAERAVALAEEVKRQRDHLQFLNTQFRNEVSAAV
                     EAKRQAVDQAASANDTARRDRADYEQRIQQLNEDIVRLRKALADKDRAHEVQLREAQQ
                     AQAVLKDRLKDQAEEQQREAERNHRTLEVTKEDHKRALQQERMRRAEMEERLRRMEEE
                     GRSTQSRYTASLSAEAESRVRKLRDEMQAERLAREAAEREAARLATEAEQLRDSVTYY
                     QQESQRMSTSFAQSEQLREKTERQCASLTHTLEDMMAQEEAHVREIGQLQEAISAAAQ
                     WGPGVAAGRGFDADGLVSDLQQLSDENERLTRECTRLADERNTLIDENGRIAEELLKW
                     KHEMRQYVASHVRTASSEHGPLNSVPAS"
     gene            complement(<36206..>37579)
                     /locus_tag="LMJF_31_0140"
                     /db_xref="GeneID:5653939"
     mRNA            complement(<36206..>37579)
                     /locus_tag="LMJF_31_0140"
                     /product="putative ubiquitin hydrolase"
                     /transcript_id="XM_001684946.1"
                     /db_xref="GeneID:5653939"
     CDS             complement(36206..37579)
                     /locus_tag="LMJF_31_0140"
                     /EC_number="3.1.2.15"
                     /codon_start=1
                     /product="putative ubiquitin hydrolase"
                     /protein_id="XP_001684998.1"
                     /db_xref="GeneID:5653939"
                     /db_xref="GOA:Q4Q6Q0"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6Q0"
                     /translation="MAKIKVKWGKENLTMEVDLGSTVGAFKEALKAETGVPVEKQKLM
                     GLKPSMNKDDATLSAAGLVTGKTVMLIGSAESTATVPTVQAAVVEANETGGYTATAPT
                     SNGLKNIANTCYLNSALQMMRSIPEIREVLDVYRGDNALLQQLGAVLQLLESTKDAVM
                     PLQFWTTLVQTNPTFGERNEHGGFIQQDSQEVLNMLLQAVNAVLPEKYAHLFEGKLHQ
                     TLTCVDDPADKGKESDVPFTMLSCNITGEVQTLEAGLEHAFDEHFTAPCEALQKDAAR
                     FTRVSRLTEAPEYVFVHMVRFSWRGDIQKKAKILKPITFPFILDTTIISTEALKAAQK
                     PVREDIRERRDTELARRCRPRAEEKPSPVDKPEEEKVPLILRNESGYYDLCGVISHKG
                     RSADGGHYVYWGKKADTWLVYDDEHVAAVSEEDVKRLRGVGEAHIAYVLLYRSRDPVT
                     RTPVIPL"
     gene            complement(<38241..>39209)
                     /locus_tag="LMJF_31_0150"
                     /db_xref="GeneID:5653940"
     mRNA            complement(<38241..>39209)
                     /locus_tag="LMJF_31_0150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684947.1"
                     /db_xref="GeneID:5653940"
     CDS             complement(38241..39209)
                     /locus_tag="LMJF_31_0150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684999.1"
                     /db_xref="GeneID:5653940"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6P9"
                     /translation="MRNGGGAIKKELARSLYRRVLKLVSAAEQPRTQRIVQTQWVEFV
                     PSEVWIAPGDELRHIVRRSFEAPYTPAAVTNAFNFLKEAQNSLFSIRVLAEWEQLEGQ
                     DHWDLYDGMALMSAALYSACVGCHLQHSLESCVKDYQLRIRSYVQNIAKSVQERIEVR
                     SLEAGHVEDLNKLIKLVREASALERREAKPEDFSLVSLLQNGCASEYVLNIIVTFVLR
                     ALDIHSTLVGADLSFRWVRVMPRNNASPIFASWTYGAMRRREVERLIRTADRHWYRSV
                     PWDALQRKSVVCALLRRQLGCLPASPDTSAKQIKSSCKKQILFLLS"
     gene            complement(<40121..>43678)
                     /locus_tag="LMJF_31_0160"
                     /db_xref="GeneID:5653941"
     mRNA            complement(<40121..>43678)
                     /locus_tag="LMJF_31_0160"
                     /product="putative DNA-directed RNA polymerase II subunit
                     2"
                     /transcript_id="XM_001684948.2"
                     /db_xref="GeneID:5653941"
     CDS             complement(40121..43678)
                     /locus_tag="LMJF_31_0160"
                     /EC_number="2.7.7.6"
                     /codon_start=1
                     /product="putative DNA-directed RNA polymerase II subunit
                     2"
                     /protein_id="XP_001685000.2"
                     /db_xref="GeneID:5653941"
                     /db_xref="GOA:Q4Q6P8"
                     /db_xref="InterPro:IPR007120"
                     /db_xref="InterPro:IPR007121"
                     /db_xref="InterPro:IPR007641"
                     /db_xref="InterPro:IPR007642"
                     /db_xref="InterPro:IPR007644"
                     /db_xref="InterPro:IPR007645"
                     /db_xref="InterPro:IPR007646"
                     /db_xref="InterPro:IPR007647"
                     /db_xref="InterPro:IPR014724"
                     /db_xref="InterPro:IPR015712"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6P8"
                     /translation="MAQDKLLDLEDPDIVLDDGIVDEHDDENPNDDLDSEDIWEVISS
                     FFREKGLVHQQLDSYNDFLMRIPKMIESMAVIPRQDDQYDPGVTMEEQRDQPRLVLQD
                     VVIGNPSHQTHSYFTGGPLPPLFPNECRLRDMTYDAQAQVTLGVELYHPHADTPHDTF
                     LRNVELGRIPIMLKSMRCNLSGKDEDELPRLNECPHDQGGYFVINGTEKVLIAQERQA
                     ANHVYTFSRQKGLLCEVKSIVEGSLNKPRTLQIIMQYRNKGPGSGFENLMCRVAQMDE
                     TIPLFVLFRAMDMVADKEILQTVVPDLKDTAMLELLRGSMSDASTLQIFTREEALGYI
                     GRRLGKQDAMANLQREAESLLMRDLLPHMGTDPSANRTKCLYMGYMVHKLLLVALGRH
                     EETDRDFLGHKRIDVAGTLLTVQLQTFLAQVRKEMIKTLQDHAANPRGVFSFGRVIHS
                     KLITDGLRRCLATGNFGDLKTGNIKTGVAQTLNRLTYSSSLSNLRRIQNPIAASSKAT
                     RPRNLHCTQWGYICPVETPEGGSIGLLKNVALMCLMSRGTDHAEVVQAVQARIDGFRT
                     IGLEDTADVRVARVFVNGTMIGVDRNPERLLHDLRTRRRNGELSNEVSIVRDIRDREI
                     RVFSDAGRCLRPLFVAENCRLKLRKSGMRDLLVSEKAGGKKSISWKTALKKGYVELID
                     CEEEDSLLIAMTPNEVEKNYYYSHCEMDPSMILGICASIIPYPNHNQSPRNTYQSAMG
                     KQAMGIYASNFNMRMDTTAHVLFYPQKPLVRTKAMTYMHSNDLPAGHNAVVAISCYSG
                     YNQEDSIIMSRSAVERGFFRSAFWRSFKAKEERQKRDALETFENPDRELCRVKRADYS
                     KLDTDGLIKPGMRVLGGDVVVGKTIPLPEADLEKLTTGNTKITKRDASITSRTTEKGV
                     VDKVMLTMNNNDRFTKVKIRTIKIPNIGDKFCSRHGQKGTNGIQFRQEDMPFNRDGIV
                     PDLIINPHAIPSRMTVAHLIETLAGKVACYKGGEVYATPFCSVVVDDFGKALHALRSQ
                     RYGNECLYNGHTGLPLDHLIFFGPTFYQRLKHLSGDKIHARPRGPLQPLVRQPTEGRA
                     HEGGLRFGEMERDCMLSYGASQWLRERLFRVSDYYTVHVCNMCGTICVADTKLNRYQC
                     KGCENDTRISQVLMPYACKLLFQELMSMTILPRLGTGPL"
     gene            complement(<45477..>47003)
                     /locus_tag="LMJF_31_0170"
                     /db_xref="GeneID:5653942"
     mRNA            complement(<45477..>47003)
                     /locus_tag="LMJF_31_0170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684949.1"
                     /db_xref="GeneID:5653942"
     CDS             complement(45477..47003)
                     /locus_tag="LMJF_31_0170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685001.1"
                     /db_xref="GeneID:5653942"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6P7"
                     /translation="MPKHSRRELSPPLPKAGMIGAAVECLHAVLHEVTLQQQALRAAI
                     TMQVRDSCAAGSTRMYTFLETSRRYLRYVLVFYVLLMAALVVLVADLSGCLVTSVATA
                     AGIRHLVLANVPGTAVIPLHFNALPFHDDDWMRHLPEDTALRDFILPDRETHELIQSR
                     TQRVDSLSLLHQHIEQFADAKFSLLSHFVNSHLASTTMYIPRTAASAQVFSPRGGVNL
                     ESLFQLGPAMFNAKGEYTAKLQVVLAKEEVGRVVSLILESAMLFSEDAIAVQSVAQLD
                     VLFTKSTSVTVRTGPLQRSWLVLLLEKVLRFWFCLPVWSYEYLVSALRQQDSAPFPPI
                     DSSREVAVVLEVYHRFTPPLDLQPRLRAMNFTLYQLPDAGAPSRVKVSRLIFFSTVQL
                     TGVARWLTDYPVSTFLLLVAILFAASAVASVGSLLGLLAYAYWRWFREQPPELFDEDD
                     SDDEFFAPPRAMPTTVVKNMAPPRLRRHLSSNELYDTLDTSQLRRSQSFNYSPAKEEE
                     "
     gene            complement(<47660..>48133)
                     /locus_tag="LMJF_31_0180"
                     /db_xref="GeneID:5653943"
     mRNA            complement(<47660..>48133)
                     /locus_tag="LMJF_31_0180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684950.1"
                     /db_xref="GeneID:5653943"
     CDS             complement(47660..48133)
                     /locus_tag="LMJF_31_0180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685002.1"
                     /db_xref="GeneID:5653943"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6P6"
                     /translation="MDKVLAYLQGALLDQYLELLPSRWSALLPRLAKLTQRLHAVTDL
                     TTVDELDSAVEDGFRLATTLLRAEHGIYQEGVTLFDGLSQASDLVRHTWRLLANDVLA
                     ELAAKELMLAHWKAAVATITADTLRVYSHALLVHARVTTARVHHLMALLREEEAG"
     gene            complement(<48774..>50663)
                     /locus_tag="LMJF_31_0190"
                     /db_xref="GeneID:5653944"
     mRNA            complement(<48774..>50663)
                     /locus_tag="LMJF_31_0190"
                     /product="putative nucleolar protein"
                     /transcript_id="XM_001684951.1"
                     /db_xref="GeneID:5653944"
     CDS             complement(48774..50663)
                     /locus_tag="LMJF_31_0190"
                     /codon_start=1
                     /product="putative nucleolar protein"
                     /protein_id="XP_001685003.1"
                     /db_xref="GeneID:5653944"
                     /db_xref="GOA:Q4Q6P5"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR011023"
                     /db_xref="InterPro:IPR018314"
                     /db_xref="InterPro:IPR023267"
                     /db_xref="InterPro:IPR023273"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6P5"
                     /translation="MAKKTATVTAKKKVVAQAAAPAAKSLKKANGTAVVAAVKKAAKK
                     PAVAPKAARRAPVVEEEEGEEEDSNFDYGDAAGNSSDYDGARDEEDGSGDEESIEFDD
                     VMDGDEEDEEDFDAEIQDDDDFEVKAEKYRRRMLAQRQLADAEQREDIVTRTAHPTPL
                     HDREQRDDEAQQEEGDVAAVQLLGKTSTAEELRDRIQETVRVLSNFKQEREEDRERGE
                     YLELLRSDLLELYEYSEFLMDSILQLFPPAEAVDFLEAMEKTRPTTIRVNTLKAKRRD
                     LVQALVKRGMSVEPLEKWSKVGLQVFESNVPIAGTIEYLAGHYMLQAAASFLPVMALA
                     PQENERVLDMSAAPGGKTTYIAQLMKNTGVLFANDVSEPRCKSLNANLQRLGVTNCIV
                     TNYDGTGYERVMRNFDRVLLDAPCSGTGIISRDKSIKTSKQYKDIQRASQLQRALLLS
                     AIDACKIGGYVVYSTCSFLVEEDEAIVDFALRRRDVQVVEMGLPFGRPGFTKYRHHRY
                     HDSLELSRHYFPHVHNMDGFFICKLKKLSDSTTKQPDGADEKLSRAGSASASSSKKRE
                     HASDDAAELQVGSKRVRLEKGKAVVLADNAPAKNHKLSVPPSSKVTRSERQIKGKRKP
                     PKPRK"
     gene            complement(<51452..>52909)
                     /locus_tag="LMJF_31_0200"
                     /db_xref="GeneID:5653945"
     mRNA            complement(<51452..>52909)
                     /locus_tag="LMJF_31_0200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684952.1"
                     /db_xref="GeneID:5653945"
     CDS             complement(51452..52909)
                     /locus_tag="LMJF_31_0200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685004.1"
                     /db_xref="GeneID:5653945"
                     /db_xref="GOA:Q4Q6P4"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR012972"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6P4"
                     /translation="MVSVPSLPSLPCIYTADLHFALAAPPFKDSSSPVASIMTAVSNA
                     AAVQATSGANGGSAVVTFFTTTYSKPMPEQSFSVPLNVLPDGLNQLVQNVLGVEGQNF
                     DFLYKDEYIGTTLFRFLQRRGISCEELLNIEYTPALQAKEGNLLPHDDWVSSVRAPYR
                     NNAELLLTGSYDHCVRLWDGDSCLALGSFHREAVKEVALHPVAPASSKTGRKRTRLDG
                     DFMFASASKDGSVAAWKLDSTSSHMQLLGSIQAHTDGVDSVAIAPGDGRLVATASWDT
                     TVKVFNWEQMMEGDTVPSKKAPLVTFTDHSRPVLCSRFSAAHGAARLYSAGYDGHIKC
                     LDTEAAQLQSQFKGDHPINRISVKPAGSSPAADLLLSACTDNRARLFDTRQKDVVKTF
                     SGSCQWLYSVVWLWDAQEGDAEHSGGSLFAVASEDATVRVYDLRCTNTALLTLDAMHT
                     DGVLDVTYVGQSIIASGGKDNKTRSFALSKEGLLS"
     gene            complement(<55157..>56725)
                     /locus_tag="LMJF_31_0210"
                     /db_xref="GeneID:5653946"
     mRNA            complement(<55157..>56725)
                     /locus_tag="LMJF_31_0210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684953.1"
                     /db_xref="GeneID:5653946"
     CDS             complement(55157..56725)
                     /locus_tag="LMJF_31_0210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685005.1"
                     /db_xref="GeneID:5653946"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6P3"
                     /translation="MVALEREYILGSFCELRIITSLSSTQLSKVTLRKPVEDEDTSTA
                     ERAEVFGTELIPGVPVHLPPGRSLSIFTSTGCTLLLVAAPTVLQRCYATSLGATWVRS
                     LLDFHSHLERARVEARGRDDVGPRVLFVSDRHHCGASTYVRWLSNFAVRLGYHPLLLD
                     GVLDTPAFAFPGSVALFHAQHCMDIEEEMNLTPGLYAQVGQSRVANPRLYQHWVQQLL
                     PSGMEKMARSERCRVGGLFFDFGVVEPHAVEQAEAAAAAAVPSVDPTASASSAPAALG
                     SDKSHTNPLDTLLDTIVAADIDHVCVVGSSWLRWKLVQRAWERFGGEGSMSIVQAMLD
                     PRWNVPPEVDCGGGQHFKIFLLDSVELVRSVPVPLWNRQRWLQYFFGTPTSPVKPTLI
                     TLEASQVRVATVGAAAMDAMSTLLPMMDSEDVDRQKADVAAVSFITLQDVALKDRIVA
                     ISTATEYERSPDGELHRLPFSVFERRIRQSTVLGFALVESVTPERLTLLVSGCPLDKE
                     LGLCFLLTEEVLKS"
     gene            complement(<57202..>57825)
                     /locus_tag="LMJF_31_0220"
                     /db_xref="GeneID:5653947"
     mRNA            complement(<57202..>57825)
                     /locus_tag="LMJF_31_0220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684954.1"
                     /db_xref="GeneID:5653947"
     CDS             complement(57202..57825)
                     /locus_tag="LMJF_31_0220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685006.1"
                     /db_xref="GeneID:5653947"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6P2"
                     /translation="MEPSSTDGQEPHLAAGEMEGEEQAVISKDEEDEEEQPNDATVSD
                     TNAASTAASDVDQDGADNDDDAVEEEGDEEDDVEEDEEADDGDDSDEEEERQVYPLPP
                     LPPVHAPSKVHGIATAEVYSIIKELRRQMDDPVEREHAKAMLQGDTDVLLAVAQVLQE
                     AHLLRRATVSDHGVVEEQLVPQPAAARPSLPTGYNSWIIETPASARR"
     gene            complement(<58430..>61009)
                     /locus_tag="LMJF_31_0230"
                     /db_xref="GeneID:5653948"
     mRNA            complement(<58430..>61009)
                     /locus_tag="LMJF_31_0230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684955.1"
                     /db_xref="GeneID:5653948"
     CDS             complement(58430..61009)
                     /locus_tag="LMJF_31_0230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685007.1"
                     /db_xref="GeneID:5653948"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6P1"
                     /translation="MNLDVVDATAEALPLELLNNTNKELTAQLTRFEQQLEERQGGVA
                     DQRRRLQFMKEHLGNVRAEIVNTQSLSETKKRELESEESMCRVMERECARLQQRQTQL
                     ERNAEDVRDRLTSVQDRIFHGNLKIEELKTTLDYNQEELEQWDEARRQKEEDELAIAR
                     YSKLDEAKVKQLTQRIEKLETTVRRQRKQLDEEMLATQHVQGELDRVANEYRKLHDDR
                     SGMLDEWEQVVRTIAERDEAIRIAGEQYADGVAWIQKRQQLKKSLSESLDEAKEETAV
                     INYTIQEREKTSQKLQEAVPVLVQQVQSIQDEVDALREEASRATRDKRAAVLQLQETI
                     TEIERRNKELTMTEKRRATAAERLKEEEMAANDLQKQADFIAQLLKDAEMASHNVAKD
                     IEQLKMAAFKENQALSEVRAAQTATLGEISGAQAQGKNYNAKINQLDGESFSQQGVLY
                     NIEFSIQQMEKRVGRAKGERTEEERKELRGKIDLLQATLDELEKQNRILQNQVKRVRE
                     EMRQSAMLIEKLEMTKKRALEEVLEMDLHCTHDEREEKKLEKQREDLLIKVDTLELQL
                     HRLRNALRAKDAELLTLEEKKRQLEADVAEREAEIEVHHRLLKMEAKLAEEERKRLVT
                     ELLDRQKNLTAVKNRQEVLVGRMDPAQARLSQVQLVIAAAKEREDLQHRGDSLDARIR
                     RMEREMLKLEKTIAVIKASNAQYKHKFDKVSDKDEEVQTRKALTTKFKELKSAISRRA
                     LEVNDFQATTRNKQEELRALAFEKERVWHTQQQMLQEYEAVTQDILTLRETSVRYDQA
                     IGKAKENADPAVARDVELVCTRERLDNTVVQLLSLSREAGDEVLDVVKQMLAAHQLSI
                     ESA"
     gene            complement(<61920..>63794)
                     /locus_tag="LMJF_31_0240"
                     /db_xref="GeneID:5653949"
     mRNA            complement(<61920..>63794)
                     /locus_tag="LMJF_31_0240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684956.1"
                     /db_xref="GeneID:5653949"
     CDS             complement(61920..63794)
                     /locus_tag="LMJF_31_0240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685008.1"
                     /db_xref="GeneID:5653949"
                     /db_xref="InterPro:IPR003347"
                     /db_xref="InterPro:IPR013109"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6P0"
                     /translation="MFSPHVHLRMLAHCPPRRTRCGPLHGELKSPRSSLYFHRSENQR
                     LACPHNVDVDVEVYLVVELTHRYPRQGCCLPAVTTTTPLFPFSLCVSLLRSRHCTALE
                     PERLRTQSPTGKHAMTKAASLKKGSGDKRAREASLQEATARKVKVETAAMLPKASHDS
                     QAHPNLFSWLLNTSRGEFFRKYFERKHLVASHGSGEYFASGLPGVVPPVNWSTERMLE
                     HVKTHPSRYGADLDIVKFDPKLKRRVSYRTKGLVDAAELEACMKDGWSVRFLRPNEFI
                     ESNSAFIGCIEKEFNCYCGANSYWTPANSQGFAPHYDDVDVFFLQLEGEKLWCLYDPP
                     EDVDVLARHSSEDYAPERFPTPKHTITLKAGDVLYMPRGTVHQGKTTLKTHSLHITFS
                     ANQMNSWADFMSRAAQYTVETLAANKLEWRRALPRDMPQVMGEVNNPVFRDTHGLPAL
                     SANQQDHRANLQTKVREMVAELTLLLTDEVNMDVCADVYGKDTIQKLQPPSRTYSGAA
                     PASRKLSHASRVRLISRNCMRLLLNVPGEARVYHIGQNSTVCLAGELGELRFEADFAP
                     AIATLLSSYPKTMPVSALPFPGFDNSDDVAENQLLLVETLRDAGLLHVGSSAKGNAPS
                     "
     gene            complement(<64190..>66928)
                     /locus_tag="LMJF_31_0250"
                     /db_xref="GeneID:5653950"
     mRNA            complement(<64190..>66928)
                     /locus_tag="LMJF_31_0250"
                     /product="putative ATP-dependent RNA helicase"
                     /transcript_id="XM_001684957.1"
                     /db_xref="GeneID:5653950"
     CDS             complement(64190..66928)
                     /locus_tag="LMJF_31_0250"
                     /codon_start=1
                     /product="putative ATP-dependent RNA helicase"
                     /protein_id="XP_001685009.1"
                     /db_xref="GeneID:5653950"
                     /db_xref="GOA:Q4Q6N9"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6N9"
                     /translation="MRAQQRMEAEQESAQRRHEEAMRTDAEYKQRFETMQEMQTAMQM
                     SHAEFFDKYSRQETLLLNHVVTERLDMPVILDLIEQHDVVFICTDTGSGKSTGVPKAL
                     LELSPDTKVVSTQPRRTATVAIANRVASLRRESVGEDVGYWIRGDKKGDEQTRLWYMT
                     SYTLLLRILENPAELPFTHIVLDEFHERQPDLEVTVALLRLALLNKLSRFKLVLMSAT
                     LNTEDWEEYFAGLRVATYKQSEPEHPIHDYFLEDTCTLLGTDYQAPPQLVSRGVVDKS
                     TVDKHFYLAQNLILFLNSCSNPVHSILVFLPGRAQVETMSTWLHTQLYHRVDAVPWHS
                     AVNLSEIEAAMKRNIPGRQKVYLATDIAEVSITLPDVVYVIDLVLVKRPKISKELPAS
                     IQYPPLVTQWISRGSVAQRRGRIGRVQQGFYFCLFPAAQITDLPAYSQPPIENSRIDE
                     LSLHCLQVVNNPVAIFSLCHGQPLVEAITSSMNMLTQLGCILDAKDPLSAGERIEEIY
                     SHQNESWSRMIMAAAQAEVMTDIPEYQYTFIGRILQLIPVSPQPGMLVFFGFLTGLES
                     LMILAAAVTSSLSPFSINASEGLQRHFNVARAMEETENVMRDFCCGLRSDIVAVMKAT
                     LLFRVEQQRHCNSVETVRHWCLQKHLSYDKLMAIVDLESHIKYELAEFMPFRSIVEAE
                     KLLEQLDKLASMVAVMTNVAFVAQSLEVTSEGNSYTNSKEMALGIFSDLTAVPDIHSP
                     SCLRWQEGDIIIPVQLNLIFDKLLASFSTAIASPKQFWISLLLFSQRVQYATFSDDEG
                     TFHVFALSYGGKERYVEVDEIAGYVVLEFRRKLSAICEVLRLTHAHRLLYEDHFNTLL
                     GSYSLAPLQDLQREVITALVSIFNNLEDMTADEVEHDEDDLDVVSLLSFALPTRAP"
     gene            complement(<69364..>69609)
                     /locus_tag="LMJF_31_0255"
                     /db_xref="GeneID:5653951"
     mRNA            complement(<69364..>69609)
                     /locus_tag="LMJF_31_0255"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684958.1"
                     /db_xref="GeneID:5653951"
     CDS             complement(69364..69609)
                     /locus_tag="LMJF_31_0255"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685010.1"
                     /db_xref="GeneID:5653951"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6N8"
                     /translation="MCATIASLDAAVLSFGRAERCGTAPGKLARSYQLFDHLILATAV
                     SATGWAEHHQGVSGFNELVTAVQRELPSRRSLRLLPP"
     gene            complement(<70251..>71135)
                     /locus_tag="LMJF_31_0260"
                     /db_xref="GeneID:5653952"
     mRNA            complement(<70251..>71135)
                     /locus_tag="LMJF_31_0260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684959.1"
                     /db_xref="GeneID:5653952"
     CDS             complement(70251..71135)
                     /locus_tag="LMJF_31_0260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685011.1"
                     /db_xref="GeneID:5653952"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6N7"
                     /translation="MRSSLFLRCSNLHTIGLDGGRSCTTAAASKATFAEQAHSSLPET
                     GGDAAKFRQLKGACDALPSRSNTTASGTGVAVQCNNTDTGVSNIAASSSKRAHIHEER
                     YNSGGRCRSAYTGTWDYGSGERYANESTRNFYRCYSANYYDPRSTGFTREEVAHAERA
                     MRLHRLKCILWNCLVYGSALYLLLEFWRGRGATGIQDSDELSRGQLEKARRHDQLRPM
                     RLQIPPNFGEVQTARYLTEWNERSRDRELAVVEGCAAPSRDSVPSIRQLRPLSVSATR
                     PAAGLDRGDEDDDDDDKS"
     gene            complement(<72370..>73347)
                     /locus_tag="LMJF_31_0270"
                     /db_xref="GeneID:5653953"
     mRNA            complement(<72370..>73347)
                     /locus_tag="LMJF_31_0270"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684960.1"
                     /db_xref="GeneID:5653953"
     CDS             complement(72370..73347)
                     /locus_tag="LMJF_31_0270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685012.1"
                     /db_xref="GeneID:5653953"
                     /db_xref="GOA:Q4Q6N6"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR006620"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6N6"
                     /translation="MEFEFNLAHTIKRLLTRKRCEQLDLDGYLVLDEQPFPASVAKEL
                     LCEVQHCFNDIDGGKTPNQVEFLTADGPVKLTKPHVYECDLHNAVVRHQLPLFNAFFE
                     GQLGELVEVLRDRLNCCEDLQPCDTADLASRSVTLKLQANEGGAFPWHYDNPGKPNKR
                     RLTMAVYLTEDWAPDIGGELQMMPFLGPCITVPPKFCTVVLFQSDMMLHRVRPILSHT
                     HKTRYCFTIWFDGALTNSNDDLFLKVQHLDEGAIPFLRRSAVQRTLSRAVYEAEYEES
                     LADCFGADSVALGISLREHHAHLQQLLSHERLRAFLKILKEYREDLRAT"
     gene            complement(<73946..>74971)
                     /locus_tag="LMJF_31_0280"
                     /db_xref="GeneID:5653954"
     mRNA            complement(<73946..>74971)
                     /locus_tag="LMJF_31_0280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684961.1"
                     /db_xref="GeneID:5653954"
     CDS             complement(73946..74971)
                     /locus_tag="LMJF_31_0280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685013.1"
                     /db_xref="GeneID:5653954"
                     /db_xref="InterPro:IPR012936"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6N5"
                     /translation="MRRLLHKCDLFRVLQDSENHLTPATPYGAVLSIATTTVVVLLFI
                     GECYSYVSGHQNCHITPSAFKNLLDADMQREVDRLHFSISLPYMPCHRIATETVSVFA
                     HDEQTERDTHVSLYHIPYGSYVSNSSAAYISGEVLSGTEDGCLVTGTAPIAAKPSSFN
                     IILKDYRVEDSRKYRPDFQIHHFSGGNAYDDWGVPQVRRQTLEPMSGLKSARALQGPY
                     FFQFFLQLIPTTVDLAGKDSRFGYQYTAFHSMLRYNGHGRAPGLYFSYKLSPFSMDCA
                     VQYDTMSHFVVNLCAVVGGVYTVAEMVEAGLEWLARKRRLREVSARNRRNAEALKNAA
                     GGTPIAS"
     gene            complement(<75956..>78478)
                     /locus_tag="LMJF_31_0290"
                     /db_xref="GeneID:5653955"
     mRNA            complement(<75956..>78478)
                     /locus_tag="LMJF_31_0290"
                     /product="putative mitotic centromere-associated kinesin
                     (MCAK)"
                     /transcript_id="XM_001684962.1"
                     /db_xref="GeneID:5653955"
     CDS             complement(75956..78478)
                     /locus_tag="LMJF_31_0290"
                     /codon_start=1
                     /product="putative mitotic centromere-associated kinesin
                     (MCAK)"
                     /protein_id="XP_001685014.1"
                     /db_xref="GeneID:5653955"
                     /db_xref="GOA:Q4Q6N4"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6N4"
                     /translation="MGGGGGVVAGTPLAAVTLHHRDEPRQASAPGVSRAVLRHERGHS
                     VMPSIALHNSTNSELTRLSELPPVSRHRRTSASRLKQTSTAQLLPTVSGARAPGGAAR
                     RRSPSSPSIPAPSSETHTFLQKVPLLAVPRGAGEEDVASSPPEHPSPAPRTTANAPVS
                     APSASPLSLKLAGHITTETRARSPSAASATRVSSVTNSRCKGRDGRITVVVRKRPLGP
                     GEPGVDCVQVDRAHVRIAVTKQRVDLTSYEESSDYVFDSAFGAEATNEEVYAHSVKDL
                     LTVSLSGGSASCFAYGQTGSGKTYTMMGTDTEKGLYLHAAWDLFERLRPGQQLCVSFF
                     EIYCNSLYDLLNHRHPIVLREDANRRVNICGVTWRTVATVEELWQLVRSGMEQRRTGT
                     TTANEHSSRSHAVLSLRITDSENPDFTGSVNFVDLAGSERAADTAAHDRLTRLEGAEI
                     NKSLLALKECIRALDEKKKHVPFRGSRLTEVLRASFTGNSKTVMIAAVSPSSVNHEHT
                     SNTLRYAFRVKGLSVPSVWPSTARNAPRLCLPVARSRSRAAAAVAAANEPTSAPAATE
                     CSFNSKHTDDAGSPRRPRHARRRRHAYKTAHEPQDEIGISDTNESCTSDTATESPRPR
                     MQITQKACRHQVGRNSTGSSTSAKRHKTCCLVPYMVESLSQRRTRHRTRKERLPLPRA
                     ACSIGESSDLLLANASGTDSKSRALAEVILPHVKGATRHPSSLIAVDVAALEQRLTLQ
                     IIAQLRLDLGQQLEEVLMEKDTIISALRSENEKLRQALDKTGNVEQFYGGSPCDGEVQ
                     KRPAVLPALLYPSSPSILQEQLSSGVSTASVGDEPPLRVLSE"
     gene            complement(<79531..>82950)
                     /locus_tag="LMJF_31_0300"
                     /db_xref="GeneID:5653956"
     mRNA            complement(<79531..>82950)
                     /locus_tag="LMJF_31_0300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684963.1"
                     /db_xref="GeneID:5653956"
     CDS             complement(79531..82950)
                     /locus_tag="LMJF_31_0300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685015.1"
                     /db_xref="GeneID:5653956"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6N3"
                     /translation="MSHAPVLLDIGSGAYAHQAEVDEVKERMGIHHHYFDCWIFGFLE
                     NKNFNIDETVAKLRRRADFEREQLAAYNVTDWMMENMRKGIIQMIGNDKAGRVTFYVC
                     TARDKPVAARREESRMNFDMFISYGTRLRPETKRCQITMLINQDKASMISNLDMTLQA
                     DIAVRIAKFYPGCVDKIYICKMGRLLAAMAKPIFSRLPAIVSDRIIIISDSDIRHGKL
                     LEFFDAEVLPVELGGKNDCNQQDKYDRFATIIRDYFEQLKAAILRGDGVKEWELNCLR
                     SAGYIEEVSPIDALKRSIIEPSISLRDPLLSAPHETGRYSPPGTSGTATAQCFTPRSP
                     AYYALDVDDDANLITCGTDSIEMDILHSSGLIQRNSLTMSRSTLRNLFTDYVIQFTTI
                     ESFFRISLTEMHERQWLQIVQWELQERRTLLLENGLIQGDKLLAGLPSSVLLVAKGFL
                     WLCLMVTSFFFLLGTCFIALLGIVTLINIFFAILVSPYHVFLYGTAFIVVAAQFVIFC
                     SRGFDLTRSTYQGRVVQALRAFGAKALAFQLVIYVGCTVAYLALFCAMAARYDVLTGL
                     QYSLAYGWIVAACLIFIYHVLFAFGLRRLRKRSYAHGSRQNHAETTLYLFMEVELDDE
                     QMEQRFPPAEVMLLTTVAVLSVAMGVAFLTGGDFFFLCAAIVAQSVLLLLCTTFTIAR
                     NVSFSSDITICGVFYATVFWVSTLFTVSQNGWSGHWGSSVLTSLLVMLFFVITGLVSV
                     YGRWKGAVRRRLFRTSWMLLLLHLISCVVALIVLNYRFGLFVLALAVHLLLCIVRTNE
                     ASNNYGVCTMSACFTLVLLACCIIGRTGANDVYEGSVSDVFLPNYANYSSTSAAAERL
                     MLANLAESQARTSNMSGGSSVSAQGGTSYAMPPLCLAQFSPTVDVVGMALFTKLGLNK
                     DVAGQDADLARWFPSFKRVPISETADSAVMRFDVFREETATVNTTIVTTRPGTDLILL
                     IESMTMWIDAYALSIFSLLMPAPYVDRVLPYLAFAQGMVPSQWGVSIDKTTSVVRALL
                     ATSRGDHENVFVVGHGPVGSRAAVIGLRAQDNVRSIVFSGPPVILSKFNLNVTERGMA
                     RRMLSVQTMQTVFSTWYLRTASMQFIPCSLGGIRCDRIDSTIEELRHLCSG"
     gene            complement(<84525..>88190)
                     /locus_tag="LMJF_31_0310"
                     /db_xref="GeneID:5653957"
     mRNA            complement(<84525..>88190)
                     /locus_tag="LMJF_31_0310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684964.1"
                     /db_xref="GeneID:5653957"
     CDS             complement(84525..88190)
                     /locus_tag="LMJF_31_0310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685016.1"
                     /db_xref="GeneID:5653957"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6N2"
                     /translation="MPPFHDPSSLSVEALRAPYILPSRRNSLIPYRHRSGRARESRVV
                     RSVRSCPAVSFFAVPAPLIRPRPPIAPPLPPPNGAKLRELMKSTYTSLSDLGAVAISH
                     RGEIDEVKRQLDVKHGYFDAWMYGFLENKKFDVGETVAKLHRRFAMEVSELASYELTD
                     YMRESLRKGIIGEIGTDKAGRVAFLVNTKRDYPQSKHRDEQRRSFDMFVSYGTRLRKE
                     NKRCQMVMLINQDGASFFKNVDMTFQADIALRISKFYPGCVDKIYICNMSRTLAAMAK
                     PIFKRLPAIVADRIQIIDDNDIKQGVLLELFDAEVLPVELGGKNKCDNEELWGAYADR
                     VEKYYAELKRAVNERGMTVKDYELESIGIDPGTAHERDAAHGVATTTPQADTLVQSVC
                     SFPAQTPSRQLSVYPAARDALQPHPPRGLRAPSLYMAGANESDDPELKLLNTCRTEGS
                     YLPSPACDLADKEEAGAQEPISWAEVVALLPDSLALFFLEELLRWRTAVENSECGERY
                     KILDSFVSGLRTTTELGIRGLDVSDRKWYVGVPYPLRALYRILLVAITLVNMIYFSAA
                     LVFCAVFSADVIITLFLGFFAKPSYVFSLGAVLLMVAIQGASLCTRAADCILAVYNHN
                     VIPLFERLGSYWGTVAEVILFFVLVIIQFIIFCVYALRSNPLRGLEVSFATGWFSALL
                     VVVFTHVFFFTGIFASPTTRDADNRLAALPFFLALNLGNAPKEQLRELDTRFMLRTSS
                     YVICGIPLVISVLLGISFLISRIVSLYVATFAATLVAAYMVHYYSDALSNSLSGSLLR
                     FTLWMLTLVWCYVTLAIGLHNHNHRYSVSVIVALVLNGTFVLLALSCLRRPGRSRLLR
                     VSYIIVMAYIFGCWITVFPLVDWRMGLFCLAIMIHNVLNIVFAPRTLTGIHASFFLAA
                     AVMLLGVSCVLLGWYGTTLMTTKAHSRPSDPPNATTLSQLELYHRYPVCTLQLGQDGS
                     FRVVDVALLNEVVSARTNATRAVDFNNWFGTRGVTYSGVVREFETDGISWEMHEFLLP
                     AAANTTVLVLNNRYAMSSIVAMVGWVDAIALSPLSIFMPYDWIDALVHTTSFATRLIP
                     FAAGRLVDELRDYVYLKKSQLKTNLILTGGGVAGGFLSAAAAQSKTQAVVFASPGLLH
                     CSRKLGVSFDDYHSYVLSIGAHNGALNYIGGQDTTVSQRVLCDASALYCMRPQFFSTA
                     LLEACGDAEGRKHLAST"
     gene            complement(<90450..>92057)
                     /gene="AAT1.1"
                     /locus_tag="LMJF_31_0320"
                     /db_xref="GeneID:5653958"
     mRNA            complement(<90450..>92057)
                     /gene="AAT1.1"
                     /locus_tag="LMJF_31_0320"
                     /product="putative amino acid transporter"
                     /transcript_id="XM_001684965.1"
                     /db_xref="GeneID:5653958"
     CDS             complement(90450..92057)
                     /gene="AAT1.1"
                     /locus_tag="LMJF_31_0320"
                     /codon_start=1
                     /product="putative amino acid transporter"
                     /protein_id="XP_001685017.1"
                     /db_xref="GeneID:5653958"
                     /db_xref="GOA:Q4Q6N1"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6N1"
                     /translation="MSANRHHNTNYAPYPQHGQGRSTSDNMPEDPPEYGGDGLHMLND
                     GHSQEHLADEVVVGASAAEGRTKESKKLDSPSLTDDGELAAKGSKQHSAYMDIAQQII
                     EADQRSREDRVWRRRHTTNPVLRALQVIMPYGGIFASAFSIASSTIGGGIIGLPAAFQ
                     MSGMGMAIIFLIVLVIMAIYSFVLLAIVSHKTGLYNWEIIARRLMGRGWDYFVVFVMW
                     VLCFGGIVSYIIALKSILTGFLKNSPTASEYIKSEPGYRLITSMLWIAVILPMCLLKE
                     INSLRIVSTVAILFVVFFTITCVIHSSQSLHARGMRDDLVSFQTGNTAINGLSSLMFA
                     FIAQVNAPEISREMYKFSVHRVFLSALLGMSLCAILYFLTGLFGYLDFGPEVSDSILA
                     MYNPLKDHLMAVSYVGMMLKICVGIALHLIPCRDCVYYMIGTEVSHVPWWKNAILSSL
                     QAAAALVAGLFIPRITIVFGLLGGFCGGFVGFIFPSLFMMYSGGFSAARVGWGHFLGT
                     YALLLTGVVAVVWGTSAAIHGAVLSSW"
     gene            complement(<95194..>96696)
                     /gene="AAT1.2"
                     /locus_tag="LMJF_31_0330"
                     /db_xref="GeneID:5653959"
     mRNA            complement(<95194..>96696)
                     /gene="AAT1.2"
                     /locus_tag="LMJF_31_0330"
                     /product="putative amino acid transporter aATP11"
                     /transcript_id="XM_001684966.1"
                     /db_xref="GeneID:5653959"
     CDS             complement(95194..96696)
                     /gene="AAT1.2"
                     /locus_tag="LMJF_31_0330"
                     /codon_start=1
                     /product="putative amino acid transporter aATP11"
                     /protein_id="XP_001685018.1"
                     /db_xref="GeneID:5653959"
                     /db_xref="GOA:Q4Q6N0"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6N0"
                     /translation="MASEEANPLNVQYCESAGNQVHQDSLDLRSEFDMEVAQGYDAKC
                     MRGVEDVSSAEAPDPYDFSQYDPKRQIELQDKIRADRVARRLVPANVFQKYFDYLVPY
                     GGLVSTGLNLASSSIGAGIIALPYAFNASGLVMAIIYMLMIAYLTIYSYYLLGQVGTK
                     TGLRNYEQIVRTLLGPGADYFLAFCMWFLSFGGEVSYVISVKDVLTAFLEDADNTPAF
                     LLNIWGQRLLTFLVWLVAMLPLCLPKEINSLRYFSCVAIVFIVYFVIAMVVHSAQNGL
                     RADPRPEIRMFTTGNTAVSAMSTFIFAFLSQLNAYESYEEMSNPTPLRLTLGATISVG
                     IVFVLYFFAGLFGYLDFGAEMTGSALKKYTPVKDVMMGIGYVGILFKLCVGFGLHMIP
                     VRDAIYHCVRVDVHMFPWWKNACVCAFMALLSLVAGLFIPSINVVFGLVGGFSGGFIG
                     FIYPSFMVMYSGNWSLSSVGWFHYLSTYFLLIVGVVGVVWGTASSIYGEI"
     gene            complement(<102752..>104155)
                     /gene="AAT1.3"
                     /locus_tag="LMJF_31_0340"
                     /db_xref="GeneID:5653960"
     mRNA            complement(<102752..>104155)
                     /gene="AAT1.3"
                     /locus_tag="LMJF_31_0340"
                     /product="putative amino acid transporter aATP11"
                     /transcript_id="XM_001684967.1"
                     /db_xref="GeneID:5653960"
     CDS             complement(102752..104155)
                     /gene="AAT1.3"
                     /locus_tag="LMJF_31_0340"
                     /codon_start=1
                     /product="putative amino acid transporter aATP11"
                     /protein_id="XP_001685019.1"
                     /db_xref="GeneID:5653960"
                     /db_xref="GOA:Q4Q6M9"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6M9"
                     /translation="MEVAQGYDAKCMRGVEDVSSAEAPDPYDFSQYDPKRQIELQDKI
                     RADRVARRLVPANVFQKYFDYLVPYGGLVSTGLNLASSSIGAGIIALPYAFNASGLVM
                     AIIYMLMIAYLTIYSYYLLGQVGTKTGLRNYEQIVRTLLGPGADYFLAFCMWFLSFGG
                     EVSYVISVKDVLTAFLEDADNTPAFLLNIWGQRLLTFLVWLVAMLPLCLPKEINSLRY
                     FSCVAIVFIVYFVIAMVVHSAQNGLRADPRPEIRMFTTGNTAVSAMSTFIFAFLSQLN
                     AYESYEEMSNPTPLRLTLGATISVGIVFVLYFFAGLFGYLDFGAEMTGSALKKYTPVK
                     DVMMGIGYVGILFKLCVGFGLHMIPVRDAIYHCVRVDVHMFPWWKNACVCAFMALLSL
                     VAGLFIPSINVVFGLVGGFSGGFIGFIYPSFMVMYSGNWSLSSVGWFHYLSTYFLLIV
                     GVVGVVWGTASSIYGEV"
     gene            complement(<107840..>109375)
                     /gene="AAT1.4"
                     /locus_tag="LMJF_31_0350"
                     /db_xref="GeneID:5653961"
     mRNA            complement(<107840..>109375)
                     /gene="AAT1.4"
                     /locus_tag="LMJF_31_0350"
                     /product="putative amino acid transporter aATP11"
                     /transcript_id="XM_001684968.1"
                     /db_xref="GeneID:5653961"
     CDS             complement(107840..109375)
                     /gene="AAT1.4"
                     /locus_tag="LMJF_31_0350"
                     /codon_start=1
                     /product="putative amino acid transporter aATP11"
                     /protein_id="XP_001685020.1"
                     /db_xref="GeneID:5653961"
                     /db_xref="GOA:Q4Q6M8"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6M8"
                     /translation="MTTAARGKSAMSYPNENTHEHEWEYDSPNRDGAELLEEQAYAAE
                     VEGPQKKGAATSDDSQKGVDPFDFSVNSPEQRIARMDRERAERVQRRRTELNFFQRWF
                     SYVLPYGGVVASGINLASSCIGAGIIALPSAFNAAGIIVAMIYMVVIAYLTVYSYILL
                     AIVAKKTGLRNYEQIVRTLMGPGAGYFLAFCLWFLSFGAEVSYAISLKDVLTAFLDAS
                     EMAPAYLQTLSGQRVMTFVLWLVAMLPLCLPKEINSLRYFSCVAICFVVYFAIAMVVH
                     SAQNGLQENPRPAVKLFNQGNTAIGGVATFLFAFISQLNAMEVAGEMHKFSVRRMSIA
                     SAIGVCICFVLYFFAGLFGYLDFGPKVTGSALKQYNPIKDTMMGVGYGGLMLKLCVGY
                     GLHMIPVRDAIYYVCQTSVHDIAWWKNACVCGSMAVLSLICGLFVPRINVVFGLVGGF
                     AGGFIGYIYPALMVMYSGNWTFSSVGFFHYVCTYLLLFAGVIAVVWGTSAAIFDEVMA
                     QRG"
     gene            complement(<110759..>113734)
                     /locus_tag="LMJF_31_0360"
                     /db_xref="GeneID:5653962"
     mRNA            complement(<110759..>113734)
                     /locus_tag="LMJF_31_0360"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684969.1"
                     /db_xref="GeneID:5653962"
     CDS             complement(110759..113734)
                     /locus_tag="LMJF_31_0360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685021.1"
                     /db_xref="GeneID:5653962"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6M7"
                     /translation="MFQCPREHAAALKEVKRTVGINHSYLDGWIYLFLANKKFDVAET
                     VAKLERRDDMERTVFAKYTMTDSLRKSMRAGIVQYIGRDKEGHSVLYFNTARDSPKAE
                     QRPERQANMDMFLSWCVRCHRKNPTAMVTWLINQENASMLRNTDLIFQKEMALRISKF
                     FPGVVSRMFICNMSSALTFVVKPLLRQLPKTISDCIFLLSASDIRKGELLKRIDANVL
                     PLEMGGRNDCDHPPNYERFATTIESYFDRCIRALNKGISIKEMEVMEEFGVDKDGAPV
                     ALAGDGAAAGYGSPTYLSNGSAVMRHAEAYRGMSTFRSAMPTTASEEMLDFAIMQDPC
                     AVSVDAERRRITVQSAVRPDREGLPLTSPTSDTTAIACNTSFASLPTAPPSLLNHVSS
                     SEFFECVSEPGESMEDFPDATITREGLYCVHLNSIEEFSYSAVLRKAFAQGQGGGGAI
                     AEQQDACLRDWISFRCRCVELMPKLEHFLEALRLGALLPADERELTTQLRRCSHFMLN
                     LFPQTRQTLPFPLLDWYAAGPTARHRSADAAAASYTGKKEAAFHTVVDPFAVNPRRLA
                     FRLDCTSPDNVLLSAQAGAIEFVENWDDLIAVDERKKRVVRRLLLTWPPQTDRCTFEE
                     QLHVRARQLWAQLTPLFRAYIEAKVGISIAEFIQHYGLLVPGGRIDETAEWYRLLFSA
                     VLQYRELHRRNWLFYVFPPPRHAGTRADEPPTMERLLQARGDTGADVQAVISLMTLVE
                     QSLRYTTDQLRTNGAGGAVATRTIVERYIEASKAKVYIPYDTQRSGVLPSESIAQYKL
                     AAATCLKNVEAPLQEFLFTMVSLTVLKQEYPPDMTKGEIMSGLQLAKTESEAHIQERR
                     QHQRVAISFARICSELQGSFGHDIHNLLPIYSAAGMQADGYALGLELLLAVAILRCGR
                     DSDGSSGLDGASSSTPADIMPAATAFSEDDSSTGGVDAAVRDAAAPPSLDVESLRETL
                     NEMSHPASRLASLKRMYIF"
     gene            complement(<115417..>117453)
                     /locus_tag="LMJF_31_0370"
                     /db_xref="GeneID:5653963"
     mRNA            complement(<115417..>117453)
                     /locus_tag="LMJF_31_0370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684970.1"
                     /db_xref="GeneID:5653963"
     CDS             complement(115417..117453)
                     /locus_tag="LMJF_31_0370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685022.1"
                     /db_xref="GeneID:5653963"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6M6"
                     /translation="MRHTCHLFAGSVLDAPSLELRRTARRVAHAETRRLREKKAVTNP
                     YHKEQYISAFLEAHSTALVHRHVVSTSASAKHIEKTPATALSAAQELTTLAQELDARY
                     ATHGSPARLARSSAEALSADNTTRLSISSLPHTPGIMFGAWRSTNGGDTRLRQRLRSA
                     DVMRHCVIRESRTPPSLSPEVIERMLPPRLPAPAQRLMVYLKSERFQRIPGPETCDRL
                     ESLLSAALRALHYSHELQRAVALYAVLCLSTFRDWHMASAIVVSLVHRWSTLVALSGM
                     SSSELMKAVHEDRSHIIALFLETVRFSSLRPSFTAPSLDELDKVCVELHKPFEEVDTS
                     AIACFTHAGGSLDDNGTKRNGTAAAFSPRWNPVVSAPLLSVMGLHRLNDSRFSGSETA
                     KMKSLAERFCLHRSRPSPSPSAPALASGPAYMPALAWGEYLRALHRCGASLAEMQEAT
                     DRITDKACTRHADSLLTSTHVWNAYLACSPGSHAKEVYEKNLRAYKVRETPATTAAVM
                     IALLREGTAESRAEARTLWKRLQHVHVSGKMVPHTSSTLTAYIRLLEAEGQADALLGL
                     LTSFEGLYEPFGVAPESFSRAVKAVHQRGRGGSRTARGLDLLAHVCHAHPFLVPPLVR
                     YTMVQAIEQTTTAAASAKVAVTGHNGRVEASLPIACPFAAAALEFSAENLAATL"
     gene            complement(<118097..>122239)
                     /locus_tag="LMJF_31_0380"
                     /db_xref="GeneID:5653964"
     mRNA            complement(<118097..>122239)
                     /locus_tag="LMJF_31_0380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684971.1"
                     /db_xref="GeneID:5653964"
     CDS             complement(118097..122239)
                     /locus_tag="LMJF_31_0380"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685023.1"
                     /db_xref="GeneID:5653964"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6M5"
                     /translation="MPRSVPSPRGLRTSGNGPANASPRSAPLTSRASSVNGPHSSCSG
                     RYRKGSSESSADRRRLRRARGRSKRPYTAHACRFSPYRPPSAAMLDPFPNASINSLCV
                     VGLSTLLTVHRTGVRLYRERQLPALAPPSTLNMLASRLSSNAAVPSASPAAVPHGVCE
                     ATGVFELIETRHEFQILESYLCAAMQPVLVNGSLFLSKWSRYFCVASGSDRIVHGVSV
                     MSSGAHFCLNHTQHQTSKVVCMQCTQLALEPCRPFSLTPAVVSVDEVGMVVLFDIERE
                     VASVLEQAPLWYRQSDARPREKGKATGPSDVTNSTRDSGGHGGSGHYQAPLQQQHLTP
                     DEEDHILNTIEKAAMSERVVYHLEHGVATRVALVGPCVELCNRCHNAFSRSTSSSWGY
                     KLVSLYLCSRARDVPADARPPEQVGDGEGGGAAELNVVLLKVLWGPRRAFVLEEVHLL
                     HEVAPTDVCDVGIAMNSSPYQVGTPLTLLLARPALELWKLCGCTGDLMETCRVYTANS
                     DGPRCDSRRDASECFLQWVPLGRHRLVVEKATESEEENSWFCTVAVTNNDTVLLLGSA
                     PMPVDHDALGETALAAASPAGDQGSGTTRKEPVAESFKDTDLEAWLDDISVPASRSSS
                     SPAAESGSTAPAAANGAGAPAAESTVTDDNGDNDDVSAARHAVTFPYTVLMELYAPQR
                     SYSSRTRESASAVSTVVLSVVPDWTANRLLLFMDDQETLLSVPLPFLERVGTLTDTKQ
                     HEVDGREGTDLTAGPSIPTSGVDDLLPSTSTAQDHHAASQETRPGGMIQYFKSASTQL
                     WGPSAPSHFVHLDASGGMVTRAPPFLNAPPTESQTSPAADRAAAQSSEAAAVSSSATA
                     AAGSRESYRFFSLTRPLMAAFFYLSGEHEESASPAVVEAPLKDSVSSVTGDAKVSDSA
                     LSVPPMQQAGNRAIGSPPPCPSPLAVSAAGQRSGIQHRYRRGSSSESSRAGSSRYRRT
                     HKPQCIGDGAPASSAVAAHTVIIEEGAAARASYISAQIALLKEESKARSGSRTPETGV
                     VADEDHGAQHEPATTVSQWQYALHRVAEVEESLERNALLYAWKDGHNDLYIRFSVELD
                     ELRQREAADEEDGRAGSLSPRGETGSISPDASKHSRGTVRPRLTLCRPADVEDGVHSM
                     GFLSQYNAVVHRRAATASYGNCFDFSSYFVTLQVPQHLLDVQERDKYRLELEDLRLRQ
                     ARDLASLHPYDMVTIFQNEERASAKDAAWRLHATFPYDDAQDGHAVDLQQLNRTAVRD
                     PAAAAALEWRWADASEARAWSDAHNFARSSTNRVRSLVKELKDWEVGPWTYATRWPSR
                     EEELRGDHGFIWSTSEAPEHTCRRRRLTRLRVSIAELKRETELMASHQRELEELREAL
                     GL"
     gene            complement(<125122..>127689)
                     /locus_tag="LMJF_31_0390"
                     /db_xref="GeneID:5653965"
     mRNA            complement(<125122..>127689)
                     /locus_tag="LMJF_31_0390"
                     /product="putative calpain-like cysteine peptidase"
                     /transcript_id="XM_001684972.1"
                     /db_xref="GeneID:5653965"
     CDS             complement(125122..127689)
                     /locus_tag="LMJF_31_0390"
                     /codon_start=1
                     /product="putative calpain-like cysteine peptidase"
                     /protein_id="XP_001685024.1"
                     /db_xref="GeneID:5653965"
                     /db_xref="GOA:Q4Q6M4"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR015232"
                     /db_xref="InterPro:IPR022684"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6M4"
                     /translation="MYVCITSALLSPSLATAALDGCCFVLAISPSPSLHEVHPLPDTD
                     THTHTHTPPLFTRITPLSSPIKQQHDKMPAATAEPQPFEFPPGYVMPLPTRPSKMDED
                     TLHPVRVPTPLPDLLPRSMKDIQKMRNLQSDGDTAKKYVPPRRDLPPPYVNDSECDEF
                     EDKTIDTTILNMSEKDRTKRMGHTYQLNGPSVEGDVTPVFENGLLFKVVTPDGSWYYY
                     NDTDKYEMHVKFTFGAKSDLQPGEKVDMYVMGTSELSASLVVFPGETTKLVAGKINGF
                     KCSAKAVPLNDDKRDILYGEVNDRIAEDLMDMAQAIGVREDDLTEEKVLAYCEENEKP
                     YIDCDFRPCDYSLYRADVDTYLPRFIPWHRPSTWIPEEQLTEVRLFRRDILPSQVTHG
                     SIGDTYLVSAIAALTDASGDRLHDLFRHPVSAANGKIERALGAYWVTINFNGWWLPVL
                     LDDFLPATRDGPEFARCAVDIRRLWVALLEKTYAKVHGSYANIASGDPLEPLSEFTGF
                     PVTRYESFWEDAQGGDDMLFQEMLSYNRMGHLQVLCTPSDGGEAFGNANVVSANPELE
                     ATYEKMGLLLHHGYAVLQTEYFEDLDLRLLRVRNPWGNGSEWTGAWSKNDKRWSKYPS
                     VRNACYRHGGSPTDADRTFWVEWSDALKIFSGGGCCHLRTPWFDYRVRGEFAQGIPTV
                     SFEVNVSAPTEAYITLSQEDERDDPSLEYHALLLSVFRHSGKKEKLDATSNSLVEKPD
                     RQLKFNFSRDVAMKYTFLPEHSPYFVIPRIHDPSVTKPYVMGLLCDTYVGNGIKVEFK
                     RVDRNCRIFANMPSFAQTGMMEDTAAEYQIRTPRQPIECIGEEIVDERLREFGILEE"
     gene            complement(<128306..>131104)
                     /locus_tag="LMJF_31_0400"
                     /db_xref="GeneID:5653966"
     mRNA            complement(<128306..>131104)
                     /locus_tag="LMJF_31_0400"
                     /product="putative calpain-like protein"
                     /transcript_id="XM_001684973.1"
                     /db_xref="GeneID:5653966"
     CDS             complement(128306..131104)
                     /locus_tag="LMJF_31_0400"
                     /codon_start=1
                     /product="putative calpain-like protein"
                     /protein_id="XP_001685025.1"
                     /db_xref="GeneID:5653966"
                     /db_xref="GOA:Q4Q6M3"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR015232"
                     /db_xref="InterPro:IPR022684"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6M3"
                     /translation="MSVTKAAITESSSNLAVASSVPEERPETRQYGLTDSLHISPANR
                     MAAEKLVAFVRAVSDPEVLHVIYDYLEEHQKAMPRYRLATKACRELLERKEEMLMACL
                     SPSGGAHESTQHSAVGARRSRGVSVPQLVDSPDRKAETARAGEGLTEAQRLLQQIEAT
                     DGCDKGDDDDADMDEFDDFNYFPAPYTPSSRFSFGQPSVSGLVTRVFSEGMLYKIKTP
                     KGEYHFYNDTLQEVMVVRVQCHLRGNEKINERAMLSPVAGTGETEITIAVLPEETNFF
                     MSGVAHMPHFMAKRVPVPRDYVSPSVTQSLRKMNADINAVRKALGKWSRASDQQAYLK
                     CCLKNNLRFTDLDFRPSSESLYRPEFDAVAIPAVTWRRPEEYIYLAEVSQTRLFRGEI
                     SCFLVKQGELSNHTVVAAMAAVAQFPAHVRWMFRHPVSAHVGKMERSQGCYRVTLLHN
                     GWWHTYLVDDYVPASLRGPLFASCAEDPRRLWVQLLEKAYAKSLGSYAATCLVDAMEA
                     LGDFTGFPVRFLDSVWAAAAQGPRDDAFRSLFRYLELRVRAGCTVLLFSPPPTDEQSS
                     ATVDMSRKRSSRIMPVKGAVPQFLPGHIYFLRDVAFYEALDLRMVQLKNPWTWETKNK
                     IHYEKKWKYTTWYDQPDSSLSAIASATTSLHGQACSHALASHALNPRACADLSPEAVA
                     LNERKGTMWVEWGEALAAFAGGGVCYTMWDRHRYRVRNAFVEGRPRLVLELKARRKVE
                     LLVTLSLETVSETLDNFGTVVAARPIQLHGTALSVVHRQANQSAKVVRESCDDIESVA
                     GRRTYVVARDVSIKVIVEPSTSSNGAAVLVVPLLDPSVVSAAAAGAGSGSSSIAAASE
                     VRFVMSIVSDAVAGEGEDLSVHFVSLRRSCGVFTGATAAFPLEGSSRVTAEYQVCTKA
                     GVATCEGSGISGNEAKGM"
     gene            complement(<135021..>137285)
                     /locus_tag="LMJF_31_0410"
                     /db_xref="GeneID:5653967"
     mRNA            complement(<135021..>137285)
                     /locus_tag="LMJF_31_0410"
                     /product="putative calpain-like cysteine peptidase"
                     /transcript_id="XM_001684974.1"
                     /db_xref="GeneID:5653967"
     CDS             complement(135021..137285)
                     /locus_tag="LMJF_31_0410"
                     /codon_start=1
                     /product="putative calpain-like cysteine peptidase"
                     /protein_id="XP_001685026.1"
                     /db_xref="GeneID:5653967"
                     /db_xref="GOA:Q4Q6M2"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR015232"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6M2"
                     /translation="MSSAQDEFDETTIHPDSLPVPATWRQKTSVFRYCGPSVAGAVSS
                     VIDEGVLYRIITDGGGWAFYNDTRYYTVQVRYRITAQSPVTPGHSVTVDGKGAQQELS
                     MELGPEETKVLLTGSVVGFENLCKATLLPRRAATTQEDQALCAEPQQHWSVLATSCPD
                     AALLDRRSVSTTHLVARCVEKQIRYVDLHFFPSHASLYRDGQDSFYIPPLHWRLPASY
                     LPRDDGVRHEVRLFHGPILHPDGLHAGHLLPNHLLLSVAIGLTCLWPQALRCLFIHPQ
                     GAQEGKRDRAVGAYHVRLCTGGWWRLCVLDEFFPASAQCPEFSHCADDLRVLWLPLLE
                     KACAKSLGSYAAMLGVPLEYFVRALTGGPCTVLREIWPAHEDLCDSTVKATRFLALMK
                     RLLLQRTAEMPSVVCWLQPHFRGTARTQHIGDRLVVLYEDIGLDPNIATVVLGLETLG
                     DGQCVARLRQTAQKRRSAESWLDLWRRAGKSWVDEVSDLVFAMEESAGDTVWMALEDL
                     PQYFQGGCVAPLTSDWGTVKVQGEFMQRQPSVVLEVTVTAPTRLLASVTQRDLDEAGL
                     PTQAVKLDNTSIGASQALAGLSCLLYAKGSGDSTHFYGSSGSTPDAFEVAQELHFAYE
                     REVTAGHLLDPRQGPYYVAPFVHAASFDVAYTITVQLIGADSVSSAAPLGAPESSTAR
                     VRFMTAKRGTALFQNLTQPILLESSMEVSSTAMNYQSHPPGQLRLHCGSGVAVDLVLS
                     GRDVPTPITAAGTE"
     gene            complement(<138348..>138821)
                     /locus_tag="LMJF_31_0420"
                     /db_xref="GeneID:5653968"
     mRNA            complement(<138348..>138821)
                     /locus_tag="LMJF_31_0420"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684975.1"
                     /db_xref="GeneID:5653968"
     CDS             complement(138348..138821)
                     /locus_tag="LMJF_31_0420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685027.1"
                     /db_xref="GeneID:5653968"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6M1"
                     /translation="MRRVLQCCLVKEPITMPSVTRYVLEKVLCLHLLHDRLSFFFRLN
                     LSFSLSLSLSHVARTPMECTMVKVCHAQGALVTNSRSQTPYSPAFSCLFLFCSASRAS
                     SCVCTQCLLGRVTPTKTISTSISISIYIGIYMYTGMRFSSFFIVWLLFLYVSLST"
     gene            complement(<140681..>143497)
                     /locus_tag="LMJF_31_0430"
                     /db_xref="GeneID:5653969"
     mRNA            complement(<140681..>143497)
                     /locus_tag="LMJF_31_0430"
                     /product="putative calpain-like cysteine peptidase"
                     /transcript_id="XM_001684976.1"
                     /db_xref="GeneID:5653969"
     CDS             complement(140681..143497)
                     /locus_tag="LMJF_31_0430"
                     /codon_start=1
                     /product="putative calpain-like cysteine peptidase"
                     /protein_id="XP_001685028.1"
                     /db_xref="GeneID:5653969"
                     /db_xref="GOA:Q4Q6M0"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR015232"
                     /db_xref="InterPro:IPR022684"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6M0"
                     /translation="MDGNAIRSICDEDVVTDAMLEEFLHPSSSLALTDTVGDMLTAST
                     LGSAVRGPVPCILAAAGTSALGAGSSSTFKDLHSSEVNQIGVEGTEGSVVHCASHLVG
                     TSLVLPVELSHSHITSDDSGDFAFFTSDVRDADAYDLIRHYVLYCKQQEKELEDLEAE
                     CARLEAEQQHLYSAAIAADMTRSMHLSAADSLSPTNSNEVSATGTGGVSSSAAVDEFG
                     EAHIDPLKLCPYMDPHDAAHNPQPYRYGQPAIHGLYTPAFKNGILYRCVSADRSWIFY
                     NDSEQYTMHIKYIFGASSVITAGPHASVKQRASGEYEVQVTVWPQETEVLLVGQVNGF
                     KNLSSAVPVNSSYTNPHASASTASARALLDRFAQQSGKPNVSLLSTEDVLECCAGQAS
                     ELAAAVGSWNGQHFVDPDFPPCGTSLYRKGVDDVFLWDMSWRRPCEYLPASQRSEACL
                     FARSVLPTDPCAGEGGDVYLCSAACCLAEHPKQVARIFRHPVSADAGSRERAVGAYRV
                     TLSHGGWWTSTVLDSYLPASLKGPNLGRCSHDLRKLWYPLLEKAYAKLHGSYAAIQCG
                     SPLEALQDLTGFPTFHFYDRWAEASWSGAGARASEHTSYSPLSEHLFTSLEEKVHQRG
                     YLVCLCLPDDGPTEAQAAQMGMVFGMSYAVLRLVRHGSVRLLQIRCPTLKLCSRGLWC
                     AGSARWQQEPQLARLCGMDGDGGPELATLWLDWSEALAMFEGGGVCCSRWDWAYDCRA
                     RGFFKDGIPSFVLEVSVDASVESASPVEAYCILSQEDDRGMSPDHPNRELRPLMLSVS
                     SHCGDDEAGEGVGGESLVDQRIRHVCSTDPDTPTEQLNYVLGRDTALRVTFQPSTHPY
                     YVIPRSRGEMPDKLFTLGFVSATAPTKTGKLRMRAVQLPSNSAVFHNRHSFSTRQLES
                     VAAVPFQIRGPDGVARVGCGSSIA"
     gene            complement(<145479..>147650)
                     /locus_tag="LMJF_31_0440"
                     /db_xref="GeneID:5653970"
     mRNA            complement(<145479..>147650)
                     /locus_tag="LMJF_31_0440"
                     /product="putative cytoskeleton-associated protein CAP5.5"
                     /transcript_id="XM_001684977.1"
                     /db_xref="GeneID:5653970"
     CDS             complement(145479..147650)
                     /locus_tag="LMJF_31_0440"
                     /codon_start=1
                     /product="putative cytoskeleton-associated protein CAP5.5"
                     /protein_id="XP_001685029.1"
                     /db_xref="GeneID:5653970"
                     /db_xref="GOA:Q4Q6L9"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR015232"
                     /db_xref="InterPro:IPR022684"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6L9"
                     /translation="MGCCNSKETKKPKEEVLQREAQYAKVSSETDSVEEQPNIEARVA
                     SVVKDLRAERIDAICAHSHACPYRYNACTVVGGEVKFYFEGGIIFCIVKEGSWYIYND
                     SLDYEAHVTVRFGPGSNIAAGQRAELGEVEDGWTCIRAIVYPLETVHLVSGTANGYKT
                     HITIKPLNEQYRHEACAAANGTAEAETEAVRSLVTEGMDEEAILHRCVETTTPYVDLT
                     FPPNGEAVARAGRDTRTIPEVAMMRPTQYLLDNNCLSVNDICGPVLALSIEPGNLGDS
                     WFMCAVAIMAENEAAVRSIFAQGSPAEKAVGAYRVLVNKNGWWHTLIMDDYLPTFNRM
                     PVFARSYDNPAEVWTSLLQKAYAKLHGSYAAITGGDTLQALADLSGAPMCRFDKEWEE
                     ATTDAEKADTLANALVQFSRSGACVVLSTPGHNSESYLGRSQASDAAAFRARYKKVGL
                     HVGYTYSLERVVMVEECGTLLFKVRNPWRSSSKWTGPWSYGSREWDENQDACLLCGAQ
                     KDPQDGSFWMCWDDASRYFDGGGVLFANPDAVDYRVKGVFCKTIPSAVLEITASESTQ
                     VFFTLSQPDKRGVDRKEGAALFAPIMLTVSKEEDGVQRVQKNTSWNPTMPSEEFNFVV
                     GRDVSMWFTLGAEEKYLVVPRIHSKGVKSDYDRPYVISIMSTDKLEGNVRVEAKHIHS
                     DSKVFTNYIAYDSEELPSVKVENQVRLPGKAPVTYVSATVI"
     gene            complement(<152044..>152637)
                     /locus_tag="LMJF_31_0450"
                     /db_xref="GeneID:5653971"
     mRNA            complement(<152044..>152637)
                     /locus_tag="LMJF_31_0450"
                     /product="putative amastin"
                     /transcript_id="XM_001684978.1"
                     /db_xref="GeneID:5653971"
     CDS             complement(152044..152637)
                     /locus_tag="LMJF_31_0450"
                     /codon_start=1
                     /product="putative amastin"
                     /protein_id="XP_001685030.1"
                     /db_xref="GeneID:5653971"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6L8"
                     /translation="MALKLGIIIYAILQFIALLCVMIGTGVDMFHVTPEYSFGVRLCL
                     TLWGEKLDCRKPKVNNPSDTRWALCPNHRNNFRVGQVFAIITIFVYAASVVFGVLWLY
                     YCSGFRWLCLALNIVGAATACVVWAVMAVTYRINNEPLCENLSIAFVFGTGFGLFVFA
                     WILDILDIIFLMRPLQIGESGEGAAPEEQKEGKANEE"
     gene            complement(154071..154589)
                     /locus_tag="LMJF_31_0455"
                     /pseudo
                     /db_xref="GeneID:12981429"
     misc_feature    complement(154071..154589)
                     /locus_tag="LMJF_31_0455"
                     /pseudo
                     /db_xref="GeneID:12981429"
     gene            complement(<157207..>159405)
                     /locus_tag="LMJF_31_0460"
                     /db_xref="GeneID:5653972"
     mRNA            complement(<157207..>159405)
                     /locus_tag="LMJF_31_0460"
                     /product="putative calpain-like cysteine peptidase"
                     /transcript_id="XM_001684979.1"
                     /db_xref="GeneID:5653972"
     CDS             complement(157207..159405)
                     /locus_tag="LMJF_31_0460"
                     /codon_start=1
                     /product="putative calpain-like cysteine peptidase"
                     /protein_id="XP_001685031.1"
                     /db_xref="GeneID:5653972"
                     /db_xref="GOA:Q4Q6L7"
                     /db_xref="InterPro:IPR000169"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR015232"
                     /db_xref="InterPro:IPR022684"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6L7"
                     /translation="MTAILILLLFRLSPTSTQLQSFHRLMALCGGSCTTSNAEKHYHQ
                     KKVHDFNYGGPAVKGECYPLFEDGRCYRVEVDRHKWFLYNDSLDMEMHVTFTFQKTTA
                     VYKAQHGRTTVRKTPKGGTQCSVVVYPLETLPYVKFAKKTQISYSAACMSRDLAPGYI
                     EKVNREAKAKCVNETQKVAGVAGVSRNEEEILYKCRKSKIPYIDMHFHPSEAALRRPH
                     DKQSVANMHAITWKRPQDYIPVIAHKEIKLFRHDVSAAGIGQGHLGDCWLMCSIAVVA
                     ESKTMVKDIFRHPVSQSKQKKEERAGGYRVCINKNGWFHNVIVDSYLPTYNGVLYFAR
                     SAGDPYELWVPLLEKAYAKLHGSYASIVGGNPLHALQDLTGFPVYSFTNTWKAAANRE
                     EVASQFFKDLLRYRKNGYLISISTPDTHTSVYNAGSGNANEAVLEARYKAAGLSTGHS
                     YSVLKVRQFVIPRVRLLKIRNPWGSGDEWTGAWGKNSTKWQKHSLVRRSCKPSKVSDG
                     TFWIEWMDAVQFFEGGGVCMVKKAWYQYRFPGQFFGIIPSVVLKIELKKQQKMLFTLS
                     QKDCRLRSPDDPDQLYKGLLISVTGHNAEKGMQQIVALSTDNPEVHPPEKYEYMLARD
                     VGLELELDPAQGPFYVIPRIMATNQNDPMDFTLGMLTPRKSTARGLRVSCVHLPDTCP
                     TFRNVVSFHMNGEVATHVQFQYKKRGGAPRVKAGITVFEATNVKPAYPFP"
     gene            complement(<161178..>161906)
                     /locus_tag="LMJF_31_0470"
                     /db_xref="GeneID:5653973"
     mRNA            complement(<161178..>161906)
                     /locus_tag="LMJF_31_0470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684980.1"
                     /db_xref="GeneID:5653973"
     CDS             complement(161178..161906)
                     /locus_tag="LMJF_31_0470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685032.1"
                     /db_xref="GeneID:5653973"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6L6"
                     /translation="MAAPPRDCAPRPSLDAGIFFPEDRRPPQPLHGHGFLLHGARAVG
                     KTSLAFQAAINTVQHTGGSVVVLCQESTLYAKVPQPFTPLSSLSESALGHIEFIYVES
                     WTAALREMMGFRTTRTVPALLLVDDDGFEVTVPTDGRGKRSGQHLNVLVDTAAASCLS
                     YLENLYDWMTRHDRPFFYVLVTNHLPESATQLSLPYAAFPLVNVWVGASGTVQITPTQ
                     AGGVAEVVPPPAYLTWQNGLRMRG"
     gene            complement(162615..163304)
                     /locus_tag="LMJF_31_ncRNA1"
                     /db_xref="GeneID:12981430"
     ncRNA           complement(162615..163304)
                     /ncRNA_class="other"
                     /locus_tag="LMJF_31_ncRNA1"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460985.1"
                     /db_xref="GeneID:12981430"
     gene            complement(<163940..>165361)
                     /locus_tag="LMJF_31_0480"
                     /db_xref="GeneID:5653974"
     mRNA            complement(<163940..>165361)
                     /locus_tag="LMJF_31_0480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684981.1"
                     /db_xref="GeneID:5653974"
     CDS             complement(163940..165361)
                     /locus_tag="LMJF_31_0480"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685033.1"
                     /db_xref="GeneID:5653974"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6L5"
                     /translation="MFFSDLSIPLCFCLTCHTCSYPRPRRRTTPRYVSAARVTVIVRG
                     WHLWGGGAPRTEHHAAPLYRQTQASFSAPDHRSILAPLRGCHSAKMLRCTALVQLRVL
                     CLTMLPDGGALTPALRKLGYTPYTLRSTYQQGHASTHPFEWSQLLDGKTNALPAKVLA
                     DYDAVVGPPGAIVYDVLLRQAPIYTKVILVEETEKDKWAEEYEACLERLQISTKRASK
                     NRITQAFQNMIAKMVVGGDASRAPAAALAGPSSSLSTRRSRSHMISSSDDLRHSFAAE
                     AAELKRGFGGSKAPSATSESAPSEDFRGTAKARHATKERNANDGELQHPRAVALQLYE
                     ESVRVSIPSCALLVYRYGDGWEPLCAFLDKPVPSIPFPEYDDGLRVLGNLQERIDRAH
                     KLQYVVGGICALCVLMTVLPRCEGSVEFVKGLYTDYQVAFGADSAACARKTAEGGCSK
                     AEPEKFETAWQKRGGSVTRTAKE"
     gene            complement(<166016..>168484)
                     /locus_tag="LMJF_31_0490"
                     /db_xref="GeneID:5653975"
     mRNA            complement(<166016..>168484)
                     /locus_tag="LMJF_31_0490"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684982.1"
                     /db_xref="GeneID:5653975"
     CDS             complement(166016..168484)
                     /locus_tag="LMJF_31_0490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685034.1"
                     /db_xref="GeneID:5653975"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6L4"
                     /translation="MGACCCKNPTSSVAMAVGEGAESIPQGGEGSGGAPTSSTFSDPS
                     AHSFALPSHSEDETVTVASMPLALVSADKIGAEGHLERGDGSDELASDTWPSLAVRVW
                     RRRGGVSGETTSCALTAAMWQWRQPPSERPDEWQVLRRVLCAHPLFAVCRDDASMLRD
                     VVEVFERQETPPGEGIVSPGDSCAFHVVVKGNAVADVGDGDALMVQEPSKRQEWAVGD
                     CFGSEGLLYVLNPGDEGAAVCAAGHPDASSPTVTWRLNRVLYQMLMRTFYDDAHLQLM
                     KYLSQSPLFQHLSRAQIRHLCERAEMVTWDTSARLLQRGEAPTDLFLLMSGSVSLMHV
                     QRGVGGQAGVTRVQSTVLGAGDCVGDAELLLLHRAADEEDGTTASKRLTAMPSCCTYA
                     VQQPVQAIRIPIEDLLAVLSGHDLQHMRERSRSVRELELWQQQVQMPGGLRSLVEECL
                     VLNISNTNSDSDSDGNEDSLVLQGGPSVAASPLSRRLSDDASQDVFVKGADATAFFLK
                     QMFSRQTYRRADGRERGLSMAAFAPCQRYRVGTVLFHVEYAAGGNGMLRDGGGLPPSD
                     DANGAVSAAGSSAAAGSPKSPVCLYAVFSGEVTVMNSDTGEAIYRVSRGNTLGEEALL
                     APLRCCSATTSLRTHAVVSSSDGCEVFELSQRAFKKFLQRPYCEALRDFCSVFSAFPF
                     AWCFPQHYWYFLFNCTTELEAVGGDLIAVRGADCKCVSLILDGQIGAYVRSSAADSGG
                     KEQNNDEETSVASFAAGDIVGGWEVMEGRPSNVAYVCVCRARMLCVPAESFASLFCPV
                     MPYLRLMWSEGRYKRVMAVPATEG"
     gene            complement(<171934..>173856)
                     /locus_tag="LMJF_31_0500"
                     /db_xref="GeneID:5653976"
     mRNA            complement(<171934..>173856)
                     /locus_tag="LMJF_31_0500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684983.1"
                     /db_xref="GeneID:5653976"
     CDS             complement(171934..173856)
                     /locus_tag="LMJF_31_0500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685035.1"
                     /db_xref="GeneID:5653976"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6L3"
                     /translation="MPGSGSAGPKSRPEMCSSPNMEAAKTTASSREAPTTNSATATTR
                     GSRRAQGWHLAVGGGALPSTASANHSALDAKLLRSSGASSGIALRSSVQFSKDTLYSQ
                     SALSVPRVFHGAARDEAADFRQNMADFLTVMYGDKTASGVVGTDEKGVGAPHASGKAF
                     VAEPDIPAALLAAESGPPPRVSSSGGVPPGSKGPLVKGLTANSRRHSQGDHIDTLVES
                     LVRAYSRRTTSARGEFQGTTGPDDDRPIIYNVARQSNYCRAQASPRLSRGNGAGTGSG
                     HNNEVSVFVSQAMGNILSPGGIRGQGAVSNRSILSSLGLDRNLFNLMPFQTQSNLENV
                     TEEEDSDTLLEPVYVGKQAMFRSVGTRPNISDISVSKSMRGVMSSAPRECGKNGHLNT
                     TQAPLRGDSGGPRRSSGITAPLWQRQGLGKSKQSLDTVEVMDKSRANQRGGSGAGCST
                     KNRNATLSMSLDSKALGKAGGADEEDDSWSDEPAGTLATKVMEGESPAIVSSARSLLD
                     YCKTRADVTLQKALGALQDEEQLKRDVVIAVEHQLRMYIHSLERAERPKKGGGGAGIS
                     DRRKGSGERSANSNLATEREKVTSGEAGAGAYLSNRDNISSDVVPLTGNVMDFLQEST
                     AGANRSKSLKSASMKM"
     gene            complement(<174993..>176786)
                     /locus_tag="LMJF_31_0510"
                     /db_xref="GeneID:5653977"
     mRNA            complement(<174993..>176786)
                     /locus_tag="LMJF_31_0510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684984.1"
                     /db_xref="GeneID:5653977"
     CDS             complement(174993..176786)
                     /locus_tag="LMJF_31_0510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685036.1"
                     /db_xref="GeneID:5653977"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6L2"
                     /translation="MFLISWCLANWKLVVAALVAVVFLSRRATALLQQEAPSVMEQST
                     TESAEADGPAHGPAPPPSSGPPAPNAPGASPPAIGGSGETPAQGEMLEPIFEEITCLF
                     ASRNPKHALQGLSDGLRNAATGVGLGLAGVVAGTYGGAKEGGLGGMAKGFGAGMAGFV
                     GLTGYGAYAGVRQIVRGVGNTRSAVSEVSKGEAYWDSNAQAWVRVNLACDFERLPQTD
                     EDLLGTARKAYEKAKKDGTLPTTLNDSAEGGGASASSATTGAGAASVPQGTDTGETKP
                     AAAEPVNYYAFLGVESAATPSEIRKAYTRKALEMHPDKNPNDPNATIKFQELNKIYNV
                     LSHEGTRATYDRYGTVDPMNVPEMTGNPMKELLGAAFLEALVGPLHFFLVFEGGVLFT
                     AEMKRELHARRRLRVAKNLVSWLDNGASGFESAQLALRDAVSTALGPVFVSYVAEEYH
                     LASRQQLHGSNWKREMDSWYSSWATSASSLWHWTTMGARTARRAFVDKNLGEEDILRV
                     LAVANERDVRQIVLQACRLVLFDMSVTPAQRQQRAMRLEELSVMAMKEVAREVASRER
                     IGASEATAAAAEKGTTTKTPADTNATAPPFS"
     gene            complement(<177481..>179361)
                     /locus_tag="LMJF_31_0520"
                     /db_xref="GeneID:5653978"
     mRNA            complement(<177481..>179361)
                     /locus_tag="LMJF_31_0520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684985.1"
                     /db_xref="GeneID:5653978"
     CDS             complement(177481..179361)
                     /locus_tag="LMJF_31_0520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685037.1"
                     /db_xref="GeneID:5653978"
                     /db_xref="GOA:Q4Q6L1"
                     /db_xref="InterPro:IPR007871"
                     /db_xref="InterPro:IPR021721"
                     /db_xref="InterPro:IPR022776"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6L1"
                     /translation="MRVAPLYSLSCSFPFLARSPSFAPHHAPHPFTPTQCIPEQRRVL
                     TVRRRRAILPVVRFRTLSMSLAAEHTEAGAPARKSSKVEPPTRNPDPNFCSYYVTRKH
                     RFCRTECKPGSLYCCTHNIAETGAAPSTAPRAVKDVTSSPSDVAGCRGDVRVPCPISS
                     NHTVYASRLERHVKVCPDLRYVTHKLPYFSNDKHANRGAVLVSSAFNAPPGGESQRCT
                     HRDFSAEGLAALIRKVHECYDSCIAPDLVVLRQPSRDREAASGEVGATTTPQATTSCR
                     GSAPVAREEISSLKHGPQHMGLIRCLSDVVRQAQDTDSILVGRCSSQCAPIHVDGFLE
                     FGAGKGGLSAALQQLIVQRLQGVDCTTTSVGEDAEAGTVPSSHREATAETSPLMPSVP
                     QSSWKSDFLAEVAQRPPLVVLDMNGFRRKSDARVRHSAVPLQRLRINIKDVDLTRAFL
                     SEIRPLPTGEGEAAAAAVPSTIARPLENWAVLGKHLCGACTDFALSCLTESPLLTSQA
                     QVRLPIVVIATCCHHRCELKHVNPPEQAEVAPAPLVLPGTSFTWSEQEFAALASMSSW
                     AVCGDVVDEERRAVGRKCKRIIDQLRVHFLRYLGYVAFQCQYTTRDVTEENVCIVAFQ
                     AS"
     gene            complement(<185194..>187230)
                     /locus_tag="LMJF_31_0530"
                     /db_xref="GeneID:5653979"
     mRNA            complement(<185194..>187230)
                     /locus_tag="LMJF_31_0530"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684986.1"
                     /db_xref="GeneID:5653979"
     CDS             complement(185194..187230)
                     /locus_tag="LMJF_31_0530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685038.1"
                     /db_xref="GeneID:5653979"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6L0"
                     /translation="MNPSEHHTNRTPTLFQRPSGVFNRPMGFSPAQRTHSVSPDSTAM
                     SQDSPARIGSFATTFFGSSGTSVVTVPPAPPQQQSPLQLRCNSDMRSIWSPQQVSRVL
                     QGLPLAHADSIAETELLSRGSCSKNEEEARVEELLDGPASLSADLAELAASPAPREMK
                     ESATEEELHGLKSNPVTIDSISGGGRTSFAQRSFFAEAVVEITSPTTATRPEKLRRGK
                     GPLVASPNTPLSLQGAALRSMAPERSAAASGFHSAVALAVTQMHLPLSPTRGKPSTSM
                     PKELRTLTGARRPSTADTVHVKLPPQPQPPQHTQPPPRLCVSSCGWDAAATSTQSSRA
                     AFGAKPLPPLATFKGVGPSIRTSTADISLQDPRQVGTVPQAPYRESADSSASSPVALH
                     ADDEFSRVTSPNTSDPRTGATNVGESTAVQSLPHPSRFDSTGFFPSLALPSASAALLS
                     SQEEVRPSPSSLHTPLTDRSSRRNTSSSSPRPAFITRANSTALSTSASPHYPIPLTPL
                     QPPTSTSAAQHFSAGATRALRSRQHGVRSPLEAIWLRSEGLLAPSESMLSAEGCNKVD
                     SPILNAASPPPAVAARDAGALLGSSSRRQSQLNVHELSSSMLSHEISTVSSGGGVVPG
                     NAMSPAGPQPVGERERWPMMQRIFREPKKGGQRVWVSIAARDSRSSSGDASEKS"
     gene            complement(<190542..>193061)
                     /gene="ABCD2"
                     /locus_tag="LMJF_31_0540"
                     /db_xref="GeneID:5653980"
     mRNA            complement(<190542..>193061)
                     /gene="ABCD2"
                     /locus_tag="LMJF_31_0540"
                     /product="putative ATP-binding cassette protein subfamily
                     D,member 2"
                     /transcript_id="XM_001684987.1"
                     /db_xref="GeneID:5653980"
     CDS             complement(190542..193061)
                     /gene="ABCD2"
                     /locus_tag="LMJF_31_0540"
                     /codon_start=1
                     /product="putative ATP-binding cassette protein subfamily
                     D,member 2"
                     /protein_id="XP_001685039.1"
                     /db_xref="GeneID:5653980"
                     /db_xref="GOA:Q9BHG2"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010509"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q9BHG2"
                     /translation="MVSSEALGEYVREYAASRLRDPVMASWVGGSLAFLATMYATSSG
                     RQLAKAMPPPPLRGIQGSIMRGTAASEGRKGSDSTLVSQSTSLSPSSPVSRANASSVF
                     ISASAATAEAYSQVFNQEVSVLNRFMQLLRVAIPNCHGREARSIYILFVLMVVRAYVS
                     VRLVNVSGLVSRTAIEGNLRHAIRALALFAVSCVPATLLNVTLDYYSELLGLHCRDNL
                     AAYFSDRYLKRRVFFQMAGLHEVDHVDQRITEDVRNWARVSASLFTSIPRPLIEAITF
                     SFTLARQTGWRGTLLTWSYYLSFAVWICCYAPNLDWMVQQRMAKEGAVRGEHQRLLAH
                     AEEITLTKGFQFHEKVLQRLFKAVTDQSRYAAYVRSRFEFTETLHNKYGSVLLGYVVC
                     AMAAMHQKNQTTTAETATAALTCASYTFKTLATAIGKSLWSIKQVFIVGGYTRRLAQL
                     LAALDRADVLVKMQTSCTAKSPIVSRASGAFPVRGNDGKAMTSYEDSFGRIVRGDHIA
                     FANVPLVLPTGECLCSSMSFYVKPGMNLLILGRNGCGKSSTFRLLGELWPLRGGCIEK
                     PEAEQLYYVPQRPYMYDGTLLEQVIYPLKKKDLTVGEAELYGYLQMAGLDHVFKKLNM
                     SWETRLPWSDDALSLGEQQRLAMARLFFHRPRFAILDECSSLVDLDVERQMYDRCVEL
                     GITVITIAHRRSVWQYHNWILYFDGSGGYMFSPLQYEAGASALVLTSVRSASDASLIG
                     TEVRLPITDRLCSEDETVAAKTGQPPKRIQTAQKEEAPKSPRAETVTEKAEREEGAEA
                     NGDGNGEHGSHRQSRHRRSRRHRASDANKAVSFETPAEGDS"
     gene            complement(<194542..>198348)
                     /locus_tag="LMJF_31_0550"
                     /db_xref="GeneID:5653981"
     mRNA            complement(<194542..>198348)
                     /locus_tag="LMJF_31_0550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684988.1"
                     /db_xref="GeneID:5653981"
     CDS             complement(194542..198348)
                     /locus_tag="LMJF_31_0550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685040.1"
                     /db_xref="GeneID:5653981"
                     /db_xref="UniProtKB/TrEMBL:Q9BHF6"
                     /translation="MQTAPPTQQRRTFSRANGADGTAVPRLVASEERHRKNMQQIQQL
                     KQALCSTVSAAAAPCMSAPSSRGWSLPSSTLSVPPLSNPSWMAPFFESPSGVVASLSQ
                     RNGATVPVSRRSAWTPASAAALRESHQEVERLVQERNKLQQQCVEWASLLGEASHCAA
                     ESAVTNAPLVSHSGVEADAWSRVHQAALAVVRQATRWYPSALREARIKSDLVATEDTS
                     TPQSARSSELFEPHEGELSEPLLHGNSSPPLTTEELADALHRLAEFLPSLASTMATSK
                     LVAASGPDLLHHIRTLEEEKRSDCLVVLSIIDHLTQVATQLRRESAEKDEALHALQET
                     VEALMEEKSQWARRARESEEALAERYEQYSQREKAWEREVTGLLQSQHNAEAASAAPM
                     ALPASIAVAPADGSGAASATATATEMGERHITQLQQELDAKEATLATLEVEHRALQAT
                     HAELQTHSQQAVASHQKRIAELESQLNPLEEELQAQACIIGSTLRKVEDLSVAHRAET
                     AALRESHNAFLAGKEVALLSLQEAKERIEVELAERTADAAQMRAELEAALGKLSAAQG
                     ASDRPGSSSLVHNGVSVGNSSVVESTGLLRPTGPSEDDGADAALQMDGASTPGECERA
                     KNVGAEDAAESPTKLVDVRKLQQSLNRMSRERTALKRKLEHRAGALSEMESELEAALR
                     LVAQRGVQVQSLTAELERAKAIDTSAPADAKAADEDGAGEEEADAETSLQLMDFSELE
                     RYEDEGTLYPDPVDLSGWLLGHAEGSWVRFSTYVQHHLSKNEQLRIAAVGPLYHIGFT
                     LLKMEGLVKQEDDSLCLPMPWRRFLLQLQQVLDAQLQATVLSPADSAKCFYALASGAG
                     LFGNLASPPRDPLTGYSLIIAALCVCLRTPSVSTSTDSSCKWHCCQAILHHVSHYGDG
                     KAASQAGRSIADADSQAPDSLFLALCAELPAAPALPEEDAGDEGATASGGAASVPLPC
                     SIRLAALLTSDLLSDHLPISHLALCAAALSDIVNSKVAPIEGQLPANSQTEAAKISAV
                     ARPRLSFAQERDVAPLLLYVARHEYLLFGWAQEMADAAAEAEGDSPSGDGHSTDTASL
                     TLSSLGVSVTWPASATVQKAPSRSAAVAAPATPPAEVESITQLLIFLCTGLLPALVLA
                     VHRCPSLERESQLIDAFFRTRRLLMAKRTALLAKNSTEASAASGVMPGVTLLLPEARL
                     RNLVNAALAPIKHTAPFPERAVQVPVAEYVRLHHELLSLYETNDTYHRYIQELLSAAD
                     AAEVLL"
     gene            complement(<199132..>200121)
                     /locus_tag="LMJF_31_0560"
                     /db_xref="GeneID:5653982"
     mRNA            complement(<199132..>200121)
                     /locus_tag="LMJF_31_0560"
                     /product="putative mevalonate kinase"
                     /transcript_id="XM_001684989.1"
                     /db_xref="GeneID:5653982"
     CDS             complement(199132..200121)
                     /locus_tag="LMJF_31_0560"
                     /EC_number="2.7.1.36"
                     /codon_start=1
                     /product="putative mevalonate kinase"
                     /protein_id="XP_001685041.1"
                     /db_xref="GeneID:5653982"
                     /db_xref="GOA:Q4Q6K7"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR006205"
                     /db_xref="InterPro:IPR006206"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="PDB:2HFS"
                     /db_xref="PDB:2HFU"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6K7"
                     /translation="MSKPVKSKTTGKNIGYGKVILFGEHFVVHGAEAIVAGISEYTEC
                     RLEINPGVPGLQVDDQRPAIPGYIAQKRDEQIKAHQLVLDHLKVDLSGDGLKMFIGGP
                     LVPSSGIGASASDVVAFSRALSELYQLNLTDEEVNLSAFVGEGGYHGTPSGADNTAAT
                     YGGLILYRRQNGKSVFKPIAFQQRLYLVVVGTGINASTAKVVNDVHKMKQQQPVQFKR
                     LYDNYTHIVSQAREALQKGDLQRLGQLMNANHDLCRQIDVSCRELESIVQTCRTYGAL
                     GAKLSGTGRGGIAVALAASSDQRDAIVKGLKAKCPEAKFIWRYTVQPSAASNL"
     gene            complement(<201590..>203008)
                     /gene="AAT25.1"
                     /locus_tag="LMJF_31_0570"
                     /db_xref="GeneID:5653983"
     mRNA            complement(<201590..>203008)
                     /gene="AAT25.1"
                     /locus_tag="LMJF_31_0570"
                     /product="putative amino acid transporter aATP11"
                     /transcript_id="XM_001684990.1"
                     /db_xref="GeneID:5653983"
     CDS             complement(201590..203008)
                     /gene="AAT25.1"
                     /locus_tag="LMJF_31_0570"
                     /codon_start=1
                     /product="putative amino acid transporter aATP11"
                     /protein_id="XP_001685042.1"
                     /db_xref="GeneID:5653983"
                     /db_xref="GOA:Q4Q6K6"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6K6"
                     /translation="MKAVAATRVPGRVLAQDNPREVDADAEELAEMDVADGDKVPVQV
                     CQDDSLHSTDSGNKDLRTIGHLLQVMIPYGGMLSSGFSMASTTIGAGILGLPAAFHSV
                     GIIMATGYLVLITAETVYSMRLLVQVSEKTGLRSFEEMAKHLLHPRANIFVAIIRALH
                     IFGGSVAYVVTIGDLLKPILSSSASTPPFLLTSIGLKLLTTAFWLVFMFPLVLLRRIN
                     SLRYVSAFGILFILYLALVVITHSAMNGMRARPRPATRLISTGNMAIEGLGVFIFSYM
                     CQINCLEVALEMRPRSLGRFTICAAVSMTICSILYYATGLFGYLDFGEMQGSILLRYN
                     PLEEPHVLVSYVGVFIKICASFGLLNNACRSALFPLIGWDPYTVVYWKYLIGAVSLAV
                     LVLMLGLFVPNVNIVFGFTGGVCGGFVGFILPALYVMYAGGWSFRSVGVINYCCTYLI
                     LAAGVVAVVFGTAATIYSVATN"
     gene            complement(203589..203722)
                     /locus_tag="LMJF_31_snRNA_01"
                     /db_xref="GeneID:12981458"
     ncRNA           complement(203589..203722)
                     /ncRNA_class="snRNA"
                     /locus_tag="LMJF_31_snRNA_01"
                     /product="small nuclear RNA, U2 snRNA"
                     /transcript_id="XR_002460991.1"
                     /db_xref="GeneID:12981458"
     gene            203934..204006
                     /locus_tag="LMJF_31_TRNAALA_01"
                     /db_xref="GeneID:12981455"
     tRNA            203934..204006
                     /locus_tag="LMJF_31_TRNAALA_01"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:12981455"
     gene            complement(<207417..>209042)
                     /gene="AAT25.2"
                     /locus_tag="LMJF_31_0580"
                     /db_xref="GeneID:5653986"
     mRNA            complement(<207417..>209042)
                     /gene="AAT25.2"
                     /locus_tag="LMJF_31_0580"
                     /product="putative amino acid transporter aATP11"
                     /transcript_id="XM_001684991.1"
                     /db_xref="GeneID:5653986"
     CDS             complement(207417..209042)
                     /gene="AAT25.2"
                     /locus_tag="LMJF_31_0580"
                     /codon_start=1
                     /product="putative amino acid transporter aATP11"
                     /protein_id="XP_001685043.1"
                     /db_xref="GeneID:5653986"
                     /db_xref="GOA:Q4Q6K5"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6K5"
                     /translation="MSTPNHPDRAPLVSNAQGLHQREDDQQQNTGPRSVSVFSQPQSM
                     QDNGEYLKEDDYSRRMSINLFNIDMEPLGVSEVLLDGHRKHMNDDTHGGSHLKCVSES
                     GEKGDEADQHPPKRPGTLRKTIHVLRFYFNVVVPFGGFLATTFNLASATLGAGIISIP
                     SGFNLSGVIMSCVYLILAAAGTIYSMNLLAKVMVKTGLRTYAQSARVLLGRGADYFLA
                     VLIIIQCFGGSVAYIIAASTLLSPVLNAPSAPAFLKTKQGNRIMTSVVWITFMLPLVF
                     PKKVNSLRYVSTFGVLFIVYFVACMIGHSATHGLHDPSIRSEMRMMRTGNEALEGLGV
                     FLFSLMVQLNAYDIFFEMQHKTVFHFTLYTTIATGTCVLLYFLSGIFGYADFGSKVRD
                     SVLSLYDPIKEPYMAVGYIGIIIKICVAFALHMIPFRDALYHFFRWTPEEVPYWKHCL
                     VMAVPTTAALLCGLFIPTINTVLGLLGSFCGGIIGMIMPALFYMYTGDFNLREVGMLN
                     YVATYLLLVGGVVSVVFGTVTTIYSTSQSSFVS"
     gene            complement(<209869..>210693)
                     /locus_tag="LMJF_31_0590"
                     /db_xref="GeneID:5653987"
     mRNA            complement(<209869..>210693)
                     /locus_tag="LMJF_31_0590"
                     /product="putative C-5 sterol desaturase"
                     /transcript_id="XM_001684992.1"
                     /db_xref="GeneID:5653987"
     CDS             complement(209869..210693)
                     /locus_tag="LMJF_31_0590"
                     /codon_start=1
                     /product="putative C-5 sterol desaturase"
                     /protein_id="XP_001685044.1"
                     /db_xref="GeneID:5653987"
                     /db_xref="GOA:Q9BHE9"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="UniProtKB/TrEMBL:Q9BHE9"
                     /translation="MEPLYGKMASFDMEALMPAQKYGIKAAFLGIIFVSFGVYNSVVI
                     PAIAAVVKGRIPERVKPLEKLSVKDKLYVGFAKAVTAVFVHHTYQFIRNTEVSRMSPN
                     FLDGPAVMRSVLWLPVHLPALFILYDLFYTLFHWALHWPPIYSLIHKHHHRQMSPFRG
                     NTDAINDNPIEYVTGEYLHLLALYLLTRFTPVGQVHALTAIIFIFLGGTLASLNHTRV
                     DLHIPYIFNVKAHDYHHRQPRVNFGQYIMFWDWVFGTFQAEGLPSEESAKSLKKAV"
     gene            complement(<211277..>212653)
                     /locus_tag="LMJF_31_0600"
                     /db_xref="GeneID:5653988"
     mRNA            complement(<211277..>212653)
                     /locus_tag="LMJF_31_0600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684993.1"
                     /db_xref="GeneID:5653988"
     CDS             complement(211277..212653)
                     /locus_tag="LMJF_31_0600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685045.1"
                     /db_xref="GeneID:5653988"
                     /db_xref="GOA:Q9BHF0"
                     /db_xref="UniProtKB/TrEMBL:Q9BHF0"
                     /translation="MACTASEASAPPQLLSENAEKHCAADIYALHHRLGRCVKQVERL
                     TSSSAGGSSLSHHKGGRSSASCVRRLGELLREARRLEKRVTEASLTKTGSAQETAELA
                     DDVVASPLQAYYRQELQARLTHLQHDADTAQRLLAQYLSQTPTLVHLPVSCVGTVPRT
                     LECGLTAVATTSFGRKCHVYVDVVPPHAACIPPAAVHFIEGASPAAADVQDSSLVRGS
                     VSQTKEEPGVRERKNSAAASFAGHPLGTSSAVGAAITAEDRIMEDIQQAIHQMKDGAL
                     QMSALMEQEKAKMKSAADLLSDGVAKGQTHMHELDRVSYVAEAAHVPWMLRFVPGMPI
                     LWRTVLQPMWAFLKQVLVMASIIAVTGCVLLLISVVPKPTVYRGQRRRTHDNCASPPQ
                     STAASATVPVTAAAPPPSEVHVSPPTSYEAEEPVAMESPAPAKTAQEVSTPSPHEEDL
                     PAEFLADL"
     gene            complement(<213136..>214821)
                     /locus_tag="LMJF_31_0610"
                     /db_xref="GeneID:5653989"
     mRNA            complement(<213136..>214821)
                     /locus_tag="LMJF_31_0610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684994.1"
                     /db_xref="GeneID:5653989"
     CDS             complement(213136..214821)
                     /locus_tag="LMJF_31_0610"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685046.1"
                     /db_xref="GeneID:5653989"
                     /db_xref="InterPro:IPR004038"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:Q9BHF1"
                     /translation="MPRPERASLERSRQQEHLINKKTMKAPPLTSTPATAQPLQTYCS
                     LLHKVSMSQPRHTAARNGGKVHQLRIKNKKSNPNAVTPFNHRARFTKLKRGIHAQRQW
                     VLDCLPTAEPHISAGAVLQPEHSETSPVLSSPSSSTKEWASDRENGDPSADVGTRREC
                     RYSQAAVKRTVAAMDALYASLDAAMKSHRYRQAGKLKRRIHACQLRLRRELKARALHG
                     SLRSDTGRSSRALSDTTGTDVQETRTAVSSGDAALPSLYRSFHPPSTWLGMGQHPRSA
                     WVDQRTGRYPQLCTEAHLQAVVRHFMNGDVADLETLPDACKAMIPAPSSSPPSTALSR
                     SQRAMKSSLFAAAYCTNVLTDALDDLCFTLLQGLYKEQRDLKQKQPLQFKARQRYVVG
                     FQEVLKCLKAGRVRLVLLATDVEAVEIPVSALPPPPPPPPQPSVTVPGVRRTASPSAR
                     PASKSTRKKAFQTLHEAVQLVQQLCGVTGPAERDTVARFNGHGTRAPPLCVSCMSRQR
                     LSYALYAKGSKVGCVAVLQAEKNREALKAVMSYARYLTTAYTAEMETTMVAER"
     gene            complement(<215323..>217773)
                     /locus_tag="LMJF_31_0620"
                     /db_xref="GeneID:5653990"
     mRNA            complement(<215323..>217773)
                     /locus_tag="LMJF_31_0620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684995.1"
                     /db_xref="GeneID:5653990"
     CDS             complement(215323..217773)
                     /locus_tag="LMJF_31_0620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685047.1"
                     /db_xref="GeneID:5653990"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6K1"
                     /translation="MEAAGAPEDSDPIPLQLDIGYVDVPRDACFSWLQRKYANIKPVV
                     ETPSAGLKGKQLRIDSALLQRLENDVVACDELRWRAFSFPSHPIHPLNTSYRHDPGRH
                     AGTPATTIEMRRTKRHSSNSAEHPTNGAKGSHTLVISTRADSEAKRRAQKGTRKAKDS
                     SAAAIVATSGVHTPKVEDLLENAVRKAKQAYWCRVLGEENVDHETPSTSAGADQSIPR
                     SWRPLLGGYVSAPSRIDQARFLIFPQSGHPVVDTRDPKAFSGAPGKLLESPQSVPYYV
                     RGSASWEVEERNPAAGAAESAHATCAEPSDESATRGGLHHSLTYARINPATAPEQRNW
                     ADTVEVSVAHQQARTERQYAPERAKVQRVTLLEDSVAVKTSQGNPRHSTLVSATRATV
                     LHSGMKHQCAVSASPSISKKYSKKVKASTAPDDALFQLRIADVYDSSVQHFALPGIWQ
                     RWVRPAASRAFTSESDGATGSHSLDDAPRGLYRMCWSAGPGVELCQKGRCTDAAESAK
                     SASAQSSVLTIFGKLCSESWVQVPLSSRWTLTLRNQSAAVVPLEASAVVAPPMVATKG
                     TGLESADTTPSSVEARGSWMKRVCTHPYFWATQGPRWDAALVRGFKNDYNGLHHARRW
                     YSLVSAELTLNGGVQTGNSARVKRSRGAAAPPPKENDSTEGTRENGTDLDGGNAEGST
                     PTAGSRWRGTSLTAFANACMVDSVRDYPRASVGFSFVSQIPRLAITPFNEIVPRKFEC
                     SLSWFAAFQPRAGEAASGKGVNGSARFGLELQSGFSKAGSSTAKPATAADGMPFLRVS
                     PVETFQHMRCGLTWRFDD"
     gene            complement(<218292..>221324)
                     /locus_tag="LMJF_31_0630"
                     /db_xref="GeneID:5653991"
     mRNA            complement(<218292..>221324)
                     /locus_tag="LMJF_31_0630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684996.1"
                     /db_xref="GeneID:5653991"
     CDS             complement(218292..221324)
                     /locus_tag="LMJF_31_0630"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685048.1"
                     /db_xref="GeneID:5653991"
                     /db_xref="GOA:Q4Q6K0"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6K0"
                     /translation="MCCAADRVSVARCRLGFVLSFWWRMLHCPPNGATHPSAWRFFAC
                     FPLCWLTYSHQICISIAFLAAMRRFSMAPALRAVAPPLPGVFACLSVSCGCASHYQKR
                     WTATQRRVIRPTDESVAELMEDADEEGACISSATASSVAAPAPLSAIAESAALYRKVA
                     AASVDGKTTPAAKRRRRDHAGDGDANTTDDAASATTTHDAVEAEALAGTSAGDGDDAV
                     GEEARGDETYILQQQQYYYELPVQTLTDIATAYLRSTENIVLVSPQEEHVLFPVLMER
                     LQEFHLSQLLDIVDSHWSRSTMLRYGTQYKDMVRDRIAQLATAAATQLEAKRRRQQEQ
                     QSSSSAAESTSAAAGALGATRRGEGHSTKTTGAGEECEDDGAVFVAEKQAADAQRSVD
                     AILTHAENEITSATVYRALVVMGISAGHRKRDLAFFQLLGNYLTFFINDYRDPHELVR
                     VLTALARAKIVPSPAFLNMIARRMPVLHKRIPLEPLPAYRALSNFARMGHTSMNTFRF
                     LADCMFAHVEKHISEEKKQLTTMAAASKKPAAATEESDAKIASHAASGSAACMDRAQR
                     CSQEVLEKERLRRMCGLKPSMFTRWLAILARFNAPHQQYLRPLVKPVILPMLPYFPPP
                     SFTRLVSTTRVFKSTDRVLVEALVGRVCDVLAPAGKLTRVDVMELLRLISQDDTPVPT
                     QLDRVLRICKDYLGSSTSTYTAEEVAANSADRSAAPRPRGTVTVVPRPRDMCNVVKLI
                     GSFQKRDEIPLESLTPLLELTEDFAKRLAYLMELCVVSLTQVDAFLELCERHQIPDVS
                     GALEQLMRKRRDVVLHAKRSPEAAAEDRDGRGSATDDEEAEEAYYGQLDIDVRETFNK
                     ILLTNDWNTHGRYRPLPGPLQVDFRNELTKVSALELLQAVDLFGKACPGALQDAPRLF
                     LSRSLLEKLGKEGEVVVEEATNSLVIRQPRAELLTREDLQAFTALVERTPLEAVRTSP
                     VVWVFIKEKAERLGLASVEATATARLTELHGMARRAYA"
     gene            complement(<221802..>224990)
                     /locus_tag="LMJF_31_0640"
                     /db_xref="GeneID:5653992"
     mRNA            complement(<221802..>224990)
                     /locus_tag="LMJF_31_0640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684997.1"
                     /db_xref="GeneID:5653992"
     CDS             complement(221802..224990)
                     /locus_tag="LMJF_31_0640"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685049.1"
                     /db_xref="GeneID:5653992"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6J9"
                     /translation="MRPCIGARNTMHARIHASAPPPLWCTRAFLSIRPFLCPPSPLSR
                     SYRTDALLCTLLSFLYFTHTHTCTHRSPYSLWPRWNRRREHATHWHSLLAGRRTPSSA
                     SIGTPPPACQHVRHILPALTHSSVFFISVACSGGCEMRTQRLCSQLATALHSSFVRGS
                     AAAAAAAVCTVLRHASAEAVLAQEEHANALYDDSKDVSPAADQEHAQDAGDEEPHRAS
                     LVSQLLPYVYGPRGVADDAHLSLPIDHVALRRMKKIMNVKSKHDVTKALYNVHLLETP
                     EDCIHYVNLTASYIRQQARMEEQAQSPSLATRQRAAYVQRQLRGVRLSGLEKSTLLRK
                     ACTLVEERRVPLVVASRLLRFRWPGDLATVACGVRQPYVMDLIRSWATEALQQNELEP
                     RDARALLSNCAFALKSAVRRRTKGGAAEPLSDISSFIGALAMKASQDANSPAKAEGLI
                     GLMWSVHLTGCPAPASFWDTMVQRVVSMNEALEGEFASSADAAASENGTPTSAHALST
                     SPASSPSTKAPRAGHFFSTLSTRQLYRFLMVLKLAKWDGNPTVLHRLADQTLRNVAFE
                     LEAANFDRHVSGDSEGERAVAAAAKPSIKPFAVVNAAEVHLGMVQQKPVRLPKSVVAG
                     RIRQVADLHPDEFLELLHLAGDLGVPFSVSATRMVDELLIPLVPHLNAKQLIVLLQVV
                     RHTRSQSSTLMQVVMDRLVERGAAGAYALPLAKATVKTAAKAPAVFQSLRMDDFVELF
                     TTTCEAQHTLVRAAEVAAMGDILYALSRRYEETSLQGQRIREVVNLLCAQADRLVQLQ
                     VASSSIADRLLECTVLLRMRANKMQYPAVQELLASRAVAVDQEERCRQARQERALKYV
                     ETLAAGAAEGAISSPCRESLKWEGLSEGDLPQVAKAALSVYGEFVYIFERMVTVKAVL
                     TAKDFELFAFNIKKAGLYSILQGAQLFQQGHFEADVPYTTPASQAAAQGLSRTMPAWM
                     DKTVTNAVLAKLSNSRISSSDTGDDFLKVLGHVHCDAAKVDAVIEMMARSPLRRLQRQ
                     RPVWLYIAELARRFGSEETKEAMSAYLKKALY"
     gene            complement(<225250..>226257)
                     /locus_tag="LMJF_31_0650"
                     /db_xref="GeneID:5653993"
     mRNA            complement(<225250..>226257)
                     /locus_tag="LMJF_31_0650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684998.1"
                     /db_xref="GeneID:5653993"
     CDS             complement(225250..226257)
                     /locus_tag="LMJF_31_0650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685050.1"
                     /db_xref="GeneID:5653993"
                     /db_xref="GOA:Q9BHC8"
                     /db_xref="InterPro:IPR002877"
                     /db_xref="InterPro:IPR015507"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q9BHC8"
                     /translation="MYRCQSALKLVEINDRYRIFHRFRPSTVVDLAAAPGGFAQVALE
                     LMHLPENAPQSALPPMVVAVDQRPIDPMPGLVAVRGNILQHQRILQAVQGALSLTRAP
                     TTSPPRVLSSARTAPQTRCVDMVLHDGVSVVKGQRAFSVTYAQNQMALSTLLLASKLF
                     QRHGLMPDLPTDAAPHRSNKPEGRISRSTSVPRSSSAVLPVCFVSKVLQCDHFAQVLA
                     ATQALFCHVRPFKPVASRPESLERYVVATDFQLAAWQRLTAPHAPLVPQNWQWRRQHH
                     RSTASVSLFSMPPAPEDCSDARHIAWNCLGCGRACIGCQPCLQCGPYRPAEGAGKRSA
                     H"
     gene            complement(<227503..>233232)
                     /locus_tag="LMJF_31_0660"
                     /db_xref="GeneID:5653994"
     mRNA            complement(<227503..>233232)
                     /locus_tag="LMJF_31_0660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684999.1"
                     /db_xref="GeneID:5653994"
     CDS             complement(227503..233232)
                     /locus_tag="LMJF_31_0660"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685051.1"
                     /db_xref="GeneID:5653994"
                     /db_xref="GOA:Q4Q6J7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6J7"
                     /translation="MQSPSPSSCGSPIRPAALPHQPNTTSRTQEDLPLGKASVATLAD
                     ATTSGLKTEALTATNATGSVLSAAALPLQEDNSFLSSITSGEPSPRSEWSSKTRQHVL
                     PLSSSSYLSHYRPSADREAQESGASPSVSRSAHAIMTSRSSIERLVGSQTTDCDSSYA
                     LLRASDTAPPECFASPPTLRGIARSAEVFVNLEDTFSAAAGPTAMQPAATATLCTPPK
                     LTGANGHRSSQAVPPFAIATVATAVTPAAVKNPAICNDASVCLKDATQHSTERGGAHA
                     RHSHVSPPSSSSLASGASELDNDDDRASEGNRLGTPTHRSFLRRSLFGKPSPALYTTS
                     PPPSTTADVAASNGFGGEYSLSQPAAHFPNRCSSNADTALVFPSQTALVTGISAVADI
                     PQCQQNRQQAQQRPLSLFKQTIGKPTPPRTAVSDRESLGSPTRPLQRNSTTAFDEEQA
                     AAPAAATTEFRSGATPFRSLVGCTAAAAAAKGPTADMETRVLPIARLITTPVRLQPAR
                     VSLSTEDWPALGAKASQEDLSDAEGMPWCGLSHPAQCTTCPPQQIEATVDEVLQHLDE
                     DSGGVAAHPCRNPYNSPHTPRGLSSVSCPSRSLSVCSSGLARSYAASFACERSVSVTE
                     QDGMATAISVSEAQPEELDCCHTPASPHTPLGNRTPGPVGIHDNSMTQYSLGHSHSRY
                     RSQLLSQSITPQRSARRALSRQTTPSQSFRSKVQSLSFESQQQQYMSNYLIDPINGEP
                     ASAAERDYLAPSRNPFSLYRTLEPYATNLLVLTLGAAPGSTSPDFGLSEHDLTESQAA
                     FTAALQRTAFRPDAAVVLYEQLVPPPSNSPGVSHRARMEESAAHAPLAALLISDVDTE
                     ESLSLANLPLTASGCSGKHGRAWSVLLEQDKATKPSGAGVVANGCGRRTTPLAAQTLD
                     VQSPTGVIRTDPQTNAALTSSSSTPAVHPCASASVALPEIEPLTPQSLFCHGMQRTTP
                     LVAAVEAASGSIPLHSPLATGAASASSGELRDTSISTSLLKQPQRGECAMSDNASPLP
                     QRPTQNPITMESYSESSTGCGTVAAGRQIHFEYEEGDGEAAWSGCDEVCCPFSPTSVE
                     EGDTQKVLHARSSLDLRAGGSGSTWSSYGSPNYLCNTVANTGFSASAQPSPVKELKVF
                     RVTSALPAWPAPECEAALATYDREARAVALPLPSLNLTRLANHSPRLQFRPPTLQRHP
                     SLGREVAELRIASESSWVRGAQAPVVAGVNASAPSSEHADTSATAQIGCRLAESFSDP
                     LEANDTSEEEVPGDRFQAHHVFQFLHRITTTCGGGDVRAAKREDGRRAIPLCVEVNGV
                     TWLAMHRLNGLPYAVKEVPAAAFNLAELRCLTLSVNPPSGRETTNREARLEPRDQYSA
                     VLTADDRLEAEDCIVRYYSVSTPLQNSINPEVHLLQLEYFPRGSLSELARRCSETHGA
                     FSAHEPSSFAVGAGVLSSRFWLEAVTQGLRGLRVLHHADLIHGCPLPLSLFLCGNTPS
                     AVRFKWSCFGNARADADIYPTESLPAWVSDAVSRLYRRAISGGSSVTPDVMEVAVFCL
                     GILEVLVNCLAARVLSVRPSRASQRLSELEWIEVVVMEKSLELYATEKENGEDMQALV
                     RLMRLLWDVSNSYRTAAQALAQLNVRVDSAARVVEQVYECELARLTRQLEERRRRPHR
                     RQQQGQPQVLHGANAAFSLPTDAFFLRSPAMRTVAAGASSRRPGEISELSSPPLHPAH
                     DLAVTRTSVSSLGAAAPLPKSRNGTPQLVCSARLPLHHTLLNCPITVAGSLFLPASTA
                     AAPAGAAFAPPATLRVERTLSDMSGRRGGGGMMGHRTRSELHPSILKAVNHMLETAVK
                     SGEGGARDAMTALLRPAVESMCQRGWTTLYAGVPLAVTGVISVDARAGTSKAAEALMK
                     SLQPMTSFE"
     gene            complement(<235673..>239266)
                     /locus_tag="LMJF_31_0670"
                     /db_xref="GeneID:5653995"
     mRNA            complement(<235673..>239266)
                     /locus_tag="LMJF_31_0670"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685000.1"
                     /db_xref="GeneID:5653995"
     CDS             complement(235673..239266)
                     /locus_tag="LMJF_31_0670"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685052.1"
                     /db_xref="GeneID:5653995"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6J6"
                     /translation="MRSGTESLGFVEEDSSQPLSRQPTKAPVVVPKRPRINTMPRLHS
                     PSLQTAKAAGAKPPLHNSASGAAAGGTTAHPSQSAAASKLAKVDIMSDSETDSILFAV
                     EDGSAARMPVRSSTSPMALPAARQSLISATPAGLEKRLSHAGSIGSIQFNSEPGSRGA
                     SPGRKARLNPRASTPVEKAEARAPPLSIARCCVPTDTSISFIEHSLESIEFGFSPLVQ
                     PEPEKCTAPAKNIALPLPPLSPVTGEAASAGTAGPHSTLNEDSIAFQTEDENDCMHSI
                     GTPAFPQNRSLVAMNSGSIPARRDGYSVSVLESCAGDSVDNDSIAFMLEDDTNDKNLQ
                     LGATAAYPLKRDTGTPKLSSAHRSHSLHSRPQSRPLSPSIQFDIENTGNGSAVERSDT
                     LLGGCATQPLAASNLPIFGRSSTPTSSPIPDALPSSSNAALGSTAGVGVLDAAGEAGT
                     ASTPSPTASQLAKKTIVTNRLQQPKKQHSRLPQPRRRAPAPVVGDGKPSPARSATHPP
                     LYQRAAVFTPLDAQASGAPSVSPTGGSKSRSASLSDRNASRKKGARVPLSPFPTHEEQ
                     RGRLKHRSKESTACWTTDESPNDRLVTEEGSTGSMDSPPEALVTGARSHTSTAAASAT
                     ASPTQAIHMAFPTPDGRRVPHSSAQVYSANQDVGNQCYRHHQQLNRDANPVTADDHAY
                     ALEMRGELVTGAFEEAEQWRQFNERQRAELVELRKRIAIARRQDRTLLESSPSHERKA
                     LMPAPSSRRFVPQPTPMGDGYSSRRPRSQGALHRGEARDKDAKCGGAQGNPFREARGT
                     SPPTGSARRLQASVQGAYAPAAAAKPSPCPAHRTGSAVSPPSPYPRATSAVHGVPSDS
                     IVQSAAAASVADLLGILWPPRTAAANPSQRRSHTIGAFAVENGTPDVDLYFLNGSRLT
                     PAQVVRFLDLVRVHSDAEPHTASAAPPRASVVGAMEALAPTTLRQQAAPSSLTVSAKR
                     GGNDVYVDPTDFYAFGRSIPRSSSPPRDSRAAPLSAKLTALLPKKGIRRSRVLREVFD
                     AMDLKRQGSIALHHLPLLARLFEVELSSIEHTRASLLQGNAMSLRSLLESAVASRQLH
                     ATSWRGARENVAAGSQRGLDAVDGVALHYAGLTRDEQANLTHLTHRLLLLSFAVNVVI
                     PIASVSRIPLLDFSTLSMIVYAAVDSVDQPMGSPKGEWRQVVQQYFIALAA"
     gene            complement(<240880..>241683)
                     /locus_tag="LMJF_31_0680"
                     /db_xref="GeneID:5653996"
     mRNA            complement(<240880..>241683)
                     /locus_tag="LMJF_31_0680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685001.1"
                     /db_xref="GeneID:5653996"
     CDS             complement(240880..241683)
                     /locus_tag="LMJF_31_0680"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685053.1"
                     /db_xref="GeneID:5653996"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="UniProtKB/TrEMBL:Q9BHF8"
                     /translation="MGKIEVTVCAARKLHDCQLIGLPDPFVRLVMGDKRYKTQVVKNS
                     LNPAWDETFRFHIPDEMSTQLRLEVWNKCTYSDDLMGYYALSLGGLTKGIVKDQWYIL
                     EKSKTQAELHVRLLAVDFGALPKQEELWMVTTDINRDPVKRAMEDGTWRPGQKTAPQQ
                     QPQSLGVQCVAAPPQQAPCVPPLLVQYVPAPQAQYTPQPQLMQYVPQQPPQGYYQPRP
                     PLPQPSYYPPGPPPPLQSGYYQQPPVPIQQVYYTQPPSQCYAPQPQYQY"
     gene            complement(<242493..>244085)
                     /locus_tag="LMJF_31_0690"
                     /db_xref="GeneID:5653997"
     mRNA            complement(<242493..>244085)
                     /locus_tag="LMJF_31_0690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685002.1"
                     /db_xref="GeneID:5653997"
     CDS             complement(242493..244085)
                     /locus_tag="LMJF_31_0690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685054.1"
                     /db_xref="GeneID:5653997"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6J4"
                     /translation="MREREVLVLLTALTLPTSPFGSRCCTLAYVIGAHNFFFAARTHR
                     RTAAMSQPYSAVADATGKAYVDIRVCDLLVQQGNMPKGLDSDFQIDGLYVVLRCQEDV
                     RRTSCLWSTAPGACATELQSAAMQLGAAAGAYEAQSDDALVWNEMFRFVVPPALPLST
                     PAISPRAPHSPPSADGGDPQGGFCAPYTPPLPLSGSASGVAGGLHDIPGGIALPMSTA
                     ASGGMRAAGSSGFPVPYTPQPSSLAISTPPLHSAAAQKQPSGGGNGARATEAVASHAS
                     LFYPTIELELWRSAPLSENLLGRYKYHVPMELMQGGYALSNLDAVVERVVLLRTKDAP
                     SIMGNLYGWSGHRLSLRLRVQAVGLAPLMAAWSPQQGSEATMTAASTIGSAAYPAPFP
                     TGMLGNTVTGAPPYVAAGVYGAPLGTLNPVLVNLLAPLGVPTGGSGAGQLAPTVMMSM
                     PGGMGGDNLHKPGQPPFFSMFPPASEAPADVGGKMFHPHLPGVLPATPQSSGQGILGD
                     GDLTWQSSTTQPTVYPPYRLPR"
     gene            complement(<244600..>247257)
                     /locus_tag="LMJF_31_0700"
                     /db_xref="GeneID:5653998"
     mRNA            complement(<244600..>247257)
                     /locus_tag="LMJF_31_0700"
                     /product="putative ATP-dependent zinc metallopeptidase"
                     /transcript_id="XM_001685003.1"
                     /db_xref="GeneID:5653998"
     CDS             complement(244600..247257)
                     /locus_tag="LMJF_31_0700"
                     /EC_number="3.4.24.-"
                     /codon_start=1
                     /product="putative ATP-dependent zinc metallopeptidase"
                     /protein_id="XP_001685055.1"
                     /db_xref="GeneID:5653998"
                     /db_xref="GOA:Q4Q6J3"
                     /db_xref="InterPro:IPR000642"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6J3"
                     /translation="MQSLAAMAPSYFSTALQSRYTCVLVTGTQPAQTPSASTSLSDVM
                     ATIRRLSYAGWLHRHLGAPLRVDDVSASVEGSQKLSALFQTLRQRPIGSASSTALRTR
                     GVLFSKDGGHRGGENGKGEEEGAADEGEDKPEDWIVPRTCLFVLVMIVMTVVLYQLAR
                     PSGTHTGWASLNKHAGEIKEAVLYENYLQVYMDDAKVYLGLVNDHDTQRHMDELADNY
                     RAARQQALKAQQQQSGETTPADGGKHEHGSKLPTAADTPAELELTMKGRPFAETALIG
                     VGAFAWVVPFIFFPVFVMFLSQYIGKSMSYAVEATKGKTKAKEMIFRVETASNTRFRD
                     IAGMKEPKKEITEIVDFLRHPERYTKLGAKIPTGAMLLGPPGTGKTLLAKAVAGESGV
                     GFIPAIGSDFVELYVGMGALRVRQLFTEARKQRCIIYIDEIDAIGLKRQGAGHGEKQE
                     QEQTLNELLTQLDGFSTGRRGDVMVLASSNVAQEALDPALIRPGRFDRIIHVDTPVIS
                     ERTDIFKVHLSKLKLTPDDTRGDSAAATTATTGAEDGAAGGADAPTAPPLAVPVSTET
                     SLVLSQVKTEEDETAEERQRKDDASAAVSTEAKRISSDNPSSDSSAYEFDIRSVLMQK
                     SERERALIDAYAQRMSNLCPGFVGADIANVCNEGAILAAREGADHVSISHLERSIDRV
                     LAGIEHRSRALSDFEKNVVAHHEAGHAVAGWFLHRADPLMKVSIVPRGGSALGYAQYL
                     PNENFTRTAKEVRDSISVTLGGRAAEQIFFNHLSTGASDDLRKVAKMAYQYVSSFAPG
                     SVYPPPGSNSTRLVKPFGVDKANDFDRRAKTLVDEVYADTLALLTKHKDDMKKLADHL
                     LKHELLTYADVVHYLGERTTRQTDRKKGV"
     gene            complement(<253198..>253587)
                     /locus_tag="LMJF_31_0710"
                     /db_xref="GeneID:5653999"
     mRNA            complement(<253198..>253587)
                     /locus_tag="LMJF_31_0710"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685004.1"
                     /db_xref="GeneID:5653999"
     CDS             complement(253198..253587)
                     /locus_tag="LMJF_31_0710"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685056.1"
                     /db_xref="GeneID:5653999"
                     /db_xref="UniProtKB/TrEMBL:Q9BHG5"
                     /translation="MMEGSPSEVHVHSSMAMGLQERPPLELVSHASEVSCLTINDNYD
                     MWNASMYPNLNSGFDASLTSATTPDTTVARFAPAMRPHRKQQLSHQMMPLPARGEQTM
                     SDIDSEVVLWDRPPTQDVLGSPAASGL"
     gene            complement(<258241..>261180)
                     /locus_tag="LMJF_31_0720"
                     /db_xref="GeneID:5654000"
     mRNA            complement(<258241..>261180)
                     /locus_tag="LMJF_31_0720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685005.1"
                     /db_xref="GeneID:5654000"
     CDS             complement(258241..261180)
                     /locus_tag="LMJF_31_0720"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685057.1"
                     /db_xref="GeneID:5654000"
                     /db_xref="GOA:Q4Q6J1"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6J1"
                     /translation="MSHAHPQKHPSTKRDVAQAAPCPPGTLSLRVSFAASKPEDRKRA
                     NNNRTASQQYELSFIATEMHLGKPFEGLVVPRSPLYPPNIISLTNRDTDTTAGEDSTS
                     SAENERITVDISDHNGKTTAKHGDCQKQTERDAARGALLIYPTKIDNLRRFRILFAGV
                     LLSISSSTQGIHSIFGVLLLQQAYQFSVREMTVVYLSGVSAGLFALPFGALYDWFGPR
                     VVVALGSIIAALGHLLFALTFGGHIPHTVVNCAVFYAVMCWGCYALHVAILPAVLTHM
                     PRDRGQPTGLLQTFSGLGASLFACLFRGFFKDNFENLMWLMFAVTLAAGAGGAWYLED
                     APYVVNRWRQRGITPREQLRAYLIRNRYMSQLVPKRRYAIMAVILVLLNCYLTIQTVC
                     VAYLAADITPGKLRSIAIGAIAITLLILVLVVPLDSIDGLSEQDKQVIAAAKAKEEAL
                     RVMQEERYRQRHLQARQAQRRRSKTRQEEYGQPCHCPDEVGQEDRSADQELSAGAPLN
                     DDSDSGIGAPEHGTQRLARLSLRLDDESDADSNVETSSPIDVPVPAGPVSAGPPQAPH
                     HRGGLLSESLGLPLYELAGPERPLITVYMHEEEDLDGEPSHSHSSHPREQMQLQASND
                     STGAANNDHRSESQQSSVENSFTVHLGGNYNSLQASDALTPSARSDPAHVELRRTASS
                     TYSNPRVETITLCGEVYVVPVYQTTFLESLTYLDLWLIFYTTLCVWGIGLVMTSNWNI
                     QIMLKARYGPMEAKHYVLFAAMAGVSVAGGRVFLGIYERVLQVLRERTGTVIVPTLIY
                     PVASVGLFVGMLFWIALPGEQVLILAYILGAFFYGMSTSATFYVLGTVFDRDMGMHYG
                     FCCVGGGVGFALCYWCAWYLTYEREASPQTPGYCVGARRCMSRAVGVYLALAFSSIAS
                     SYLVHRRYSKLVRGKLAQRRVIVPRIKQLLVACGCCGNGDQVKGSGSTCIIGTAETKE
                     KGVQLQD"
     gene            complement(<263200..>263535)
                     /locus_tag="LMJF_31_0730"
                     /db_xref="GeneID:5654001"
     mRNA            complement(<263200..>263535)
                     /locus_tag="LMJF_31_0730"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685006.1"
                     /db_xref="GeneID:5654001"
     CDS             complement(263200..263535)
                     /locus_tag="LMJF_31_0730"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685058.1"
                     /db_xref="GeneID:5654001"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6J0"
                     /translation="MSNITFCLPAALQLVMPPYREVSQNVPSADTLGDCTGERGVFTE
                     VKTAPRVCLHEPLTLVQSLLAHVADKEPEHDETEFFDAARVYVALRHRLNHVDAAYSS
                     GKRAQASKK"
     gene            complement(<264663..>265622)
                     /locus_tag="LMJF_31_0740"
                     /db_xref="GeneID:5654002"
     mRNA            complement(<264663..>265622)
                     /locus_tag="LMJF_31_0740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685007.1"
                     /db_xref="GeneID:5654002"
     CDS             complement(264663..265622)
                     /locus_tag="LMJF_31_0740"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685059.1"
                     /db_xref="GeneID:5654002"
                     /db_xref="GOA:Q9BHG3"
                     /db_xref="InterPro:IPR010261"
                     /db_xref="UniProtKB/TrEMBL:Q9BHG3"
                     /translation="MQMEEKQAFFVESVDGRKFKMVIRGDLGKLSVAKIRRYLKSYGV
                     PENQLLLAGNRVLEDAMLGEQFGLENEGVLHLREPTTVQHLAPAAVPSTAQSRTQLQQ
                     KPELSYEPQSAWRETRYEPAAHDARQMQREIERLQRQVEAAEARNADLEHQLEQVAES
                     SAPYPPRGGAGGARRMSNSSDLDGLQVAKQSLKILAQKLGVSLQFDKNLTCVVGTDAD
                     FSILLTYDPATERLYIYSSLLTELPDHPPLRMKLYEVLLEGSLLGREVCGGGVGLSTQ
                     NNVVVLTTSLPVRHCSPEALCEVMPLFVETLVRWRSLIDELVR"
     gene            complement(<268609..>269502)
                     /locus_tag="LMJF_31_0750"
                     /db_xref="GeneID:5654003"
     mRNA            complement(<268609..>269502)
                     /locus_tag="LMJF_31_0750"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685008.1"
                     /db_xref="GeneID:5654003"
     CDS             complement(268609..269502)
                     /locus_tag="LMJF_31_0750"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685060.1"
                     /db_xref="GeneID:5654003"
                     /db_xref="UniProtKB/TrEMBL:Q9BHD3"
                     /translation="MTKSYLNQDQQLRAQQVYTTHKHLKELSMATKEALTYHDKYLAA
                     MEHVMSCLLNNSDALEDARKHLTQEAAVDIQPTFPTAGRLAAAYSNWRVSAELHMMRT
                     ELEFLKEVSTTGHEAVKKTKNAVHGLEKVAKKCAHVNSPEFEAKISSKSGKALEKLLH
                     EQRETNTMMMSIENAIKKDMMSLATSWSAKLVTRGDALYTAFRSLGCRTVACFPTTDP
                     TLSQGMPPPAAGYVLSQPSSASTSVPYSGGTAVGHGTPSTLPAAQSVECAAVPLSSAG
                     EGAAAGVKLEFNLNEGKPVSR"
     gene            complement(<274233..>275135)
                     /locus_tag="LMJF_31_0760"
                     /db_xref="GeneID:5654004"
     mRNA            complement(<274233..>275135)
                     /locus_tag="LMJF_31_0760"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685009.1"
                     /db_xref="GeneID:5654004"
     CDS             complement(274233..275135)
                     /locus_tag="LMJF_31_0760"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685061.1"
                     /db_xref="GeneID:5654004"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6I7"
                     /translation="MAAVPQQVPVSSTGRRAQREWVLKIKETSNLLYRSAAQAQRNFD
                     QYLTAMEYVGALYKDYGELLSTAQNSFLNVQSDVEGVEDVKNICARLHISIHRWEHSE
                     ELYAVRNQLHLQTQVLKAHSDHSSRVLQECVQRDELIKMHTEKSALLATKLRKQSSEV
                     DKLQKECDKLDRKIAKRSEVAQKDLDAMAVKSTATVLSLTSQFFKVMHKNGAFIADRF
                     SPDRAGVGAHDFDTASDDAVTGTLRRLHSVRSEMSSVAPSAVYGQNYNTFHPSEADTR
                     VSDGARNSGIPLRYETSVPPAMSA"
     gene            complement(<280516..>281409)
                     /locus_tag="LMJF_31_0770"
                     /db_xref="GeneID:5654005"
     mRNA            complement(<280516..>281409)
                     /locus_tag="LMJF_31_0770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685010.1"
                     /db_xref="GeneID:5654005"
     CDS             complement(280516..281409)
                     /locus_tag="LMJF_31_0770"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685062.1"
                     /db_xref="GeneID:5654005"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6I6"
                     /translation="MSMQQDFVHPRQLDDMRAIHAAINSFSGVMTKMMVLMKELGTTL
                     GHVSHSFDALASLTFTKDEVKQYARKCGGEIISMKEGIAFCEYNKLVHEDVLHPVEQL
                     KESLKEAEQAAKAEKSAFEKYKKAKQRVDKQEKAFAEKSKPLDTSKSYPTHVRARNKA
                     LVSLQNCNNKFEERFVMLTSDVESVTSTALRRYLELNAGYMTSVVDALTKTDPTVEEA
                     AVFYRQEKQAHRQSAVEQCCLQVNSDLSTAHASQGYRFDPSRMNGCLHDTIIFKRLPS
                     RLRHSTGSRTRSLRVNRPAVE"
     gene            complement(<282448..>283272)
                     /locus_tag="LMJF_31_0780"
                     /db_xref="GeneID:5654006"
     mRNA            complement(<282448..>283272)
                     /locus_tag="LMJF_31_0780"
                     /product="putative c2 domain protein"
                     /transcript_id="XM_001685011.1"
                     /db_xref="GeneID:5654006"
     CDS             complement(282448..283272)
                     /locus_tag="LMJF_31_0780"
                     /codon_start=1
                     /product="putative c2 domain protein"
                     /protein_id="XP_001685063.1"
                     /db_xref="GeneID:5654006"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="UniProtKB/TrEMBL:Q9BHE7"
                     /translation="MGRLEVCICGACNIGGTRKAGIPDPYVKVVMGDRKKAHIKYKTK
                     VVSSSLNPVWNEVLTFQVADYDSEQIVFELWNKNVIVDDLMGVYALSLNGLTRGVVSD
                     LRVILTGTGLSSPELHLQVLAVDFGVDPQPSSMVVRSIKEYNAAAVTNPVMTATEMKK
                     VTCADDFDSVQKPSSSEPAMGIPLQAQVAPPPQPLLQPVYNQQPTFVQQAQPYPLQPA
                     PPVMYLQPPPPPPQVVYVQQAQPLPHPIYYQQASPPGSYYGAPQQPYQCMYGPSPI"
     gene            complement(<284338..>285204)
                     /locus_tag="LMJF_31_0790"
                     /db_xref="GeneID:5654007"
     mRNA            complement(<284338..>285204)
                     /locus_tag="LMJF_31_0790"
                     /product="putative c2 domain protein"
                     /transcript_id="XM_001685012.1"
                     /db_xref="GeneID:5654007"
     CDS             complement(284338..285204)
                     /locus_tag="LMJF_31_0790"
                     /codon_start=1
                     /product="putative c2 domain protein"
                     /protein_id="XP_001685064.1"
                     /db_xref="GeneID:5654007"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="UniProtKB/TrEMBL:Q9BHE8"
                     /translation="MGRLEIRVCGARNVANVQRVGKPDPYVKVKLGNSKKSQIKYKTH
                     VAENCLNPVWNELFKFQVADYDSMQVVFELWNDNVIVDDLLGSYSLSLNGLTRGVVID
                     TWVLLEGTKGSSSELHLRVLAVDFGRDPGPGDRLTLSLEGDTMMPSTGQTYRPPKNYV
                     PPTQGIVLQSYPPAPLGPPPPVVYSPSAAPRPQVQYGYVTPPQPQRYACGAPPPPPQQ
                     PPSQGYGYGAVQAPQNYSYGAPPPPQPMYGAPQLPQCLPYAAGPPPPQMYGPPPPQRR
                     PVQMAYGIPPDM"
     gene            complement(<288377..>288538)
                     /locus_tag="LMJF_31_0795"
                     /db_xref="GeneID:12981431"
     mRNA            complement(<288377..>288538)
                     /locus_tag="LMJF_31_0795"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722325.1"
                     /db_xref="GeneID:12981431"
     CDS             complement(288377..288538)
                     /locus_tag="LMJF_31_0795"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722373.1"
                     /db_xref="GeneID:12981431"
                     /db_xref="UniProtKB/TrEMBL:E9AEF2"
                     /translation="MYLWGDEGVAASLTGHSSVMMECCFAFFFVRFFSLLPSELFFLP
                     RALESVVFQ"
     gene            complement(<289685..>291457)
                     /locus_tag="LMJF_31_0800"
                     /db_xref="GeneID:5654008"
     mRNA            complement(<289685..>291457)
                     /locus_tag="LMJF_31_0800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685013.1"
                     /db_xref="GeneID:5654008"
     CDS             complement(289685..291457)
                     /locus_tag="LMJF_31_0800"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685065.1"
                     /db_xref="GeneID:5654008"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6I3"
                     /translation="MSTIPKDSIDEMVSRIAIPDNIPIQNLPVLNAPELKLIGRCVSF
                     CVKLPANGATSVSSYYTGLVSMVTGTSVALIYVNRYTHEDFEEYKALEQRLANNENPA
                     PDEQRTVESAPHGMNKLMRSLRRLHSVPTRADVDASAMQSGRSVFDGLPAHPNAKEGE
                     ASADDERALSITADPCVLCATDAAGSLAPAVPLTTVAELETAEVRDGDVRECVSEAAR
                     LLLAEGAGGAGSVSRGLQVRAFRRFSGSIGPIPYVTFLRKSIHDVEFGRDPNAIFYSL
                     FQNPAKHIDDMQCLRMFVRRYLVHTSEGNNPRQVPLYAFLSARCAWPDVDRELVNRLV
                     HEELAALVKADRAIAAEKERKRAREERQLQRYRAPAGLFSSTGILYLTKIPQGAFLAA
                     VVILVVTMIFAMLLSVSLSTVSDSLIITFLSKFMRSFLAAIVVWGITGITGIVYATVV
                     HLPLRECTMLVGMHVFFAFFSTVCCIMCIVLILANITKGAIYKHMVSHRTLDLCAFYS
                     RRNCTGFLQSCDVMDAYNVNLCSTCPQMLAAGGCYVVARRMVDAALAPMLVFTLFITI
                     ALVYVGILLFKLLVAAKAMTGRFF"
     gene            complement(<292899..>294788)
                     /locus_tag="LMJF_31_0810"
                     /db_xref="GeneID:5654009"
     mRNA            complement(<292899..>294788)
                     /locus_tag="LMJF_31_0810"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685014.1"
                     /db_xref="GeneID:5654009"
     CDS             complement(292899..294788)
                     /locus_tag="LMJF_31_0810"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685066.1"
                     /db_xref="GeneID:5654009"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6I2"
                     /translation="MEEHPAFGGRGPTSINGFHDDYQRERAPREPISTQDMDLEDDLD
                     HRIGRERPSRSPTFDPTAPTEDPVPRIVLCEDRPIENLPAMVSPELKLIGRCVTFLVK
                     QTLNGVLATSYYYIGLVSTVTVSTATLMHVNRYTPADFKAYKSREQRLAKGVAVPANS
                     GSSIGNDGGREFNEKSMSPNNRPPSSLSGSELRSYSRANDDEVAAAEDGGLTRIRGTG
                     RLTDLYASGSLAHSALLTTETELETAISKQRDKEQLLAPYTSLEENQGQPEAGGAARH
                     RHFRRFSGSIGPIPYVTFLRKSIHDVEFGRDPNAIFYSLFQNPAKHIDDMQCLRMFVR
                     RYLVHTSEGNNPRQVPLYAFLSARCAWPDVDRELVNRLVHEELAALVKADRAIAAEKE
                     RKRAREERQLQRYRAPAGLFSSTGILYLTKIPQRSFFSGIVTLLFTLLFAVYLGVVLS
                     ITSDALIVSFVNKFIFFFVASVVVWPTAAVAIMLHASKGHIPLLVDHFRLGTRIAFTL
                     AAIGCCVMTLLVVLWKMTNQAMFDHMLVHQRDQLCAFYQQHTCTGFSEACGSGRINPN
                     LCLLCTNMPVTNTSCYAYLWVEVEKALVPLLCFTCIILMATVYAAYLVVKLFLFVEVM
                     MGRIV"
     gene            complement(<297195..>297941)
                     /locus_tag="LMJF_31_0820"
                     /db_xref="GeneID:5654010"
     mRNA            complement(<297195..>297941)
                     /locus_tag="LMJF_31_0820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685015.1"
                     /db_xref="GeneID:5654010"
     CDS             complement(297195..297941)
                     /locus_tag="LMJF_31_0820"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685067.1"
                     /db_xref="GeneID:5654010"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6I1"
                     /translation="MLASSAGIDASAMQSGRSVFDGLPAHPNAKEGEASADDERALSI
                     TADPCVLCATDAAGSLAPAVPLTTVAELETAEVRDGDVRECVSEAARLLLAEGAGGAG
                     SVSRGLQVRAFRRFSGSIGPIPYVTFLRKSIHDVEFGRDPNAIFYSLFQNPAKHIDDM
                     QCLRMFVRRYLVHTSEGNNPRQVPLYAFLSARCAWPDVDRELVNRLVHEELAALVKAD
                     RAIAAEKERKRAREEPVAMSRWTYPLQSDY"
     gene            complement(<300619..>301545)
                     /locus_tag="LMJF_31_0830"
                     /db_xref="GeneID:5654011"
     mRNA            complement(<300619..>301545)
                     /locus_tag="LMJF_31_0830"
                     /product="putative lipase"
                     /transcript_id="XM_001685016.1"
                     /db_xref="GeneID:5654011"
     CDS             complement(300619..301545)
                     /locus_tag="LMJF_31_0830"
                     /EC_number="3.1.1.3"
                     /codon_start=1
                     /product="putative lipase"
                     /protein_id="XP_001685068.1"
                     /db_xref="GeneID:5654011"
                     /db_xref="GOA:Q4Q6I0"
                     /db_xref="InterPro:IPR002921"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6I0"
                     /translation="MLPSSCSRIVVVAALLLLCGGARAVVLSGEYSQTDAIRSLQYAN
                     ATYADSDAVASWNCGGSCNANPSFKVTSIVKGDDAHSLHAYVGVDEGSAQVVVALRGS
                     ATQQEQLMRQLVEPVLYDITSGCGLECRVHAGFQRSYLAVRRTIRAAVVRDLMMHPDY
                     NVLVTGHSVGGAVALLAAIDVQAHVNRMFFVSRPIVSLYTFGMPHVGNRAFAVWAAGM
                     LSRGSHFRITSRHDPVPRMLSSGSADFQHVPYEVYCSAADGTNCRVCEGSVDSDDPTC
                     IAHTSNVNMRDHFFYFGERISGGAAGDAMLYL"
     gene            complement(<303205..>304044)
                     /locus_tag="LMJF_31_0840"
                     /db_xref="GeneID:5654012"
     mRNA            complement(<303205..>304044)
                     /locus_tag="LMJF_31_0840"
                     /product="lipase precursor-like protein"
                     /transcript_id="XM_001685017.1"
                     /db_xref="GeneID:5654012"
     CDS             complement(303205..304044)
                     /locus_tag="LMJF_31_0840"
                     /EC_number="3.1.1.3"
                     /codon_start=1
                     /product="lipase precursor-like protein"
                     /protein_id="XP_001685069.1"
                     /db_xref="GeneID:5654012"
                     /db_xref="GOA:Q9BHD5"
                     /db_xref="InterPro:IPR002921"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q9BHD5"
                     /translation="MCRIQSWTCGSACNSVATFEPKAAMSHVITGAGGFVGVDHATQQ
                     IVVAFRGTSNIQNILADIHVLLAKYDKSSSCGSQCEVHSGFYASYMSLRQQTRDSVLE
                     LIHKNPTYEIVVTGHSLGGAIALLAAADLQERLNNLESPSDLKLVSVYTFGAPRVGNV
                     AFAKWPDSLLAKGAKYRITHAGDPLVIVPARTWGYAHRASEGFYMTPSNNSAVMCNDL
                     SGQEDSTCTLAIFFRVLDDHMYYMGDTTGCKGHASLPSAAVCDAPAVGCVIFLLGVLY
                     SLL"
     gene            complement(<307999..>309309)
                     /locus_tag="LMJF_31_0850"
                     /db_xref="GeneID:5654013"
     mRNA            complement(<307999..>309309)
                     /locus_tag="LMJF_31_0850"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685018.1"
                     /db_xref="GeneID:5654013"
     CDS             complement(307999..309309)
                     /locus_tag="LMJF_31_0850"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685070.1"
                     /db_xref="GeneID:5654013"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6H8"
                     /translation="MSMQQDFVHPRQLDDMRAIHAAINSFSGVMTKMMMLMKELGTTL
                     EQVSHSFDALTSLTFTKDEVKQYVHKFGEEIISMKEGIAFCEYNKLVHEDVLHPVEQL
                     KKSLKEAEQAAKAEKSAFEKYKKAKQRVDKQEKAFAEKSKPLDTSKSYPTHVQARNNA
                     LVSLQNCKSEFEERFVMLMNDVESVTSTALRRYLELNAGYMTSVVDALTKTDPTVGEA
                     AVFYRQEKQAHRQSAVEQCCLQVNSDLSTAHASQGYRFDPSRMNGCLHDSIKKSPNTF
                     QQQHRLSNTVSPGQPPRCRMTSPAMPATEAGAPLPSRGASAVANVQTLKPTAEAATAT
                     TAAVITAPPSAVEDNADDEEFGSISQVGIAGREAPPLYTFARGPESVVSSAPPQPGYI
                     ASHNAALTTEFMTRMEANSIAASEVSALARRCSPCDPSESTGRL"
     gene            complement(<315900..>317732)
                     /locus_tag="LMJF_31_0860"
                     /db_xref="GeneID:5654014"
     mRNA            complement(<315900..>317732)
                     /locus_tag="LMJF_31_0860"
                     /product="putative ras-like small GTPases"
                     /transcript_id="XM_001685019.1"
                     /db_xref="GeneID:5654014"
     CDS             complement(315900..317732)
                     /locus_tag="LMJF_31_0860"
                     /codon_start=1
                     /product="putative ras-like small GTPases"
                     /protein_id="XP_001685071.1"
                     /db_xref="GeneID:5654014"
                     /db_xref="GOA:Q4Q6H7"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6H7"
                     /translation="MSSTGQHVNIGDADDYTYTEDPAGQRVKVPVSKEYVFKVVILGD
                     YSVGKTSLIKRLLSIPASGASPRSHEDCSDMDDSVGDSDADDALATVTPTVGTDFYSL
                     ALPDVIPGASVRLQIWDTAGLEKYAASYESTLRNASFVICVFDVTNPSSLHSVVGRHL
                     SIVADHVPHLDQSSIMVVANKIDIIVDVSTNSEALRSARKRARLPENAFVIAVDEEAS
                     MDTSDSSPDIFTSAEGASENAIVTSRKVQEEVFDLFTDVHYSEVSAKTKQHLREMLHA
                     VCYALLRNSVGDNPNIQIPDGTPPSEVFAHTVLPPHSGAKCPTGASAGTFSAPQLDPA
                     ATKTPPAAVPRDSPTRGSLQPPPRTTPAPPAASWRSTEAISFDLSPTQFSSKAGFSPA
                     EGSDGAIGKSGGDDSAPQRVGSGGDSPVDGSSTRLPTPRGNLAKAVDAGGVHLDLTAG
                     STEQGTGPNRKEDPKARKEREQTEMKAVLSCAGQRKVNPNGGGTDTGRSAAWLQNDAD
                     RMENNITLGLKKAGDAPSAARPAPVSSILDSHGVQGRCKGNQGTRGRDSDDDDDGARM
                     QLQLKKRFAQIEHDIRQNAAAANQRAKKAKKKTKAKGKCNCCVL"
     gene            complement(<322189..>323631)
                     /gene="AAP3"
                     /locus_tag="LMJF_31_0870"
                     /db_xref="GeneID:5654015"
     mRNA            complement(<322189..>323631)
                     /gene="AAP3"
                     /locus_tag="LMJF_31_0870"
                     /product="amino acid permease 3"
                     /transcript_id="XM_001685020.1"
                     /db_xref="GeneID:5654015"
     CDS             complement(322189..323631)
                     /gene="AAP3"
                     /locus_tag="LMJF_31_0870"
                     /codon_start=1
                     /product="amino acid permease 3"
                     /protein_id="XP_001685072.1"
                     /db_xref="GeneID:5654015"
                     /db_xref="GOA:Q4Q6H5"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6H5"
                     /translation="MSKPSKSIPAQAEGEVLSDSLMGGNSGNAVDKHPSGEQGSHLHK
                     SGSLTDSSSHNGNGADAAKPEHNIILRFTGWLIPYGGVISNCFSLGSVTLGGGIISMP
                     SSFAMSGIIMSVIYLVVITAATVYTMTLLGYAMKATGCKTFEELSLVLFGRGWDYFVG
                     FVLWLSCFGTAVAYISAVSSLITPILEKSPGTPAYLLTTSGNRVITSLIWLVFMVPVV
                     IPKRVNSIRYVSAIGVFMVLYFAVTIVVHSSMNGMKEGMRGDMKYFTSGNEAVYGLSI
                     FIFSFLCQAVTGSVYFEQRPRPSVSQLTIASVISMTVCMVLYIFTGIFGYFDFADDTQ
                     DSILYNFDPVHQPYMMIAYIGMMIKICAAFAMNMLPCRNFVYHCLNWDLETVPYWKHT
                     IVILTMAVATLVCGLFIPSINTAFGLVGSLCGGFIGFIFPAYFWMYSGNWSLSSVGIW
                     HWLATYFLVVAGVVAVVFGTVSTIYYSFFV"
     gene            complement(<327730..>329172)
                     /gene="AAP3"
                     /locus_tag="LMJF_31_0880"
                     /db_xref="GeneID:5654016"
     mRNA            complement(<327730..>329172)
                     /gene="AAP3"
                     /locus_tag="LMJF_31_0880"
                     /product="amino acid permease 3"
                     /transcript_id="XM_001685021.1"
                     /db_xref="GeneID:5654016"
     CDS             complement(327730..329172)
                     /gene="AAP3"
                     /locus_tag="LMJF_31_0880"
                     /codon_start=1
                     /product="amino acid permease 3"
                     /protein_id="XP_001685073.1"
                     /db_xref="GeneID:5654016"
                     /db_xref="GOA:Q4Q6H5"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6H5"
                     /translation="MSKPSKSIPAQAEGEVLSDSLMGGNSGNAVDKHPSGEQGSHLHK
                     SGSLTDSSSHNGNGADAAKPEHNIILRFTGWLIPYGGVISNCFSLGSVTLGGGIISMP
                     SSFAMSGIIMSVIYLVVITAATVYTMTLLGYAMKATGCKTFEELSLVLFGRGWDYFVG
                     FVLWLSCFGTAVAYISAVSSLITPILEKSPGTPAYLLTTSGNRVITSLIWLVFMVPVV
                     IPKRVNSIRYVSAIGVFMVLYFAVTIVVHSSMNGMKEGMRGDMKYFTSGNEAVYGLSI
                     FIFSFLCQAVTGSVYFEQRPRPSVSQLTIASVISMTVCMVLYIFTGIFGYFDFADDTQ
                     DSILYNFDPVHQPYMMIAYIGMMIKICAAFAMNMLPCRNFVYHCLNWDLETVPYWKHT
                     IVILTMAVATLVCGLFIPSINTAFGLVGSLCGGFIGFIFPAYFWMYSGNWSLSSVGIW
                     HWLATYFLVVAGVVAVVFGTVSTIYYSFFV"
     gene            complement(<330668..>331144)
                     /locus_tag="LMJF_31_0890"
                     /db_xref="GeneID:5654017"
     mRNA            complement(<330668..>331144)
                     /locus_tag="LMJF_31_0890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685022.1"
                     /db_xref="GeneID:5654017"
     CDS             complement(330668..331144)
                     /locus_tag="LMJF_31_0890"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685074.1"
                     /db_xref="GeneID:5654017"
                     /db_xref="InterPro:IPR029488"
                     /db_xref="UniProtKB/TrEMBL:Q9BHH0"
                     /translation="MEPKRSGNMACVERERERDYWRHLERLNNQRCRIDNTIPVSCAY
                     VRPIGSMRRNPARAEQVNRDNQKLVEKMVHIMNTRGGVDTSEPWRDYNKAINSQRRRN
                     QEQANIARENAKLLDRLERTQPTYRSEKFEADRRRNEEFAARASRYPYQPMDRTRY"
     gene            complement(<332843..>333082)
                     /locus_tag="LMJF_31_0900"
                     /db_xref="GeneID:5654018"
     mRNA            complement(<332843..>333082)
                     /locus_tag="LMJF_31_0900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685023.1"
                     /db_xref="GeneID:5654018"
     CDS             complement(332843..333082)
                     /locus_tag="LMJF_31_0900"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685075.1"
                     /db_xref="GeneID:5654018"
                     /db_xref="GOA:Q9BHG9"
                     /db_xref="UniProtKB/TrEMBL:Q9BHG9"
                     /translation="MSAMQLLIVALAACLSVAAAKSKEEFPLVWVCLGITVVGVIAAL
                     YVAYKRPDELHLPGSVVMTAVESDPGNGKSSVENV"
     gene            complement(<337138..>337644)
                     /locus_tag="LMJF_31_0910"
                     /db_xref="GeneID:5654019"
     mRNA            complement(<337138..>337644)
                     /locus_tag="LMJF_31_0910"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685024.1"
                     /db_xref="GeneID:5654019"
     CDS             complement(337138..337644)
                     /locus_tag="LMJF_31_0910"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685076.1"
                     /db_xref="GeneID:5654019"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6H2"
                     /translation="MLSRRLLLQRGQAKAGCSLVIFKENVGAWMPSNDAPVKACCSLS
                     EIIRMGGLAAKLEKCQCGDASKRLRSSSALRGNDDNGGEPSSPAERLVTPLAKLLTSA
                     VGRHLCLSTTHCGSSKGEKATSLAAQCYIMTISHAQMLLLLCPTLCKEAKLGDGGGFI
                     QCAKVCRS"
     gene            complement(<340961..>342826)
                     /locus_tag="LMJF_31_0920"
                     /db_xref="GeneID:5654020"
     mRNA            complement(<340961..>342826)
                     /locus_tag="LMJF_31_0920"
                     /product="putative sodium stibogluconate resistance
                     protein"
                     /transcript_id="XM_001685025.1"
                     /db_xref="GeneID:5654020"
     CDS             complement(340961..342826)
                     /locus_tag="LMJF_31_0920"
                     /codon_start=1
                     /product="putative sodium stibogluconate resistance
                     protein"
                     /protein_id="XP_001685077.1"
                     /db_xref="GeneID:5654020"
                     /db_xref="UniProtKB/TrEMBL:Q9BHE5"
                     /translation="MGNRQSSVPLEGEGHPEVFYRGVKAAQEGRFTVSEVYFVQALTR
                     HPGRRFWDTFTRAVLQKERNAGFEGGGASLPKDGVQEDVGAGPAVDGPLGSCNDVQPQ
                     PVRGGSVTDKADELPGSDDRGDGGDSAEQTDARTNGAQPVYDTKVVDVFLPLDGDLTH
                     IMDYYRLLADIGHTYLQLIPSTAHVEKVTGLAARYCIFTITHTQMLLHCLMLWKEARL
                     GDGGGFIDYAKVRNLKICSGAAEHTAQSNADAHSSNEGKQKWRTIDRTASLLFTLQLL
                     EANCRYYCLVFLANYCALLLRSYSCLTDQRKVNRVHANVVEHLDMVSRLVLDLAGEYP
                     NEYLSRLIMANLPKPSNFDRECLSSMGASSHMGSQKILSFGNDQHRHLYASGYPWSPT
                     QSALIPLILARTVRLTVQENVSRTSQAQLRSPAERLSYHYTTWNFDSELVIVPGCSLY
                     MLKKSLPGFEPGKSTFAHYATMAEHEELHVPRAAADVHWQRGSAAVPVPEDGGGAAPG
                     SHRNPRKSEDSADAEKREALTKKCEERLIKKRRHINTDLHLSDERTCVALCLEEACAT
                     ALPSLLLASILRKMSGIPESAEFINNVTDLVMGLYGSDSSEWHIIASILRKHLEG"
     gene            complement(<349728..>351593)
                     /locus_tag="LMJF_31_0930"
                     /db_xref="GeneID:5654021"
     mRNA            complement(<349728..>351593)
                     /locus_tag="LMJF_31_0930"
                     /product="putative sodium stibogluconate resistance
                     protein"
                     /transcript_id="XM_001685026.1"
                     /db_xref="GeneID:5654021"
     CDS             complement(349728..351593)
                     /locus_tag="LMJF_31_0930"
                     /codon_start=1
                     /product="putative sodium stibogluconate resistance
                     protein"
                     /protein_id="XP_001685078.1"
                     /db_xref="GeneID:5654021"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6H0"
                     /translation="MGNRQSSVPLEGEGHPEVFYRGVKAAQEGRFTVSEVYFVQALTR
                     HPGRRFWDTFTRAVLQKERNAGFEGGGASLPKDGVQEDVGAGPAVDGPLGSCNDVQPQ
                     PVRGGSVTDKADELPGSDDRGDGGDSAEQTDARTNGAQPVYDTKVVDVFLPLDGDLTH
                     IMDYYRLLADIGHTYLQLIPSTAHVEKVTGLAARYCIFTITHTQMLLHCLMLWKEARL
                     GDGGGFIDYAKVRNLKICSGAAEHTAQSNADAHSSNEGKQKWRTIDRTASLLFTLQLL
                     EANCRYYCLVFLANYCALLLRSYSCLTDQRKVNRVHANVVEHLDMVSRLVLDLAGEYP
                     NEYLSRLIMANLPKPSNFDRECLSSMGASSHMGSQKILSFGNDQHRHLYASGYPWSPT
                     QSALIPLILARTVRLTVQENVSRHSQAQLRSPAERLSYHYTRWHFNSGLVIVPGCSLY
                     MLKKSLPGFVPGKSTFAHYATMAEHEELHVPRAAADVHWQRGSAAVPVPEDGGGAAPG
                     SHRNPRKSEDSADAEKREALTKKCEERLIKKRRHINTDLHLSDERTCVALCLEEACAL
                     ALPSLLLSCVLQKATREPHFREFMNNAMNLVLGLYGPASSEWHMMASFLRKHLEG"
     gene            complement(<353775..>354686)
                     /locus_tag="LMJF_31_0940"
                     /db_xref="GeneID:5654022"
     mRNA            complement(<353775..>354686)
                     /locus_tag="LMJF_31_0940"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685027.1"
                     /db_xref="GeneID:5654022"
     CDS             complement(353775..354686)
                     /locus_tag="LMJF_31_0940"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685079.1"
                     /db_xref="GeneID:5654022"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6G9"
                     /translation="MQAAVVVRACLCDGRRDFSRPAAACRGRTLGHADPGRWQSVAKR
                     CSPRLHAGAHADVSEREGGEQRNGGSAYRGDCGVGIGWGVCLSGENAKATQGSADVEA
                     RFPEEAAQQARGASPVAIPLPLNSRLTGILGFFRLLVDIALACLQLRCSTLWGGRRAS
                     VAAVTLSTTAGLEVCGSLRLLCRRTTLRRDRQRQRRSQQAGVAAHVAHGVYVVDAGAR
                     GGRLPLLRAVLSGRLLQPPHTGAHAAVPAPHVQRVVHVGVPGALGCRARAPAECCQRL
                     CTGVRRQARCRAHAAAHLGCAGRAAPR"
     gene            complement(<357384..>359249)
                     /locus_tag="LMJF_31_0950"
                     /db_xref="GeneID:5654023"
     mRNA            complement(<357384..>359249)
                     /locus_tag="LMJF_31_0950"
                     /product="putative sodium stibogluconate resistance
                     protein"
                     /transcript_id="XM_001685028.1"
                     /db_xref="GeneID:5654023"
     CDS             complement(357384..359249)
                     /locus_tag="LMJF_31_0950"
                     /codon_start=1
                     /product="putative sodium stibogluconate resistance
                     protein"
                     /protein_id="XP_001685080.1"
                     /db_xref="GeneID:5654023"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6G8"
                     /translation="MGNRQPSVPLEGEGHPEVFYRGVKAAQEGRFTVSEVYFVQALTR
                     HPGRRFWDTFTRAVLQKERNAGFEGGGASLPKDGVQEDVGAGPAVDGPLGSCNDVQPQ
                     PVRGGSVTDKADELPGSDDRGDGGDSAEQTDARTNGAQPVYDTKVVDVFLPLDGDLTH
                     IMDYYRLLADIGHTYLQLIPSTAHVEKVTGLAARYCIFTITHTQMLLHCLMLWKEARL
                     GDGGGFIDYAKVRNLKICSGAAEHTAQSNADAHSSNEGKQKWRTIDRTASLLFTLQLL
                     EANCRYYCLVFLANYCALLLRSYSCLTDQRKVNRVHANVVEHLDMVSRLVLDLAEEYP
                     NEYLSRLIMANLPKPSNFDRECLSSMGASSHMGSQKILSFGNNQHRHLYASGYPWSPT
                     QSALIPLILARTVRLTVQENVSRHSQAQLRSPAERLSYHYTRWNFDTGLVIVPGCSLY
                     MLKKSLPGFVPGKSTFAHYATMVEHEELHVPRAAADVHWQRGSAAVPVPEDGGGAAPG
                     SHRNPRKSEDSADAEKREALTKKCEERLIKKRRHINTDLHLSDERTCVALCLEEACAT
                     ALPSLRFASTLRKMSGIPESAEFINNVTDLVTGLYGSDSSEWHIIASILRKHLEG"
     gene            complement(<365052..>366917)
                     /locus_tag="LMJF_31_0960"
                     /db_xref="GeneID:5654024"
     mRNA            complement(<365052..>366917)
                     /locus_tag="LMJF_31_0960"
                     /product="putative sodium stibogluconate resistance
                     protein"
                     /transcript_id="XM_001685029.1"
                     /db_xref="GeneID:5654024"
     CDS             complement(365052..366917)
                     /locus_tag="LMJF_31_0960"
                     /codon_start=1
                     /product="putative sodium stibogluconate resistance
                     protein"
                     /protein_id="XP_001685081.1"
                     /db_xref="GeneID:5654024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6G7"
                     /translation="MGNRQSSVPLEGEGHPEVFYRGVKAAQEGRFTVSEVYFVQALTR
                     HPGRRFWDTFTRAVLQKERNAGFEGGGASLPKDGVQEDVGAGPAVDGPLGSCNDVQPQ
                     PVRGGSVTDKADELPGSDDRGDGGDSAEQTDARTNGAQPVYDTKVVDVFLPLDGDLTH
                     IMDYYRLLADIGHTYLQLIPSTAHVEKVTGLAARYCIFTITHTQMLLHCLMLWKEARL
                     GDGGGFIDYAKVRNLKICSGAAEHTAQSNADAHSSNEGKQKWRTIDRTASLLFTLQLL
                     EANCRYYCLVFLANYCALLLRSYSCLTDQRKVNRVHANVVEHLDMVSRLVLDLAEEYP
                     NEYLSRLIMANLPKPSNFDRECLSSMGASSHMGSQKILSFGNDQHRHLYASGYPWSPT
                     QSALIPLILARTVRLTVQENVSRHSQAQLRSPAERLSYHYTRWHFNSGLVIVPGCSLY
                     MLKKSLPGFVPGKSTFAHYATMAEHEELHVPRAAADVHWQRGSAAVPVPEDGGGAAPG
                     SHRNPRKSEDSADAEKREALTKKCEERLIKKRRHINTDLHLSDERTCVALCLEEACAL
                     ALPSLLLSCVLQKATREPHFREFMNNAMNLVLGLYGPASSEWHMMASFLRKHLEG"
     gene            complement(<372099..>374747)
                     /locus_tag="LMJF_31_0970"
                     /db_xref="GeneID:5654025"
     mRNA            complement(<372099..>374747)
                     /locus_tag="LMJF_31_0970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685030.1"
                     /db_xref="GeneID:5654025"
     CDS             complement(372099..374747)
                     /locus_tag="LMJF_31_0970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685082.1"
                     /db_xref="GeneID:5654025"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6G6"
                     /translation="MQPSKVHFCTASVRPWVSEYLARMGVAPANTASARPHRDSALKA
                     QQADRAESELVAAPEQYREARRQLLGALHVQPFSYANVVARARGLSQTQPEDTFALRG
                     LCSTDYDSLDENCMLEPAARQSAGCTGEADAPPSAPASADAVSADAGPAQALSSPATC
                     VASAAGAPAAAVARWPTVSQMTRAIERRIMDHRRLWRAANRLASDRLGSGEMCCALTS
                     PTSTAQSPSTSFFFGSSLPFLLATIPHTLISAIAEHAILHAWYGGPHVYPDAKLPCPT
                     ATFVFKDSPLLRVDDVTSLQWDRAQAANFLVAVLRQPAVQKELRQRLWSAVQNCHRGV
                     LRKLESLAVQKDVEGASKEAAADRLILLDQEPGMPSPPSLSLREVRDDLFSFDELLYF
                     VRVSPSTSSTSRQQRVECESLRSTHLFRFVTSRADVAAALRDRPRSNVSDLLFCVSLR
                     NGDTSAKASSAPVSLSTRDKLWLLLSEMVRLRYLVAYLLNFEVMLHRVRNSTRHSQRG
                     QSTSKEVDSAGFPGNSSSEQADAQDAENAKCIAAVFRFLDIRLHTRLAVSPHHRRFLR
                     HARVRHCERSATPEPPDRATAAHEATDADTSVRHEARRYATVQELFSAFSKALEESTT
                     PPSQLPATVASFTSLAKSPGEGQGAAENGIEAMSKRPDHMRGRSARQNVVQARATSDG
                     PSSLSDTDDEFLKAIVSATRQDQPPDSTVQSTPMRATHRGGVKSPSANPGELPCSRGL
                     PGRRCLTAERSTTCLPQSRRAAEDPHPFVDVVFERKSNRSKWPFQALRARTNASNFKV
                     RFGGSHDASSHAAVICFQLSCTREEREKAEIAPLSGKSAADLLQQYPYVTHVNGISAR
                     KVELVVRLFRSAHVLKLRLARRPPDR"
     gene            complement(<376013..>378322)
                     /locus_tag="LMJF_31_0980"
                     /db_xref="GeneID:5654026"
     mRNA            complement(<376013..>378322)
                     /locus_tag="LMJF_31_0980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685031.1"
                     /db_xref="GeneID:5654026"
     CDS             complement(376013..378322)
                     /locus_tag="LMJF_31_0980"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685083.1"
                     /db_xref="GeneID:5654026"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6G5"
                     /translation="MSSTTLTEALNRLSSCKEPADLIYSRDAARLLGSAALPQSAAPT
                     VLPPHGTSPVDDYSVLLARRIGTMVARLDELSSPTSQVILTPRMMLCELMDIVRQALY
                     DSLPADMQNASPTDKAAVVKQFNSYASSRQVPIDSAVEGLYAVSYVSVKLRIELVALQ
                     LQRRIQEELAKKHTKTSAASVAALVVTQTLLEDFVAVYNNIMLTVPIIKAAVRESNAE
                     EAARRLAPVYPQYYYQLCDWALVLESTVSSPPMSYTQVTRVKINEQDGTAVVDLHRPT
                     PETPWGLLLNEQGALVDIDVSLRVFEKARKLHDLLQSTPQGASIVMIKGRSVEPVAHG
                     DYAAYTRHLLQTLQSATEGRKNVQLVLKSSSFKAEARSLPTEVAFLAPPQGGEGTPGQ
                     RVTLVMHRQSTAAEWGFTVDEQLYWRAPSTHILSRPAKEFVHEYGMQLRLLAVNGVEA
                     LHMTQVQLLIEAAETVVLELLVMPKSAQDRLPASRSTTTTTPVAATTLSREMLSAEAA
                     EPRDTISGDDLDRGRVEAAVSKFLQQRAAASTAAAVSSAVDPPIAMETPLVESATIPP
                     SPAAAAAVIAAEGAKKGKKRGRKPKAPKQQLAESTVSQTAAVSRSVADAEPTAVPSAE
                     AIIQDRDGIEAEKAASDASEPPGARPQKPEGEPVEPCTFDNQVKLTHLSEDEMVLERP
                     SVDTPWGLPIGRLTDPSKAPQQLPLRLMSLPSSRKARVRQHPFFRNFRKEPTTWYIAA
                     VNGTSASEAEATLKHISQLTRMTLRFLRK"
     gene            complement(<379293..>380510)
                     /locus_tag="LMJF_31_0990"
                     /db_xref="GeneID:5654027"
     mRNA            complement(<379293..>380510)
                     /locus_tag="LMJF_31_0990"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685032.1"
                     /db_xref="GeneID:5654027"
     CDS             complement(379293..380510)
                     /locus_tag="LMJF_31_0990"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685084.1"
                     /db_xref="GeneID:5654027"
                     /db_xref="GOA:Q4Q6G4"
                     /db_xref="InterPro:IPR017956"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6G4"
                     /translation="MLLRSLPLYAVRVVSASLIESMPSRGTGRPTTGSHATLTFHLHR
                     LHNSESFGVDCNFQSFDGCNEECFVRSMSADLVASSAALKSVLGDGKAARTSSVRVTS
                     INGIPRLTKATVRELFDSGCDVVVQCAVSAVADSPSDPKQMDTGLEREEDEAEAMRAP
                     KKRGRKPKVPVAGALGADVTEVVGTSSKNAVKRRGRRARGLSLQKPKVSKKRLRYSGA
                     RSAVKQMTSKDTDLSVDDSAADDINAAALETLQKLAPVTPVRTRGRRSTKREALLDAK
                     WRSTATGETSDDVWFTHAEATPAVGGGTDEARPEDAAVPTRRRRGRPAKVAVVDAPTE
                     VETEGAAKRGRRRSASRTFEPEKAKKTSGRRGRPRKMDKAVEVLDTTQAAEASSKEKP
                     AEQSEAADAELEF"
     gene            complement(<381689..>385042)
                     /locus_tag="LMJF_31_1000"
                     /db_xref="GeneID:5654028"
     mRNA            complement(<381689..>385042)
                     /locus_tag="LMJF_31_1000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685033.1"
                     /db_xref="GeneID:5654028"
     CDS             complement(381689..385042)
                     /locus_tag="LMJF_31_1000"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685085.1"
                     /db_xref="GeneID:5654028"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6G3"
                     /translation="MYRGRRLSKMPQKEASESAAHAPEPASAPSVRLTPAIPTPNIHA
                     ETVQMKEKYTAPFMLYDSQARRIVANRQYDRALVAEMHRVQSILLTHLRTPIQAHLSY
                     TPKELLYELEAALYHVCASLAVQDNVSSLRHVLNDTEADPHMPQLESFLAHHNAPAKT
                     VVALAHCLSEGTSHDVLTSFLQMLEQRVQQERDPAVDFKRSADEHRALLATKNNLQDI
                     AQLVRDVQTAYRSIDTASQALRRQPQSDPTEVDMPRSPAANAVPARIVEEAFYKVLRW
                     VVAVDADRRALKAAATSTAAATEAESAPVTTPMPETAATPSTANVKAFARVIEYDPYT
                     GHLTLERADVAQRWGLLLNDKGLLVGVENELRNSSEAGERLYDAVQQQSGEAGGLAIF
                     EVNRRRVRAVHLSSEAVAFSRDDIMRKLRAGLTQPTKTLSLTLERRKQADLTVPREVL
                     FEVSYQGGEGGVGQRCLLMVERASTSISWGLKLQYLKGAAAVLSDFAPNMKLSNAAKN
                     LLFDMRGRLRVLKVNNRDMARLSVEEMRSLISGSLLLTLHLQVTDAKGDVPPEAEAPQ
                     PSQLERSLSTEEVADAQGTSAVDAASSEAQKEAAALAEAEAAADEPAEATKMVSLVQG
                     EIDNLADSIADEFLKQHSQEATLEATASDKADAPAVEEAFEALEELRCARLTTTIGAP
                     GGADNHRGDRDAEKDANLEQLSRQQHWEDDDGIKDAASGFADEETADHALMDSFKDVA
                     DGEAVPKVEEVDNRITEGEENVAEHGVAAHVDAVEQEAMDGIEAAEDEAEAEPSRKMR
                     GRKKAPAKVAKVRATKGEKNARGGGRRKKGGKAAAADGQEADDDEDACAREAAEDDDK
                     QLENVEDKEAAEVSLGEAALAAEAEALPSEAGAGDATIEGAEAKQRCGAGSKASAVEA
                     ATSKEDGRGAGAVEDTGAIEPDNIGKDSASAPVDVPLVDLPPTAAEVAIEHGLENTMK
                     KQSAKADATEAALAAEDEVDDVPRISLNRLLEAQPLTFDNDVRLEKFDGSTLELERSS
                     TKRPWNIKVAFAGDDIIMTKLPPFAPKQQTHPFLRSLRAGPQGEVKWVVDGLNGQDLS
                     VMTKSNKTKALDAIKGSTKLSFVLRALRK"
     gene            complement(<385868..>388123)
                     /locus_tag="LMJF_31_1010"
                     /db_xref="GeneID:5654029"
     mRNA            complement(<385868..>388123)
                     /locus_tag="LMJF_31_1010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685034.1"
                     /db_xref="GeneID:5654029"
     CDS             complement(385868..388123)
                     /locus_tag="LMJF_31_1010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685086.1"
                     /db_xref="GeneID:5654029"
                     /db_xref="UniProtKB/TrEMBL:Q9BHG4"
                     /translation="MDTRGLRHLKSYLGKEGEQLARAKRASDVVPVLAARQAAAAAAA
                     RATAADVTTVSNTVPAPLSPSVMKYLGGRLASGATHKLSRTQMALAAALAAPGAPSTR
                     GHAEGSENGETALAVTRAKVADMAAAVDTLAVSALELAARRAAEDTEARRSTAESSSL
                     FVLVDTSSEAAEVAGQLEGRYGLTVLLLRDDNACRHPTFPSPASRAGVSTLRGTTSKT
                     PAAERRKTKSNSRTVDEVAPKDEATESTPALAGAVVVVVATPAAFLAVDRRSAIWKFI
                     GSCALLLRRAPTHTGSLLHTLKGIKAAASSSPTKTTPHALNAQRWACIGHVPAIAVLA
                     AEQKWLTEPELDLLTTLRVERHVGSGVGVVSKSTEASVSSAVAALRAPVTVHYAVAQG
                     THRFQFLFGLLKGLAPHRGIVVHVATRECVAFLYDTLYSLVGELPSHVQLLSDYEGAS
                     AYTNMHTTADRQRLCVAFDSTVESGQNGKTAAVLLSCHGLVPRRGSVFLQYDVIPDLL
                     NYNQFIAEVLSPGAVAADAGNDAGGTAPSAAAEVAVRRERMARRRKRSTSPTPAPVAA
                     RRVGADAANSAADASSGSKAAIPAAVNYTHILLLFRPNEVAGALRHLRRDGASRYRLE
                     FRELGPRAGGRYFLIGEKLKSMNKKLFPVQNAAYDAYKATMRTYSTIGPRDVYDETKV
                     SLEKVAEEFGYTELPLLDLRLKDTVFRPKEDYYRAARQKQDAERRAYKAFVQGNIVGE
                     SPEEHVADSVA"
     gene            complement(<392279..>395134)
                     /locus_tag="LMJF_31_1020"
                     /db_xref="GeneID:5654030"
     mRNA            complement(<392279..>395134)
                     /locus_tag="LMJF_31_1020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685035.1"
                     /db_xref="GeneID:5654030"
     CDS             complement(392279..395134)
                     /locus_tag="LMJF_31_1020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685087.1"
                     /db_xref="GeneID:5654030"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6G1"
                     /translation="MGFFSLLSGGVVKAAEGKDARAHRERTNRSASSDQADSDDLHPK
                     VELSAPVRRVPAMNTQGKAEPKWSRLHSVAVPAKRGPLSLWSRLLCRPEVYDPHVEAA
                     PLTYLLDVSEPHVMVEDEEQADAQNEEHAAGCTRCEGDLSQRRYSVRASMGEGCRART
                     PLPKDDDEHLDDPEDTVMSCCMANASSDVEELEDAEVQSDVAEANAGEPFLHPQVFHV
                     FDTRRCRACASTLLWSPTVADNFSVTAPLPGGSSAPPTDATESGAASSRGSGLSTERR
                     LISREELTRKRLQRRQQLKEAAKRDREYKEAWAALVASAGLHALSLEEDKTCRRTHVP
                     NTDERGSLSTAAASAAATTAVMSSCLTSEALESLREGTQPLSYDLPEMLLARLGHYAQ
                     LPKKAKGGAEEAAALAQDGDRAGSCSSRSSNGSSQIALDDEHVNVETGLSLMYGSVLR
                     CRSSASKTRDVSDEAGASRTSRRAAAVRGGSQRLPAGKYPLGSRAYAERVLFVQRRQQ
                     ECALFALITEAHRQAREAHRRLAQLYYYYIIPILAQYSTEDEIRGLERSLLQCGSGAL
                     RVYHSEFCRTVVYRRSESQSSVSGGASDSIACCFQVQPVDYQLTEYRFENVWRELFAD
                     VKAYLGMQACEDEGFSTLPSLLELEDGAAASSSTTSAGHGSVCVAATVLHSMELFERQ
                     RHTHGAARDAEEWLAWYYYYFIPHVQRADSAEERAAIQRRLLPPPPSPSSTSICRTEP
                     KYGNECSQVHANDPQPLQPHPLENEYLPLCWTLACNTAQREKVLNYRRDLKLRAIESF
                     LKQRPVAVGESAAARATDCTRTASETEPASVTTVNTVKPTPETVGAKVATASFECHLL
                     KHMPENGDLVDSAHKTEASRLFEKDVEADRGEASLLKPSLQLLSADALSGQNHGAVKI
                     EDADSEETEDDDGAIPVGTHHTVNVGCFGLSFFSIFD"
     gene            complement(<399111..>401819)
                     /locus_tag="LMJF_31_1030"
                     /db_xref="GeneID:5654031"
     mRNA            complement(<399111..>401819)
                     /locus_tag="LMJF_31_1030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685036.1"
                     /db_xref="GeneID:5654031"
     CDS             complement(399111..401819)
                     /locus_tag="LMJF_31_1030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685088.1"
                     /db_xref="GeneID:5654031"
                     /db_xref="GOA:Q4Q6G0"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6G0"
                     /translation="MTSYFSTSPNTKPDELASLSAVAPPTSDADAYSFEVVAGDYVPS
                     AHTERSYRPGPYSSKPLYADCNAGTRLPPFHQAEDWAPLASVQAASGSALGSQGRCHI
                     YGFSPVSDAPSYDVLPLNNHSPPVPPPPVNAGKDGLLHSHSDGGVNLYTYRGPNADYT
                     SRKQNRLHQDFKALPKEERQRLVEREAATSDLLARTVHLRFLPLTMLQSELGAICSEC
                     GEYLRVRICGNSTNNQNWIYGFVEFATTAGAEAMMRRSGMELNNGPGRPPLRLKCNSA
                     KQPIVDRVFHDADPTTGNPCIFGLGNFAKRTLGDALESYYNLKEKEAQQLQDPPATPF
                     SARVSPSLTAAAVRQPARLSPHARAFQPSSSPLPGAEYLPGVHHAASGTSAGASNDDH
                     WTSPLLSVATAARRADSDAASMDSATGVTSAVTKHHTTGAQGAVTSAGTPPCVTHSPS
                     QDYSTFNTAAYSSGAASHATPCQPATTNSVAAQRCASSGFNTNATPLETVAAALSVSS
                     DRIGSALPDFLLPPSNAAAFPTHSDLAGNQLSLALQSIMLTGSATDGDEVLERGRELT
                     LRAIGQAHCFLNSQQGFYDAMGTLRSLVELLDFHAAVTGGAGATGSGDHTAELPQRAT
                     QLRLLANLMMALLYMMKRNLSDALPHIHAVVMSCNDIPVLCLWKTEQQQQQQSAPQKV
                     TGGKSERLSDTHRWQGLAVGNSVYDKTEEEGSYGCFGAPASFLEAVLESIREEDNVQE
                     EEAKNASANNSNNGDTASTSSAEAQALLRRDQNFHRYVLNVLVAIGLSMEEVHPVITR
                     SAYALAAGRARDVLGTASADLDECLESTAPNPNLCDRLYGPVSSTGNGNGGSSSGGRS
                     KRDITFFPRVFFTTAEAMRQDVLRMADTELFWHRLPPKQCVQCYTE"
     gene            complement(<410138..>412450)
                     /locus_tag="LMJF_31_1040"
                     /db_xref="GeneID:5654032"
     mRNA            complement(<410138..>412450)
                     /locus_tag="LMJF_31_1040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685037.1"
                     /db_xref="GeneID:5654032"
     CDS             complement(410138..412450)
                     /locus_tag="LMJF_31_1040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685089.1"
                     /db_xref="GeneID:5654032"
                     /db_xref="GOA:Q4Q6F9"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6F9"
                     /translation="MSSARSEGSERSPDEVPSLMSSTTPLAAVAPVDSIGVKASPAAS
                     LLTAICSPTQTISNVSVASSHTSVMRLSRTEVLARTVHLRCLPPFMKQRILADVFEDC
                     GEYLRVRICGNAATHQKWVYGFVEFATKDAAAKMTAYCGMELPNGPDKPPLRLKLSPS
                     KQPILDCMAYDADVVNGTPCGFGRGHLAECTLNDVLLVVGSGSGTPKSSTTGGGSSSG
                     GGCGGVGDRRMKAANNALTALTVQSIRKVAATGCGCGCSGVNCCRCCSCWKGLPESTE
                     RAACAGGEVSSGIDAQGTAAAVGAPAAARGCAGCATGDGGLAMATHPSDCCGDAAATL
                     PQLTAMCSGLVDLQMPFVFPGGGSPLDIMQQLAAAFQGLRDSAATHESQLDGPSIARR
                     AEAMALEAMHRSGRFTSDTCIQDTLSELTQLLAFLDSNAAVTGGAAQTASGDCTATVP
                     QRVTQLRMLAHLVSALLCVMRRRVGDAVPHVEAVLVTFAQIPPSTLLLRARRHGKAVA
                     VLEQRHAEKSKRSQVLGASHEGRGPGAVACAAAAIGAPAVSSLVKRRCVPSLPLGSFV
                     DEDVAGSLLEMVDEEGEYDGSHCEDAKIHHMSNRDDSLDKDDIEDKDDDTALLKDSSG
                     SASSCTYASEAFWNSTDTAALCRRDESFSRYVLNVLVSVGLAMEEVHSVIARSAYMLA
                     NGRAMEVFGEPSKLLADRLAAAPTGNPHLCAALFAEMAKNGSARDVTFFPHQFFESVN
                     VVSQRLLDIRGTECFWRQLPPNHIVTLFNA"
     gene            complement(<415453..>416616)
                     /locus_tag="LMJF_31_1050"
                     /db_xref="GeneID:5654033"
     mRNA            complement(<415453..>416616)
                     /locus_tag="LMJF_31_1050"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685038.2"
                     /db_xref="GeneID:5654033"
     CDS             complement(415453..416616)
                     /locus_tag="LMJF_31_1050"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685090.2"
                     /db_xref="GeneID:5654033"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6F8"
                     /translation="MSAVAHEFETPAEVRPSGQNGINMAAAPPAREDGFSVSATELAS
                     KPHPNRAIQSTVSVPHTRILSRPSAGGVHFSDAGRTAASGSANGGKSHAVPYEGTVVH
                     PSSRGRVSRSGAGAGAVASGAEAKAVVQLAGEKVKAAKVQFPQEIAAADHRATPAGGK
                     KRVPEPRLKHAHLPKVPEAYATAAAANGNGASAVKTTSRRRRRNGNTAGAEGRRPPHS
                     QTAGQGAVKATKAKQPVGISKKTQGENGRAHCTEPAASSQESGKRKAAAARTAEAAAA
                     AKGSPKQKPAKKAIPAAAAAAAATTNAKSAEHGAAAQSQTEKSAAAAEASADQACVDK
                     KNIVEEATTEVDGVLSAPAVEKEAAAAAKHADPEATGAKEEAAEQPEEDATEL"
     gene            complement(<418222..>419850)
                     /locus_tag="LMJF_31_1060"
                     /db_xref="GeneID:5654034"
     mRNA            complement(<418222..>419850)
                     /locus_tag="LMJF_31_1060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685039.1"
                     /db_xref="GeneID:5654034"
     CDS             complement(418222..419850)
                     /locus_tag="LMJF_31_1060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685091.1"
                     /db_xref="GeneID:5654034"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6F7"
                     /translation="MWASSLTSPALGKVRLTEESWISLDARGVLGEDVTAQFVRWLCE
                     SVLPADSVLREQLEANVLLDLRLATARGVYAKKAFKRGEVVLTIPLLSVTPDDAPSCT
                     AWLCLNSETLAKYSTAAQQRVGLPSYDTVKQVLSVRRSSFDPIPHPLFLDQVCAALLL
                     ACEKADGAASPLYPYLRLLDSAELFDDEAIKELHIGVLEPTTHMEYDEHVKRFRHYMR
                     RLHAVWWAAYESATGRGPGADAADAAGERAETTAALASSVPILRIDGEGSETSVTVDR
                     EGRCYQDVGNTAVVSADSKVSGVDAAATRMAWKPPPSLEDMAWALRVLVSRQKTLPHL
                     RVDRAAFERVREENVEGEVLDAFGKAVMKGKHAFYQHVLRAIDEDRLHVNEVDPTAIP
                     TIVPLLDMVSHPPGGVPNVSYTVERVERTGGGSDSTTEVGTGPHRGDLASGKPTSASP
                     SYQVVVRATDDIEEDEELTVSYVKCYSVAYTLYRYGFLPLSRREDDVATLLQANNVDG
                     NLRPVPKSRSPPSSLSKDGVMSALRRWWPSMFAT"
     gene            complement(<421744..>422535)
                     /locus_tag="LMJF_31_1070"
                     /db_xref="GeneID:5654035"
     mRNA            complement(<421744..>422535)
                     /locus_tag="LMJF_31_1070"
                     /product="biotin/lipoate protein ligase-like protein"
                     /transcript_id="XM_001685040.1"
                     /db_xref="GeneID:5654035"
     CDS             complement(421744..422535)
                     /locus_tag="LMJF_31_1070"
                     /EC_number="6.3.4.15"
                     /codon_start=1
                     /product="biotin/lipoate protein ligase-like protein"
                     /protein_id="XP_001685092.1"
                     /db_xref="GeneID:5654035"
                     /db_xref="GOA:Q4Q6F6"
                     /db_xref="InterPro:IPR004143"
                     /db_xref="InterPro:IPR004408"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6F6"
                     /translation="MPAHCPPNIHFLEEVTSTMDVARTMRATAGGKAFAVVAAEQTAG
                     RGTGGRTWTSPKGNLYMTVGVPQLGQPPCLKEELVPVLPLICGLACRRAVLEVLHLDG
                     ALAKASVAADAAKAVATKWPNDIIYNHKKIGGTLIESDGDYLIIGIGMNIAVAPQMTD
                     AGREATMINTIAEDFGVKSCPPRDLANAIWCHLFDICSSPEWTRELVIESFDKVMDKS
                     LKLHKRLPGGRDPEELTAVSLNSWGHLKVRHADGTVEDLSAEYLF"
     gene            complement(<423697..>426621)
                     /locus_tag="LMJF_31_1080"
                     /db_xref="GeneID:5654036"
     mRNA            complement(<423697..>426621)
                     /locus_tag="LMJF_31_1080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685041.1"
                     /db_xref="GeneID:5654036"
     CDS             complement(423697..426621)
                     /locus_tag="LMJF_31_1080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685093.1"
                     /db_xref="GeneID:5654036"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6F5"
                     /translation="MSRSQLSIDLEDFLGYEAPIPTDAFVVGIRPRAPLPRRSTHAYD
                     GNGSDLSDLSSRPNSVVASTDVRSRRRPREMLYGVHEDLEAQRRALVGQSRRANSPRS
                     RVTVIKEEEAMNSETTVGTNDNDTEVQRRGGPLRRLESNRAQLSREFSEARDLERQQQ
                     QLIAMLTSRLDDMDARFQAQVTELSAKLEKMNVSVGEKYDAIYSKMSDTISARGEEVS
                     RLEQELRALKMSNAEEFKSCRDSIVACRADLAKLEGRLEGVLSRPPSSSVAAAPSPSS
                     TSVSPAPPAQPCSSSTAFKPGGNACGGFPSSLPSAATFSANAPASSHPSPSASTAGTG
                     FGLATSAAALGGFGAKPAEKAVAAAAAAGVANTTAETVNASSASTSAKAPAFENPFST
                     PPTDASSSGNPFSLGGSANTNAVAATKPQDASSDKLATSASTSAFGMASSSFPAAASA
                     APNTGEAKPLVFGGGVTGALQGAAAAPAPFGTASTSFSFLAKPATPPAQGSSAVTNSF
                     NVAAAPSGTPSGSPFSLTSGGATSTSAAAGGNPFMPAAVDSSSPKPPAFGGAVTPQQG
                     PPLANGGTSAASAAAAVTSSSLDMSNPSARAPGSGGSSSGGSRSSGFGGVAFPASTTP
                     STGAQAAPAGAFSFGTSHAQGPNVSPAAFAGAAGVSSLASTAPASGSSGSGTASAFGI
                     GTPDSGGRNGSTPFGSSNTGNTAGGGPGALGSSTFPSTSAFPSSAAASASTPISGPFT
                     SGGGAPAPSASAPPALGGCSNGAPSSVFSCGGAPATPEQGTAGAQGANMNPPKPVGTT
                     FGGGGFTAHTSANAFGAVAGPNAVSTNAFSGASNTAGTGASSSIFGGSGGGVGSNPMN
                     GSAASTAFGSNTSNSNAGNSLFGSGGGGGPAAAGAGAFGAVPAGGPIPVFGSSPAGGS
                     GPSRSAFGAAPPAFSQPLGTSPAFGGGGGGAATMGAMGGPSQGTSILGSSSSRKKAPR
                     RY"
     gene            complement(<429673..>431613)
                     /locus_tag="LMJF_31_1090"
                     /db_xref="GeneID:5654037"
     mRNA            complement(<429673..>431613)
                     /locus_tag="LMJF_31_1090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685042.1"
                     /db_xref="GeneID:5654037"
     CDS             complement(429673..431613)
                     /locus_tag="LMJF_31_1090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685094.1"
                     /db_xref="GeneID:5654037"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6F4"
                     /translation="MEYVSFLDASAATLQAADRLSPVRGRPAEDEAEEDDSGLLSSNQ
                     LSTSLNPFVGTAAFTNTQNVYWAKSAGLGMPDNPKKQHSTVCGASLAGATPMYTEVSQ
                     RQLTSQFASISLTEENWCASVIAENNVSARDGGARQTVVKAARIPSCPPRSHLQPKPQ
                     IRSPISPSTPEGRRRENKTGEFFRLAHELKKQRRRLREQQQQQQQQQQQRRRWQQTEK
                     WYRGVAKPHTYLRGDSFSTAPRASVEVVAPASATGSVRAGYDGDEDAVATFHNPPTQP
                     PVNAPRGSGILSSMRGLHRETLLQKKGVPLFLRQTQPLPQTPLQKADGRGRSQRNLRA
                     LLPTVPMRHGWGAEGFSYSPPTTQLCRDAYSSDSDVPDSSSASISESLLSRQSERMGV
                     FPALDFPHVRSPDWATLNSMECDASESRLSVPSASEEATGSDQTCVLTDVARNVVPLE
                     VVPPLPNTTMPPTRSNARNFDYHGMRAAARALSPNRPPVWVSAPTTRAARVPLWGVPP
                     PVAAATPNSRARKGLLPSTLCLTKGSRFTFSADSSSAQSSGSPASPDRSLSTSNSRRD
                     NSTVRPLQRQRKNGSSGVPRGDEAVRGDVSTHSTRTGGAQGHINTFATAPGAMLPRKA
                     VMQRFCERFAALKHMLCMKPLE"
     gene            complement(<437514..>438659)
                     /locus_tag="LMJF_31_1100"
                     /db_xref="GeneID:5654038"
     mRNA            complement(<437514..>438659)
                     /locus_tag="LMJF_31_1100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685043.1"
                     /db_xref="GeneID:5654038"
     CDS             complement(437514..438659)
                     /locus_tag="LMJF_31_1100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685095.1"
                     /db_xref="GeneID:5654038"
                     /db_xref="InterPro:IPR029416"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6F3"
                     /translation="MFVFEPAAPSSAAADVSACASFSDAEPYKSLCMKWGLLRLGEWN
                     MHTYRYRCPSEVRSFTEGTLSAQPVASPSSRQTANAAAATVSAVALRFHHGVAADFLR
                     SLFEAPCVRSDLVGDDAYHAQSVVGANKLQFRPLTCRWTTLEPLRHGLVDAKIVRQVL
                     RDVDGATMRDANQLVYFLPAVKRAEELLPHGEVISDELRALFLQAHSRPVAQAEGECG
                     ELYDASDREDTDTDDDDMWGSMSGAKLPMRQLRGVFGKESREEFLYHIVWRLVAGSGP
                     LNQFDDDAAVYLDAARELYRCLVKSLHVVEATEQEADGDVAALEEPNSASARYHAVVD
                     TSVYEVTTVPGMTLFPRSDGVHPSNLNYCYVAVNPSEQTATMWYHRC"
     gene            complement(<439410..>440057)
                     /locus_tag="LMJF_31_1110"
                     /db_xref="GeneID:5654039"
     mRNA            complement(<439410..>440057)
                     /locus_tag="LMJF_31_1110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685044.1"
                     /db_xref="GeneID:5654039"
     CDS             complement(439410..440057)
                     /locus_tag="LMJF_31_1110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685096.1"
                     /db_xref="GeneID:5654039"
                     /db_xref="GOA:Q4Q6F2"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR015720"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6F2"
                     /translation="MKSTRVAAALPRDGGASRLLVALVLSACFSAVLSAALTTEVNAG
                     EIFIVTESLGAGRELYFQFALHPDYLLPVTIKDRGTNEGLMHWKDLAFGAFAVPVSDK
                     PRNIIISFDNSNTMFTSKNVNFDLRTSVNVNYAVDAWKLDPIEQKIRALSGSMQQLKT
                     LQVSIRNQQKNHRDTVESANERVLLWSIFQVLAFLIMLSFQLFMLRRLLEKKTYV"
     gene            complement(<441025..>441495)
                     /locus_tag="LMJF_31_1120"
                     /db_xref="GeneID:5654040"
     mRNA            complement(<441025..>441495)
                     /locus_tag="LMJF_31_1120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685045.1"
                     /db_xref="GeneID:5654040"
     CDS             complement(441025..441495)
                     /locus_tag="LMJF_31_1120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685097.1"
                     /db_xref="GeneID:5654040"
                     /db_xref="GOA:Q4Q6F1"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR015720"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6F1"
                     /translation="MFAFYMTPTFDFPVRIRCRETGDVLQAWKDSPQGYLNLPSTDKT
                     RHLVFEFDNSQSLLTLGSVSFEIRVIPDPARGVREEEIDPIEKKVQTLFETMQTLRKL
                     QELIRYDQKEHRTLVEHANVRVHWCSIMQVVSFVAAAGGQLWLLRRFVEKRRTL"
     gene            complement(<443635..>444852)
                     /locus_tag="LMJF_31_1130"
                     /db_xref="GeneID:5654041"
     mRNA            complement(<443635..>444852)
                     /locus_tag="LMJF_31_1130"
                     /product="putative N-acyl-L-amino acid amidohydrolase"
                     /transcript_id="XM_001685046.1"
                     /db_xref="GeneID:5654041"
     CDS             complement(443635..444852)
                     /locus_tag="LMJF_31_1130"
                     /EC_number="3.5.1.14"
                     /codon_start=1
                     /product="putative N-acyl-L-amino acid amidohydrolase"
                     /protein_id="XP_001685098.1"
                     /db_xref="GeneID:5654041"
                     /db_xref="GOA:Q4Q6F0"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="InterPro:IPR017439"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6F0"
                     /translation="MPAINREELDRRVEQIYDQVVAWRRYIHENPDLSFEEQPTAAYI
                     KGELQKMDAEGRWLHISQPESNCVVADLKGGGGDGPIIALRADIDALPVEELTDVPFA
                     SKKQGVMHACGHDTHAAMLLGATKLLLEDAGRIKGTVRLLFQPAEEVPPGGAQMMIEK
                     GCMEGVAMVFAEHIIPMKEGPTGTVLVKRGPFLSSSDTLHVEIIGRGGHASMPESSID
                     PIAIACLAVTALQQVVSRRMPPSKCPILTITTIASSSDSYNVIPDRVTLKGTLRTQDR
                     EVRENAKKAVAEVLHGICGSYGAMCSLNWLPGYDVTVNTDSAYDVGMRVFAQVLPSKD
                     QVVVLSACMSPSEDFSEFAKVAPANYVGIGCYNPGKGCTAVNHNAKFCVDEEAMKVGV
                     KVHYGTIHELLMQ"
     gene            complement(<446427..>447362)
                     /locus_tag="LMJF_31_1140"
                     /db_xref="GeneID:5654042"
     mRNA            complement(<446427..>447362)
                     /locus_tag="LMJF_31_1140"
                     /product="putative monoglyceride lipase"
                     /transcript_id="XM_001685047.1"
                     /db_xref="GeneID:5654042"
     CDS             complement(446427..447362)
                     /locus_tag="LMJF_31_1140"
                     /EC_number="3.1.1.23"
                     /codon_start=1
                     /product="putative monoglyceride lipase"
                     /protein_id="XP_001685099.1"
                     /db_xref="GeneID:5654042"
                     /db_xref="GOA:Q4Q6E9"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6E9"
                     /translation="MSYYCSGGHCLKYATPGREPPDPQLFPHYMQNAQNLWLHFSEWW
                     PHGDGGSCPAPPTKGVVFIVPGLGEHTGRYDSVALRLNQEGYVVFSMDNQGTGGSEGE
                     RLYVECFTHFVDDVCAFVVFIQTRYAALKSQPTFLMGHSMGGLIATLVAQRDASGFRG
                     VVLSGPALGLSKPVPCFMRSLAHFLSQWFPKLPVRKLDPDLVSYNTPVVQLVKQDPFY
                     SNVTLRARFVDEMLIAQDRAAEAAGTSQFPFLIVHGEEDQLCSLETSKSFFKSALSED
                     KNLVSYPRAGHEVLTELCRAEVMAEVIKFIDERAR"
     gene            complement(<448021..>451344)
                     /locus_tag="LMJF_31_1150"
                     /db_xref="GeneID:5654043"
     mRNA            complement(<448021..>451344)
                     /locus_tag="LMJF_31_1150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685048.1"
                     /db_xref="GeneID:5654043"
     CDS             complement(448021..451344)
                     /locus_tag="LMJF_31_1150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685100.1"
                     /db_xref="GeneID:5654043"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6E8"
                     /translation="MSSPLPLLRPVLEDLPAVPSMAGVTASPEQGAAGDSQPSGGEAG
                     CALEASKHVHASAPTSSLSNGETPVHASDNRGDVTVDASEVGESHQLQRRQDYGKTPS
                     ELSALPERPVLRVVAGEGSGRAAPAAGSVHCEEGDWSEPGSPTTSPVQGAWTQHVYSQ
                     PTSAGRGNSVVVLSDAAARMIAHAVHRSSLLQQCFTQWQAQQARHAQQRLRRECFAEG
                     YYQRNLLYLFFRAWQWRYDRRVTCAEQRRMLEALRARHLRHRAFAAWQRWKNARRRLR
                     GRLGEMQARTEAALTRQCFERWHRTSAHRALARAAAQASADSLRDARFRDWRHFALQR
                     KEGRLLASVLMLHTPVAWTAAQQSSCDGLHLLYAWVQWLRVAMQRRARQLRKCESALS
                     TVAMRAEKALRRRWYVWWLQVTCASLQSRHTRRRLLQRYYKRWAPVGRLCLIGLQWER
                     ETHSPHVQRRCLAHWRCRLGRRRTSREHLRMAELFFESVVQAHAARAVFRCWRALHST
                     RAKAGRMRRVAEGYARPALLRHLFLRHVTDGVLASPTGLADVLEHEAWHRGADAKVVK
                     PKSIVIASNEKSILDVSTKTSGTSSTRLRPPIPLRHHLQAPTGRLSVPAASPEAPLEP
                     DRRSNASEMAGTARPITASAADHAADMEVWLPPPPSYEEVTSSWRSTDASGRMGACAL
                     PVRTDVGVGTSCEAPTPLQRATPRISSAGDRSAARPDVVHQREEAAPPPVSTVSGRGM
                     SPAGAPNVWPATVPCYAVPNGAPVSWAFGFVPARRGWRALDTLVPPSASVTSPASAVP
                     LYRSLPCAPPTGDAVPAAVESPSCAAFSRFCAEGAAQPFAGEHGPGAPAAAPSPAVPL
                     QSKGLFPAPPSPRTHYGFDIHRHVDPLASLTYSSSSVPRAEDSGCVDSPDPRGHGSHR
                     AQRRCVGPPAVTLGNAILSQGRVPLSFAGRCARSKKYTGVPSPERKALRDVQSAHATF
                     LSSLSSSSSRSSSTSAAPRPSDAAPFPLRPPSSTSDSSTLRARARDALGDYKRRTRLI
                     AAEKAELATIESQLALAPHTKDMGHKKELSKRRRYLQRRLLEWEQRRAQIAQLAVWLE
                     DCVSAATSTAVSQRGAGEL"
     gene            complement(<454453..>456342)
                     /locus_tag="LMJF_31_1160"
                     /db_xref="GeneID:5654044"
     mRNA            complement(<454453..>456342)
                     /locus_tag="LMJF_31_1160"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685049.1"
                     /db_xref="GeneID:5654044"
     CDS             complement(454453..456342)
                     /locus_tag="LMJF_31_1160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685101.1"
                     /db_xref="GeneID:5654044"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6E7"
                     /translation="MAEGNAGMSAAATSAVDVGGSRRLIGQLSRAAVTDVLQYTPHIP
                     SICCAAAHPHLRYAREAVAGTRVAEGSAHHRSDLYVCWDWTTNCEYHSLSGAEEELEA
                     DLRQLGWWLTRPFTEDGKPMTMEVNVKREVSYHPPLSSTPSATAAATEAPPAGFEGIL
                     LILTQPPFQRTDVGISCLRSLIVTPNRKEVSKTAMELIGQLAYLEKLESFTQFLTLPL
                     PSLTSVSVLRLHNVRALTSLESLVPLSGLKRISLCRCASLHSLAALSQLRELKELRLS
                     DCRVLDARGNYSACRRLTSVSMRWCGAVLHVGDLATLPNLRDLDCSYSGVRNLESLTQ
                     FSQLRRLCLRGCHSIHELFHAMDAFAALLEPPGAVAANEISSAFLDRVAAPTIVDQHV
                     SLSAVNKLTSTGEASAPPACTLLYPALSTTMPSPASSFSQLEELDVGESSLVSLSGLP
                     QCAPELRHLTVRECQQLHSLSPLGELLKLTSVDASFSGVDDLEGLSESVSLQYVNLRN
                     CVRLRTAASLARVRSLHEIDLSAANQNCIICVCNNELDKRNERTAGPCARRRRSEPLR
                     QRLLMLSGPVGGVDDIRIDTAVTQRSSHRLVQHCVLRQEAEALLRQPLEQVLATEARL
                     QEEMW"
     gene            complement(457496..>457933)
                     /locus_tag="LMJF_31_1165"
                     /pseudo
                     /db_xref="GeneID:12981432"
     misc_feature    complement(457496..>457933)
                     /locus_tag="LMJF_31_1165"
                     /pseudo
                     /db_xref="GeneID:12981432"
                     /db_xref="PSEUDO:CBZ05862.1"
     gene            complement(<460507..>460845)
                     /locus_tag="LMJF_31_1170"
                     /db_xref="GeneID:5654045"
     mRNA            complement(<460507..>460845)
                     /locus_tag="LMJF_31_1170"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685050.1"
                     /db_xref="GeneID:5654045"
     CDS             complement(460507..460845)
                     /locus_tag="LMJF_31_1170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685102.1"
                     /db_xref="GeneID:5654045"
                     /db_xref="GOA:Q4Q6E6"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6E6"
                     /translation="MSAINSLHFIFKGKNYMVPESFVTKEHPGGKAVLMALADKDITE
                     AFEEAGHSNDAMEMLEEWCVNVSATEKAGLLKRAEARHAEEDEWRWRSTAIAFSVAAV
                     VAAVVLRKSS"
     gene            complement(<461712..>462200)
                     /locus_tag="LMJF_31_1180"
                     /db_xref="GeneID:5654046"
     mRNA            complement(<461712..>462200)
                     /locus_tag="LMJF_31_1180"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685051.1"
                     /db_xref="GeneID:5654046"
     CDS             complement(461712..462200)
                     /locus_tag="LMJF_31_1180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685103.1"
                     /db_xref="GeneID:5654046"
                     /db_xref="GOA:Q4Q6E5"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6E5"
                     /translation="MPENIRYRFFFKGKSYLIPKDYIDNEHPGGSYEIMPYVDKDMTD
                     AFEDVDHSLNAVEMLEEWLDEEYDLAIPPDSTAVASPAQEGAKTAGPVTEASPRAAAA
                     TPAVPIAAPTVSTAPAATAPATASEPSTPKLFVPAVATAAAVAVLMASIALVYVGVPK
                     RR"
     gene            complement(<463352..>463744)
                     /locus_tag="LMJF_31_1190"
                     /db_xref="GeneID:5654047"
     mRNA            complement(<463352..>463744)
                     /locus_tag="LMJF_31_1190"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685052.1"
                     /db_xref="GeneID:5654047"
     CDS             complement(463352..463744)
                     /locus_tag="LMJF_31_1190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685104.1"
                     /db_xref="GeneID:5654047"
                     /db_xref="GOA:Q4Q6E4"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6E4"
                     /translation="MTSIATHSVAPPTAKDGAEGPIWHIYEGRTYRVPMSFVRRHPNG
                     QKLLLPYANRDITQAYHDAGHSKKAMRTLLRFLDESVSIEELQLLCEKACEGHSQYTW
                     NWCVRAGSLLSVMAVVAAVYMRCKQRSA"
     gene            complement(<466305..>466709)
                     /locus_tag="LMJF_31_1200"
                     /db_xref="GeneID:5654048"
     mRNA            complement(<466305..>466709)
                     /locus_tag="LMJF_31_1200"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685053.1"
                     /db_xref="GeneID:5654048"
     CDS             complement(466305..466709)
                     /locus_tag="LMJF_31_1200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685105.1"
                     /db_xref="GeneID:5654048"
                     /db_xref="GOA:Q4Q6E3"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6E3"
                     /translation="MSDKETYVRLFYKGTSLVVPMSFVLNEHPGGAEYILQYANQDIT
                     SAFEDMNHSTNAHALLNTFEEVEAKEGVRDIYNPAEYQRKIKLSHSYDEERRCITEMR
                     RWRRRTTLITAMTTLAAMGVAAYALRRHLQRA"
     gene            complement(<468061..>482880)
                     /locus_tag="LMJF_31_1210"
                     /db_xref="GeneID:5654049"
     mRNA            complement(<468061..>482880)
                     /locus_tag="LMJF_31_1210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685054.2"
                     /db_xref="GeneID:5654049"
     CDS             complement(468061..482880)
                     /locus_tag="LMJF_31_1210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685106.1"
                     /db_xref="GeneID:5654049"
                     /db_xref="GOA:Q4Q6E2"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR022099"
                     /db_xref="InterPro:IPR022105"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6E2"
                     /translation="MRIEVKFGSAKHDIEVPEDATLGTLKAAIYDATNVLPPLQKLLG
                     KPNLQAKPDDTLLSALGVKEKTKLMLIGSAAAEVVKANAPSAEEKKKEEERERRLRNL
                     PYRFWRLPAYGGFLADPYVAGRGEPLEGGTTLLTLLCMDVILCRLNTLGAGSRPNPSA
                     ASTKLLQALGQRGAAEVSHPFLQDISVDLRTAIQRAHGAIRSCYDFTVEASKAVQPAT
                     VLEVVDRCVHRITSLPTGEWTMIPSGWIGTHSYTIMFLLVHRRAAEVFDFVVVNRGSE
                     GQGYHPRWQTAEKILSCPILKFQDVSSTRLQDKTFWLLLLSLWMRRNDPQNQSEFIRA
                     EVFYDVLLPWLVEKLPEGRRHEDDVNSNRSGQAGSLHLTTTRFTTEMILQMTGGAGDS
                     EQQMSSSPASSTDSPFTLFIYRNAASPICSSSSGIKSVITAFCYILEQYYPALTALEK
                     KRVKYVLKYEFFARAAEDLSRYSRRFLTNSTSVTRADSVQAAPTASRSPAPSTKDAQL
                     RAALDRLKAAGINDTAANLSLSAVWPRLADNRVYIKDKQNKILPDTDFRDKMVLLFVG
                     SLRVPSGKETSTLLAEAVTVMKQKCGPDAVEVIFLSCDETQDDYEEHCALFDFPRATY
                     PCVEVLNAMELVKVPELLVFQRDGELLHRQGISALQSDPEAAQFPDGPWKGAVPLSAT
                     DVQLLRVGASQLAHHTKKRLDRGQPPVAGSDAVVQHVVELVHAVEAVVDALPQDDVQE
                     LIQAASEVRTSTTASAASVTGGASTVSSCPQRTVDAMVQEPIDVAREGVFQNAELLPK
                     VSVAAYYGPAFQSSVPSLPDIHDLAKATNYAELFALLPRVRTVVETLWRRAGNSGTAS
                     RVAVQLQIIEFITWIFSTLIPVPLPASYTIDAVPQEERWCVSSFYTEDIIPPALQPPV
                     GEGGVVPHPHATDPQLTMLECVYYLMLSLVNAWQAVETPTRSFDAERCLISMDMLLVF
                     DAILRQVKGSDKCRMISTLLNTGGGCGYFLSTTQGKQNIAFASVAAALQLTRPHLLPI
                     RSAILRYIEEQQKMRLGHELFDLRMPDKLELFKGSHTVDFLKSVLANAGYSLEQSGGL
                     FGGGSSEMEKLMEWLCSNRSPLAKEHPTFGMMRDMTLLAKFMGTMEMRDAQLLHRRKE
                     LDALASWRISFEEDAPGRQMSAGWRTRPAPPRWECLMVRGRDMDIADIAVKGFGDREV
                     MYGEGLALHSPIDVSRMIEVDHPTEDDVLHAKVLPTFAGTMNVEESEVLLSCLTAPYV
                     RIPLVLDFFASQDRHTYLFVYEVQEVLRAVLFEPAAYASPAALSHADPRSVPMRLSKE
                     QREMVELRRLRGDLSQQNYEGCLGTTYGLLMSELTHAPTSVLRPLRSLLESITELGPS
                     SVYSSNASYVLYVVGLLCDVLSFCRFIAHQQRERQAEASRTAPAASPKTEESDEAAES
                     RRSEGAVGVIQEYHRHFLQFFVATVQPLLWAWLEESEENADTPTQCVIHAHMSRVDRA
                     LWKGYDSLSASAASYGAGGGQHGSSRSGVTSAAPAEDPHAHLIRMLRSYAFVRARHGF
                     GMGMQRSQLAAQEGDNLLTPEEKMLRFLQAQGLNTSRVSKELLEQGKQLMMSGGRRRA
                     VFVQIRSRNYNDTVRVPNLIHSDPSSTTESKLLKLPPADVPENVLFCDLLGDHHLITS
                     FLDEMTPQRRGAVLLSIVQSVLRDHTESEGGAPAPGTLQDRRRLRRSRSTSVSARASA
                     VNLDTMMDDDDEGHAPHECCSQREETPLWSISAPGVYKGPASSGLFFHAQTCELFWRN
                     DELKPVPDSMSHFTDFENILGKDTLQCGLVSRHEHRHWVHLVGTPYDVIEWTAPPDLS
                     DQGVHHPFVIAGNWPAESVESALFENITYDRVIAVEDDNPWPQKEERWAVNMLRDILR
                     AAFPNGMRFYPLAPALSTVAASDAGNEEEGERLTVPALHHYEMRFLMNDAPQYESETD
                     RATWKEAVAYRYPQPRIEIYNLVPHARKLYRSLVYSTNQHYCLHSMALLTGTRTRESL
                     AVTAFQAGELKRRIFNESTLEIHRYNEAIRGREVYIPARLLQGLIPSVLLESFFMWQG
                     EDDVLRGYPLSEESETAVVLLDAAASGAGKRKPARGEVADHWFNYSIEVHLHLGRRGS
                     GAVDEAASSPATSSACVVVRRNDKGHSAIAEKRAASPTDVARTKTMAEAQGAAHRLML
                     ERATSGEGSMELSTDALHANEEDESGSGLIRIADADVALLHEALSHLPKGVCMQLLRQ
                     ARGDIASALTWASSAANADALLAMVGKDAKASGEEGSSKRHQLAQMVAKTQRAVETCD
                     YVLVNLLHCRNLSHLLQMLTRIEDCSHILAWGRRCSAAGKAKRDAASADEGTAHSLRV
                     EDTTDTGSYVQIELIEMPRLRVRFYTSTDGASSRARLFLADQPGWRLAEWDDFHTARC
                     RQLRALQAPFQQCLLLCNSTCEVAFLCPNHDFAPMKISDDPFNPMLLFDRSSYTWREA
                     VPSPFYVYVVHSSSSFVMPPSLSASLYYAVMQCATQHYAGAMRTLESCYTDSSFSTEE
                     GYMFALFERTMADRFPDACAVRLKLAHAVQYSLNTYQWPLATELSDYLMTKHHVAEDC
                     RLSRGEVLDLLKRCAQATPMVRSQLELYAGLMKLEHKQSDRSAMVPVVVQTPSLERCR
                     FPWERLLLYPWERIAPQKLKRVCYQLQSPEMVKNEKLVEFLWTDQLLMDEEGGANTKK
                     GFYFLYCMKRNTVAPTIGEEHVGVTLSQLLARWFQLRHSRWGREEQQGSETEMAPSWC
                     STVLQLMEMFPHTDWPAPADNAERYILARGVSLTEEYEASEHSHGSIIGDQETAVRRR
                     RGTIPELFNAIHRVAQKHFKTDHITEAVREARQMSRLRTPASQKVTVLMRDHLRGRVV
                     PGDTGRDQVELNEADISVDYFRNDNAKDDSAAAALRRSSLQALCTEPLSSLQLAQSVI
                     AEGEPAAPPVFPSMSVLPFDLRTHPLSRTPLAQNMLDRLEEDSMRFRTQQQAQRPRYF
                     QCLSKDIVQELLTTPDAAVVTASLATAVTVLSDCVRQLHALGEQDADGVMRLRSSLLS
                     LANDVHPRSSTESSHSSSGVSAAGAQSLDRGRLVHYLQRAERSRVAVPLEWLCAGLLS
                     TTLESDLKAENLFHGSLPQIQAELILLMLLSNRMYFAEQAAQAVQQLLLFLELCGHLR
                     GVVPPHAEMTASGSKSTVQTRAARIRELVQHFSLEIDPSVLQQLTAAVPIITNASTGT
                     SAAEATGASDTCVPLSEDTRRTVTSRLQQLANAALDMLTARRTYVHIHPDLSSSAAAS
                     SAGEAAGKASSSSFRATLDPRFLVFEFLFNILLRARQVEMVEWFVRNIREGQSRVQQM
                     IMGQGKTTVVGPLLALILADGQQLITQVMPTALLEQTRGILRRCFGVVVTKHIYTVQF
                     DRSNEEGTSDGVELLYQKLKSAEEDCSVVIAAPECIKSLFLKGIEQLHMMESVPTEDM
                     ELDEAADDRYATHIKALRRKMMERSALADAITPILELWKRGVLIMDEVDVLLHPLRSE
                     LNFPIGLKHPIDMSGPRWLLPIHLLDGIFASQQRRACEDVQRQLECGSSSQTANSVRL
                     GGSSLAEMRSVQEEKRRHALSAIRSVILTGFRQRALQREPHLVLLDPSHYYVEQLLPV
                     LVPWLQLWLHEHLMDHLPEQERQNWAYVSSDAFAEKTKPFLLSPVKRDDAESYVSREL
                     NACMPHYGLQLLNLAHDWLHRLLPHVLAKIDRVSFGVLQPSDLALSGDAARIPYSRKM
                     TAVPFVAKDVPSRSSEFAHPDVVIGLTILAFRYEGLRLQDVRELVTQLKQDFARQAGP
                     KEHRPAAKLYKHWLRLSSSDRAAAAAATEKTVTDDTEDVLRSFERAGVPLSQLQVTDK
                     AQMQSLYHLLHGVPEVIHYYLCSTIFPRTMNFQQLKISACGHELGSSMLFTKRIGFSG
                     TPSNILPLDLGECFYEPGSDGRVLSVLTNPEVVHAEVLPDSWTPLRLLDRIAAAQPPY
                     SALIDAGALITNMDNEEVARYLLARLPAALFDGVVFLDRRDRQMILQRDNGLVIPVSQ
                     CGVPLAHRFTFFDQVHTTGTDVKQSSTAVAVITFGKDLVLRDYAQGAYRMRGIGKGQR
                     LCLYLIPEVVSRIQAALGSRYRTGDMLKDVPAWLLLNSMKVEGLQFFKLSLQELANVW
                     RKKAIAHLLHDAQHANAHPELFTGWMRCRRFHLPRPTAGTGAAEAGKHASSEEDASAA
                     IADAALKLPSVDLLRAAIAEFREVIEYPVAGRIAQTPSFSEHLQEILQARSQELIEGD
                     ALSQGLVEQLLDRMRRSIQGSQAAAEGGSSDPAKEASGKGATGAGQEGVHNTMDLNAE
                     IVHEQEAEQEQEQEAEQEEQRISAFSRDDESQIGWAVDTLRTCGTIAADTVRPTHGCS
                     FYQMNTFQIRPSQPKLQVSSQYLVSDNYFRLDWHGVGERRLKNVFLFLEWVPIPAALS
                     ASASQAATGGPSSEAATIVCSGLLTLAEGESMRWLIHHSRYVKKNFCLALRFASSGAY
                     MDATGPFSAVVHRQGVQALHHMQLSSTSSSGGGYDVSTCDAVADRAVLLYRFLNSDMF
                     YSTKQLAILEEVLEAMSPSDRLHFFTECLRVRRRSRNHWEDAPIAVLFVSEAERPYLR
                     QLAVGKRVQQGVEDMAEVVVRAARPKASERVRREAEPVQRSFERFTVALSQALSACGA
                     AAAFSAERVAEMLAESFPAVVKTLSVREVAQSLFFLVQQKRGAVGCSAASAPPAAAAS
                     ADTAHYISAEELFAVIPPLNAEVLRERVEAAHAPHPSAAAAQSASIAVWSCDACTYQN
                     PIASNMCSMCMAPKPKSVREAEDAAMAAAVDAAAGGAVEEDEGDDDGVDAPWQCEVCT
                     FINESRAKPMCEICMAPNPRPLKKPGGGRAERSPLGGGFECPEGYWVCLVEHGGCSKF
                     NPNALFYCQVCEKARPNLASVRF"
     gene            complement(<487881..>490289)
                     /locus_tag="LMJF_31_1220"
                     /db_xref="GeneID:5654050"
     mRNA            complement(<487881..>490289)
                     /locus_tag="LMJF_31_1220"
                     /product="putative vacuolar-type proton translocating
                     pyrophosphatase 1"
                     /transcript_id="XM_001685055.1"
                     /db_xref="GeneID:5654050"
     CDS             complement(487881..490289)
                     /locus_tag="LMJF_31_1220"
                     /EC_number="3.6.1.1"
                     /codon_start=1
                     /product="putative vacuolar-type proton translocating
                     pyrophosphatase 1"
                     /protein_id="XP_001685107.1"
                     /db_xref="GeneID:5654050"
                     /db_xref="GOA:Q4Q6E1"
                     /db_xref="InterPro:IPR004131"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6E1"
                     /translation="MAGRILIVLLAVALLAVAVAAKEPLNPIATPVNAHVANNNVNQN
                     AGNIHVPPLARPLMSAETASVVIVLSAAVGFSFAMYWWYVLSFIKITPGKDQGLRNAY
                     LTDEVMRNVYVIYTRISEGATAFLMSEYKYMAIFMSGFGTLIFFLLGIALSSPQEGNV
                     PPQSPWMNASLSLFAFLVGAVTSVGAGWIGMRIAVYTNARTAVMATSGGDDGDQASGY
                     RLGFQTALRGGITMGFGLTSMGLFALFATVKIVAAYFGSGVETIPELYECVAAFGLGG
                     SAIACFGRVGGGIYTKAADVGADLVGKVENNIPEDDPRNPGVIADCIGDNVGDIAGMG
                     SDLFGSFGEASCAALVVAAGSAELTASFTSMMYPLLITAVGVIVCIVVATMGATNSGV
                     HRSHDIEPALKRQLLLSTIGATIVLIFLTEVALPPTFSVGGMESSRWGALICVLCGLW
                     SGLIIGYTTEYYTSNAYRPVQEIAEACETGAATNIIYGLALGYLSVVPPILAMCTTIY
                     VSYRMCGVYGFALAALGILSTMSVALTIDAYGPISDNAGGIAEMSHMGHEIREITDAL
                     DAAGNTTAAIGKGFAIGSAALVALALYGAYVSRVAIPVVNILDSCVMPGLLFGAMLPY
                     WFSAMTMKSVGVAAMDMVNEIRRQFQDPEVAEGRKEPDYESCVAIATKAALNQMIPPA
                     ALVMMTPIVIGILFGKYTLAGLLPGAIVSGVQMAISASNTGGAWDNAKKYIEQGGLRD
                     KNKGKGSPQHGAAVIGDTVGDPLKDTSGPALNILIKLMAIISVVFAPVFQSKMGGIVL
                     NLIE"
     gene            complement(<490904..>493831)
                     /locus_tag="LMJF_31_1230"
                     /db_xref="GeneID:5654051"
     mRNA            complement(<490904..>493831)
                     /locus_tag="LMJF_31_1230"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685056.1"
                     /db_xref="GeneID:5654051"
     CDS             complement(490904..493831)
                     /locus_tag="LMJF_31_1230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685108.1"
                     /db_xref="GeneID:5654051"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6E0"
                     /translation="MYDSSSEHQTGSKAPLSRCSTHHLQRKPLEDCLETLNWYTDCFV
                     FPRTNLPSCWSTHCLTLSSTAIRYSYTQPPIRMEAETLLRLTVLSFGAAAPQPTHAKH
                     HKDNVAPPTPQIAASQDIRMTFINLWAGQLGQFISVNAFLRETLLFFLPGHWCCGPCE
                     THNLDLPADAAIDTKSLAPRLEQYRTQRAVKQWAINPFFQQLDTLVTELQPKPRHAQP
                     SFQEWLKVVDHLLTALRTLFMTMYSAFFNSFCNVHKTLIDSFRRLAWEDVQTSYALAV
                     CDLSRTIESKLITVVSHAISTNVDACTANTTLQLFRTPDNLTANEVSDYVASALLARL
                     GDVASSVALNARFAKQFPQAATSISVAEDRREESLESLRSSISSYVEKLLAAARTTNL
                     GAPSITEPSAFPSDELSTFSYASKATSTPPLSVEAKRIAQAAQVLPCIPRSVSVEDAF
                     ALTTMSEGADVFSSVAAVAASIGDVEGSVRSLVAQQHEEQQAVLGWAPNNKGRQRESW
                     YGADKTSEVTNPGIDDAPALAKKPPAIQEKPVECYRSDPGETALFWNRLRQKLGLDEA
                     SVTQARAQCGFRCESPYPNVYLKDLDVRNNDRTTQLFVEEVRPLLSLKDSPTLKARNV
                     RLFREACTSYGKQLWEKTLEIRETLPCLPVRVRGVLLGTMYSAMRADKQFQSLKQIRV
                     QLCQVATKTGGTAKDAATLSNAEEQLLKRAELLAQAVNATENDAVEENRSQAQPTEVT
                     SAQKPECREKAALTSISSETALFKKGLCGSISRYAGAIGSSVSLQTTSARSTDAAWPR
                     SAVMDVLAQSRKSMAELPVQEISPGTPVADVYRQACRCHGVSPNLSVVRELSGSDADY
                     FATLNLSSNYVGVEGLRPVLDLLQYNGEHLISLSVCNNDLESDDVNDLCGILRGPAGT
                     NLVHLDVSYNPFTNATFPALKELVSSLACIETLVMKGTLLSSSASRELQVIVERKMIQ
                     RCS"
     gene            494626..494696
                     /locus_tag="LMJF_31_TRNAGLY_01"
                     /db_xref="GeneID:12981436"
     tRNA            494626..494696
                     /locus_tag="LMJF_31_TRNAGLY_01"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:12981436"
     gene            complement(494742..494813)
                     /locus_tag="LMJF_31_TRNAGLU_01"
                     /db_xref="GeneID:12981456"
     tRNA            complement(494742..494813)
                     /locus_tag="LMJF_31_TRNAGLU_01"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:12981456"
     gene            complement(<496958..>500839)
                     /locus_tag="LMJF_31_1240"
                     /db_xref="GeneID:5654054"
     mRNA            complement(<496958..>500839)
                     /locus_tag="LMJF_31_1240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685057.1"
                     /db_xref="GeneID:5654054"
     CDS             complement(496958..500839)
                     /locus_tag="LMJF_31_1240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685109.1"
                     /db_xref="GeneID:5654054"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6D9"
                     /translation="MQLFSLPKQTKKNAASPKKATSGHPVPDNSHKNAFGQDDKTAGT
                     LHLHHSPSSHSRNRQGGASNRTSTGDRASPLSLPSLQSPSTNSRSHVDSVSSSSQQQQ
                     AQRQASECEKTSEVLMPRLQRASGALTGTPNARTSSSTGFPVHGATAALAVRRSAATD
                     PPASKPATINSTPATPRSDLTAPIWQPPVTRLSPSDVCTVQKPSVHFVSPLPEDCDKQ
                     PPIGLPDKTAIPSPPSLTATSAQKGQPPALPKSRLAAPAVVPPAPQPLPPSTTSLPVF
                     TAMESVPKQPGSPFRALKRHKNSYEGVSNLPGGSISTRTNGNLSNDTVTAPIEGNAAA
                     GVGRSSTSASRVTLSPFCKERQANGACTGSSAHDTGHEPVASFADGVDGSQRSQQSNI
                     PVIAHVVPIPPPMNVGKLGSFRGAVGTLLKSTRRTSSMYSNHSTQSSMEVVVSENSSL
                     VRRLQCTSNRLSTPRTTIKSVSSCSLSLDDVPRPLNRHASTLSTEQQEALRRTPSFLT
                     RAHTPPPSSLRDLVQVRKGRRLLQVRCNTPDVHSAAPGVRSASEQSLSISPMVVLSGL
                     PPSGSDDGKPAARSSARSTEHASPLPEHDKKGDASGQPLKDLVATGSGAVSPNGPSDS
                     GSRCSLRNGGRAAEGRANDARLLAEAGASSEAPRPSSCETIKPQPRAAHIPSPPPFHH
                     HQTSEPGLAEVSPPPLSCSLDSVGTSAAVSHDLHKSTSSSMSLLLDEAAAFDFYGSCV
                     LSTLQFNAKPPQCITATPTPADDSDSATSVDEAAQGQQRSAQQEQKPQKPEMSRNGTP
                     SSAAVKAKRQNDVSISVSESAKLSVADLLGAASGKTAAKATDARKVEGATSAATPNQN
                     KSSAKHVRTVRPASRQRVVSAYVDEDDDDEDGFHQASCAILKPASASAKQQGTSYGGP
                     SLVSSPPRETGHDYLTAIPSSAKPSQPLRETPPTPAAAKPAAVAAPLRAQLGLSWNDD
                     SDDDENEEEYDNLLEGFHPAGFDARRGARSSNSIVFYLDKEDSLSSMDVVVRAASIPR
                     GSWAIPSSLADTKLLPLNQKPQPEYSMVKLSTTVKTGGGGARPHVTFDPYIAENMHPV
                     AQFTSSEPSSTLPDSHVNKSLSSHGNLDQYGFAIDSSFSSLQLNANVRGSRTVLSRNS
                     ASGVPSKASTPSAPFSIFLGTTLRFAPDKSKMQRPLANTFGYTNAQRRARAAAMAAGV
                     SAEEWARAAGIDEDDVDTEDGVYGEVYTDENGDEWYWEEVEDEECEEDEDEDEGNVSD
                     SARALEKRGEGVRHSPASTSSVSGVTATATR"
     gene            complement(<502293..>505568)
                     /locus_tag="LMJF_31_1250"
                     /db_xref="GeneID:5654055"
     mRNA            complement(<502293..>505568)
                     /locus_tag="LMJF_31_1250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685058.1"
                     /db_xref="GeneID:5654055"
     CDS             complement(502293..505568)
                     /locus_tag="LMJF_31_1250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685110.1"
                     /db_xref="GeneID:5654055"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6D8"
                     /translation="MSSPSATDAPAKATIKPHRAVAFFASADRSHCLVGVVASTPTIT
                     QCDGTVAVLVQPRPLILLAPQTLQDASKGGGLVTGRLVDASDPSVSGLPTASIPSPKW
                     ANNRGSATMPLSADDVGTVMTAEELREMQEHRDRLKADLASSRDRVREIDELFCQHTQ
                     EKNSSATLPTTPNPLRAPSPLKEHLDAARKTVDDAAKAADAAEKELLLARAGLRTVKP
                     FAWADLQRRHSGSSSQPLVSLIETAVAPLHDRACASFDDAIVQAVSFPKRLAAVKSMS
                     VTVNDTQRALRFLKAWPTVAAVAKEHKTASALYRWIDALAKAAEAQRRLKATQHVLAA
                     TPSQSPDAAWPSKELARAPETASQPAKKLYSVAEAALRKEWKDQMEYVQMAEEELAAV
                     DALIAEAEALAISSPHVAQGSPKGAKTIVPALVVPTSWVACALPEDEAPRIGVYTHQP
                     RGNQIEFSSSASLILSAVAKELVPSAVVSTATPQDRTVSALNLAESRKALAGSDNNSG
                     SNYHGTGVRRSTNSPQLSPRAAAAASTGVSNAALVPVTEVTTARQRAEDAEEKTRLLE
                     ARLSAALQQNPKEAEVQLLRDELDAKRTELRRVTEERDRLLQERCERSSRYVPLSRRA
                     TADGAQSDGASQAGSGRYARRSSTPRDTVDRSVVEELEDQLTAAHQRISELLIEAGEW
                     RRRSPSLTAVSIAPKAAKSSRVAISHGDCSHASVLQSPSTEEMDTAPHSASDTPRQQS
                     LRGTTVSPCRTLSSPMITQEMYDELQARLCAVSDELETQRQETHQLEEQLNDALHRRS
                     EAEHMVLAQKHELEEVWERLEAAEARAEEQELLTQQRLLLTHTQLFPLQSQLSQLNVS
                     IPLPSVSPIVNSNPSQTLQPTVASTRAPLQHAQHTLSVQDVLGSGSAPGAADAEVRSQ
                     TNEDAMTIATNANTVYGSASRLSVDVYPHSPGTTSGFPSFGGGGGAATSAAAAHAAER
                     SLVSQYSRAPSALQSRPVEQLSTIELRHEVHRLREEVERYQSGELRMVMELQTLREKQ
                     KAERKRRRDARTARIQMLARMQGNIADVIEKSTKELRAIPALLERSRSEAEALMARRR
                     MGG"
     gene            complement(<507420..>509303)
                     /locus_tag="LMJF_31_1260"
                     /db_xref="GeneID:5654056"
     mRNA            complement(<507420..>509303)
                     /locus_tag="LMJF_31_1260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685059.1"
                     /db_xref="GeneID:5654056"
     CDS             complement(507420..509303)
                     /locus_tag="LMJF_31_1260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685111.1"
                     /db_xref="GeneID:5654056"
                     /db_xref="GOA:Q4Q6D7"
                     /db_xref="InterPro:IPR024743"
                     /db_xref="InterPro:IPR026983"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6D7"
                     /translation="MPIKKHDFSPRKSSSPTKVLPSSTDTHHSVLANISSVAHVRVSV
                     NDLVAFEYVCEETKGWKWGLGTVAAIPGPRLVQLMLWAGSGGEMPPEALPVSEADRAA
                     AVKRLKELQRMRQEAEEEMESLNKTLTAKHAHYKECRAAYEADAARAREAAAEAREEV
                     KNMDEADWREIRSYVKPPDIVKLVTEAMMLTLGERTLDWNYILKVIRQRTFLKRLEEF
                     DSQSILLATRRRLRKEYLLNPRFTHRDSMEGSRALGIVQRWVVAQLATSEANVDICLY
                     DQARAREKKHIEKMEDTLRQRRDEAEKYNDEETQLKRQLGDLPVRIDHGKHVNDAAKV
                     SPAPSPRGGSAKNASSPRGGKPDNGANGATPRGRPGAPPLHENVYSTANTWVFTDESK
                     IVLHSSILVNYDEPASMVVTLTPEQVEKLKKALRDRATLFAEQHKADGKIKNLEEDLE
                     NVRGVLADALQDLADAKAALAAQDAVLAAKDREIDEAKEAAAAAARLADTNKVGLPPA
                     MAPSKGPAGQCKELNALIAALDSEKEKKKPSDKKGKKQGGRADVELEKEVMVNGIALN
                     SSMPALFHARDDRELAKIIDRLEKEIRILRNESETANCVLDGVHATINGRPDLKQYFE
                     EDT"
     gene            complement(<511041..>516074)
                     /locus_tag="LMJF_31_1270"
                     /db_xref="GeneID:5654057"
     mRNA            complement(<511041..>516074)
                     /locus_tag="LMJF_31_1270"
                     /product="p-glycoprotein e"
                     /transcript_id="XM_001685060.1"
                     /db_xref="GeneID:5654057"
     CDS             complement(511041..516074)
                     /locus_tag="LMJF_31_1270"
                     /codon_start=1
                     /product="p-glycoprotein e"
                     /protein_id="XP_001685112.1"
                     /db_xref="GeneID:5654057"
                     /db_xref="GOA:Q4Q6D6"
                     /db_xref="InterPro:IPR000938"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6D6"
                     /translation="MVESSSTAPSLLRAGAAEAIAFPPSAAEHDFEELQERDSEQQIS
                     RSLWTQRVRDLWGPEPPYEEQPEDRSGWVVGTLFYHWIGHYIREASREQLTESGLPKP
                     TRQYRAYNAGVVLSAELQRQRARRHAWDGYVGTRVGVRWDDASDGVLRWVGAVQQYGT
                     PGRLYAGVEWRVAPSRRRGCCARRCMGWLLRRGRSAPVPERGPGAYHRGEVDGEHLFD
                     PVEDDTVLTCERVEDVVFRLGFRGDASQVSSTRALLKELPESAQQCPHAIQVWWAVWT
                     LFRQSMLHVVVLGSIRNGCQLMTPLLLKWFVAYLGGVGEHKDRSKAGITATITSPVSS
                     SDSAFASVHRVSSAGSPDIGWQRGVWLAALMFVTMVGETLAGNKQYHVRRRSSLQVRN
                     ALSAALFEKVFTMSPKATHHPAFNAGRLTNLVSADVGVIGRFIMMFWTLVSTPFMLAI
                     VFYQLYVLLGASVCVGGVVALAFMPLHAYLVRKMSSRYRSKADATDHRVRATTELFAG
                     IRVAKFMSWEPFFICRIEKLRSVELSHLKTLQQAIMMVFFQFNATPGLVIASVFFTFS
                     VTGHTLTPTIVFPAIALFNLLMGLVSMLPFALQLMTKLFVSLRRLNMFFDADDELVPV
                     VEDIALAASRVMPTDVPRAIGADDAQQQTPSSPLIHDVAAQFVHADLSTYVAQELKKM
                     DGALEANSAVSGAADRAPLPEAEASLPDHPPSSSSTAPAPADPVTEPVKAEGGRAGHE
                     DAAAPSEPLSSSAQKGTAEITFNEDSIYVLKTKTLLADVDLRVPRGRLTVVLGPTGSG
                     KSTLLNALIGALAVTRGRVACSRSVAYVPQQPWIMGATLRDNVVFFGAPDAAAFEHAV
                     RSSQLASDLALLADGAETEIGENGINLSGGQKARVSLARAVYADRDVYVLDDPLSALD
                     AQVGERVMRECVCGALAGKTRVLATHQVSAAAYADYVVVLAADGRVAFQGSTEAYYKD
                     HLAGQVSHRGAASSDDTAGAVENEAPVVSITAEKKLSDLMGEALPAADTSLTAVSEAE
                     GRAVEKKGKLLTEEERFRGAVGWDVYVRYMKACGGVGVCVSIVALYLATEVVMMSTSI
                     WLALWSTKWLPLSATQYSFIYVALSFASALTTPLRYWLSMSVMRRASREVHQELLRSV
                     ACATLQFFDTTPLGRIVNRFTNDMSNIDSDLQGSYSYLLSTISTFFSTVAMMVATQVF
                     VLGILIPCMVAYYYLLKFYARANREIKRLVNRVNSPMLSVLQEAIGGRWTVQAYGAAP
                     AVIRKAIRCADVIYTCSYLQLGAELWLSVRIQLLSTSITVAVALGAVAAMHLSFLPSH
                     IGLLSLSLTLALEISSLLDGIVTVLASVEADMNSIERVFYMTDHIEHEDLQEAVVAEV
                     QRITEGPHGPAQRCAETLAESDEPPVLDNWSSPLLIRQSGNTQFGALVLEHVDMRYRP
                     GLPLVLRDVCFAVAPGQKVGVVGRTGSGKSTLLLAFLRLVEVCGGRMLVCGRDARDYG
                     VRELRGLFSMIPQDPLLFDGTVRSNVDPFGRCGDAAVWRALRQVGMEERVRGEAGGLD
                     GRVQEGGANYSVGQRQLLCLARALLKRGSAFLLMDEATANVDPALDRQIQRTVQHTFR
                     DYTVVTIAHRLHTVAACDVIFVMDQGRVLEFGSPRELVERQGSAFGALVRSLGRDGEQ
                     LFGETTQRA"
     gene            complement(<517988..>522604)
                     /gene="ABCC5"
                     /locus_tag="LMJF_31_1280"
                     /db_xref="GeneID:5654058"
     mRNA            complement(<517988..>522604)
                     /gene="ABCC5"
                     /locus_tag="LMJF_31_1280"
                     /product="putative ATP-binding cassette protein subfamily
                     C,member 5"
                     /transcript_id="XM_001685061.1"
                     /db_xref="GeneID:5654058"
     CDS             complement(517988..522604)
                     /gene="ABCC5"
                     /locus_tag="LMJF_31_1280"
                     /codon_start=1
                     /product="putative ATP-binding cassette protein subfamily
                     C,member 5"
                     /protein_id="XP_001685113.1"
                     /db_xref="GeneID:5654058"
                     /db_xref="GOA:Q4Q6D5"
                     /db_xref="InterPro:IPR000938"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6D5"
                     /translation="MHALYGAEPAYEKQPEDRASWIFGSLFYTWLGDLMQRAAREELT
                     MDGLPRPMREYRAYNAGVVLSAELQRQRARRHAWDGYVGTRVGVRWDDASDGVLRWVG
                     AVQQYGTPGRLYAGVEWRVAPSRRRGCCARRCMGWLLRRGRSAPVPERGPGAYHRGEV
                     DGEHLFDPVEDDTVLTCERVEDVILWGDGPGGETQEAATTGEDSVDDSDISSQRQPEQ
                     SGVVVAAPPTCMSVTVALFRVLRWRLLLLGPLRLTVEVSALLTPMALSWYIRLLQGNA
                     DTPSSDTAGSDTSSAAASSLPSSSFVDSGSMMGALWQPVASVALLFAISLVRSLALQK
                     YAQVAYRSAYAMRSGLSSCIAAKCLRIASRELRRPELNPGRIVNIMTTDVASIEDTLH
                     VLWMAVTVPLQVCAAVSMLYRSIGWAACISILMLLFFLPIQVLLTKMTYASTVGLAKS
                     SDARLRTTNEFLSGIRTIKFMSLEDTFEEEINARRAAELRAVRRYQIISTANLLISQC
                     VPSCTTAAVMVAYYRKGYPMSPDIIYPALSLLSLMDTPFELVTTLVGVFSQFLVSMKR
                     LTSFLAADDAQARDILEAALASKEGDDAAAVLCNATVSSYKAVPLPPASSRESGGGET
                     HYELRAKTLLADVDLRVPRGRLTVVLGPTGSGKSTLLNALIGALAVTRGRVACSRSVA
                     YVPQQPWIMGATLRDNVVFFGAPDAAAFERAVRSSQLASDLALLADGAETEIGENGIN
                     LSGGQKARVSLARAVYADRDVYVLDDPLSALDAQVGERVMRECVCGALAGKTRVLATH
                     QVSAAAYADLVVLLEEGRVAFQGSYAAYCQYARVHYERSLSGMGKTSVYAAQTVCELA
                     SAVDLSKLEDILDENAEVQRPLTESTLESSGGVLFAAEPQAHRVLGDTVTEDSPDVTV
                     VESGEEKAVGAVPWVVYRRYIEACGGLLTLCRILIFFVFTEGVSRSGDVWLSLWSGGK
                     LESLSTHLRLSVYVAAVLAAILVPPSRDLWCFTITRRAAYHIHAGLLRSLARARLSFF
                     DVTPRGRLINRMSRDMGLIDWDLSVSVDILLFFFFYLMAYFAIMTTSQPFVLVLLLPC
                     ISVYGHIFRFFCAANREMQRLLNISNSPVFSILNEVVTGRWTICTYGREQDMMREVLR
                     RLDGVFACSYMRCMGNRWLSVRVELLGNVTVSGLALLGVLAMKLPWMHMNLGLLALSI
                     TKASSITMVLSSFIRIGASVEASMNCVERVLYYTDNAPAEDIGIGESAMEACDSTALS
                     VVAGDGESAAAAAPAGSLVLEHVDMRYRPGLPLVLRDVCFAVAPGQKVGVVGRTGSGK
                     STLLLAFLRLVEVCGGRMLVCGRDARDYGVRELRGLFSMIPQDPLLFDGTVRSNVDPF
                     GRCGDAAVWRALRQVGMEERVRGEAGGLDGRVQEGGANYSVGQRQLLCLARALLKRGS
                     AFLLMDEATANVDPALDRQIQRTVQHTFRDYTVVTIAHRLHTVAACDVIFVMDQGRVL
                     EFGSPRELVERQGSAFGALVGSLSKGAQQAFRLALEGLSDKPSV"
     gene            complement(<524482..>529146)
                     /gene="ABCC6"
                     /locus_tag="LMJF_31_1290"
                     /db_xref="GeneID:5654059"
     mRNA            complement(<524482..>529146)
                     /gene="ABCC6"
                     /locus_tag="LMJF_31_1290"
                     /product="putative ATP-binding cassette protein subfamily
                     C,member 6"
                     /transcript_id="XM_001685062.2"
                     /db_xref="GeneID:5654059"
     CDS             complement(524482..529146)
                     /gene="ABCC6"
                     /locus_tag="LMJF_31_1290"
                     /codon_start=1
                     /product="putative ATP-binding cassette protein subfamily
                     C,member 6"
                     /protein_id="XP_001685114.1"
                     /db_xref="GeneID:5654059"
                     /db_xref="GOA:Q4Q6D4"
                     /db_xref="InterPro:IPR000938"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6D4"
                     /translation="MPEYSVPGQRAHASAAPRPHAHSTVLSPAYHQPSHLRPPPRGLR
                     DLFGEEPAYEKQPEDRASWIFGSLFYTWLGDLMQRAAREELTMDGLPRPMREYRAYNA
                     GVVLSAELQRQRARRHAWDGYVGARVGVRWDDASDGVLRWVGAVQQYGTPGRLYAGVE
                     WRVAPSRRRGCCARRCMEWLLRRGRSAPVPERGPGAHHRGEVDGEHLFDPVEDDAVLT
                     CERVEDVVFLPLERYPAGAAPPPGLSPEDAKMCETPQAESVLYAVFYCFRKSLLWLLP
                     LRFVVELSALLTPMARKWYVGYLAPPVTPQATTKVPPPPIFHAFCSVAVVFCVSLVNS
                     VTTAKYEQLCRRYAFAARAALSSCIAAKCLLISEKSVQRPELNVGRIVNLVASDVEVL
                     VSAFQGLWMIVTIPVLLVAAVCLLYRTMGFSALVGAGMMMLIAPLQILATIMSSRCSY
                     ALASATDERLRTTNEFLSGIRSIKFMGFERHFQRLVTEKRDAELTALRRFQIATTGTM
                     FATSLTPIVTLASTFITYALTGQTMSPHVVYPVISLLQLIHAPQQTMFSFLVIYAQFF
                     VSMKRLTSFLAADDAQARDILEAALASKEGDDAAAVLCNATVSSYKAVPLPPASSRES
                     GGGETHYELRAKTLLADVDLRVPRGRLTVVLGPTGSGKSTLLNALIGALAVTRGRVAC
                     SRSVAYVPQQPWIMGATLRDNVVFFGAPDAAAFERAVRSSQLASDLALLADGAETEIG
                     ENGINLSGGQKARVSLARAVYADRDVYVLDDPLSALDAQVGERVMRECVCGALAGKTR
                     VLATHQVSAAAYADLVVLLEEGRVAFQGSYAAYCQYVQQQGCTEEVAETVDTCFASEK
                     VDKRAAAARICALLSEAMYVKSCDTADRSAAACKQRCDVGEAGKLEQQQQEEPRLPDD
                     AAELAEAVEVFAEPTHNREEKASGAVAWSMYRRYIHAAGGMHVFCGVAAVFLFTEVAQ
                     QLPTIWLSLWSSGALEGVSNNGCVAAFTIFALSTVFVIPIRVIFVFNGLRDAARGLHS
                     GLLSSLVVATLNFYETTPLGRLTNRLSRDMREIDAALPTYVISAAVHGSFILGYLLML
                     TVSQPFTVFLLVPCISVYGHIFRFFCAANREMQRLLNISNSPVFSILNEVLTGRWTIC
                     TYGREHAVVARALQSLDSVFACAYTKAVGTVWVTVRVELLGNAAICVLALLGVLSTRI
                     PSVPVNVAILALCFINASSLSQKLSSLISVGATVEASMNCVERVLYYTDNVPTEELCD
                     ENEKAHRPENVFAPAVIDGIELSPEDVTAAAAPAGSLVLEHVDMRYRPGLPLVLRDVC
                     FAVAPGQKVGVVGRTGSGKSTLLLAFLRLVEVCGGRMLVCGRDARDYGVRELRGLFSM
                     IPQDPLLFDGTVRSNVDPFGRCGDAAVWRALRQVGMEERVRGEAGGLDGRVQEGGANY
                     SVGQRQLLCLARALLKRGSAFLLMDEATANVDPALDRQIQRTVQHTFRDYTVVTIAHR
                     LHTVAACDVIFVMDQGRVLEFGSPHDLLSRGDSVFSVLVRSLSKGARKVFYRTLKEGV
                     AR"
     gene            complement(<531497..>534484)
                     /locus_tag="LMJF_31_1300"
                     /db_xref="GeneID:5654060"
     mRNA            complement(<531497..>534484)
                     /locus_tag="LMJF_31_1300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685063.1"
                     /db_xref="GeneID:5654060"
     CDS             complement(531497..534484)
                     /locus_tag="LMJF_31_1300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685115.1"
                     /db_xref="GeneID:5654060"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6D3"
                     /translation="MSATPSRAPSSGTARLVSFFHVSSDLTTPLSIAQSKTMSDASSH
                     KSVNDAEREGARRCANALRQEGTTAAAASAALDPSWVAVESHASQPAAVSRCTRGASS
                     SRPSCQPLPEEYQRWKIKSPSASRVTMKLEFSLENTPLAGARPPPVWCESSPFTAPRG
                     SRNSLANFPTPSRRITTLSGARNSVSTPGRNPYTDVERGISNQRRRHAVVRYFFVSHE
                     GAIRLNIRLQQLLAYRDLCEAELHERLQVLPPEEASVAARSTARCGCATETEREIERV
                     QAALAHLAASSLELAETLEGMGGLFTSLQSVPRSHQTATALHSNHILSAVDVERAGER
                     GAKSGGRSVNEDIPAAAKKAGEKKPPVQQPVDASESSMTTSVSTAFEAGGSYSLVESP
                     RASTVDEAANQRPPSKPPIAVAAWRNNQKGDLPSAGQTARSAEPSQTESAGVTGSHGI
                     TPRNSTVASDFMRASIVATPKVTVETAAVTDAKTRPGQLPFSSPRRKASSTTDNERKE
                     VSAAKATPPRCKVIDCTSVSTPGRDHRTTESWLCQAAASHHLASASPQQPPSSLCSTK
                     ATVSSAASVKPQYPSGITAPRAKALAGNPDRWTPVCTQGQPTSSSLTDSPLARYRAKR
                     GYRNPESHLCSQLAGAPRQSASATHNSLPRAVTTGEPSGVQDGEKIKGPVTATRASGV
                     TRHATLHEDQATFMQERRRLGPAKNEGNHKASQDNSAVQSQEKTPTSTGRWPDTPCSR
                     AAKSSSPPPHSRASDAPALGQSTESTAVASSTISSHPPASTSHPSLSDARQQWPKPLT
                     ASASALGRGSATPSTNASAAHALTGSAMSVMDWNAPLRATEVAGSPPPSASSASVPLN
                     QELPSDEMASWSPADSGVALAGGAVSLSDVDSWPAGEPQEAEQNAKVSAGALLRGTTR
                     DRSAELRMDGCHSIWGSIRALESRVGDMESRTTALGKNAEKCAVLEVIGHLKARVGVL
                     EERITLLEQQSSASHLRIHCEKS"
     gene            complement(<536746..>541332)
                     /locus_tag="LMJF_31_1310"
                     /db_xref="GeneID:5654061"
     mRNA            complement(<536746..>541332)
                     /locus_tag="LMJF_31_1310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685064.1"
                     /db_xref="GeneID:5654061"
     CDS             complement(536746..541332)
                     /locus_tag="LMJF_31_1310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685116.1"
                     /db_xref="GeneID:5654061"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6D2"
                     /translation="MSTRGSRRHDIAHSGAPPQRRTSVLVAAETRQKVDAETAEKDVS
                     ALSLACRGSSASSIGGWRTSMSPAPFVAIEAASAAASPTDSTATPTALANGCADPSLS
                     RVAATLARASAARTFYKGRARSGSGNAVPRRETAHDPSSGSSLPPSLAVKDRHHQHRC
                     GKFDKEEHSSGSSAGPHDKSQRARLAADVCADQPKLSRHPYQLGVENFSELTAEPAPP
                     RRRVSAYAAPFGPSSWSAFTGDRAEASSPTAAPSAVEASHSPVTSSSHHNVTSRANHT
                     GRLKPSLPTTPGSPKAMNVTMPSMCFIYTRTSNRSTDRNREKPKYRSLSAATNALSDE
                     VCAVVAASTESSATAMKVGDFAAERVAATTHAASAPVALPTQPLLRRGTLPQANTKGT
                     LGQPNARALFARSLTHTCVRAQEARPAAQSSSEGHGRPADEKRNDAARKDADHAADGV
                     LRHTSARDFEEASHSHLQRWRQRQEENRSRAKDVTSISASTPPVVESATTLRDALVKN
                     TAGAAPREQELKPLPSEPVTDASWQRREKRAKPSTQAVSTANTDLAVAPQPPTEEPER
                     QHRISVTVEARNAASPPTVSGSFLLSEVRYSGTVPDLPEAALASVASKRNSKASTTPA
                     PEPPSTAQSRSVIDGSAAAAARNHEAQAESTANVSTHLPPSKSSPSCCLTEDPRHRVA
                     AKDGIPVDREAQPPPLPSAQHTSHPGFVSVAAEGVTPANRWLLDRTSAHQSAPCQTTK
                     GPTATAKEDAAPFLSASTADMQGLFRAVLGRREQRLRLQEYSNAGRVSPEQPTSIEAP
                     AGASGGVEVSPVFSSLEQPSTRHTTVTSSPCTSPWALTQGATVSPPLKVESTRSAARA
                     ARAVALEGVEALRTSSVVSSPAGPEAGENVSRSGGGVAAEAHTEPVLSARRMGGDLRS
                     SFSTTEVSAEQPSPGIKLLQSAKDEELTERRPSSRTPGAYTPLLHWIRQNRTQLSLPS
                     SGAPTLLPAVDVAAGRAAIPAATEIEQNPHLVERRAPVNKYHRPSRTTSDTEVDHNEA
                     QLPEAGASWQAPNELLLRKLADARGSHRRSSTNSSVCVPSLDKGVTSVRHPTPAPAHP
                     LCQGAAAGHRTPVAEGALLPHAPTSSVADDAKGASACAVASLGDIPLDELDKLEQSIN
                     ALLTNYGSRKTAGEGSAPAKLTAAAALMRETSPPAKTSTSTNTRHRKAMAAVNKHSKN
                     NSKDDTLAPSNSQDSSCAWPHHSCAIETDDDDSQLEGSGLWCGDEDAHEANPPPVFVP
                     PLDLTLLLLPTGDSEELKPYRIPLPSAVPAPEEAHRRFLCSIGAYAAAFREEGSTATA
                     DDSLRAGAVADAPSAPASMTGAEDAAQPPGNSASLNDSCALPSRRVSKGCTSLTPVSP
                     FVNERVRRMRASRQPFSSTGTSTVNVRSPRVSHHATGAVKDGAEKTVSEEADAGNPLL
                     MEKAADAIPTEENEMLRSSGEAGHVRSHVAPLVLFTDDSDALDGGRGAERDRRVNRQR
                     SRVQRILLNCQEQRERKDTVLDELNIFKTLTKRF"
     gene            complement(<543666..>551357)
                     /locus_tag="LMJF_31_1320"
                     /db_xref="GeneID:5654062"
     mRNA            complement(<543666..>551357)
                     /locus_tag="LMJF_31_1320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685065.1"
                     /db_xref="GeneID:5654062"
     CDS             complement(543666..551357)
                     /locus_tag="LMJF_31_1320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685117.1"
                     /db_xref="GeneID:5654062"
                     /db_xref="GOA:Q4Q6D1"
                     /db_xref="InterPro:IPR000222"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6D1"
                     /translation="MSSDIEVKSTEAGSAPVDTSAASSPGATGAHGPGSGHTSLSLLR
                     TDATPSSATLSPVVENPSDTTQGDAASLSGRKRRLSFKDRQRHRAGASGSTDLELRAI
                     NSRPVHSPMSTASLSSPLTLDLSPAREHPFPHPALKRTAAAASPPLTACVFTEMGPSH
                     RGGRADASRAPSQTPITLTGPDALTAAVAVEEGPSVPDSMVLRATSSNFSFTSKPTGS
                     LHEHSGSLASASQLQSPLSLLPQDTASAAAAPPPHLPSSLMLCTSASSSSGNAAAQIN
                     ADDTRAPLPKLRTPTTIGSSTTSPIGFGSRMTLQELRTLSPVSSTSTSSPRMSFKDRQ
                     RAAVASRKPIIAAGASVLARSSPREVVASSSFTAPSESSVATPSSLPAASTAQLAPHS
                     IAAALPERAAFSAMTPGTQVPSPLPGYPSLSTSTPFQKLDPAAQVDPTELGCADRDRN
                     TSTEDTSELPATRSLSRLPLAKLTATESVRPSPPPLATAPPALASHLKRCTPSGPSAP
                     ASTKPQFRFFAQGCQAEEEEDQSSGATCRGHSGQPRWLRDRSGSAGTASTNPADADVG
                     EKSYVDDDEESLLACTQNEARLHFYDPNIESAPMEFNMASPCARYNTNSSASASRESG
                     IAETRNSTERSETMREGPGRSETMPSMLTGESGPDVVKAACLSKPLWCYTRARTESLE
                     AAPQSTGSSTASRLVCAEGPQTSSSTDSRQVNVKFEQHHYSDNACGAAPLPAAVRTMR
                     ARASSSIVDRWRQYQQPHTSQQDAHVTRGLSSTHSTLAPALSESSVSLGSTQLSCTAL
                     PRRRHRSKMLAPDGALIATSSAGRLGGAESSRVFSPSAAGHHRRSHTLDDFALMALAS
                     GNRSGATPSSVTPEPLSLSSRSTAAFRSTVNARFPPLSTHTAVVVSQGVSAGLADERS
                     TRGDLPIPLGPIPAGALPLTATSSGSSASGSAEQSFNAGVVSIFSSGVSPMPTVRKQA
                     SSHANSLGKVSSALAAALIAPAPSVEDLSATTPTVNADTPAGCSSVDELSTHTMRRRS
                     SVVDPGACPSTGGGAVANTANPDDAEDSDGDYQQRTVYSYHGGDSIMSATTAELRKLR
                     RRSNYSSLHYGTMTSYYHKRNEQRHGGVAASQPGRRRSGGGRRRHRAGAGVDSKESTS
                     LFLQTGVFARDSAGSRPDGANSEDDVETVWEQKGSDEAAASKEEEGRVGGAAAGQRRH
                     HRGDQAKDDAFTAAAAAADDDDGDAAQRRTVGMWTSVEHVFLPRYEVVPEAASTTPLT
                     VPASPKSNTNASTSAVTSDPEAKQRHGSSYGSIPDKKKNGTPNLTPASDQQPPHPLPP
                     ADASPISIPAGSPSLGAASSHLMTPAPLTPKGSPFTDPSGNAGGSRPSGLVVLPDADC
                     SVDARASVSLSCSQFRRTPAQASGTMRLEPEDFTFGTVAAEYNVDPADEEEFPQGSCD
                     AKVAARLIFDAAAGVMLMDLEDEVGRYERHGHMPPDDRGSLTAPLEHTEEGSGAKGDH
                     DACDDEANDGACHCNAAFIAKDFKGPDCSRYDANDLYDHCSRCHRRPAAFLCLHCLEA
                     VCPSHVRRHHLQNPSVCTLFLNLLDIMNSFDRIFWCEKCQQFTWKHTEVYDALVDQIA
                     FTRGTYLKRPARDIHCVGYEVRLKDVTASAAVRHAPGSAVGAEAHARAHSIDNVPPAA
                     ILNQTLSDLWIPAALQNVISSPATEAFTAAEMLPASANPLQRASNASALPNGGAQLPM
                     GTDASALDLSPKSLSSGGALVRQRQTTVASNSLSQLPARSPMQQFLSRDLLDFSAGNT
                     VTVGEPVTKLCALAASVQGWRTTQEDAEAVFLVDIPAISEEVVNRKELREVAAAAAAA
                     DAAAKKTLGALDRGDTHRLDSSLMVDGSYELSASSASENSPELNSALRPSDSGAHKRR
                     DTGDEEAASTAAGAAKEEAEAAPKETMPMAVFCMFDGHGGDAVAKLAARHFEAHLRRA
                     IEETRPDDVRARALLFFLKAETDSAASAGATAPWLPQSVSAVPAGDGILNYAAPLADS
                     LNTPSGPAASSPPPSLDAASGRMPHSHFSSPLQRPSGSAAVSVPFDRFSAKRSEANGD
                     ETASPPKTADVPFTLSDELRSASFAGSFSVLVPVTAESLRLHAAAATLGVGDAGIKRT
                     SPAFDDATGALGGKNQHPGSTQADTVLTTNKRVSNSHSSNRNRKCGVTLDAWEAVEEP
                     LPDMVAVAAGVGSPRTGVLLPRSIAAAEELRHGSGSSYNPNPAAGNVAICPSPAAVVS
                     IPEMEMLRQYFASIMEDALMSLDDYLRSTPEGVRGDYDCVGCTACVVGITANFVLCAN
                     VGDSGAAFYTKDRMKVISVKHRVSDEAEQARIHAAGYNIINGRIEGMSAVPRALGDFD
                     FKQCGGRGPRKQAVSAVPDVTIMPVPSDTDQWGIVLACDGVWDTATLHQVHVALTNTV
                     NDLAVSGSAMDAVLRGAELYQNRLRGPSVAVGGSPWSSSSVSPSRAGGPLHSSEALGN
                     SHKTPLPTKGGSFTSRAVTEESMIRYYDDDDEGAAPRLTQVDAILLTAAAGVFAQCVA
                     PEDNDEGVGLDNCSLIIVERRNVQE"
     gene            complement(<560920..>566637)
                     /locus_tag="LMJF_31_1330"
                     /db_xref="GeneID:5654063"
     mRNA            complement(<560920..>566637)
                     /locus_tag="LMJF_31_1330"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685066.1"
                     /db_xref="GeneID:5654063"
     CDS             complement(560920..566637)
                     /locus_tag="LMJF_31_1330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685118.1"
                     /db_xref="GeneID:5654063"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6D0"
                     /translation="MSSAERNTRISGHRGHKHSRAARRRADIESSAHFDPHCSGDFDD
                     LSLLPLCTQILHVQFDDLSSSEPSISAAHGSDFPHAPGAAASLTSFNNKNQPPQPLQM
                     VPTLSFQNVHSASAGAADTSRTDHANGHKDRRQRKQKPECSQQDCHASGAIRSPPWST
                     MNYPLSSVGSHNVALEPSSSSLTASCFSVGPNGVSGGYSDSTGGVSGAAGCGDGALAA
                     AAAWPDCGGSGSARSPLQRAHHSSNVGTASTGADGGGNVAIADGNEYAILQPQLMQML
                     LQQQQQQGTAPPNTFMPSSSPRTNTLKGLRDSSTAGSAPTMSAISACLMQLVSRNGGN
                     EAVQTTPNAPLQQLFAPNPLPPPSPSTEPSPRAPQSNSIIDSDSVPTVPSLGAPGTRI
                     VYAEAQMRGNTATKCLASTRARGFGSNNPPAASSGSLGQTSLHPYHFGSPLPPAASRK
                     DSEGGADINTLAPTALLTAVNPLHHAFSPLPPSSTATLPMLSAGMYSPFTGAVPHSQP
                     GLPPPPPPTAAQSQPPLKPTSRAGNRHRNRGRGTAPATENHNTSAGGNDRNRSRRQQV
                     AEDGHASSRQGATAPTAGDAHAEPKNGANFVVGAWYEGVVKRYNPLRGFGFLTCTHQL
                     HFDLHACERACTRHADAVHGKQQQQQQRDLEKAAVAATSGTSATLQCINEGARVQAEQ
                     RSLSSKSVLRADDTSTAPLSASIDSAKESDICLPHNAVATEAHREGNTDAAAPAATTG
                     TKNAEVADAADATVSSATVMTSTGKAHGTVVYSTMQWYLHMMGATGKQTSAEGTVAAR
                     EAEDDADEGKHSYRASFEDLGTLEREPAQLGDIFVHHSCISMNGFRVFVQGTAVRFSV
                     AVLMDTVQAVDVIPLGPEWEQPLSPEALAQPPLYKVTPTAATVLRYHRLEEQRDDDTG
                     KKSGGGLQSRVGGMSAQWTDMAVIPSPAIPNSVEGQSGLLVVRVPPKTGPISSQTTLT
                     STRSGAATPGLAAMTSASATTTATRGGVDTSQRTHATEHWSAMPHTVAATSAQVSDAS
                     TKEPMCTGAKEALRGGPQLLDVIHPDSIAATFLAIDREDQRTLQGKPDAPMITPATPV
                     PSRNCNAFHETTMKATESSMPAAEVESLTNRTSLENVPRNQLNRDPSVFSDGWLTSSN
                     NDLTSVHGNTGGTGMQMSGRDSRNVTMVTVTATNPAQNSDRNTGSHSQAPPNSIDDLK
                     DSRGRGSGTIPTSMFGDCKDLVLSGNMDEQAISSFNGCGAGRKVDKNDCGGNERAAGG
                     AAAAAASCSGVAVLAHPKTATHSAAAAAQGVAPLPANGDFSEPRSHDDGELCEVLVRS
                     HSGSDSAEDEKDSIPTTPSVNTIPESNLGLVLDWTELFNLKIANERVKDIVKHKTDFK
                     LLPHHSVKIIAAAATPNQMSDGSSSFDAAALVPKVVPLSAVCELDSSSSRGVEEGEGV
                     AEVSGCRSAPGSCSNHGDPVGREANPSSSQPPMRGGDSGQTGTTQLTRDESSCNGHEA
                     RPRTGKPQKSSRADGQRKWLKDKTVPAFVMVDMADLPPKLAAQVPRGVTVIALPRETV
                     KDLKIKTISVPRDASSDPVSPCLAEVQSAVPVAGGPRTSGSKAHVPFHGPVQAAGGRN
                     VSSSLAARRPSGNVPAHGHAERTDSEFYRKPVVSFDKKTTSICSAPALDGGKCSDSCS
                     PENGCHALPFTLALPQSQQVCQPLPRTSMERKPDPMLNKSSRGSVNTFKTSSYSVPMP
                     QSLINVLSSPWIQDSAALSQPLPYPMQQQPPQHLFALQQQLQRSTPSGSQLTSIRTTL
                     GHASNNTLSQQQREPLNPVFASLNGTAALQAATCIANGSYAALDSSGLYPSQCISAGV
                     GMGTGAQPSMWAPSHALAPAQPVCAPPPLPVSSPQAVPSGTALSASPQASSWWCSSQG
                     NGRSS"
     gene            complement(<581301..>582686)
                     /locus_tag="LMJF_31_1340"
                     /db_xref="GeneID:5654064"
     mRNA            complement(<581301..>582686)
                     /locus_tag="LMJF_31_1340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685067.1"
                     /db_xref="GeneID:5654064"
     CDS             complement(581301..582686)
                     /locus_tag="LMJF_31_1340"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685119.1"
                     /db_xref="GeneID:5654064"
                     /db_xref="GOA:Q4Q6C9"
                     /db_xref="InterPro:IPR002059"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6C9"
                     /translation="MFRAVYSNPAANVPASNCMTDGFPLLPPQRPHSSGSQLMRGCPL
                     PWNDGRTLMYGVPAKNEASLQQVSYSRTLGQRWSSGSADNAAQCAAATHSTVCFASCA
                     SGANGSAGGSPVLLQPAMGVPAFVTDNQQLPSMVAQSSPTVSRLTSGMCSTSEGSATF
                     GASTTSATSSTVGNCAATGTAATTNGSMAHTGTSPALPGFQMSVPLPTSAMTAVAAPP
                     QQPQTCFWLSHTTGALTPIRKEDMMTISDTSASTNTHSYAMPPPPTMPSQPSSASATS
                     VPTYLMAPQVSSFGGAMVQAFSELLSGSTAFSVPALPLPQPPRPPKTLNGLQYHLGEL
                     YEGFVKRYNPNRGFGFLTATTHVTVVNDGSNSDSATGTPIASLNNTTTAVPTTGEAET
                     PKEYRTPVHLGDIFVHQSSMQMEGFRTLPVGGRVRFCIGYKDGQQTLQAVNVELLPQV
                     LPPNVEMASSP"
     gene            complement(<593689..>595233)
                     /locus_tag="LMJF_31_1350"
                     /db_xref="GeneID:5654065"
     mRNA            complement(<593689..>595233)
                     /locus_tag="LMJF_31_1350"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685068.1"
                     /db_xref="GeneID:5654065"
     CDS             complement(593689..595233)
                     /locus_tag="LMJF_31_1350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685120.1"
                     /db_xref="GeneID:5654065"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6C8"
                     /translation="MASPAAWKGAPSTASASAAQTATPSTVARAPVSGSTPMMMPLSL
                     TTLASQSLDTNTLLGTPPQQLLIAQGAEGAATAASGMPSMVNPNQMYIMGLPGVGMPL
                     NYVTQTFAPATGAPVMMASGSTLAYTASGASMGSSTYSMLPGGGGFRNVSAARVAVYQ
                     AGSTSGVSQLPALATMSEDTLGSFSFSSTTSKMTPQCFPGAAPSFSATGSCTSTGAVL
                     VQASASAPSANLPPPPQYSSIVKSPAGGASRPIFDSRPTPVVRKGDAGKGYEAGAHYE
                     GRVKRFNPIRGYGFVSATYKLIPLLKYRQMKEAKAPGSISTFEKQGHTPDARPRDSTG
                     SSADKEGKVSEDASLLLASDVDAVAALHAEINGDDLVYIKGVPHVRHPVTMGDVFVHY
                     NCLRRSPGEVNMEANGGFVNLPAGSRVQFKVEVFVPAELMEKASDDKEAAAMLNNLGV
                     PVEENPNLLSGAIATKKGWGYQAIDVLLLPPKGTLPAQFAPQNSATATEDAASGCVSS
                     VSLSSF"
     gene            complement(<601324..>602592)
                     /locus_tag="LMJF_31_1360"
                     /db_xref="GeneID:5654066"
     mRNA            complement(<601324..>602592)
                     /locus_tag="LMJF_31_1360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685069.1"
                     /db_xref="GeneID:5654066"
     CDS             complement(601324..602592)
                     /locus_tag="LMJF_31_1360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685121.1"
                     /db_xref="GeneID:5654066"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6C7"
                     /translation="MASIPEPIFALALRIFALACIHRHFIAASPRELLGFHLGGLSLS
                     VSFSMSADGCHINAHQATPVRPHSLAQSVRLLRREGKCHRMLGNLDTAAGDALRSFHD
                     ALDQAQQSLQRDEGRLRATEQLLSDLMLEVDCLKADSAPNSATLQRREALQAEKLKML
                     HHTRHQREAIAATAAHIQHLKEPRVKLTERVDALKVDVKALRRQYGLRAAQVHAFIAQ
                     FLQPQNSLENLRCQLARLQQGRVSQAEALRASKRHLEELKAELAALKAADRLDTTTGP
                     NGNSIVGNDQHLETKRDHEVAAVSGLASDGNGEELNAEDSECAGSVPAPSEADRRSEA
                     TRRRSEQAAAHKAAEAQQAAEQARLEAVCVDLKQQVLLLCQEIEGADAAQQREHKAYH
                     DALNDAASGAGGGVLRQCQRCACDLFEGFS"
     gene            complement(<603309..>607307)
                     /locus_tag="LMJF_31_1370"
                     /db_xref="GeneID:5654067"
     mRNA            complement(<603309..>607307)
                     /locus_tag="LMJF_31_1370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685070.1"
                     /db_xref="GeneID:5654067"
     CDS             complement(603309..607307)
                     /locus_tag="LMJF_31_1370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685122.1"
                     /db_xref="GeneID:5654067"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6C6"
                     /translation="MHARGRPTVSPRRAVNGTAAAAASSAVKGGGESDSGTPATLSVG
                     VVTRETAKLAAAKPSAGVTFPPTNGGKNAAAEGAVTTTLEVPSSINLCDGSDALVTPR
                     QRYSALRPTMSVSPLTTASTRTLSSNDDNEEGSPAAPKRKVGIAHKAATAGSSETGTY
                     GTQRASTAPCRTDSGSASATVAALRGRLAATSGLSTTRTSTGSLTAGTFAGSTADAKS
                     AEAAALAELRELRLALRDKERAITRLTRDVETAAQTAVKAQRKTEELQGKLESEKSAF
                     AAHKKDTLAQRQELQRELRQAQAGLRLAEQVQDKLQRELEKQKEKLATASSRTTSVTT
                     TPVMTPRSAAPSSASFDAMLQAKVSSLESEKRLMKDTIRQLEEKVSAATVAAAAAGLA
                     KTAEEQRDASAAAAAEAAEKIATLKKEVLDLRQQLSTQDTTVRDQRERLGTLLEENKV
                     LKAREKAERKPARQDAAVATPRTGALPGKGVSEEQLLSVRSPRQAVTLVTPEKEAMAH
                     LREELTAAQTQVEEHKRMYEHAERRTKRLEIELAAVRRRAETAEEAAKGIASQAAGSP
                     ASTTAATAIFKDTVASMREQLASVTAECSELRQRARERTEEATTLQSALQETEDDRDA
                     RVRQIRYLKSRASEAEEKAATALAAQKTELSGALENARTELRSVKAELRAAADSAQRH
                     QEASKALRSQLGEEQQRCSNLEKEKRAAQEEAAGKAAAADASKQQADHYKKKTKQLTK
                     KLDEALRELAVLGEEYERIFDERKMAAKSDAEKSAIAEARRLMRGQPGTYIEQHTTMS
                     DTETVIRAVSPLEAKRTASVSRNLSDALLSANRPAPVTGATSTAWAIAALDQERQARE
                     QLELDVLSLYSKISAIDHLEQKSWHSVERGGACAAAGASSTNLPVGSTHDRPRDPPQP
                     PWMPVALQQSPGTCGAPGRSRSPGRARSPQATHALDGRYFDPTIFTCPENPPCSAGVD
                     SVNVRGHATVNSHQHAEPPQRSRSLPSQALQLSPGARSRSDAQSTYRGLSPRSMVLST
                     PTSALQPYRSDSSTSVTSALSELLATSVYYSTRGAGSSGNGAGPCATVELQFSSSAGR
                     LLLSKRGHRVQRPVFSAAANEAADLDVCCAAIGSVSHTIYASHMLAKGHYHLKHIFRF
                     IVRVLSDCKSGGGDILIGFADRHIPMESFGAKRNALRYRGCYYLSLRDGGLFCPAQDI
                     CDATYEGWLAAAAGAAGRRCGGVAWPRRDRGASVTFSHGGEAPLTEVRATSSPVNTRA
                     LPRPECVVRAGDEIACTLRTDERSISYSWNGVECGVAFTEVSLSPSLYPCVEVNTSGG
                     ALELLGIDSSSY"
     gene            complement(<609006..>612212)
                     /locus_tag="LMJF_31_1380"
                     /db_xref="GeneID:5654068"
     mRNA            complement(<609006..>612212)
                     /locus_tag="LMJF_31_1380"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685071.1"
                     /db_xref="GeneID:5654068"
     CDS             complement(609006..612212)
                     /locus_tag="LMJF_31_1380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685123.1"
                     /db_xref="GeneID:5654068"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6C5"
                     /translation="MTSEARLMPSVEERSFRSALPGSAAASHGELSVRGRSDVEERVW
                     HPIKLKDGEDSARWSQISLGVVSRKRGEVHRGGKPRDTSDAVAISASSEASELTVAIA
                     EAVPRIAQEQASATEAYADRWSHELQQSTAAEEELRQLYQQLEKELIGTRRAANTAEE
                     RHKRELELLKRQLEQERAERLKAEQDREDLLAQATMSPSHTPRTGGGLPSAEQSDDSK
                     GRQSLGISPSNAYISDVFYDKLKEREERARARVRKEFVRQAQESLYAEQRRRAEAEKA
                     TEATLKRLEKAEEDVSKVREALQEATSVLEAKDVQLHERAIHVQELEAQVHLLERQLE
                     AAQDAERLSSELTSKNLEEVKALADQRQAELEAQRQFVHQLQEKIGLTTLDLFDREND
                     QEGVLRTVHELRARCRQLEEEFAAAVQEATALLEQRRQRAEDEAQLLRGRNEELKQRC
                     VAMGEELAELKTRLECDSSEVAQLRARNEKALSECHVEIRSLQLQLERVTEVAQRRSS
                     ESATAKEIEQRQNAALVRQYAAEARSVQEELDRLKAQSYREHEKHLATVLDLSQQITA
                     LKQANTQLEHAINVRERESTDATRLLCHAREEVSQLREERRRMSAPFFDHREGSQSSS
                     AASSYDALLRRIAELENMQKELTERLCVANSTVEQLQSVQQATADQPKSRRALSGHHR
                     RRRSKPYFPVPPTDSFLQMSDDEQKKQRAGGHDVASAPLGFMGSSLMPAFTGHRGPTA
                     SLLNLLESIVQQLESIIRCAKQQGESAVQRNSPTASPSPQEHRVQQFKQSEELEALDR
                     VLVSCMAALECCHLRRTSSPFYSSFRDGAAGRESNGAAARGEGKAAGREAPSPSVGAS
                     LVDSDHTGAVRSRSSSVADRWLQHVQDRRDVAQHATSAALPQDHFPQIPLERPRRSSQ
                     RSRSSVGGDDEFLSYSTNTSAAAPHLLTERTARGGAAACVLQRSKQQCTPAGKRVFDG
                     SDAVQRIQPRTLASVSEGDREVLQSEPCWEGDEDTEALVQGERVAPSVLLHLSARYTC
                     ITESPPARPRRTEAVPGRRGPSGGAAAASHTKPDSSTK"
     gene            complement(<613366..>615654)
                     /locus_tag="LMJF_31_1390"
                     /db_xref="GeneID:5654069"
     mRNA            complement(<613366..>615654)
                     /locus_tag="LMJF_31_1390"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685072.1"
                     /db_xref="GeneID:5654069"
     CDS             complement(613366..615654)
                     /locus_tag="LMJF_31_1390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685124.1"
                     /db_xref="GeneID:5654069"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6C4"
                     /translation="MRSETQKNRSHYTGGPVSRALFGSHAVDLSTDNSQTGSRPDTRS
                     ESHDDGNARWNLHGGADAHGKDHAERDAGTDVSPPPRLPLNFALGGFDTGAGLRGGYA
                     ARVYEESDDNADDEDTDEGGDDCERANDEEELGECSPAGNGAAAPGMFSQGACARHLD
                     VEARKAAPTAGAQPVDRLGFHTAKRAEPNVPGQHSIGAAMYAAAMSSSATEAAPAAAN
                     TFRRATPVARAAYSVGYDHAVGESPANSLRASPLRNDGAAVSAAATKEAGVLERASPK
                     LTTTDTLGIATRGGPGTTVASQSFGYSMGDAKPVPSPDVRYVPAVSVAHSAAGSRTAY
                     NRNLGTYSAFISATQASEVSPVHGKTSSLKESMQGALAHGHSSTTSSPLSPQRPTVGA
                     TDDMHAHRCSDHASATGFDHTLMSPVLVLDEGANAQNSGDEPCLRDAERVGLPVPTEP
                     TMAAIAVHAVPPATMGSALVIPGEPKPRLSSGRRRSAENSRANRRASASAADVAKPAC
                     EQEGHVRSPSNTAASTVRESLSPAVAPLPTRQHPLESVRIGETTEEAADAVNSSAASE
                     RVERHSTAAKSDAAPVRAPTMALSISVTNVFNYSEAERMWLSCDRPSTLPACSTPRST
                     LVNGRKVPPATAGASDKASLPPSASALKVSLYCRPLLVQLPSPSLHASLLCAAGDSAL
                     VRVTLAVLYYAPRVLVTSLLRALICSAVVFFVLTAGLVAMDAAWSQWPILSVYTAEVK
                     GNAAMMILSTREWLASLGIASE"
     gene            complement(<621518..>621898)
                     /locus_tag="LMJF_31_1395"
                     /db_xref="GeneID:5654070"
     mRNA            complement(<621518..>621898)
                     /locus_tag="LMJF_31_1395"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685073.1"
                     /db_xref="GeneID:5654070"
     CDS             complement(621518..621898)
                     /locus_tag="LMJF_31_1395"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685125.1"
                     /db_xref="GeneID:5654070"
                     /db_xref="InterPro:IPR005735"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6C3"
                     /translation="MPHSPQSTGQITCQQCHVTLAYPIGAPSVRCPMCAAVTPVQQFS
                     VTCVCCRCILILPQNTSLAMCPRCRTVMSIPASIREGHTGPQAPPKQCVYIDRPPTVN
                     SSGVKVTHLAVGTKLDDDNPPGKH"
     gene            complement(<625062..>628910)
                     /locus_tag="LMJF_31_1400"
                     /db_xref="GeneID:5654071"
     mRNA            complement(<625062..>628910)
                     /locus_tag="LMJF_31_1400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685074.1"
                     /db_xref="GeneID:5654071"
     CDS             complement(625062..628910)
                     /locus_tag="LMJF_31_1400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685126.1"
                     /db_xref="GeneID:5654071"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6C2"
                     /translation="MGALPSHETHERGLYSHRHGRNRRNEIILIPLTTSFFPSPDCPL
                     FQHLYNSRYRRTAKYYFRALRSAQTPRDSDYFCTTTAINEEEEFEKFYKEYLEKRELG
                     GEKASVTAATVTAVSPTASSPLLSGCSATGDSGADAGSTNGLAGTIPSAQSPQDCLNA
                     HGLPPRVDPMDFRSYSDTREGLYQILIRDNELGVLATDEELRQAYWKQLQEQQTGRQR
                     VYQQQQQGRHSASQAATGGAGAAGSMPPPPPLPPPLSLSPSALLSPSAGMNDAHAPHG
                     GPDASGAPPSASVAMDDLSFDEFVSGYMAAKRYMKGKPSHTSYSTTAAADVKGNPIMP
                     AMGAAGSAKVLNEYSARHYKHVTSPVAYHVRPLPCVIASRYDPGKPQPVNDPLYVQFG
                     DSYVRIMGMFGFFPSTIGMRRAAGSRGSEGGTGAGKPQRSFPRKEGNCNGSDDIDEEF
                     EIEQHLLKGTMFVDKDVGDQILGNMVMLATYMYARQCIEARIHPQAIPMLPVLIRFPL
                     SNIPMLQFVREFRVRLRSLLEAGTAKAGQKPVHTGMSGFNPEDLAEPHHPQLQRLEEE
                     GYLFEPDIPCATTPQQLFMSEEQASSTNAPLRRHVGMKTPSCGKYPIIMMSGFNVQST
                     PLRHPALNTTGYPPAMAAAAMIAAAHRHSAMSSPQSGSKSASPYAASGMGRAPTFPST
                     APPPPLPGQAGPASASNSITLPPPPPPPPAPGAPTSASTTTTPADEARKSALLHRRKQ
                     RFRIWVEDGHICIWASAAYARRAALIMAQQLNTTVDSNSVPEQRSWNYRGLLHANTTV
                     PPPRHVNDVIIVADDIPTMGLWQGDVLRCCTQAELQAMLKSKGAAPLPLPCAPEETES
                     KSGVITGTTERQAASLSVAAAATSPSVSTSTADSGIAAAGAGGHVNFTSNHASNPLLQ
                     EKDLAAPEAFWVRGSGGLDDSFTNITETNMPPHPKAEKQLMQAVMQRAKKAAATVAVA
                     QNSGKKRRLTNAEAAASAAAQLFIDIDRREGTMNIEEVVLAWIKVVAILTRDSTEEDR
                     AWVRDPQGNPVRIDRYVIRRYEHDGARFFIGVTPRFVGQQRRIEKVLGEVFALEEREG
                     HRWRLKNQGCGEEDEECEDGLRTSHDDDPSNEEEGHHRHSSVSHVSRHTESLSYAFGA
                     SAASSLKAPESCAGGMSSMFDDVWGALVIPMSHSPPSSTSCTPVAPLTVGPKRQPSLA
                     ASLNAALPRSDSGESVENSSRLAFTAVFGNTAPAAGKSSATTSLRARNAELMSAGFEV
                     DDLLERYASAPLFFGGEDDE"
     gene            complement(<638274..>645431)
                     /locus_tag="LMJF_31_1410"
                     /db_xref="GeneID:5654072"
     mRNA            complement(<638274..>645431)
                     /locus_tag="LMJF_31_1410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685075.1"
                     /db_xref="GeneID:5654072"
     CDS             complement(638274..645431)
                     /locus_tag="LMJF_31_1410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685127.1"
                     /db_xref="GeneID:5654072"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6C1"
                     /translation="MGLVPSRESLYETPAATLQPRALPFISRAAENYMYKTNRTGRVF
                     GSGMALGSAGDAPRPTALLNGVPTAELANKIMEADLNAVFIEDPAEATAAVAASRGSR
                     RGSAKSTEAQCRGRDAGTLALETPAAEALRQGRVPYVYYYEHRALPLTTEFFPSPDCV
                     LFRQLWHARKQQNPRYHFQLDHTWSPGALTDPTAVYESFTELATRNMTDIQAACLSAG
                     QPITKENLAQAQGQLQAAVRALNGGDVGMGHCATSSAGSQRTRVPFATRKEFYNLVVL
                     TTKESVIYDTNQELRAAVCGAATSGEAMRKRTGKAGREPAAEESSRAERDCQRLRPVP
                     CAVVLVRRCMPAHEYRYTYFVANNERHHKASSGAAGASSRRRGAANACGTGEAHQLQQ
                     RESHSTLVCGDSVRAAVEELQPVDQTPQGEVDDDELTVPWVQVRAPQAPLGLAELRVV
                     GMYGCWTVEEILRHTLFAPTVHTSSDPDVAADSIATQNSPAREAHVEAVLRRAAPHGV
                     PSSTLVNTAFFEKQVGDKEQCHTYFALCRLFAHGMRRCILGNTSDKAAVTSTGDHAAC
                     EQTSADDEVPDEPSQQTGEASTERQRADPAWQDFIGALSGGASATSAFGDLANCFLIR
                     FSNIPQLQLCRQIRRMLTELQGIYPAPPSLEGFQAAQRQRNMVAMSRKVGTSNGAGTG
                     AAQGGDQSAHRSPPLKCRNGDEDTTAPPRLQGESESSLMDSTGAQPSAVAKTDDKQQH
                     EGVTIAKRCGKLAVLPLSLDPEAIAEGPHQLCERDRLERDGFCCYASHGLVVFRLSRV
                     AVARALNQLSFAPLHDSVEALCVTLTAAAPPPLTYRGELRPPARLRTHTMAATAADVG
                     RSGEEVEDGDNKMRGGAVTSAEAHSPEALANMYNNAVRYSSCATGFSMEPLWPIKLDS
                     ASWATHATALEDTPDELIGVLPRNSIEQRRGRLLPLRGVVMSEGAAAAANGACNGGAA
                     HQGCSSGASAPSQPHQQRHSQSALSSTPACALFPVDVYTVSAELDGMPFRELVEMMHQ
                     EQQQRWQLTACGASQESTLRLMIESVDAQGNIEPDSVLNWSPMAALGSLRWKRALAAA
                     GCGYAGASGDRSNAAAEVAGMRSMSTLSANVPVSQGVVSIFVREPERILHTGDRIRFS
                     PHRGGSPNSGGRNSPMAASGSGTPHTRSRGGGNANSGTSQHGYWYVDDNLTTEDMILS
                     WMRRVGGRARETCGTDTKWVRFPEPVLQVLLRFAHTCRQQPGGEWLATGHALRPLHPA
                     DEELVEPDLLQNYPDILRTRRFRQWRFSHDGYVYFHGVTVRIPGSSPLPSHPPPAAVM
                     TAAAHHAAIHNCGEMTFGMCGRRSPGLAVVSSARAAFEPPQQQSVVPQQRSVMQYGAE
                     SQPSDVMPHSGSGEGGGGQYGAGAATGGPAYYADQAMYSIMGGSGSMPRKHYDPSMAS
                     QQLHPCLSALPRHQQFSQHVPQQYSTQQLSQKTQHVGGAFLHHTMQPQQPQQPQQYRG
                     PKAHYACTDHSSMVGGSEQEATPSGYYGNSSSSAAEGAGGARPSPPNTINGFHLNDAD
                     LLQSNAAATSSSINQQPEYQPRGYHSHHADGGSFSEGTSVGGTGFFVDYPDGTFYESS
                     DRAHSAATMVVPAQVTSSFYGGIYNPSVEQLPHTPQQQQQQQQQQRYRSQAHSPFNVC
                     EPASGHASGSRRVDNTLLAYGLPPNAAGIVPPGEEVPNPSMVAAGCGRDQEEATSSSS
                     EPFMMHVASGDQQHQQHSRQQPHSSMLPPPSAPAPPPPPQQPMNLSLHGEGDRAGHAA
                     ERRTTDDYPPRRSPTTILAATAVTVSAAKPTSQTLIIQTLRGAHPAVGHRAPPVASFA
                     PDVIDPLPLSPSGGNTRPVMTPKDRTAEGVDSGADIVSDCSTSSRPTRARVVPGCNPD
                     LSSTTQQTRVGAQQVYQQSQQQQQQPLQQGQAPPPRSPQLASGPGSFRDTITTDVIEA
                     DSITVRVMQRKPSMARQSSYNGATGGAVASGYRTGSGAFGNSSNIAGDGSAPDAFSPS
                     PMGYGAMGVSPSGGLESMRDEANSMHRKTGGVSANDSRTVPELRSYRLSQVRTSTTGH
                     QVASGRSAAASFAVPQLQRQSSMMGSSSPTQRTSQRISHNPYTTAGALCATPLATAAG
                     LSIHSQGGAGGCKAGSSGPYDSFADALDNRYGSASDFNASVSAFPLSLAHNAHGTTHG
                     TYYLRCAGDPTGFRSSPATSQRPSFYPSQRAAGDVDDSSRAGQQQEGRHESYASFYEG
                     AEGAPASTHYSDIYQNAAADGTTQGFFFSMGEYEETGNSAEELYGGSPDYQISQGHVR
                     PLEGKMNKSVGRGGSAYGGVPLPTRNMHHQQQQQRSVGGGNACNGGAYEDSTPTSALP
                     YSSQSQQQHAYSPTSAAFQRH"
     gene            complement(<651025..>654498)
                     /locus_tag="LMJF_31_1420"
                     /db_xref="GeneID:5654073"
     mRNA            complement(<651025..>654498)
                     /locus_tag="LMJF_31_1420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685076.1"
                     /db_xref="GeneID:5654073"
     CDS             complement(651025..654498)
                     /locus_tag="LMJF_31_1420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685128.1"
                     /db_xref="GeneID:5654073"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6C0"
                     /translation="MGISPSREAQDQYLDELCHRKKKAWRVDRRRKEVSLLPLTKKFM
                     HFIQPDSATSLDSRTPSNSGSRNFNTDTSSSHTPRSSRRDYCPAQLCLDAAPASLPFV
                     QQLYNAYREPGTQFYCRKESWGTLNALPRDLYYPTVESFYAATVSCYEEDMYETNEDM
                     QRAYDQQKLACQLRAFGSMHKGAAPTRRPKKSTPGPQIRPTPCAICFEYPTSSIAPPP
                     REGADTFSAANANRCGAPHGSVVFAPHCSFMVIGFVGLVPVRRQKTKASAESFLRPPA
                     EIAGDEGEGERTGTRDEPAEYELVAFISKSAGEQHLGRALFQAAFLYVDQCRRAGLPG
                     NPPLPSTRFSCFLMDVPSLCFLREVRLRCAELQWTRRLARALRRIRIAAHHLAIEMNN
                     VVASELCAFMAECFLKLNFHPSPTPPVFLFAGFVGDAGSAVAVDANASFPSAAIHAAP
                     LPSSASAEVQVLLQSTADSEGLPGHRGGSALGSGSCGGAKESTNGGTFGSAGPGAATV
                     KLACVVGTNQLTVGKVVYPHATVLERAVQVSTGAFVDADWAVAQDLSGQEMLATDFYD
                     PDPEDARDYSVCVRPLAEPGPRLTAVASDVILSWSKSLYVQARVADTSNSHWVNSYPL
                     DYYTAARLKVTPAPQTEDPAARQSSPSPLSPVAPAAPSRTQGGSDGRARTSPLTASNV
                     KALSRASPWGSNGGHVADGKDAADAGADPSAPPEAATRAFYLWEFEHQGRFYTIGLVP
                     NFARAVQRRQGNAADRDASNLRNKNSNRERHAPTAAWASAGGDVITSAVDPMSETDVS
                     SAVSQHNENSRSYSDRSSRSGETYHTAGSSHSTISNLHLASGRCTGRQRRMLLSLGTG
                     EAYENSIPVSSATPPVSGGCHSRAMPDTGSSIWNAAHVSIHGGSVGGEGMASKIFDAS
                     DGAVAALPMSSGGNGTLDCVGSAHESSGAFGSHPVCGDGVPPPGELQHLKRYVNTPYE
                     HSRQQFQPAQALQRRLSDGVSRGLPSKSVVRLFPQLQTGLDPDDNGIAGSSIPSLHGF
                     GPGGYSDGLVDYVGYEGSREAGIFPPEFAIKATAPTAGGRTLQLPPKQQQQPAGEQKG
                     DGRGVLGPSRALADSGKAGTQAALVTSNPGEFPMMPQPPVLRVAAHLQEAKDADGKTK
                     LRWDWRSLHER"
     gene            complement(<655514..>660937)
                     /gene="PRP1"
                     /locus_tag="LMJF_31_1430"
                     /db_xref="GeneID:5654074"
     mRNA            complement(<655514..>660937)
                     /gene="PRP1"
                     /locus_tag="LMJF_31_1430"
                     /product="pentamidine resistance protein 1"
                     /transcript_id="XM_001685077.1"
                     /db_xref="GeneID:5654074"
     CDS             complement(655514..660937)
                     /gene="PRP1"
                     /locus_tag="LMJF_31_1430"
                     /codon_start=1
                     /product="pentamidine resistance protein 1"
                     /protein_id="XP_001685129.1"
                     /db_xref="GeneID:5654074"
                     /db_xref="GOA:Q4Q6B9"
                     /db_xref="InterPro:IPR000938"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6B9"
                     /translation="MSSQRPEMSEGPASYSAHSFGEVNRRLWRLPTKSVPKGSGCDDA
                     VLDWAAVRELLEEAPEERSGVLSRYLLMWLNPYVTLAWRERLEEAYMPPPQRAHRAVC
                     CGALLSRAFRDEEVCGGRDAWRARVEAALPVLCGDCADRASECEVGGSDCHGRWGGAR
                     VAAVNELSRVGLRGEEGVHGRLRWVGYVRSSDAPQTLLCGVEWDADSALPLYRARVAG
                     DAAAEVVHDGCVHGERLFYQVQEGRARCTCEYVEDLVPVSAIPTADTGCQRTPHTPSL
                     LWALLRTFRSDLMAILPPSIAGMMCEVLTPWLLQQFVLFLQSNKDQEGVRKGLLFFLM
                     FAIVKFVQPAFVNKEMHRSRRVSSLFRTSTLALIFEKCLMISPDALSRPDMSTGRVLA
                     MASSDVENIKEFPTQVTFLWKAPTMLTFYVAYLFVLVGPSAVAAVLVFAASLPIQGGL
                     TNAIGGAQASLSSCTDQRLRRTNELLSGIRIVKMMGWDSKFVSAIEDSARADELRFRR
                     RLQMCQVGLWACVSSTPTFMIAAVLTTYTLSGHKLDASVVFPLIAVVSAITFPVMMLP
                     EAFTSLAKFIVSTGRVTQFLECDDSHIIVEHAERMFSSTGSGGAASRDAPLPSAASAD
                     LARVLVSVPAALPVYEPRHVGLRRVAQRMLCAVLRRRVPVELQWRRAAASPATGEGGR
                     KPVRAAVGHDDGGAAVAGGEDGRGSDGGVALYAMVDRTLLHDVRVSFPRAQLTVVVGA
                     TGSGKSALLATLLGAFRLEGHVDVARSVAYVPQQPWIMQETLEANITFFEGDRRRAAG
                     GVADDSDSGSAQAFSPLRCAEQAAGAAAVSRCFGCGCGTVRERLARAVRSCQLDADVA
                     LMARGLGTEIGECGINLSGGQKARVSLARAVYADRDVYLLDDPLSALDVHVGRRVMDE
                     VVLRALAGKTRVLATHQLQVLPHADQVVVMREGCAVFAGSYAAYAASEWKTYVESDEA
                     AAASKKSGCGGGDAVAECTEVSSAWSSAVSVESCGGTREECDFVRCSRADVRVRKGDG
                     EWEENNGRTLSRMHWQGSRASENSEAEECNDGDSTVCKSVGLARSKAAPRTAKGSSGL
                     ATDEDAADGGDLMIAEEKETGHTPWSVYRAYVEAGGGVPVAIQVVLRYFFSEVLSTGS
                     SVWLTLWSVNYFGSLSTNEQLGVYLGLVFAVAVTVSANDLFIFQFARRAACRLHAMLL
                     YTVSSATLAFFDRTPLGRIVNRLSRDVHVLDDELPANVIPFLGIAGYVMTSLAVTLYT
                     SPLSVVVVLLAAYAFVRLLRFYATVVREVRRRSSVGQSPLLSLLEEVLHGRATIAAYD
                     KSHVLFAEALLRLDLVYSCTYVEKVVTLWLAIRIESIAALVIIAVGLIGVVEKLVEAS
                     PAMPEARVGLISLSLTMCLDLSWSLSALLDLAAVVEASMNSVQRVCHYIDCVPQEAVL
                     LEPRDAYVARALAATGGSGRGGGGSTRSASDIVVVAGGGDDEAAPAWQGVAARSGAGG
                     AFGALVLEHVDLRYRPGLPLVLRDVCFAIAPGQKVGVVGRTGSGKSTLMLAFLRLVEV
                     SGGRMLVCGRDARTYTLPALRRLFSMIPQDPVLFDGTIRSNVDPFGDATDEEVRAALV
                     SVGFVGVGGSSATFPTAAGLPSAASASMFALDTVVQGGGSNFSVGQRQLLCLARALLK
                     KGSAFILMDEATANVDAQLDQTVQRIVAEQFGAYTVVTIAHRLYTVAAYDVVLVMARG
                     RVVEMGQPRALLERRDSVFYGMVAQSAAVAGSREGLSREDAEGAASGARSRGVSDGGA
                     ELSAAGREHGVEAAVASLMRQCK"
     gene            complement(<667597..>669191)
                     /locus_tag="LMJF_31_1440"
                     /db_xref="GeneID:5654075"
     mRNA            complement(join(<667597..668805,668808..>669191))
                     /locus_tag="LMJF_31_1440"
                     /product="hypothetical protein"
                     /artificial_location="low-quality sequence region"
                     /transcript_id="XM_001685078.2"
                     /db_xref="GeneID:5654075"
     CDS             complement(join(667597..668805,668808..669191))
                     /locus_tag="LMJF_31_1440"
                     /artificial_location="low-quality sequence region"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685130.2"
                     /db_xref="GeneID:5654075"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR009030"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6B8"
                     /translation="MAQSHRRVVLIAVLAAAVLLLTLAAPVARARVASPWDAVEDDGL
                     TEREYDAADTPFFISEAERSNTLKVMQAFAAAMPSLGWSGTDFCKWAGVRCFDTNVSF
                     IATRSLAIGTLPEMPDDVDYSMVKLDDQPLDQNTGITGTLPSSWGKLHKVRTLNLGYT
                     SISSTLPASWSSMSSLRFLTLSSTDLFGTLPAAWSSMPAIEQIVISRTQITGTLPEEW
                     SAMRSVRRIHFQQCNLYGSFPASWARMPSLERLGLQRNNFCGCVPDSWLASPTLWVGV
                     DAKHRMADCATAHACVETTTPEPVPSNSGSTGDASGPSGSSTATTAEPTPSSSGSTGG
                     ASGPSSSSTATTAEPTPSSSGSTGDASGPSSSSTATTAEPTPSSSGSTGDASGPSGSS
                     TATTAEPTPSSSGSTGGASGPSSSSTATTAEPTPSSSGSTGGASGPSGSSTATTAEPT
                     PSTTTTTSPTPCPTPCRVPNCMTCAPGNAMRCSVCFPGYVVTAGGRCMRRAGEDAAVF
                     PVGTAAVAAVCATVVVMGAVLA"
     gene            complement(<674790..>676172)
                     /locus_tag="LMJF_31_1445"
                     /db_xref="GeneID:12981437"
     mRNA            complement(<674790..>676172)
                     /locus_tag="LMJF_31_1445"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722326.1"
                     /db_xref="GeneID:12981437"
     CDS             complement(674790..676172)
                     /locus_tag="LMJF_31_1445"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722374.1"
                     /db_xref="GeneID:12981437"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="UniProtKB/TrEMBL:E9AEF4"
                     /translation="MLRCLTCAFLTAALGVFFVQLGSDAAMAHAAEDTPLSLQIEKAR
                     FSDAEPRYSFTSVQKLNTLKVLQAFAGAMPSLGWTGTDFCKWASVTCYQSTVLFTVSG
                     TSVKGTLPDLPDAVDYSHVMITAINLFDQKSSISGTLPSSWGKLQHLVTLNMGSTSVS
                     GTLPASWGSLRAVTFISLPKTSISGSLPASWRSMSSLATLILYDTQLSGALPPAWSSM
                     ASMGILQLHQNRFTGSLPASWAQMPELRRLSLIANNFCGCVPDSWRRASFRVTVDPQN
                     YAANCATANSCDPTTTTTEAPTTTTTEAPTTTTTEAPTTTTTEAPTTTTTEAPTTTTT
                     EAPTTTTTEAPTTTTTEAPTTTTTEAPTTTTTEAPTTTTTEAPTTTTTEAPTTTTTEA
                     PSECEVPHCITCVRGNPTRCDVCASGYMVTAAQWCMKRPSADLASSPSMTAFNAAASL
                     GVLAAVLLSM"
     gene            complement(<682048..>682956)
                     /locus_tag="LMJF_31_1450"
                     /db_xref="GeneID:5654076"
     mRNA            complement(<682048..>682956)
                     /locus_tag="LMJF_31_1450"
                     /product="surface membrane protein gp46-like protein"
                     /transcript_id="XM_001685079.1"
                     /db_xref="GeneID:5654076"
     CDS             complement(682048..682956)
                     /locus_tag="LMJF_31_1450"
                     /codon_start=1
                     /product="surface membrane protein gp46-like protein"
                     /protein_id="XP_001685131.1"
                     /db_xref="GeneID:5654076"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6B7"
                     /translation="MMPMLLLRGAMQRPRAALLAVALTLCLLLAPVRGADSPFTQYKA
                     VQKANTRKFLQAFVDANPLLEKLPSVDFCEWVYSECTSKGVNLYLDERAMVRLPEMSS
                     DTVGKYVLVTSINLSYGKGTLKGTLPASWGSLTHVEYISLYSNSLTGTLPPEWAKMKS
                     AKWFLLYRNELTGTIPEAWSSLRYMTWACLNDNNLTGTLPSSWGSAPQLTIIEARGNR
                     LTGTLPPTWGSLRKVSSITLTDNNLTGPLPEEWASAQPLYGVSVERNNLCGCVPNAWV
                     SHTFLYGIRVDDSLLAADCSTANACK"
     gene            complement(<686914..>687825)
                     /locus_tag="LMJF_31_1460"
                     /db_xref="GeneID:5654077"
     mRNA            complement(<686914..>687825)
                     /locus_tag="LMJF_31_1460"
                     /product="surface membrane protein gp46-like protein"
                     /transcript_id="XM_001685080.1"
                     /db_xref="GeneID:5654077"
     CDS             complement(686914..687825)
                     /locus_tag="LMJF_31_1460"
                     /codon_start=1
                     /product="surface membrane protein gp46-like protein"
                     /protein_id="XP_001685132.1"
                     /db_xref="GeneID:5654077"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6B6"
                     /translation="MMPMLLLRGAMQRPRAALLAVALTLCLLLAPVRGADSPFTQYKA
                     VQKANTRKFLQAFVDANPLLEKLPSVDFCEWVYSECTSKGVNLYLDERAMVRLPEMSS
                     DTVGKYVLVTSINLSYGKGTLKGTLPASWGSLTHVEYISLYSNSLTGTLPPEWAKMKS
                     AKWFLLYRNELTGTIPEAWSSLRYMTWACLNDNNLTGTLPSSWGSAPQLTIIEARGNR
                     LTGTLPPTWGSLRKVSSITLTDNNLTGPLPEEWASAQTLYGVSVERNNLCGCVPNAWV
                     SHTFLYGIRVDDSLLAADCSTANACTS"
     gene            complement(<689004..>692129)
                     /locus_tag="LMJF_31_1470"
                     /db_xref="GeneID:5654078"
     mRNA            complement(<689004..>692129)
                     /locus_tag="LMJF_31_1470"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685081.1"
                     /db_xref="GeneID:5654078"
     CDS             complement(689004..692129)
                     /locus_tag="LMJF_31_1470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685133.1"
                     /db_xref="GeneID:5654078"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6B5"
                     /translation="MLGGPTRCLHVLWGQSLASYVPPHSPSGLVRGYLLRRYPVSGAV
                     TASSPAQRSDAEVEAHVTAAQWLPARTPAEVVLNANEFSTFHAVPTASPEDVRWCTRY
                     LLATSSTSAASVGMENLKLQERNLTTAAAMGDLRDTASSSYETPSGRADTASPFFSSI
                     ITSLNALRHVLGEHRCLLAGSEALQTGVPISCILAEHEEARMYLTWSLDSHQSGPWAQ
                     GMLPKPSNPARDDEHDGSAGAAAGSKEAPAPLTDGCVFAMEGASGGAESAATPHQRLD
                     PRERARRERLTRLRQRFQSEVAHLHSHRPGGGFAEAVQGPMPISAEGAQGKPFLPMAE
                     PWVPLLTVATSAGSGLAAAIKAAAVAWACCACGVRGSSASSLRCCVYAMDILWRPAPA
                     TALVATWWAALLHQHEHQSSNSTANSAENAHSSSSDAAARHSLQRRLPTLTGPASERS
                     EGRHSASGRRVEASRAASASSLSPCTHNFHVLITGGDTADHFLLPLMAGVDDSIIRTR
                     TKKADPSEHIDVTAQNGGLSGGNLAKPRGGDAACASSSVPSVHRPRPETLAMVLCYAC
                     PAAQVAHLHAIRHSYLAQQDMTDTSATTESRGALTGQGDANVASHAESTAVTAGQGGS
                     LPSMRQADCATTGVVELCTETPAVSMVTALPHAASAATPSSVGASSPLSLSYHLRGSG
                     PSLSPSSGAQPVLSSATAAAQPMTLKDVAACVFESSLLERPLRYADLRHRCQGACVGA
                     SRESLREPHAVFAPAALHGGASLQQGWCSLCFAPQTYAPALLSTLAESHFGQPLRPGH
                     SFDALCRRGPAPSPPHVQMAQEVLRCATRGGCVHRQSPEGGYQMRKHADACSPPLRAP
                     ASTASTLPRTCANDGSVKCGVLREVQWKHVCGGFPLPLTAVRGRSSPYFVPCLLFTDL
                     AEVASTIFTKGHEGRLFHAGIGTMRPSWPAVSACPDGPDGLPREALSAGLGASPQATL
                     QYSAAEESRQTQAQVACAVAAVEDSVFELGRTHDTEMLGYRGVVAGNYLFMCCYPDAW
                     QDAVNDALMRR"
     gene            complement(<694460..>699352)
                     /locus_tag="LMJF_31_1480"
                     /db_xref="GeneID:5654079"
     mRNA            complement(<694460..>699352)
                     /locus_tag="LMJF_31_1480"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685082.1"
                     /db_xref="GeneID:5654079"
     CDS             complement(694460..699352)
                     /locus_tag="LMJF_31_1480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685134.1"
                     /db_xref="GeneID:5654079"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6B4"
                     /translation="MQQRLQQYQEEQYLQLSLNSLGVLTSYWPSRAPLGFAAAHPRCR
                     IAAEARLLGTHIHDDAEGEYEAAWTNWARQVPFGDWWVSDLAERIMPSERRFASEVQF
                     MDAAGDIVDDALWYSDHAPNTLTVAANATSRGGERRCAARPHPPGTAGASSWRYTLPQ
                     RCARTYFEHKQQRGVTAAAAIATGAVHSGLDSEDSLRDVSSLPEYPYTGTNVRCAAMR
                     AGYLGGVLVGHLVSFLVRSTAADAGQYIRSPSLTVSLLSTGLAAQEHAQLQWRRVLHW
                     EVGEEREEERRRKHAAAPVCSNACEDAAPRSQNGDYPGGSWTYSHWWLSRPLVLGRAC
                     VPPSPSPCSRFAHEDIRGHVEDDGVHQVPHDPTCAAAAAPPSTSLYAYGDHPASLPLR
                     MTEGCNACASYSTRGWKTTRTTAQLPEEVTRRMDMLVPSPARCGQQPRRCCSSFLSAV
                     HLYECRAPPALPSPSLSATSDNPAHWWSAFLRCPCCAHLRILDVNFEGARAKKLEGWA
                     MAAASVDSAGPAAGRDSPPSASPQLKTLDLQASSDGSTPSDARSRRFLLEGRQLQLQT
                     ITNGADCASSARPHPWVPVLRYVTEVHLTSSATLHDVGFLGDLPALRLADVSFNVSLT
                     DAGVQGLYRSTSLRVIDVSYCPQVDAAAAELVRCLVELEELYLSGTGLTDATLRTVAA
                     HLRSSGSTPHDALLVTGTGAPAPGQTPHSARPDGGRRLRVLHACACRRVRNPYKALAS
                     IAVMQRNQRRQWRGGGVAHGQSCWAGLQELRLSAVAMGELHYESDQSRSGSSSTSGTE
                     SEGRGSEVGAATERVADAAGEGAGLLLSSLLERGHEAALPPTPARSLPAVSSSSLPSR
                     GTAAPVEKAGAAAKVTAAADVPGVLTTPPSLLWQRLTTLVFTDTKFRCALGDVGRLPS
                     LQRLSLWRCAVEEGERLGAGEGAHRPWLSGLEQSALLHTVRLDGCSASAIRDAGSLQI
                     LARLPSLQNVSLSHTDIRDADLDAFVAALCESGATAPQHQFHRLCLRSCGRITNAGAV
                     ALLSSVRSLDLSDTAVRQEVLDALGSSFAAQRHGGLHALQALNFSACSLILDLSPVAH
                     LRHLRWLNVSHTPLSTAAVAALRFCAALTHLTLKNCAGVHHVRDVMAIATLEVLNVQG
                     SGLYDSDDEDEEEGGEAIPGAGRATEHSRRRSFMPGTPPNNFSDPLAHRDDSHALEEG
                     SRSRSAVVDVFPGDDEVLFTSSLHTLLLSHTRVRRIRRLGLLPSLMCLDLNNTAVTDA
                     ELVKFVCTGVMAADKRASDAMSPRARNPPVVVHSLRARRLDECASRGCRGPPLRLLSL
                     QFCRRIFSVGVLGLCPHLIKLDVSSSNVTSQGLIGLHRSTSLVQMRLLSCKGVHDMRA
                     LHAIPSLAEVDGSGCNVHSGRITGADVRGGSGARAAAGAVADGGRRGAEAKESGGRLS
                     LLPLFAHGGNVPHMAAPLLHSDLLQESGSAAEDIAAVRRATEGTSFLTIALLQASTSL
                     SCALGLARGCQRLVLDGCVNICSLVELSMLSSLLELSLCHCHGITAASVAELISLSQW
                     CPRASGTDSAQSVVVSSVLPLSAPFASLRTLRLSSCQNLTGSLAGLELLPQLRCVYVD
                     RCGITSVYEVVPALQSRVVL"
     gene            complement(<700388..>705130)
                     /locus_tag="LMJF_31_1490"
                     /db_xref="GeneID:5654080"
     mRNA            complement(<700388..>705130)
                     /locus_tag="LMJF_31_1490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685083.1"
                     /db_xref="GeneID:5654080"
     CDS             complement(700388..705130)
                     /locus_tag="LMJF_31_1490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685135.1"
                     /db_xref="GeneID:5654080"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6B3"
                     /translation="MSVLARGEGTHQRCHYCHPFLPLFSISIPLLLFFVVLPLPPSPS
                     RTCCSMRWSCACLCVCVYAYYTLHLPRSRAPQLAPRTLCPCWRHARARLPLRASVCAR
                     CHPPLFPSRILPCIALQLFNNAMSAHGPSVDAPLPMVADIVERHVDFISSTAAASSPA
                     LVGPPLRPIQAITGQAFPVVRTRHSYGRQRTIGGEATTHLSALQPSRASLPSASAAAR
                     TTGFSAHVQPRDAITASADVYEAGGEFSSFPGTCTRMHGGGAELVLAAGGSAQQRLPA
                     HQWSVLEFEQLRSGYYVRPVDVSYSKAGGTGKEEAATTCLTSPTSLPSSCVHGEAFFS
                     LLFQCLRSTVRKHQQLALEVLLAHLHGLAMTTRASKSARRTEAVALRDRCLHGPNCAP
                     FIFFLLEILVSAGHPAMIELAATCLLLLSRGMTRGEPAGSTGSTEAPASVEDALGGCS
                     AVLHFVEAVAELGSPAGGAPEDTEESRSDGRSVDVEGRGAEKPADNPDLPFSEVSELL
                     RGPDARLGLEQLGFTNKVLGAMHPLLRNASPASIVPRGDGEETGREGVESEAHRGCVE
                     PNATLSTFPLSSLASIHAEVLFLELLLCGGVGVGLRAACRRVAEDPAFLTWTEAQLSA
                     VVMGHRRLEDIAELLCVLQHLSRVPSALHGFLCGSSVANSNLTGTLDRGGVAAAVAHQ
                     HARHRFYETWLLFFTLVCSTSAAEVRTVRHASAILWSMLILRACARLGHRKSGTSNNG
                     ETGEDNAGHSKLAASHRGYGMVQDVSDTLLAEGMHVGGGVVMEMWFLQYVSEDGTASA
                     AGGGTGSLDHYFLDAARMALHLCRSPASSGSHVTPTDISSGDSHDAVSLEVTVAQRVL
                     AEMRWTASAHFLSTYIARTHHRSAAVCHALCSTEDETHEAVQLLLCSVVMDAGRLTRA
                     FARFTSPLLSTPWSGSADGPRKADADGEHPHTTRGDPAAIPVGAPTHHLKTVSAQVSV
                     VSAIRAVEHCWWREPSGNTESNARAVETDSAARDRALLFLCLEAASLYANTRLAAALA
                     EVYPAIAVDMVLGYAEILAHAFEEAFLRMRDGTAVRLQVDELCTMAEAVQLLQHLGNS
                     GSSVEAAVPRSIVSTAGALPSNSPAARDARGARIAAFFLVHSIAVSKRCLDAVPLSLP
                     LLLLRPQVEAKTKPERADAAALVPAATSTAELVALMNSLQSGIELTPVPVMPASGDDA
                     TDTSASLSSAAAVSVSGAPRCWALYPLFDASFTAKDVWASWLRRILGLHQRVKDVLGW
                     DGVLSHVLLWTLAHRRELWGTAGGATCDGAEAGVRASALSPSSAAALCELMVDLCAIL
                     HELSARSCDLRCSADSRTAASAAAASRTLEVSLAAYSDVPAEEGMPLLLHAVLAYVAA
                     HSSARAALAALQVLLGSPVLPPSSTVAAGVEARGEPGDEQQPSCSPAQPSPSSHGTSA
                     TAQVCAWLQSWAAAQGRRMQSARSVCWSLDDVVALVQLVGPRFRNDDFSGRSCAYEEG
                     ATDGYRTVDTAAAEAMLTPTDADARLAVRDSMWCARCLTEGLLRYYVQQRIATSGGLS
                     MMERTVLRSTLQDLDWYPSTLWPQVEGG"
     gene            complement(<711309..>714755)
                     /locus_tag="LMJF_31_1500"
                     /db_xref="GeneID:5654081"
     mRNA            complement(<711309..>714755)
                     /locus_tag="LMJF_31_1500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685084.1"
                     /db_xref="GeneID:5654081"
     CDS             complement(711309..714755)
                     /locus_tag="LMJF_31_1500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685136.1"
                     /db_xref="GeneID:5654081"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6B2"
                     /translation="MGVAPSRETIRRGFFNVSQANSSAAGSGSGSGGGSSKRQDIILI
                     PLTKEYFPSPDCPLFVQFHKARCDAAVNYYFRRPGNPGDLSRIPNYASSYRLPGEETR
                     AQRRRRRQQEREARTAAAAAESATESGADANLHAAGLMPERGHSSSEGDDDDNEDDSY
                     PSREALYRGVIEHVEEMLFDTDAEMRQAYEWALAHPHTTMGLDGKKQRKVLPVLCAVA
                     FRSDISKVLNLHNAIPGGAAARTATPVSSASPQSPSYTGSGAFTAMNNMQAALENGVY
                     MFGSIINIVGCFGFASMQEDVEDAQRVSTQASAMANQATSLLTPGSRQSPSMTAGGTY
                     HNDPYSFTSSQASSGGMKATSPRTSSGTLLRTRGAGIKGGSYLARIGTSEDVMTLPPP
                     VAAPLAAMVFLTKSAGEQNLGRVTYIAASTYYYQMIQAGLIERQPSVRMEGPVAYQSP
                     AAASAPSLPPYDSGANSAAPVPAADAPPPMYGAAAGGGSSASPGTLPTLSAVAQGAPR
                     PFLPPMETFSFSSLLTNIPILSFLYEMKWRWGYLGVLKGGTPTAGVSRNSSFSGPLSG
                     HHMDGMTARGPGTMMGNHSTGGLSAVDRSVGQGVTDEMEMWITADQMIHGRISKDLAQ
                     RLCWSLAERPEVMQERVTQLPSEESGYWRYRGLVDQAHPPPVPEPGRVVTIHPKDVYV
                     MGSDVLPGFNEGDILRFDPGRLVWFADHSIPLEGVVLAAMRPYCKQAREADSDDPAWV
                     TRVCDRDELEVLHSGDGDVCYPPPRASAEELAVLESCPNMVHIHEHIGNFYVYRFERD
                     GTTYYHGTVPNFANPNKKKQAASGGSLGASMSGPQSSANPPSSAATVATAPYAAPMAR
                     PPPILSASTTTANASKPASVPVPKTIASALFSLLPASRATAQKDSTATSDASGSAVAR
                     SGAGEHGGQGSSQTGAGNTSAAPTAAYLATPVVSSASSEAMRTARRWVQAIYSYAYGV
                     QNVQATRRGSSAANLAGAAAGPSRPRVLGGVPPPGAAGMNLSGGSYPSTPVHGSRGMT
                     PTSIGASAGFPNVVAVDVAVWPPQRRMPAVTTPLLCPVTSTSPCATPSTPTLLAGNGP
                     AVAWHSRSSSRTQMPQTGAPAAKEVSPAAPLGGITGTAGTSASKPTKRYVEGGSYEWD
                     WR"
     gene            complement(<717486..>722582)
                     /locus_tag="LMJF_31_1510"
                     /db_xref="GeneID:5654082"
     mRNA            complement(<717486..>722582)
                     /locus_tag="LMJF_31_1510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685085.1"
                     /db_xref="GeneID:5654082"
     CDS             complement(717486..722582)
                     /locus_tag="LMJF_31_1510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685137.1"
                     /db_xref="GeneID:5654082"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6B1"
                     /translation="MGAVPSRETVEHWLSQPPFYGQRQQIVLVPLLKKFFPSPDCSLF
                     VQLYEARCDPAVRYYYYANDGINKVQSTPTSPVSPMVYAAHEGVDNVASPTYLAEVIG
                     NAPVYCPPADVFPSVNLTREAMYDAYITNGGEKMVYETDEEMLRAYRADATSVRPLPC
                     VVAFLYRRPASAASPTTSAATGDAGFEGSLEGASIDGTAAVDAHSVPKGCTEVLGCYV
                     KATGFVGDVRGLGASCPRKMLDCEMQMFLTKSAGDHHRSHVLLTAIYTYAEQWQRACL
                     HCVPCDITAKELAPAVTKGGDTADKDLGDVFFYYKPFSQSHYMLAEASRIAGHNRTTK
                     LEAAERNGNRSGTLAMDEKARFWAPPPLPSLVMRSRRANVPLLCFLREMRTCARSFFL
                     FHFKHSLEHQDLLKLGCGERVGGADGGQDRQTENNHLTTPLDHGAGANCFLGMPPLGS
                     VQMWLQGATRASASLAEFGDEGSSTDTESMLNFHVMAPYVRAFSEFIVACLLHNINPL
                     EASRLSSAPDDSAIAAASAGDDTKDATTTGEAPTTDAMGGSPFFFTSPTDAAMMAANP
                     TFPRSFSSIRLRDEDMLVQPWPPSSSGGETGDEAFATTAAATAAASPSSAGLLSVWRS
                     RLTDHHLFWSVGPSIANRRTATAALLHWYKTEQAPVVWGCNLDEKNCKMVADGKESAT
                     ASCNVTAEAFPSSSLRSYMSTVTVNGQKEELLRCNTVLSLMRLEAGMPAEARVLRVCR
                     IPLEELLLGELRNSSKLAREAGPEDPHWVRQTESPSGDGGATKYAGCVLHASNPAEGE
                     SRTVIASKGVELPVVPPEADGIIGDGTSCLWRVSLIERMCRIIAVTPQFLKPIRKKHP
                     KKKLQPKTAIVHGTASNVFLLVASPSPTAASPTSVSPTTTGPAQKGAVEPKENETTPA
                     RASVVTSPDRQGAVALEEARPGGTVTVPDPLAPDAATATAATTAYASAAATTKTKKKT
                     QRMADVAAAPSFAFTPTATESRTEDKAAPPAAVRATNAAVATDTAAVAAQLHSTEGAK
                     TTPAENSKRAGAAMKGSSQTLTHTHAVVEEKQSKPSASLTPIVSAATKAKTTKSTARA
                     PGASAAAEKANEVQARNAASRSGAAGAAETFATKTPTAKHATIPTAERQNKMSSPPRP
                     LQPPVPAGEYDSNSRSNKAAPGDKHPGSSTASSFGGASATACAPPHPPGDIYYPVPPL
                     CEAKTLQQLLRDPYEQHGYGYQVPPPPLPFADPHSISNAIPSCVGYYCSSDGYQPHVG
                     YGGGFVSSNSHAAAYYNTDMRGGAPVAADVGKHMGDGGYGDSPYVYAAQPQQLQALLP
                     PDQPRRHTGTTEGIRGECLFSPVGPYSLPAKEEGNSCEAVPTVGPGSQQRAASSLRHH
                     VSFEEGVSLSKEAVTDKAALSSPRWGATLLRPGALCSGSPTTMSLASPNAHWPSHHHT
                     AAMPPPVLLQGCDIGSPMSHDFEHQHNASMSGTGSHLDFQLHELNSLVTTDSSIAMVN
                     GHHCHHTRHASSPYQTSTTIMEDAGVPCGQGCGSVGGSVNVTVRVRHHHGCTHSHVAS
                     YFSDATLDSASTHHHHHDMVHHMNCSTSVVSGGGGGAGAGAASLNGTQASHSCASLEH
                     SSSAFRRLSGAGCGFPLERTIATESDHHRHASSPRQHYEHQRHHHVPGARASSTRSGD
                     TASAARMTDKRTGTYRWDWRTASLDMGYED"
     gene            complement(<733545..>736400)
                     /locus_tag="LMJF_31_1520"
                     /db_xref="GeneID:5654083"
     mRNA            complement(<733545..>736400)
                     /locus_tag="LMJF_31_1520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685086.1"
                     /db_xref="GeneID:5654083"
     CDS             complement(733545..736400)
                     /locus_tag="LMJF_31_1520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685138.1"
                     /db_xref="GeneID:5654083"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6B0"
                     /translation="MGTAPSAEIVPDAPFRVPQSGVRQVALIPIVEQYFPTPDCPLFR
                     QLYEAYTDPSVRYYMRPNFDGKSGDLSCIPPIENSREDMHRLLLRHTAQGMFPTNAAV
                     REVYEVGDFYRIRPMLCAVVFLYEGTSYVPEGSVQLPSPSRSGASAFAKVIGIIGDTC
                     ALVKKPDDPLIPFRRDDVLKIRTLIMKSAGDHNMSRVVLLAAYIYYHQCCRIIGLPNV
                     PALSASFTCFKTNIPFLCFLREMRDRMANVLEAPKRSKFYIDEYCLHGAVSREYVAKM
                     MPAVACYYISFLKAKSEQRVLKQLSHQQSIVTGCAGKDRAGLTGKALMNRAETHVGSV
                     YTDVFNDHASLAVKAAALEGALKSGGSTPPKITYVVKGYVTRAVTSISNWSHAANEVY
                     VVCVDSTVTVVDRASVEALDGPTHTPSLAHQPDLNEDAEAADSTTSAVVETLQVHRGD
                     ILSFYVPPSICSTGASPSLSVTTAHDISKDEDIFYGTSNLEALKFCSNNTSLLSSSSS
                     EAPSRCGSAGFALDAAKGASDEDSTSAEATPSSGATGLDGDAASFEAKKGSWRVDDNI
                     FIESVLLSLVRDECKLAREATEQDPGWVYDDANKSCVHDGSFYVWHFRRGHEDFYYGT
                     VPKFANPNRQSNRKNGGCSSGNAAQGKVDRGGVGGAGASRDPNSGVRSIGARGKNGDT
                     SPILPPTPADALPPSVPPVRRQNILSQPPQSSKLPQKGVLLSRPLSAASPDIQQAYLA
                     SIAAGVSLPQPPAYDASTQSAVQAAPMPFAGSIGQGHLKNSMYATYPAEAAAMAPAGA
                     PVMYTFMPVIQGQSEMSPAPQQQLHTLPPQGMYSHEVPPLPPSPPQQQEVWGVAGAGN
                     VQGTAAASQSVGTCAVNALGQLVAVGGLMGSGVAPAQQVSYTPSVAAAAPQSYPSYVM
                     VNGQLCILQSTVATATAAAPSPMLSYQQHAHMMAFSQ"
     gene            complement(<742883..>749722)
                     /locus_tag="LMJF_31_1530"
                     /db_xref="GeneID:5654084"
     mRNA            complement(<742883..>749722)
                     /locus_tag="LMJF_31_1530"
                     /product="putative protein kinase"
                     /transcript_id="XM_001685087.1"
                     /db_xref="GeneID:5654084"
     CDS             complement(742883..749722)
                     /locus_tag="LMJF_31_1530"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001685139.1"
                     /db_xref="GeneID:5654084"
                     /db_xref="GOA:Q4Q6A9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6A9"
                     /translation="MLRSGALCKALSSPVSHTEASATVSSRGSAADHSIPVGVPVFID
                     AFEELTTAKPSPHRESHISSSKSPNELERCRRFYHGTQPCEQVLSAPPVRETVIGEEE
                     DLSLLHAQCVCSSDVQLGTTQAACAWRPASPEFTDLVPFLTSQSPLESLCSSESASAA
                     PLSLNATRRASPRDAPTATAAAPTTSGDPLKMTMATAPSLTVHTDSNTGRAQHSRTSS
                     LLYYSPYIHYDGNSESLETDAALHRSHAAISSAISCFHASSLVTPRALPSYPLSSSAR
                     KSMALTKLPAESPRGEGSRSSSPTGTCGGAACIISDALTLTPEKPDHLLRALASEEGA
                     YVPPLSTSTTTQCTIPPITAPQTGKQNVNTRSGFVPSVPSIRFPVAYSIPVSDSERSL
                     ASIPALGYGPRSTPNACSLTSARSGRSARSARHSNRCTSTLRNGVPTLKELFPTLPDD
                     LYLTRDRLCISHGSKRRLGSGAYGIVQQAELYPPGVEAPRIFTPTSESAASTSIPSTP
                     CFSPANGRVSIHSFSSIAAAVGNHQNVAGVSNGGYYGAEQTGRPGATAMVAKTSGNIH
                     FRTMSTLSSDSVTASALPVHQQPYNEQTASFYNGVDDMVRWSSAVESVKDLPWGHALN
                     LNDDAMPNMTTAQATVLSPTSGSHETPVFDAVSTASSEDQDSASHSPFAERSLHCKTT
                     AATPMDFNCETQNDLQLPAVLGLRLGHNPDLRVSPRTSLLVSSGHLSSRDCGAATAVD
                     DADKSTVRTGICEEGRDCLASVIEPVRPSRGEGEAVDGETEPGAQHSMTSRTGRGAFS
                     LPHSPVGGGRAYRSSSKRVWRRVACERGDGSEGSGLRTYPFFTSPITREGSMDTSSAA
                     VVEGKPTSCCEMVVSTATVGAYLHRFLSRTADIVSSEFVDHVDAANNRTREAAVVGAD
                     ASDKARAEGYGCLPSALPRAFEEGEEWREDESAEETSATPERRGPEARQQRTQESLEM
                     SRSSFLVSISYTEHELTCNDAGDETLMLTAQPVIEGAIREPQEEHQHTMDQTPEGTEK
                     TPGAGLRLRGKEHDISSAGSEAQSETRSYGEAATTTSTDVVLAAAAGEAERIVQRFAH
                     RSTSASAPASTAAAQGATAVVFAPRTHVRGGVGANGILGGNLTSSSTSNLWTPSCTAP
                     TGASAAASAMSATSTTRPGNLGGALVSGGTTNTLQSSFDFPRTPAVHHDMNPSMVSDA
                     LSSGAVPFRSVATKVIEKVDLARNAMKLNALHNELRMASRLRHPCLVNIFGVAEDAKH
                     FYIVMDLAEKGNLAQYQQRFGVRATCEMAPRFTADVVLALEYLRDGSQHSYWVTPPPE
                     STDDSLLQDHRHCTPRTLRMRGTASAASATEPRGLPGSTSTHSLRQATESASVATASK
                     RLSLSAPITPPLPSQHTGATDVTDSVGADMCSSASAVGLVPRESMSEPSESPSRTSPT
                     AFGLEPPVPAHTATLPRQQDDNGRSLEQHDSIIVHRDLKPENLLLTWDFHVKLADFGD
                     ACFYGDSEANNFGGTPSYISPEVFARCKASPYSDLWALGCVLYELLVGERLFSGSLVE
                     VGTAVQKFKPEALIFPDTLTSTTADSSAAKERGARERGSGAGAGIAEAAKDLVRQLLQ
                     PVPEERLGSAERGGFDALKAHPFFADIRWDKVLQATTTTTNDTNYAAELAEYLEPTEA
                     VVYCSPVKLLPTLEGSSSKEHLSIKSGSTNSRSTQIALLMVLTDAPRLLLVNLDLNMV
                     QFEIPWSTELRVGVLRTERFTITVPVSDVLRSPSTPVPGSPLPPATTAETTPMRSNSN
                     FSAATANTITYTFSDCNGRADLWGVKIHHLQSMCSAKLESGSATGRSLPRLYSIPVLP
                     TAGGAFHLPRPSASYQQLQHQRRRDTPTLSPRAGSRFLQWPRTTPRTMRAGSLSSLTI
                     SSNEHSIGAPRDVRATAATGTCAALSSDACSGTLSARIAPATRARATSFSHRTSVSQS
                     SVFTVSSAAAATPGTSSAMLHSSDLLQPPSFTGATPPSLHPRSATVAVTIASPNTSDS
                     PRDSLNTWKTNAGNSESTSTPKSPLELDCTRSAACVRPAAPPPLCSTASTSANTPGVS
                     PTSTTAISIGGGDSPQCGGNVSEARWNGCFLPPATSVCASTGALHPLSASAAATYTSG
                     SVPESALGCSSSVGNVTPHLAFCSGPRCGGEGLLSNSFEGAHEALSQGEGTPGPWNTP
                     TQADSTPGTPGVLRLPSVCRDNEEGGTVGGGAPIIALAETAPAAAAAAAKLSIKRSQA
                     RQQYHGAQKMKSKPCSVAATSSTTAAGLEKR"
     gene            complement(<757237..>758514)
                     /locus_tag="LMJF_31_1540"
                     /db_xref="GeneID:5654085"
     mRNA            complement(<757237..>758514)
                     /locus_tag="LMJF_31_1540"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685088.1"
                     /db_xref="GeneID:5654085"
     CDS             complement(757237..758514)
                     /locus_tag="LMJF_31_1540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685140.1"
                     /db_xref="GeneID:5654085"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6A8"
                     /translation="MSMWKVFPVDGVDGGDCHNYNAFVWQQLFSNFDLESNSGPTNVD
                     EVNKTPGSCSIPMIGLKQSNASAKDTALSVKLDARRTSSFGGSPTALQDDGYSSEDEH
                     ESPGDQAGSGRSTTPFYSSPTTTATAKSGSGSCVASAQNSSDATVPCFFVNGVRHSIE
                     SPCKTPDWTVVPASSSASVRQVSVESPLWASAHIDPSPNPAKTVVAGNNSGVPCAWVC
                     AEQSTTQPQSSTNLPLYAKPLTPPAGYAVPASPPSSGMMGGVQSTFTLPMGSSAYVAN
                     TVSVMQPLPASAMPVAQHASTPSFFPQKNDSAANTFPDCSILGFVFMDGEGCLRLAPQ
                     GCSAPASALSALPMMHVPCGATASSSMPQMQYTPSTTPAQPWRPAAAPAAAPAAASAA
                     APSASLPCAMSSEASGNTKAWVFRDGRWISLSI"
     gene            complement(<760673..>761461)
                     /locus_tag="LMJF_31_1550"
                     /db_xref="GeneID:5654086"
     mRNA            complement(<760673..>761461)
                     /locus_tag="LMJF_31_1550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685089.1"
                     /db_xref="GeneID:5654086"
     CDS             complement(760673..761461)
                     /locus_tag="LMJF_31_1550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685141.1"
                     /db_xref="GeneID:5654086"
                     /db_xref="InterPro:IPR007741"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6A7"
                     /translation="MSRNGELCLQRIIVSYSPNKGNPAMRQFMATHLPEFHRQYPQVK
                     IDIRPRQWPESSITGIYRDGSEKAYSIRFLSSMGINVRFHRLVNEGNDYNHSFSASHL
                     HLQRRSVQGTWNPYLWNYEGTRARHKPPAQWSRKLTEKEWDYYVQQYGAQMKAEEDTI
                     ADRVRRYTDIPEASTEEVNQRWKEHVMPRLQTDLEYNLSHWKKQHRTGAGRPAPPTLN
                     EYSLFSVPDHSSLGQDAIDMLRRREAQREEDWWRERKGQLKPPE"
     gene            complement(<761983..>762951)
                     /locus_tag="LMJF_31_1560"
                     /db_xref="GeneID:5654087"
     mRNA            complement(<761983..>762951)
                     /locus_tag="LMJF_31_1560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685090.1"
                     /db_xref="GeneID:5654087"
     CDS             complement(761983..762951)
                     /locus_tag="LMJF_31_1560"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685142.1"
                     /db_xref="GeneID:5654087"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6A6"
                     /translation="MFAIRCPASMLWHPSVHHSLLLLRALEQPHTLLLDTHTASRGRL
                     SVPLLSECAREVRIQTPPGHHEFDSPAGASTERSVLLYRAEDLLHIVNRPLSAGHDLG
                     AACPTQSGVFASLLEYLEASTVSSHVISAIDALLVSLNTGDMETMRQTHACLVELIER
                     LEASITDESLSEAHRTDQKEPLSTWPLFCTLQFLIEEGGMLTSAFPRTNKAYTRLCHS
                     SKAVALHRRLVQRTVEQLLDVGSSANADVSQGARVEMNYPAKGFLREVQRHLASYNRS
                     MEERTTDGVSGEKGPLNSRASGGRLGIQAVQARLPWTLQARPLRKG"
     gene            complement(<764899..>765372)
                     /locus_tag="LMJF_31_1570"
                     /db_xref="GeneID:5654088"
     mRNA            complement(<764899..>765372)
                     /locus_tag="LMJF_31_1570"
                     /product="putative cytochrome c oxidase VIII (COX VIII)"
                     /transcript_id="XM_001685091.1"
                     /db_xref="GeneID:5654088"
     CDS             complement(764899..765372)
                     /locus_tag="LMJF_31_1570"
                     /EC_number="1.9.3.1"
                     /codon_start=1
                     /product="putative cytochrome c oxidase VIII (COX VIII)"
                     /protein_id="XP_001685143.1"
                     /db_xref="GeneID:5654088"
                     /db_xref="GOA:Q4Q6A5"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6A5"
                     /translation="MLRRTVPAVSFTVSHRALMMRPSRPLLSGDMHSSDRFKAAWDEI
                     PLHMLGASHKQMFEWYWRAMYQLGLRDPYRLTKLRSMLNWAAFFSFLYLTYISIFYSS
                     FYHVYMMDWPEHFKRENARDYAVSHGHDVWAGDGKFIRPYFHINPPMLTMTEEDI"
     gene            complement(<765953..>766324)
                     /locus_tag="LMJF_31_1580"
                     /db_xref="GeneID:5654089"
     mRNA            complement(<765953..>766324)
                     /locus_tag="LMJF_31_1580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685092.1"
                     /db_xref="GeneID:5654089"
     CDS             complement(765953..766324)
                     /locus_tag="LMJF_31_1580"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685144.1"
                     /db_xref="GeneID:5654089"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6A4"
                     /translation="MSADPEAPADPSRVSGGHIVRNMIYAHDENHNLEILSGWSEQGT
                     REYDQETVRPASANMNKGHPCFSLNQELLRCSYSCPTEMKLGGRTATCNTERQALMRC
                     LVKNKQWKPDETERRPRYRFW"
     gene            complement(<766855..>767415)
                     /locus_tag="LMJF_31_1590"
                     /db_xref="GeneID:5654090"
     mRNA            complement(<766855..>767415)
                     /locus_tag="LMJF_31_1590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685093.1"
                     /db_xref="GeneID:5654090"
     CDS             complement(766855..767415)
                     /locus_tag="LMJF_31_1590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685145.1"
                     /db_xref="GeneID:5654090"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6A3"
                     /translation="MLQYTSSARQALRATALVLNFFPLGYTCGPKNKQVFFPPNNLDG
                     RTTHQMKKLQGSTDKHPGLVPRDKLKLHCEFCRFHWVQDTLVVRCAAHPKEHNQREIW
                     LEPTWTWGKQQPYQYYKYMPVNINPRTGMPLAREDAKGMNNERRSQGLPTKTRLLERE
                     RRGISRAITGLGIYNQRWQTRFPFAT"
     gene            complement(<769011..>771446)
                     /locus_tag="LMJF_31_1600"
                     /db_xref="GeneID:5654091"
     mRNA            complement(<769011..>771446)
                     /locus_tag="LMJF_31_1600"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685094.1"
                     /db_xref="GeneID:5654091"
     CDS             complement(769011..771446)
                     /locus_tag="LMJF_31_1600"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685146.1"
                     /db_xref="GeneID:5654091"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6A2"
                     /translation="MSCVSVDALVLISEHLPGQTGAWVSSSPRARRSREMSSQGLYLS
                     FNWFKDAASSSSQRGRRSQLRCEINDVQGMRLCRWWLLRCSGAFRPAPSTACVAEATP
                     PSGTARLRPPPKLSQYMECPLRVCCWGNRHASAALKNGTVSTIDIPRLNCSLGELLSL
                     GRIECVGINGSALSPTPPEWLSCLAVARGTEKLSIKSATLPLNELLSFLYSSTATLRV
                     VEIAGMALPRLQMFALASRIEELVLDSVTVHPHSVVAIGNAERQGNGQPPPPSNWVPL
                     SDLASLQKLRRLDMTNCKGDFDCAGIARCCFLRSVHLSGCNVKDADVPHLAQLPCVEE
                     LLLSRTRITNVQALAAGKGLRIIQLSNAQVDSDGIDGLQTLPYLTRLDLSSTLVSDVN
                     CLGQSQSLIYLNLAKTHVTSEGIAGLSRLLTLEHLMLNNNNIRDVSFLAESHSLKTLS
                     LQSTLVDSAGLEGLGRLRTLQDLSLAHTRVTNVTKLQHCRNLWRLDLQGSFVDQAGIV
                     GLERLPKLRVLVLSKTDVASLELILKSESLEQLEVKFSHVNERSAFFGVTKASALTDV
                     TLTHCDVSDINNLGMCKELRLLNVWSSKVTSEGIAGLCDARSLQEVDLAETAVTDISP
                     LLSCTKIQALILYRSSVRSLDGIGALQQLRRLDIAETSVSSIRSLSACQRLEILNLSN
                     TAVDDDGFQGIGQAQSLKVVSMSFTAITQVGQLGQCSHLEELHAQSCPVTSEGLVGLE
                     RACCLVKLNLSYTKLQSGIQRLTNCRKLLKLNVKFTEVPYDEVAYVKRHLPSCRVMND
                     AAQRMAKDVTLLT"
     gene            complement(<771715..>772530)
                     /locus_tag="LMJF_31_1610"
                     /db_xref="GeneID:5654092"
     mRNA            complement(<771715..>772530)
                     /locus_tag="LMJF_31_1610"
                     /product="diphthine synthase-like protein"
                     /transcript_id="XM_001685095.1"
                     /db_xref="GeneID:5654092"
     CDS             complement(771715..772530)
                     /locus_tag="LMJF_31_1610"
                     /EC_number="2.1.1.98"
                     /codon_start=1
                     /product="diphthine synthase-like protein"
                     /protein_id="XP_001685147.1"
                     /db_xref="GeneID:5654092"
                     /db_xref="GOA:Q4Q6A1"
                     /db_xref="InterPro:IPR000878"
                     /db_xref="InterPro:IPR004551"
                     /db_xref="InterPro:IPR014776"
                     /db_xref="InterPro:IPR014777"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6A1"
                     /translation="MFTLVGVGLGDASDVTVKGMNAVKEADVVFLEAYTSFLINSNAE
                     KLAGIYGKPVILADREMVESGAVLDDAKVKKVVLLVVGDVFGATTHSDLIVRCNRQGI
                     ESKIVHNASIINAVGCCGLQLYRFGQVISLCFWTETWRPDSWYERLQSNRAAGIHTLV
                     LLDIKVKEISDENLARGRKIYEPPRYMTIRQAIEQILEVEGYKQGGAVAADGSTFAVG
                     LARVGSESQQVVAGTMKDLLSVDFGAPLHSLVIAGDVHDCEQEHVDLFRMAGQ"
     gene            complement(<772799..>773338)
                     /locus_tag="LMJF_31_1620"
                     /db_xref="GeneID:5654093"
     mRNA            complement(<772799..>773338)
                     /locus_tag="LMJF_31_1620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685096.1"
                     /db_xref="GeneID:5654093"
     CDS             complement(772799..773338)
                     /locus_tag="LMJF_31_1620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685148.1"
                     /db_xref="GeneID:5654093"
                     /db_xref="InterPro:IPR002786"
                     /db_xref="InterPro:IPR026533"
                     /db_xref="InterPro:IPR029001"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6A0"
                     /translation="MTVWAIGTTNRAKAESVVTVVNRCFPNETHEVRLCSVSSAVSDQ
                     PMSAEETQRGALNRAKAALEVTSDADYGVGLEGGIEHIAGRWFECGWMVILERKTGKC
                     GIGSSARFEMSETIMRPILNEGKELAEVIDNLTGEEDVRSGLGAMGVLTAGRLGRAAA
                     YEHGLVFALAPFLSDSKYW"
     gene            complement(<773690..>774766)
                     /locus_tag="LMJF_31_1630"
                     /db_xref="GeneID:5654094"
     mRNA            complement(<773690..>774766)
                     /locus_tag="LMJF_31_1630"
                     /product="putative 3-ketoacyl-CoA thiolase-like protein"
                     /transcript_id="XM_001685097.1"
                     /db_xref="GeneID:5654094"
     CDS             complement(773690..774766)
                     /locus_tag="LMJF_31_1630"
                     /EC_number="2.3.1.16"
                     /codon_start=1
                     /product="putative 3-ketoacyl-CoA thiolase-like protein"
                     /protein_id="XP_001685149.1"
                     /db_xref="GeneID:5654094"
                     /db_xref="GOA:Q4Q699"
                     /db_xref="InterPro:IPR002155"
                     /db_xref="InterPro:IPR016038"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="InterPro:IPR020613"
                     /db_xref="InterPro:IPR020616"
                     /db_xref="InterPro:IPR020617"
                     /db_xref="UniProtKB/TrEMBL:Q4Q699"
                     /translation="MPKKIIGNLTSMACASGLSSLSQACMLIEGGHADVVIAGGSDSV
                     SNTEVPLPRAVTYGLMMAQRKGVMSFFKEAGYNPLKWFPGGIALTERSTGKTMGWHGD
                     LIAELNSISREDQEALAAASHANAARAEKAGYFKEEIVPVTIDKKGKKAEVTCDDVMQ
                     RDTEKMKAKMPSLKPVFRKEGGTITAATSSTLTDGGSAMLVMSEEKAKKLGYPTDVCV
                     KSWYFSGIDPYPQLLLAPVLGWGPALKKAGLTPKDIDLYEIHEAFAAQVLATIKCLKS
                     QEFFDRYANGAKPVLTEDIDLSKLNVNGGSLALGHPFAATGGRIVTSLANELRRSGKR
                     HGLVSICAAGGLGGVAILEHTARR"
     gene            complement(<775331..>776653)
                     /locus_tag="LMJF_31_1640"
                     /db_xref="GeneID:5654095"
     mRNA            complement(<775331..>776653)
                     /locus_tag="LMJF_31_1640"
                     /product="thiolase protein-like protein"
                     /transcript_id="XM_001685098.1"
                     /db_xref="GeneID:5654095"
     CDS             complement(775331..776653)
                     /locus_tag="LMJF_31_1640"
                     /EC_number="2.3.1.16"
                     /codon_start=1
                     /product="thiolase protein-like protein"
                     /protein_id="XP_001685150.1"
                     /db_xref="GeneID:5654095"
                     /db_xref="GOA:Q4Q698"
                     /db_xref="InterPro:IPR002155"
                     /db_xref="InterPro:IPR016038"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="InterPro:IPR020613"
                     /db_xref="InterPro:IPR020616"
                     /db_xref="InterPro:IPR020617"
                     /db_xref="UniProtKB/TrEMBL:Q4Q698"
                     /translation="MHSTRHALRQRAVLVTGARTPFVKSFGALMKADTLDLASASVAG
                     LLNKTSLDPRDIDHIVWGNVVLQGSAHNCAREIVIDLNMPKKIIGNLTSMACASGLSS
                     LSQACMLIEGGHADVVIAGGSDSVSNTEVPLPRAVTYGLMMAQRKGVMSFFKEAGYNP
                     LKWFPGGIALTERSTGKTMGWHGDLIAELNSISREDQEALAAASHANAARAEKAGYFK
                     EEIVPVTIDKKGKKAEVTCDDVMQRDTEKMKAKMPSLKPVFRKEGGTITAATSSTLTD
                     GGSAMLVMSEEKAKKLGYPTDVCVKSWYFSGIDPYPQLLLAPVLGWGPALKKAGLTPK
                     DIDLYEIHEAFAAQVLATIKCLKSQEFFDRYANGAKPVLTEDIDLSKLNVNGGSLALG
                     HPFAATGGRIVTSLANELRRSGKRHGLVSICAAGGLGGVAILEHTPKK"
     gene            complement(<782158..>783594)
                     /locus_tag="LMJF_31_1650"
                     /db_xref="GeneID:5654096"
     mRNA            complement(<782158..>783594)
                     /locus_tag="LMJF_31_1650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685099.1"
                     /db_xref="GeneID:5654096"
     CDS             complement(782158..783594)
                     /locus_tag="LMJF_31_1650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685151.1"
                     /db_xref="GeneID:5654096"
                     /db_xref="GOA:Q4Q697"
                     /db_xref="InterPro:IPR002893"
                     /db_xref="UniProtKB/TrEMBL:Q4Q697"
                     /translation="MTDESRDSSPETGDDRPPVNHDSVLRYPFREMRMEWFDDYMDNI
                     SPSKRVAVATRLMDCLMAHTVLHEDPFLEKAVTFIYNRVATHETFRNMTGVFGEAHDV
                     FRIVCMTAKFTVSNASEKNALLNLLDQHCTRFQAAAQKTKSENSETLIAAAGHVTECV
                     CSLRKNMASAEAFRRLMDSIKFLFFTVNTRNGVSPYSSNGKLLFNTFVCCDGCPCYAK
                     LRTGPTVFLRDMEKIKVLDCVMIAAVNAKDARMHDTTSKFLHNFCKDFMENPHLDDIG
                     HLVHNGRLFYCRTALFDALDNIESISSPQSDIADLPSAKTFTLDRIVLAVLWVKSEVK
                     EIRLLCSLVPTLNEALSSAEAAYSRLDCEDVLQVLYTLKEHILTVFLALSAPEYHLAV
                     HSRDVFVGKQADMKCASPSCPGTTKDLLKCSGCDVTFYCSPECQKADWDKHKNFCHEI
                     ESRRSQPASPTIVYGPVQVLKPVSRRND"
     gene            complement(<784068..>784628)
                     /locus_tag="LMJF_31_1660"
                     /db_xref="GeneID:5654097"
     mRNA            complement(<784068..>784628)
                     /locus_tag="LMJF_31_1660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685100.1"
                     /db_xref="GeneID:5654097"
     CDS             complement(784068..784628)
                     /locus_tag="LMJF_31_1660"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685152.1"
                     /db_xref="GeneID:5654097"
                     /db_xref="GOA:Q4Q696"
                     /db_xref="InterPro:IPR010492"
                     /db_xref="InterPro:IPR021151"
                     /db_xref="UniProtKB/TrEMBL:Q4Q696"
                     /translation="MIRSYFDLDDIGACEEPVAVTFTVPSFSMGKDLTVRTHEGETVS
                     EVAAGCVATVPLWAATALRTEGYVSVHAPHTFSLATFREFKTDPLAPSLHRKSPYFYQ
                     AGLQLCRLLSNPTSSGHMSAEGNRLAAQLFRLYQLRYLRIIFAAAKKGFDLNDVRDRL
                     EESERHLLDSYLRGQAEEALWYANFT"
     gene            complement(<785750..>786598)
                     /locus_tag="LMJF_31_1670"
                     /db_xref="GeneID:5654098"
     mRNA            complement(<785750..>786598)
                     /locus_tag="LMJF_31_1670"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685101.1"
                     /db_xref="GeneID:5654098"
     CDS             complement(785750..786598)
                     /locus_tag="LMJF_31_1670"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685153.1"
                     /db_xref="GeneID:5654098"
                     /db_xref="UniProtKB/TrEMBL:Q4Q695"
                     /translation="MSITAGTLPPVKGTSVKKSPRKGRPADSMGNGTGAAADPHCYHK
                     CRCYGHDDTLPNYKLLTIPRTNNYYAATGGCPCVPRVAAHPGSWRLKEGQLRSSTYRC
                     GTGCIKKSAALTLGCCHHSGDQYGWRRGPHTVLDKNTAATGKCDTFGNLAFKSTSRAY
                     CAVGGDDLSDVSSASPQKLEDLEALILEEHQQRMRVEEDVDELAGIQRNGTADWYKKI
                     HHDAERRRLLAQISEVELQDLLRDVKNIVDRPLNQTNMDLLRRILHRQEHLQRQREYY
                     AAQELE"
     gene            complement(<787559..>788386)
                     /locus_tag="LMJF_31_1680"
                     /db_xref="GeneID:5654099"
     mRNA            complement(<787559..>788386)
                     /locus_tag="LMJF_31_1680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685102.1"
                     /db_xref="GeneID:5654099"
     CDS             complement(787559..788386)
                     /locus_tag="LMJF_31_1680"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685154.1"
                     /db_xref="GeneID:5654099"
                     /db_xref="UniProtKB/TrEMBL:Q4Q694"
                     /translation="MPSAPTCQHGSYHQCECYGHNTQLPNYRHDISNPRTLQGYYAPN
                     GGCPCPATCGAEKHGLYCSDRGADASAMPKLTFRAADGPHTVHSASDVDGNGRDPATS
                     IRTAFPNSRNYGGTVAQRGPTTLSTRAQLSASRKARAEAKREERAQDRKNFLRGVLRD
                     EMLARMDAEGKRAALEADTGLMGTHHGEEYEANQRAAGSMRGGLDSTSRDPDTVLTLG
                     EQYREIMDELEYVADQPVGSKYNIIRLHYLVEEEDRLNRLRLQERIRKTAEAMQSKK"
     gene            complement(<788988..>793478)
                     /locus_tag="LMJF_31_1690"
                     /db_xref="GeneID:5654100"
     mRNA            complement(<788988..>793478)
                     /locus_tag="LMJF_31_1690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685103.1"
                     /db_xref="GeneID:5654100"
     CDS             complement(788988..793478)
                     /locus_tag="LMJF_31_1690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685155.1"
                     /db_xref="GeneID:5654100"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q693"
                     /translation="MAPPPISPLPISLPLPPLAFRRSPLAPRAALLLPLSESLPSQRP
                     PRSLVTRRFRRRSMQWTEVDQEQLHRFLEGFTNPDPLVQASNLEQLQALSDYPSALVS
                     TLAIVCDAAASVTVRLSATTVARQLLRCGDRLPLYLSATGDDPATAAQSIAEALFDAA
                     LEGSSSLSSATTAAPLQRATANLIACLLSGLAHTSLAATATALWSRIISSLLQRTDPA
                     TLIVNHAFQGGHWHTAQRGALCAALLRAICEAPLSTSKVLRERLGSQAAECLALCSLF
                     TQLLQLLETQMETEQAASRAAARFNALWLEETLTAFQACMESGLLPCAPSDFLRAPAS
                     DQSVTSPGADSSSTGLGEGPSMQALRAVGTAVGSVQIGAQGLLLRHVLGRLELWDGQS
                     AGGAFPREVVASAAPFVAVGMRYMADAVALDAVHPLHGAFHATATPLLAKFCHAACLA
                     ELQYDGAGEPDSVHAAVLACINYVTEWMNTECAHLSAPSSRLAAFSAHPSMVTAPTEG
                     YVSCLYSMLVDAATLPPSVADALEEHTTHQPDSAADFLVKSAAGRRREPRGSHTQKTY
                     DEWTSVAAEPAEETRNASAVVMPESCDKQDDTLLADALEVALPDNGILRHAVAWCAAG
                     LSCKQAWMMAVAPLVVRPATISPLASLGAACAAESALFVNNEFLDSILAEDEVSASLA
                     AATPELLVQHLAAQVQSVLSLLGPPTQEGFGTRAPFFVRIQAVRYLGRLVVGLLDAWQ
                     HTSSADHVIRSRSGIEERAHRVMLAVGGLEKLLGLVLGHLTTEVSKAAQVECVKTLNS
                     ALTSYLKVMEQLMRSAVNSGAASDLEEESLGSTSGSSGDMDAGDESGDAARHLLLSDA
                     CERARVFFQSFGATTDLCAVVEVLRVVSSHLPSFQWSVRQAVYHLFSEALPSLWRTAP
                     LVDSLSASQADGTHSVASYSARLVTAQVLEALAQHYATLLRSSSLSNNASPMLEMATL
                     LTSMADVTSAMDGGALEMVVPWILQVAHHMLDLYAHYLTRRAHSDHLPTADSASGVVD
                     MTDMCMVSLDLVSCVCDGVIDRDALLEQQLRPKEDGGAFGTMDARVMALATSMLLPPA
                     ASGIGCDGAPSSCSGSEALPNRCIALLAACQSLADHPTHVSTRLNSVTADGAVEDEAF
                     CLSDEFGDVRRACFAIVYDCVFLVAYRSSLFRPLDVAVAPDTGLVSSPRCLSGSLGRD
                     LFALCMREVLPSSTPLSVTQSADYAARFRFVSAHNAAASDAWLCLGSLLSLWDQQHWQ
                     TRRSAARGAQPTCEGERGPRSVFHIHGLESTAELHSHGLHTLNYLLALLQDTRGTIMS
                     NMRLNMTTAACGLAVLLCDSGRSHTDSGALAPVCPLPFATISATFSVAASTRIQEYAP
                     NASGGDLSGISEAAHVLWCLGRLWQEAVQPLPQDALCSFLRSNGRETTKTILWWTRCV
                     FGAKKRLPPADPPASASAPFWGSLLELWRPVARALVQAAKGKALSLTQAQLSELGQLE
                     RL"
     gene            complement(<793790..>795820)
                     /locus_tag="LMJF_31_1700"
                     /db_xref="GeneID:5654101"
     mRNA            complement(<793790..>795820)
                     /locus_tag="LMJF_31_1700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685104.1"
                     /db_xref="GeneID:5654101"
     CDS             complement(793790..795820)
                     /locus_tag="LMJF_31_1700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685156.1"
                     /db_xref="GeneID:5654101"
                     /db_xref="UniProtKB/TrEMBL:Q4Q692"
                     /translation="MHRSYFRVWRCSALAQLCSPSLYALRQGSRAAYTRFSSLLRSDF
                     NLRQHRSPDGADREPQRQLQSKLSRSANVPVYACDREERLAQQAPLSPVASYHDDSIT
                     SVVHENALGISDGETASAALSRVASSSSLRTRHIRRQSQEKGPVVSSATLLRSLEKRN
                     SPYVSTLRKRVMPRHTGTHGAIEDPNSAHQSDDQRRAATDLRAEETRSIERDGYDPAL
                     VVHVDSRRRQVRLNDVQRELIWKARQKQYHDMLQRMVACLQSHRSPVEKCQTIYSLHD
                     EVIEKHLRLRADTYEDIFHTLYSVGVRRGGGAGQPGKASLGSSAQLVSGGAGWENWCG
                     QEGSLGGSGGILPAELTTPSAASSTVLSPHGMEKVWEMYRYLVDSGTDPTPRILQYTM
                     GLLEHASVSLAAARSHTTADASGTPTTHGRYRARCSGLILLEAKAHSLMMDADRFHLT
                     PTEYTVNSYIAICEACDVMHLAVARVTDYQTRQERQASPGMYARLLTGLVRCGHYTDA
                     MAVVTTMQNVAMTTYLVNAVLQAARHSRDPASVFAFYRSLFFAPSNPLRVSGDGDHER
                     GGGAGKAPRPWCINATSRSATGLVPSLVTFSIMAEVMLQTQDYTELTFVIAEMQYYGV
                     KGNGLLLNKLLKMMHRAGRPRSEVRALQSAMDAKQVRVFDENRRGGHVPSLE"
     gene            complement(<796760..>798766)
                     /locus_tag="LMJF_31_1710"
                     /db_xref="GeneID:5654102"
     mRNA            complement(<796760..>798766)
                     /locus_tag="LMJF_31_1710"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685105.1"
                     /db_xref="GeneID:5654102"
     CDS             complement(796760..798766)
                     /locus_tag="LMJF_31_1710"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685157.1"
                     /db_xref="GeneID:5654102"
                     /db_xref="UniProtKB/TrEMBL:Q4Q691"
                     /translation="MPPTLATLRSNAVAASATRRFKKSVMSTSKPQSASASGECSTRP
                     SPGARSRTTVTSRGSTLVAVHPNTSASQLGTSTKSSSRRKLPLNSKGAERTYKPAPLT
                     AVGSGALISSHTPRTPSPALSCGTSRSPRVLISPGVDERASRTRANCTSSLPSSSAAT
                     SVPCALYDLHHALQHRLLEDLGWSLHWYLDTETEIKQLEVFKELDEKTKHPSHKKENK
                     PTTAAAQGKTSEAATGDGEPKSAAASPRVSLTADQQDSSALGGSLKGNISSLTSPRHS
                     DPNTPPRPHRIDVDGRELPFLVHKPKLGVTTNRFDCYMCQDLSTEARFAASQAPRSKL
                     SRSPFEYRLASLQRWLSKRSAESDKDRLLASCLSLETQRYLAYLGFADCWTSLFVTAG
                     LPTVMPVAASCPSPPREASPRLPMTLSGAASRLGSVPLSFYVLPALCRWKCVTPFRRD
                     RMLRESVMHPFPLPEAFLWGCRGASLAQLQSRAEVSKAQAASADVSHSLPSLTFFTIQ
                     KRSVLTERRRSSIWRNQTASLGEFCACDVYLVAATGRGTGDGAAVADTIASVWGYVKR
                     EDVDSRTLSLPSSPSSAAQKCKDGREGSTTATTSAKSPSGELFYIASSLENYLRLALM
                     FGWVYGWQMCFSSAGPPPNSVLWLRLVNKSAYEAALAASRHTAP"
     gene            complement(<800144..>803740)
                     /locus_tag="LMJF_31_1720"
                     /db_xref="GeneID:5654103"
     mRNA            complement(<800144..>803740)
                     /locus_tag="LMJF_31_1720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685106.1"
                     /db_xref="GeneID:5654103"
     CDS             complement(800144..803740)
                     /locus_tag="LMJF_31_1720"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685158.1"
                     /db_xref="GeneID:5654103"
                     /db_xref="GOA:Q4Q690"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="InterPro:IPR019559"
                     /db_xref="UniProtKB/TrEMBL:Q4Q690"
                     /translation="MGFGTDFTEEELAELKKLNSIYDKLLPKRSSESNSVSSSFLYRL
                     DDHGRIPLRDFFVPSAGSPSVARMGSNPPGIAAKWQTMLREMNGEVVVRSGQNIRNTR
                     AVINRILSWSITFQQADRAAAAVSLGHDGGRALAREWVRGIVVYFQERMDKLFAELNI
                     TAQEDACVQELRLPGMDGVDLVSRCVEAARTVITPMLTTSPYFIGIVGCCREMVLALK
                     VVQGLLSHISSHTRLMRSSAAATTPDGRRNALAILTLGEDFLESLRTSLWLFRFVLLF
                     LGALDLQQSPQREATISEQHLDHSIHCIASLVAEVESKRDSSAAASLEVRATLDALVL
                     GHVKNACLSRFPPSKTLELLKRAQGVRKDVAASEAANGPFARCSPVLKQLLVDYPTFM
                     ESTAKFVERNEMSDWGISLMLVQLFCWDVTTPPDLAAQAKRQVVYHVPKLTGSFPHGS
                     TVLNAMVREALHPLLSVLFSALPSGARGYGTSGGAIGAETATRASDGSAVAGPGRLST
                     IGGYDASLLLSPFEQKVCAALLTLATWLQSLSFPGGSRMHRWASLDVGDQIMREFNLG
                     EGCFTSVLGEVLHNVIATALDQVENDCNHSFTTRVATALETDDSVSRLSTAVLQYLRR
                     VERIWNAVTEPSLELHLSALDDVFAIGAKTLPSVVSASTFGIAADVSATAERASYDTS
                     LFGDCKYLFYDTVQNVMRARWPGRYADLLTDPLLQSVHVYLLRAESASQRGGGLRSVA
                     LRGAPVRTIGAKWPNPPPQPAPKELAPRPVNTGAAATPARGPPPSAAEQDAVVFTSKE
                     ELHSALRMVRCIKNRDLFINRYTITVRERLLTRPAPDVISDAELESNKKRHEQEAEQF
                     LTTWLGDASLLKPVRELHMSYSAQSELFDLASNGSVGATEAPTKGIRLATTILDWRVW
                     GDKEAASAATSCQAGANGAAPAAFPTSAAELVARAGQALSMAASETATLPFPNDALVH
                     LEKVEHAYNEKHSTRILRWDWNDHAYTSFTVSYPKEGGRVTTIHGTLLLQRLFLAIAA
                     YGRTGVELKTLAKRAGMDERRIAAVLRLCLDRDKLLVRISGSSDGAGEAAPSGGVHIA
                     LNYDYTRPPNRPRGEFTYWPNAERRRVTAGTADEDTTITKRRNMIKTSIMQIMKHVQR
                     IKHDELYNAVREKNAKVFDVTVRNFKQEIEGLIGQDFMARSCKDSNVYVFRA"
     gene            complement(<807477..>808622)
                     /locus_tag="LMJF_31_1730"
                     /db_xref="GeneID:5654104"
     mRNA            complement(<807477..>808622)
                     /locus_tag="LMJF_31_1730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685107.1"
                     /db_xref="GeneID:5654104"
     CDS             complement(807477..808622)
                     /locus_tag="LMJF_31_1730"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685159.1"
                     /db_xref="GeneID:5654104"
                     /db_xref="UniProtKB/TrEMBL:Q4Q689"
                     /translation="MASEASVALGVGVTLALFVFFAVVLVFFGVFTNESRTRSFERER
                     QQRVELVRQRRRQEQEQWRERRLREVVLLLIERGEALEGVSLAFQLPNRPEVSARRVL
                     HSRRGVNSVRQNLEIQLADEQENNRLDEEARRIARMPLNELLANGRPQNADAGPDVMQ
                     MLLDGQEIQHHTTSEDDSDFYLNDEDTMPVSVMPFLSQQVNEEARHDRGGGGTAPPTP
                     LQSSASAPGQPQPQQGDGAMSNNVAAEESEIDARTAAVLLQEQRLRDSREMALLQELR
                     REKRRKHLRAAEEVYGEGADYEHNPANDALLRIQVNSGGSPGSPLWRFLTPLTSLRTN
                     RSRRDTKSAFDGLSPQESTVYQRENTVPQKTPASGKKKNRSFEVAPF"
     gene            complement(<811024..>812592)
                     /locus_tag="LMJF_31_1740"
                     /db_xref="GeneID:5654105"
     mRNA            complement(<811024..>812592)
                     /locus_tag="LMJF_31_1740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685108.1"
                     /db_xref="GeneID:5654105"
     CDS             complement(811024..812592)
                     /locus_tag="LMJF_31_1740"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685160.1"
                     /db_xref="GeneID:5654105"
                     /db_xref="UniProtKB/TrEMBL:Q4Q688"
                     /translation="MTGVRHNLLFAPRPVLYRVVCEGVSESTAGKHPHLTPTSPTIDF
                     IAVVTLCLSALFHVFASFEPWVREPLLLSHFFACPCYTVNWSASRPLLHSQPHTHTHT
                     RRRGFMRTTSLRARGSSGRHSHPRLFPATLSLFLHRPSAPYPAVRAVRGSSITQQACV
                     PLLSLHRQLSSDDGCLLPPTAPAAVTTVGSPTGEDDDDLKMDIYRSQLTPEDAERKAK
                     TDLFLCLILTLPRDQDWKDMLTAAFRAGTWKPHHLSAVLRGVQLNKYNEPAVCALSCA
                     GVCATSLPSSRTAALRHAIAEIAKTAPASSTPSTRLQRAKDILAFCADEGGVYAPPSA
                     EDSLADVSTAPPSPAEEETSRRSKVFAPSPADAHHLLVLLLKAAQRGASAASSLSKPN
                     TPTQAVASFHDVWNFLAWMELHGYHILSNAVLDALEVVVDEGGSQAGAGAAAGLTRAA
                     GPSSASSPLPLQYAMVSQRVHRLDYLRGERALLQEAVKNAEQGSSGASMSTGAVRERR
                     RRRDVPRTAPVHTE"
     gene            complement(<816685..>817911)
                     /locus_tag="LMJF_31_1750"
                     /db_xref="GeneID:5654106"
     mRNA            complement(<816685..>817911)
                     /locus_tag="LMJF_31_1750"
                     /product="nucleosome assembly protein-like protein"
                     /transcript_id="XM_001685109.1"
                     /db_xref="GeneID:5654106"
     CDS             complement(816685..817911)
                     /locus_tag="LMJF_31_1750"
                     /codon_start=1
                     /product="nucleosome assembly protein-like protein"
                     /protein_id="XP_001685161.1"
                     /db_xref="GeneID:5654106"
                     /db_xref="GOA:Q4Q687"
                     /db_xref="InterPro:IPR002164"
                     /db_xref="UniProtKB/TrEMBL:Q4Q687"
                     /translation="MPSQVHVDPMARTASDASEASSSEVDMVAVMTEMTVAERRRVYA
                     LQGLLKEYYEVRQRLRAEIVALANECAAENQKLFAVRKEIVTGARDITEEEMQRIGCT
                     AAPTEPDKKEDAAPAKKCVKFVDPVDEKQNSALVKAAASPSGGIPAFWLTAMSNSEAV
                     NSMITEKDRDALRHLTDIERGFVDGDPEKGDRLIFHFSPNEYFTNETLTKAYHTEYDE
                     DHGEPRITDVVGCDINWKSSKKNLTVTVKQKKQRNKKSGQMRVVEREEPCESFFNFFS
                     PPNPDSDDDEDGDDEDFLEQEMEMDVEVGTALTQAVVPRAIFYYTGEAVVETGKELRE
                     QYGFGNGEDEEDEEDEESDSDEEDEDDDEDEAPAGAANFRNIVRQRGGGATPGGRGGR
                     GGAASQQPPQQECKQQ"
     gene            complement(<823732..>824859)
                     /locus_tag="LMJF_31_1760"
                     /db_xref="GeneID:5654107"
     mRNA            complement(<823732..>824859)
                     /locus_tag="LMJF_31_1760"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685110.1"
                     /db_xref="GeneID:5654107"
     CDS             complement(823732..824859)
                     /locus_tag="LMJF_31_1760"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685162.1"
                     /db_xref="GeneID:5654107"
                     /db_xref="UniProtKB/TrEMBL:Q4Q686"
                     /translation="MAGAVPSTGASEVVTCPSTLTSPVKIDQEWPTTTSSATHTTPAP
                     QAPMATLCTLAKSSAATTPVTGSTRAVSQPSPVFTMSAIHRFLCRSSIMVPFMAERAA
                     KEVVVLPPPIHRFYRQADEARRSLVRRADFLASCSDNELAATNADGSVSADRKASTKV
                     DPPRGDVFNFTWTTKEVNAMRMQQREYLRKQRGSPHAPVLVRMNELVSNILNDSDWEQ
                     MEKASPTVATVAAPAVRADVANIVAGLCTRAIPQAEYIRSVFQYRMSVLQKRINAVPT
                     GVVVPSVVQATMTLDELSESHSGESIPKYKKGKATSKKVLSPTTAPTVTFPHPGVPFT
                     YQDLAQDPLLLTAEQRADRRAALLHRRTLSEEVYGQPVPYI"
     gene            complement(<827032..>830406)
                     /locus_tag="LMJF_31_1770"
                     /db_xref="GeneID:5654108"
     mRNA            complement(<827032..>830406)
                     /locus_tag="LMJF_31_1770"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685111.1"
                     /db_xref="GeneID:5654108"
     CDS             complement(827032..830406)
                     /locus_tag="LMJF_31_1770"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685163.1"
                     /db_xref="GeneID:5654108"
                     /db_xref="UniProtKB/TrEMBL:Q4Q685"
                     /translation="MSLFSSTPTPEDTTPPPSNATLLTSTAQLQPHLCYYYHQHYSHA
                     PHILPLRNPGLLEQRDVGDDSLQLPREAAAPGPSVASPIAPSSPQRILRVHQPLVYAP
                     WGMMPQFMPQPADGTPTHQPHATPGAPVSPTTATVIAQGAPAISLDLPVPRSPDKQVR
                     TYCALALFVLMAAMGLLLSSFFTPICTACLNFTRSVTDVQDPAVYKRSIEGSLGMQIS
                     AYAAFSPCTVFKRHACDTITADQVSGWMRSITNGMQAPFPDLFSYSGIDRARVSSCSY
                     ICLPAATAHPVPQLQNTAAPVVIDWRAFRSDCGPTPPALPLHAHHGWRSGGSGLGNVL
                     TGLRAHEREPHSHPPLAAPGQGDAPGHNAPTHAPPAAGTPQGGNVSHVRIVLHSSLPQ
                     GAKAAFTLTCDSDTDTVPMLNLTTIYNADVSAYLPDDTDASSSKMVSAADLITRADPK
                     NVVREYQPVMRTCAEYLAACATIETGYYIVIAPASPLHRCGQEPVSRPSSPSQSSATA
                     AKVLICDITVYEPTAYAAGAMRFTATAQLAMNMVVYPSNVRFPSSAAGAPVCLTPSAI
                     LLVFAEAFMLLTIVLIAVAVGMAPAQRAKLRQLRAALDVDASVAMEILYRAQGAVAAA
                     MPLTAAPAPAAPRTPHEPGAEAGHATNEPAAATADDASPMSFTSPSTAPPQPHTQTPQ
                     QQPSVAHTPQSALSGTAAAMLLVPPYHQLGGPTVPGTSGSGSVGVPGIMAGRHPSPYS
                     EGYYLQPEHGPRNAAAPRRDAADGVVPPAGAAHTLLAAAAAPQGERDRSTTTRGASYT
                     ASPGTSLVAQEKSVVCSSSGVRDVSVRNVTLHRIGRRWQRQRGTAGVVHPDAGVGSDE
                     DRDADGGERAAREDAYQRSAPPQPPAISGGAGSGIGCAMAPMWAPAAPGALPARGHQP
                     DPLADEAHAADAVSPPALMSVEHPEPLMPVSVATGWMFARSRHIASQSMLEESSSSAR
                     TAEERNATGASTPGNWPGSDTESGLGSDDRLPLASYVLPENSPGERTIQLFLLRARKS
                     YTRLRRKQVRVLTKLLLYVKAAAFTALVFTLVCTGLQLSGVSARGREGLQFRGGDTLS
                     DDYVLNASHVALMSLSLACVVVAVVLDFAVERKRLW"
     gene            complement(<838195..>839580)
                     /locus_tag="LMJF_31_1780"
                     /db_xref="GeneID:5654109"
     mRNA            complement(<838195..>839580)
                     /locus_tag="LMJF_31_1780"
                     /product="putative dihydroceramide synthase"
                     /transcript_id="XM_001685112.1"
                     /db_xref="GeneID:5654109"
     CDS             complement(838195..839580)
                     /locus_tag="LMJF_31_1780"
                     /EC_number="2.3.1.24"
                     /codon_start=1
                     /product="putative dihydroceramide synthase"
                     /protein_id="XP_001685164.1"
                     /db_xref="GeneID:5654109"
                     /db_xref="GOA:Q4Q684"
                     /db_xref="InterPro:IPR006634"
                     /db_xref="UniProtKB/TrEMBL:Q4Q684"
                     /translation="MALRYSTETMRVQGIGSPYASLAELYIPDPTNASRRTLDTARTT
                     LNWSELPSAFLNIKAYQDKVGVGCSGWGIDVSLLLVLYPAVYWFLGIMLIRYLCREPF
                     ARFGIYMGVVTEKSTCHHHGIASGKHGVASLSPRNRKKIMKFQNQMWLSMFYFASSCF
                     GYYVQRDQPWFKLPLDDEASLHLLLPHPYNPPAELIMYYHYGLAFYFAELCSLFIIER
                     HMKRSDFLEYAVHHITTLLLILCSHIGLEHRFGAYVLFIHDASDIMLSVSKSIHYMWQ
                     EETARRERHNTKNAEEENSKAHRKSFLQRCIVSELCLNCCFAAFVLLFFFFRLYCLPF
                     MGKATIRMSPKVRHGNLNMWMLVFLLNVALQGLHVYWAVLIIVLSLSIAKGGELRDIR
                     SEDEEDSECPSCIHQRSLSESSGAAAAEEGNGMQQRNVARESKVAPSLSSSLTSTRNR
                     SQRRGSSKRKE"
     gene            complement(<845243..>847060)
                     /gene="AAT8.1"
                     /locus_tag="LMJF_31_1790"
                     /db_xref="GeneID:5654110"
     mRNA            complement(<845243..>847060)
                     /gene="AAT8.1"
                     /locus_tag="LMJF_31_1790"
                     /product="amino acid permease"
                     /transcript_id="XM_001685113.1"
                     /db_xref="GeneID:5654110"
     CDS             complement(845243..847060)
                     /gene="AAT8.1"
                     /locus_tag="LMJF_31_1790"
                     /codon_start=1
                     /product="amino acid permease"
                     /protein_id="XP_001685165.1"
                     /db_xref="GeneID:5654110"
                     /db_xref="GOA:Q4Q683"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:Q4Q683"
                     /translation="MSNRSADSCPRTCRGQQREEYPDHASSHTMTVGAAHTAKPTATS
                     RSAEQRPQRQSHSQPRRTGCLDVLQTIRDGVIKAVCVIVPPGGILSGAFNMASSSIGA
                     GILGLPAATDSAGIILAMILLAVITYFSVFSMYILALASENTRIKTFEGLARWLFPAR
                     RYAFSYWAAFVRLFYGFSGCVAYIISVGNCLGPIFTGAAKQHPDNSAIQFFATTQGNR
                     VLTVIIWLFVMLPLVIPKHIDSLRYASAIAVTFMVYFVFVVVAHSCRNGLAETSKHVE
                     LSGNQVDDDKLVHNTVFLFRTGNSVIHSVGIFVFAYACQINAQEVLWDLRPEIRTTKS
                     FTLSAFIGMMLCTTLYVLVSVFGYFDFGSKNLLGKSLLLMFNPFEEADIMIAYVAVMI
                     KLCVAYALLTIAARNSLYYLIGFQHRYRNRTEAGGAEELDFVAGDADATVQQTANLPA
                     AVTNSDVVQSGKLDGVDNNHGMEGTTKGRNASQTVDEDCEAGEDVDEECVDGTAEDTT
                     YVDNIPFWQHLLVVLVLSVVSLLCGLFIPNISTVFGFAGSISGGFIAFIFPALFVMYS
                     GNFTVAQVGWFTYLNTYLLLICGVVGIVFGTGGTIYVTI"
     gene            complement(<851556..>853319)
                     /gene="AAT8.2"
                     /locus_tag="LMJF_31_1800"
                     /db_xref="GeneID:5654111"
     mRNA            complement(<851556..>853319)
                     /gene="AAT8.2"
                     /locus_tag="LMJF_31_1800"
                     /product="amino acid permease"
                     /transcript_id="XM_001685114.1"
                     /db_xref="GeneID:5654111"
     CDS             complement(851556..853319)
                     /gene="AAT8.2"
                     /locus_tag="LMJF_31_1800"
                     /codon_start=1
                     /product="amino acid permease"
                     /protein_id="XP_001685166.1"
                     /db_xref="GeneID:5654111"
                     /db_xref="GOA:Q4Q682"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:Q4Q682"
                     /translation="MSRRPSMRGDGAQQPCSHAPSAAKDAHRAQDPAAPPSHSQPRRT
                     GCLGVLQTIRDGVIKAVCVIVPPGGILSGAFNMASSSIGAGILGLPAATDSAGIILAM
                     ILLAVITYFSVFSMYILALASENTRIKTFEGLARWLFPARRYAFSYWAAFIRFFHGFS
                     ACVAYIISVGNCLSPIFTSAAKQHPDNSAIQFFATTQGNRVLTVIVWLFVMLPLVIPK
                     HIDSLRYASAIAVTFMVYFVFVAVAHSCRNGLAETSKHVELSGNQVDDDKLVHNTVFL
                     FRTGNSVIHSVGVFVFAYVCQVNAQEVLWDLRPEIRTTKSFTLSAFIGVMLCSTLYVL
                     VSVFGYFDFGSKNLLGKSLLLMFNPLEEADIMIAYVAVMIKLCVAYALLTIAARNSLY
                     YLIGFQHRYRNRTEAGGAEELDFVAGDADATVQQTANLPAAVTNSDVVQSGKLDGVDN
                     NHGMEGTTKGRNASQTVDEDCEAGEDVDEECVDGTAEDTTYVDNIPFWQHLLVVLVLS
                     VVSLLCGLFIPNISTVFGFAGSISGGFIAFIFPALFVMYSGNFTVAQVGWFTYLNTYL
                     LLICGVVGIVFGTGGTIYEIV"
     gene            complement(<856091..>856471)
                     /locus_tag="LMJF_31_1810"
                     /db_xref="GeneID:5654112"
     mRNA            complement(<856091..>856471)
                     /locus_tag="LMJF_31_1810"
                     /product="acetylornithine deacetylase-like protein"
                     /transcript_id="XM_001685115.1"
                     /db_xref="GeneID:5654112"
     CDS             complement(856091..856471)
                     /locus_tag="LMJF_31_1810"
                     /codon_start=1
                     /product="acetylornithine deacetylase-like protein"
                     /protein_id="XP_001685167.1"
                     /db_xref="GeneID:5654112"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="UniProtKB/TrEMBL:Q4Q681"
                     /translation="MAYLLTQLKEKGPKGAGCLIGAPADMRVVTSNKGFCEWHVEMQG
                     KVIHSAMALMSTSCNAIEYAAQIIAEMCETALDITKSTAQERNYSCSLACISTDAVVG
                     GSAVNTVPAECDVVCSVRRPLGYL"
     gene            complement(<862594..>864411)
                     /gene="AAT8.3"
                     /locus_tag="LMJF_31_1820"
                     /db_xref="GeneID:5654113"
     mRNA            complement(<862594..>864411)
                     /gene="AAT8.3"
                     /locus_tag="LMJF_31_1820"
                     /product="amino acid permease"
                     /transcript_id="XM_001685116.1"
                     /db_xref="GeneID:5654113"
     CDS             complement(862594..864411)
                     /gene="AAT8.3"
                     /locus_tag="LMJF_31_1820"
                     /codon_start=1
                     /product="amino acid permease"
                     /protein_id="XP_001685168.1"
                     /db_xref="GeneID:5654113"
                     /db_xref="GOA:Q4Q680"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:Q4Q680"
                     /translation="MSNRSADSCPRTCRGQQREEYPDHASSHTMTVGAAHTAKPTATS
                     RSAEQRPQRQSHSQPRRTGCLDVLQTIRDGVIKAVCVIVPPGGILSGAFNMASSSIGA
                     GILGLPAATDSAGIILAMILLAVITYFSVFSMYILALASENTRIKTFEGLARWLFPAR
                     RYAFSYWAAFVRLFYGFSGCVAYIISVGNCLGPIFTGAAKQHPDNSAIQFFATTQGNR
                     VLTVIVWLFVMLPLVIPKHIDSLRYASAIAVTFMVYFVFVVVAHSCRNGLAETSKHVE
                     LSGNQVDDDKLVHNTVFLFRTGNSVIHSVGIFVFAYACQINAQEVLWDLRPEIRTTKS
                     FTLSAFIGMMLCTTLYVLVSVFGYFDFGSKNLLGKSLLLMFNPFEEADIMIAYVAVMI
                     KLCVAYALLTIAARNSLYYLIGFQHRYRNRTEAGGAEELDFVAGDADATVQQTANLPA
                     AVTNSDVVQSGKLDGVDNNHGMEGTTKGRNASQTVDEDYEAGEDVDEECVDGTAEDTT
                     YVDNIPFWQHLLVVLVLSVVSLLCGLFIPNISTVFGFAGSISGGFIAFIFPALFVMYS
                     GNFTVAQVGWFTYLNTYLLLICGVVGIVFGTGGTIYVTI"
     gene            complement(<868545..>872654)
                     /locus_tag="LMJF_31_1830"
                     /db_xref="GeneID:5654114"
     mRNA            complement(<868545..>872654)
                     /locus_tag="LMJF_31_1830"
                     /product="protein kinase-like protein"
                     /transcript_id="XM_001685117.2"
                     /db_xref="GeneID:5654114"
     CDS             complement(868545..872654)
                     /locus_tag="LMJF_31_1830"
                     /codon_start=1
                     /product="protein kinase-like protein"
                     /protein_id="XP_001685169.2"
                     /db_xref="GeneID:5654114"
                     /db_xref="GOA:Q4Q679"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4Q679"
                     /translation="MEPPLHATLHAKPRASCSKEPRAETLPRLCARQQNVHRTSKRAA
                     WLDFLCRVDILWAILFFALLATVGICSAVVTQAIVSAAVLESWRTLHHLHANIIRKRL
                     DQQISTAYNMAADLMLLQARYPFQMQSEDTLATLCSILAGYDKDMLLAALSLVSFELR
                     ETITCMHGLTDDALTDSLFGYVSYNHTVNATNYVDKDTYRFQRPLRMAMEWPSQARNI
                     SNFIDENMNAVPIFALVNELAAGRNPDIDIRNAWRVNPILPHLMELNVPVGMVYGSPT
                     MPVATPITDYALLHINGSRLLREPDGTHHIRARIALFVNQTLTNADPAIMSNNWGQHF
                     ISSVIHTPLVNTSVSYLKASDVRDPLMRAALKHVDLAQLQSEASRSTVDFQHNGAPAM
                     VTAWTYTTSKGLCLPLVYASVQGNITVPHTLIRDMGNGITVAAVLIFTLIFWRLIHRT
                     ISQPLNGVRTSMLASVEHGDRQLYYPRDSKLVRFTEVDALIQAHNKTMQQLRDVDAFI
                     PEGLRLRVTDDSACQSDHVPTRRFSCLIHNSKPQKSKGMQLSLHLSTVVYLSMSATAS
                     TTTDPFSSLQRRSLAEEQESRQIRGQRLIAAAEQTAQAANTANSGPFPTPAALTAFIT
                     AVHELCHTHHGTLHRLCPDACVLHFNSAVRAHLPRGPGDASAAAAPAAAPPAPAVRHG
                     VPAAQSAPQPRPPRDTRQEEMKRRAAQDARNAAAFALDLVSWTAAQSGSGDGAQKDGA
                     AAMPDVRALLDTSMFTCGQYRPSGSEQTLQVALGRDVQRDLGRVPQRIGVRVAMTEET
                     ATLLRADNDSGGRGRGNVDVGVRQIPVDVLRTGRAGLDGDVVVLYEALPGRVAGDAAW
                     QLYARCCCDGFEHMLRGDYASALAAYRGVAEIADLEPGLLPAAMRREAVASAVTGGAV
                     SVQVARLMRECERRVRLRITERLCKVRFCPLGIDAVLRDSKPLGNGTGALYPGVLSPT
                     EGGVGVPRKVCGRDKNRRGFSRTSAHQFPRVRERYVLAVKDGISTFRYVVPSMPSWMR
                     DEHGLYWHIARCPMNNELTPEFMWHRRVLALGSAGALCSVNYLIYREVHPVVAKVIRN
                     APPGPMSDALRSATPVCAPSSRQAAAVRRLIEKHQQLSHPNLLSFLGFSESLEGGVMP
                     LWEFSPGGTLRELIFRYPNVKPVTINRFGLQILTALSYLHERGVAHGSVRLDNVLVSA
                     DGKCRLTGHSGDNEAARELFYMHQTCFISPLMATGALPTPQCDMFCIGLGALEALTKQ
                     PAWKWATGNDGQPLGTAAELSELMKAGGTTFSSALTQGRVVVNVDPLRGASVVGKYSN
                     RAVESLIRCLSLDPAERPTAMQVREASKEMLLLAGLTLEEDELAASICR"
     gene            complement(<877913..>881989)
                     /locus_tag="LMJF_31_1840"
                     /db_xref="GeneID:5654115"
     mRNA            complement(<877913..>881989)
                     /locus_tag="LMJF_31_1840"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685118.1"
                     /db_xref="GeneID:5654115"
     CDS             complement(877913..881989)
                     /locus_tag="LMJF_31_1840"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685170.1"
                     /db_xref="GeneID:5654115"
                     /db_xref="GOA:Q4Q678"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4Q678"
                     /translation="MHLQNSRLSSGATAPKQLHRDMPSPGRPVKRMRCRLAVLKGYLL
                     RVDVFLCIIDLLVLLCVAVPIVFVSQVYLTRMLVSSWRTVHNTRVYYITERISISTIS
                     VRDIANGFMALNMLGGSSYSDHDLMENLCSSLDNYDKLTRFRALSLVSLETESTISCI
                     HGVPAMDSMRTLTGYFSHDSIINGTYLIDNETYDLVQPPQMVTEWPESARNISAATAT
                     TYSGAPILELLPAYLDGSVDSVDSRHHWILPAIMPHIICYILPVGYLARGRTDISSVR
                     YTDFTQVLLDGSRMLLDYDFVEAPGLAMAAFINQSLADDDPLVLSNSWGQPSVSNDSI
                     YSIFTTVPVTYLKASNISDPLMRAALQHVDLAALQHEGYRRSVDFEYAGAAAVVTAYA
                     YTTAQGLVVPLVVASSHAAITTPYLFLMRIFDGILVAAILLLTGASFSSARCLISQPL
                     RRITALMLASMSAGRRALFYTTTSNTLLQLTEVHALIKAHNAAMQQLREIDAFVPDEL
                     RAEGGAQRTNSSVSNITSSTGISNGRKVGKFGSRCLDTHLSTAVFVTIQAPAALSSSP
                     VIPPLSSSLRPILAEQGEQKALRGQRLVSVVKHAAQAANTANSGPFPTPAALTAFITA
                     VHELCHTHHGTLHRLCPDACVLHFNSAVRAHLPRGPGDASAAAAPAAAPPAPAVRHGV
                     PAAQSAPQPRPPRDTRQEEMKRRAAQDARNAAAFALDLVSWTAAQSGSGDGAQKDGAA
                     AMPDVRALLDTSMFTCGQYRPAGSEQTLQVALGRDVQRDLGRVPQRIGVRVAMTEETA
                     TLLCADNDSGGRGRGNVDAGVRQIPVDVLRTGRAGLDGDVVVLYEALPGRVAGDAAWQ
                     LYARCCCDGFEHMLRGDYAGALAAYRGVAEIADLEPGLLPAAMRREAVASAVTGGAVS
                     VQVARLMRECERRVRLRITERLCTAISSLLGVDQVLSKWTLEDMPEGTHPECGQEAVV
                     EADKSIADERPRRISRRRAQSIGELAKYSEVRHRCVVHFQERQVTLRCVLPSAPRWIR
                     DHIGLCWHLSRSHGNDEATPVWSGMRMALGSAGFIASVSFSPFRDLHPVVAKAIRDAP
                     PGPMSDALRSATPVCGPSPEQEAFMKATLLKHQHLRHPNIVSLIGYSHSLEGGVVLIW
                     EFSPGGTLRELLNRYGRLPAITTIRFGLHALSALSFLHENNIAHGNLNLDTVMVDSDG
                     SCRLVGLYTHERLPFALPQTHYISPLMATGALPTPACDVFCYGLGALEGLTRQPCWRW
                     TTKEDGEPYGAASELLDLMKDGGHAFCDAVVQGRVVANAEAFDTPLFAEKYSELARST
                     LRSCLSHAPSERPTAVEVRNIVKILLSEGGLACEEDEI"
     gene            complement(<885855..>886160)
                     /locus_tag="LMJF_31_1850"
                     /db_xref="GeneID:5654116"
     mRNA            complement(<885855..>886160)
                     /locus_tag="LMJF_31_1850"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685119.1"
                     /db_xref="GeneID:5654116"
     CDS             complement(885855..886160)
                     /locus_tag="LMJF_31_1850"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685171.1"
                     /db_xref="GeneID:5654116"
                     /db_xref="UniProtKB/TrEMBL:Q4Q677"
                     /translation="MPNVRALLDTSMFTCGQYRPAGSEQTLQVALGRDVQRDLGRVPQ
                     RIGVRVAMTEETATLLCADNDSGGRGFFSGSRNALQGVCGHSRCGRSSRGWFPRWTR"
     gene            complement(887144..887663)
                     /locus_tag="LMJF_31_ncRNA2"
                     /db_xref="GeneID:12981438"
     ncRNA           complement(887144..887663)
                     /ncRNA_class="other"
                     /locus_tag="LMJF_31_ncRNA2"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460986.1"
                     /db_xref="GeneID:12981438"
     gene            complement(<887344..>887802)
                     /locus_tag="LMJF_31_1855"
                     /db_xref="GeneID:12981454"
     mRNA            complement(<887344..>887802)
                     /locus_tag="LMJF_31_1855"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722327.1"
                     /db_xref="GeneID:12981454"
     CDS             complement(887344..887802)
                     /locus_tag="LMJF_31_1855"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722375.1"
                     /db_xref="GeneID:12981454"
                     /db_xref="UniProtKB/TrEMBL:E9AEF5"
                     /translation="MATDSDTLIIIFLWLVYVCLHACFDYCERRSLLRAEELEARERA
                     QAAAARSGSQPRSSRRRTRTSGDATAPIAVIVLGADGDLNTNLNEPCEGAVVPGASGY
                     MPVLPEQVHYGESTYMNRQEDLSAAALEKALEELSPAAEVDAGKEDPALR"
     gene            complement(<901717..>902505)
                     /locus_tag="LMJF_31_1860"
                     /db_xref="GeneID:5654117"
     mRNA            complement(<901717..>902505)
                     /locus_tag="LMJF_31_1860"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685120.1"
                     /db_xref="GeneID:5654117"
     CDS             complement(901717..902505)
                     /locus_tag="LMJF_31_1860"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685172.1"
                     /db_xref="GeneID:5654117"
                     /db_xref="UniProtKB/TrEMBL:Q4Q676"
                     /translation="MILFQYVFPCYPQQTASERASLAERATNSSSNVASTANLSGSAT
                     TSPGTSHIGDVGGSIVSLAAGAFFAVSVVVAIYYFFDVYRKRTTEERRILAHEGGGRG
                     AGGPPMIHIIEGIPMHYSAASAAQHESTEEVASLRRLAQASLADIPQSSLVSVADHVR
                     SRGQDRTIRVHNLDADLRISNPFSLPSSSVEAQPCVGHVVETDEGEQRLLGGEETWKR
                     LDYGSAMYYSSPVDESPHTNGSEGDEGDDDVAFYDHSENLPSDK"
     gene            complement(<914739..>917675)
                     /locus_tag="LMJF_31_1870"
                     /db_xref="GeneID:5654118"
     mRNA            complement(<914739..>917675)
                     /locus_tag="LMJF_31_1870"
                     /product="mannosyltransferase-like protein"
                     /transcript_id="XM_001685121.1"
                     /db_xref="GeneID:5654118"
     CDS             complement(914739..917675)
                     /locus_tag="LMJF_31_1870"
                     /codon_start=1
                     /product="mannosyltransferase-like protein"
                     /protein_id="XP_001685173.1"
                     /db_xref="GeneID:5654118"
                     /db_xref="GOA:Q4Q675"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="UniProtKB/TrEMBL:Q4Q675"
                     /translation="MQHHHPPGPSLPAMQLPRQAPDSRHKASTSRGSSKFSTSKLPSL
                     ARLLPLRRRAHLPEHATFRALAFVFLSMVLLCVTSFLLHQLDFGDDHPFQSLMPGVVP
                     PPSPPIAISSSDLVLSLIMPLLHDGDPVSGNTTAYVFLSNLLGPLVQSEDALCHRSAN
                     NSTQAPAYQVHAVVVSGDAAASSVLGGALRGVLPDGVLHSGDVLPQGRPRDGLTPASS
                     WHAWELNMDTVRAALGGAVRGGARCLGDRVTLVAPAAPAPDTTVEVLVDAALRTRGGR
                     AGSHFVVLSSFLGATRMPYTEPGDALETRHEGTGLLDALVRTATQRNGGRVAAAQCTI
                     LQHDGDSGGWRNPPPRLTARELASLRVVDKGGMTGATHDGEVLLPYLTRRLSGYSAAE
                     QRASWEEVVDAVSLHCGIFDRRVYDAVGGLAGALSEPAVRDAVSAREDHAMGAVDRGG
                     WALTLRMQEAYPAWQVWGSRATAVVRAGVAGVRTRPAVASLQRPVFSLLDWYGRAAYS
                     VVTELQRRRVGVPWRLRGEDSHHSAERTAVVQNCLPPVIRYHTDFSAPCIGLNREAMA
                     YIRPLMERYGISVMGGEGRRSCPKSGDALLQLAYGGVGDLFSSVPSPATHSFFRDRLR
                     RRALLVFQHCRAHRFFPVPRHRFHECPEVYIGHSMSELSNIQQKSIVPMRTRADEIWT
                     TADFFATIYRRNGVSPDKIRVVPEAVDVYEYDPANYARQPTMSRCANISLCDNRPSLT
                     EEERLQRYVFFSSFKWEDRKGWDVLLKAYWAAFGPSAPPELRERTTLVIKTRLTRLYS
                     PELSRDSVLHFIETWGRGGALPGMTSMAGYPHIIIVTGEVSAAEVVQMYANADAFVHP
                     TKAEGWGLPAVEAMAMGLPVLVTEWGGPLRFMERDSCFRIPVDGLEEVSPDSPYGYEE
                     GMKMAIPSVEKTAELMRYVVEHPEHARRVGRRAREYAVRELSEEAVADRMDRLFVDSV
                     IGKQRG"
     gene            complement(<920841..>923417)
                     /locus_tag="LMJF_31_1880"
                     /db_xref="GeneID:5654119"
     mRNA            complement(<920841..>923417)
                     /locus_tag="LMJF_31_1880"
                     /product="mannosyltransferase-like protein"
                     /transcript_id="XM_001685122.1"
                     /db_xref="GeneID:5654119"
     CDS             complement(920841..923417)
                     /locus_tag="LMJF_31_1880"
                     /codon_start=1
                     /product="mannosyltransferase-like protein"
                     /protein_id="XP_001685174.1"
                     /db_xref="GeneID:5654119"
                     /db_xref="GOA:Q4Q674"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="UniProtKB/TrEMBL:Q4Q674"
                     /translation="MPLLHDGDPVSGNTTAYVFLSNLLGPLVQSEDALCHRSANNSTQ
                     APAYQVHAVVVSGDAAASSVLGGALRGVLPDGVLHSGDVLPQGRPRDGLTPASSWHAW
                     ELNMDTVRAALGGAVRGGARCLGDRVTLVAPAAPAPDTTVEVLVDAALRTRGGRAGSH
                     FVVLSSFLGATRMPYTEPGDALETRHEGTGLLDALVRTATQRNGGRVAAAQCTILQHD
                     GDSGGWRNPPPRLTARELASLRVVDKGGMTGATHDGEVLLPYLTRRLSGYSAAEQRAS
                     WEEVVDAVSLHCGIFDRRVYDAVGGLAGALSEPAVRDAVSAREDHAMGAVDRGGWALT
                     LRMQEAYPAWQVWGSRATAVVRAGVAGVRTRPAVASLQRPVFSLLDWYGRAAYSVVTE
                     LQRRRVGVPWRLRGEDSHHSAERTAVVQNCLPPVIRYHTDFSAPCIGLNREAMAYIRP
                     LMERYGISVMGGEGRRSCPKSGDALLQLAYGGVGDLFSSVPSPATHSFFRDRLRRRAL
                     LVFQHCRAHRFFPVPRHRFHECPEVYIGHSMSELSNIQQKSIVPMRTRADEIWTTADF
                     FATIYRRNGVSPDKIRVVPEAVDVYEYDPANYARQPTMSRCANISLCDNRPSLTEEER
                     LQRYVFFSSFKWEDRKGWDVLLKAYWAAFGPSAPPELRERTTLVIKTRLTRLYSPELS
                     RDSVLHFIETWGRGGALPGMTSMAGYPHIIIVTGEVSAAEVVQMYANADAFVHPTKAE
                     GWGLPAVEAMAMGLPVLVTEWGGPLRFMERDSCFRIPVDGLEEVSPDSPYGYEEGMKM
                     AIPSVEKTAELMRYVVEHPEHARRVGRRAREYAVRELSEEAVADRMDRLFVDSVIGKQ
                     RG"
     gene            complement(<928359..>930089)
                     /locus_tag="LMJF_31_1890"
                     /db_xref="GeneID:5654120"
     mRNA            complement(<928359..>930089)
                     /locus_tag="LMJF_31_1890"
                     /product="peptidase m20/m25/m40 family-like protein"
                     /transcript_id="XM_001685123.1"
                     /db_xref="GeneID:5654120"
     CDS             complement(928359..930089)
                     /locus_tag="LMJF_31_1890"
                     /codon_start=1
                     /product="peptidase m20/m25/m40 family-like protein"
                     /protein_id="XP_001685175.1"
                     /db_xref="GeneID:5654120"
                     /db_xref="GOA:Q4Q673"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="UniProtKB/TrEMBL:Q4Q673"
                     /translation="MRAPPLAHDSLSTAHPSPSRSPLRPTPCALAPPPSATDADYTSS
                     PPPPPTQTHPFVFPLASSPIDHHRAVPSSSPHRRSLPLSLCPRCPSTTADRPLSPFCT
                     FATMSALWAQVRQTVESEWDKTIVPAISAYIEVPNQSPQFDPEWATNGLQEKAFGILI
                     DWMNAQNVQGLTYDYITADGRTPFLLVEIAGTEPTNNTVLMYGHMDKQPPLRPWAEGL
                     DPHKAVVRDGKLYGRGGADDGYALFAAVTAISSLQRHGIPHGRVVITIEAGEESGSPD
                     LDYYMERCKERIGKVDLMVCLDSGSMNYSQVWLTTSLRGVAIGELTVQTLTESMHSGV
                     AGGVVPDTFRITRELLSRIEDCKTGEVTIPEAHCEIPPNAVKAAEAMKTVPFKEQFAM
                     AAGVATVPGDNVELAIQNFWKPSLTVTGANLPDPQIAGNVIRTHTTVKLSMRLPPLVK
                     AEAALQAMKRILEADPPYGAKVAFKGVGAGNGCAAPELKPWLQEVLHEGSTEAFGNTY
                     ACQGMGGAIPFIGMLIDMYPEAQFVVTGLLGPQSNAHGPNEFLHIPYAKGLTYSIARV
                     VAAHLHNTPK"
     gene            complement(<930550..>930936)
                     /locus_tag="LMJF_31_1900"
                     /db_xref="GeneID:5654121"
     mRNA            complement(<930550..>930936)
                     /locus_tag="LMJF_31_1900"
                     /product="ubiquitin-fusion protein"
                     /transcript_id="XM_001685124.1"
                     /db_xref="GeneID:5654121"
     CDS             complement(930550..930936)
                     /locus_tag="LMJF_31_1900"
                     /codon_start=1
                     /product="ubiquitin-fusion protein"
                     /protein_id="XP_001685176.1"
                     /db_xref="GeneID:5654121"
                     /db_xref="GOA:P69201"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR001975"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="InterPro:IPR019954"
                     /db_xref="InterPro:IPR019956"
                     /db_xref="InterPro:IPR029071"
                     /translation="MQIFVKTLTGKTIALEVEPSDTIENVKAKIQDKEGIPPDQQRLI
                     FAGKQLEEGRTLSDYNIQKESTLHLVLRLRGGVMEPTLVALAKKYNWEKKVCRRCYAR
                     LPVRATNCRKKACGHCSNLRMKKKLR"
     gene            complement(<933806..>936352)
                     /locus_tag="LMJF_31_1910"
                     /db_xref="GeneID:5654122"
     mRNA            complement(<933806..>936352)
                     /locus_tag="LMJF_31_1910"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685125.1"
                     /db_xref="GeneID:5654122"
     CDS             complement(933806..936352)
                     /locus_tag="LMJF_31_1910"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685177.1"
                     /db_xref="GeneID:5654122"
                     /db_xref="UniProtKB/TrEMBL:Q4Q671"
                     /translation="MLLGSGGVADGVTAVAATDSIGYPMERPPASEGNLQLQRSKAAL
                     QDALEGEKHRRLQTVDVGGMVGYRRVTRPRNESVYGGLAPSSRSTKKQLTAADEQLCK
                     RLATSHNSSSSTLQHHSAPGVSSSVASQKVCNGNSTSLLSYKGARQQATKEDRDTDLS
                     AAACGGAVVDLRESSAVVLQPLDTLQDPPLDEGKVHPNGKGDYSPSLTSDTSYPGTAA
                     AAAAIQVPMLESRGQPSCRRSSRVSSLLSSHATCITTAKPSFKSCSAQPSGLHAVGSS
                     RSLTGSRIKCPRSVPGSAVVYADDVTGVNERHQLLRRMSSSCNLSIVWIPPPLCEWVK
                     PGEACSVKANSTQSRRASSAGTPVAQARVLGAPCRLPSTTTPHKKQETSRARSSHSEA
                     SSGFAHMREKSDEERHILQCWLSGTCGSFTHANKPKMAPAAERLPIGHAADSDRNGAD
                     SHQLPFREQAARTSESATQDSPSASSRREALSAVTPTLGEVLERNRANLKVQPNAHPD
                     AAPYSPSAAYTRNGNRWAAAQAHLPAFTYSAVCAAAQHPYYAPGQQQQHPVPYGHTYD
                     VAYHDDSQASSAEAEANPYMHGGSGGFLPALGHAKPSCVRPVGGIKANKWRAPVPPAK
                     HRVVFELLDPVIPARPRPTCRQSQLPRRPSQRFPQRSASKSLGSSQQERIGLAEVEAG
                     ASPIQPVHQQALSLQRENAPAATSDRGDMTLTDLSEDEECALAHNYPAVAPPRTAAAA
                     DDTVYATVARKRKRDLHKRKAQQNVRLCRVFAPYMASLRAGPGAGGRGRAMQHKQKRR
                     KNGRLQHQRGSSNAQDNLRSINYAALATECDPLDHLLSRHGFWGEAMTRL"
     gene            complement(<940976..>944908)
                     /locus_tag="LMJF_31_1920"
                     /db_xref="GeneID:5654123"
     mRNA            complement(<940976..>944908)
                     /locus_tag="LMJF_31_1920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685126.1"
                     /db_xref="GeneID:5654123"
     CDS             complement(940976..944908)
                     /locus_tag="LMJF_31_1920"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685178.1"
                     /db_xref="GeneID:5654123"
                     /db_xref="GOA:Q4Q670"
                     /db_xref="InterPro:IPR011016"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q4Q670"
                     /translation="MHASLQFFQLLPRSQRTPMMRFHARARGNAAPMRSRVSTAITAA
                     LLSLLVVAACLVTTTVSATPPADAEDRQGATLTLLASATAAKTARRQTSVLDRFWRHS
                     REEQNTLIETFFGVPLTKVNIDTISYTAREITPVADLKLDAHPPGQLSRSPMLTATGS
                     GVQLAASLSLQEHLTLTTQADASNGRLVSKLSVVHATSVATMNEPPSAAVAQAQDPAA
                     QMSVLQQNHRVASPAITQPRRHLKSSAQASAIESLRSGAIGVNKSHLRVSGIASRRCT
                     DLKREAEKVVRAVADAKGGYSAIKDYSSAKMLAAKKAAGSLMRTMGNHVKDTLINVNS
                     TRALLPITIVGSGNTVVKFNGEAGNMIEAVVQLKDHRYDKLVRRDNCYGMYLQVELRN
                     HYKLDDGAYNSKDTATVVAMTQTRDYVGRNTWIKMESSAKNSDIDDNTRPDVPIQEEG
                     SSRWADFWDTFAPMLDNSAMCKVLQSVSMRVEKVPVTEPYYIILHSTTIPSLENPQND
                     TSASRTQVSRFDDSHYTCELNLFFNEEPAARLGRLQLIFAFVLPLIVLFLPLPFTMRR
                     ADLVQQYMVESDFAEWIWLLPLLLRRKMVEALKAAIEWILSLRSAYQQRVLRNQLLRQ
                     EQAHQGTVAAQSATEQEQPSQQPGVQHFGWGAAATGAPSLETPDLTGFHASAAADAQT
                     EPSPPRQQYESCTQCQFHEEDASFSTRSSRSTCSTPTRASAGSYSDESHDNAYFHDRG
                     HHTHGGRNVGASMASHSPCSSDALMGDVRCRSSMTGRTHGTRRHRHHAGESHAVCEAA
                     TAVSVHVPPEPDVTGHWWEGNQSGPRARSNGHDLLFTTEELVDAGCSLPTRKQHQHAA
                     GAQRPTATDAIQTVSMRPREEMEAVKSCGGAVDGVPAAGASAPMCTGITAPSAAAAAA
                     RERAPVSSAANAVPHEVEEEEESFCRICREGSDIAPLIVPCACTGSVRFVHAMCLDRW
                     RIESAKRNLANVNHCEICKEPFRVNIQRSTLLWESSQQILNGVCLFLACLIMIVTTTT
                     LMHIVLGEMSCSASYHQVAYSAMFRFEGISLTFFVYCLAVLLVLFANFIVYSWFRSQP
                     DVEEYVEEMHIVPPFYTRRNVLLIVLVCFVLLAQAHAMGYLLKYFLYRTSNIAWNWET
                     SPLMGGVLFSVFTIFTTIFCGWVRDMYTVHVVHRDRGDAPATDVVVVPIGDADRAEPA
                     ADNSNDGAAPAPLSQSIIVAGTAAPPASLTGTSVTAASPPPPPFPSPATPGVSPSSPA
                     LPTMPDSAAQQRPADEDPDYTRHFGIPPDQRVIHAFEYCPPRRKMPQR"
     gene            complement(<946646..>948631)
                     /locus_tag="LMJF_31_1930"
                     /db_xref="GeneID:5654124"
     mRNA            complement(<946646..>948631)
                     /locus_tag="LMJF_31_1930"
                     /product="putative dihydrouridine synthase (Dus)"
                     /transcript_id="XM_001685127.1"
                     /db_xref="GeneID:5654124"
     CDS             complement(946646..948631)
                     /locus_tag="LMJF_31_1930"
                     /codon_start=1
                     /product="putative dihydrouridine synthase (Dus)"
                     /protein_id="XP_001685179.1"
                     /db_xref="GeneID:5654124"
                     /db_xref="GOA:Q4Q669"
                     /db_xref="InterPro:IPR001269"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018517"
                     /db_xref="UniProtKB/TrEMBL:Q4Q669"
                     /translation="MAYNQKQLEAYRQLIAEGKPFRSITCPYCNGRRDATVKHVHPST
                     KPPSAWGFWNDVLVRKYAAVQSPAARANMEATITDSSAVRGAPRRVAEEGMSHEAAAG
                     ALPLDATSGPRMFLVGPMVDQSELPFRMLCRQYGATVAYTPMLHAKSFADGAVYRSHF
                     LSVCPPEEVKAAMQAPLASPSVAAGTHGGGSSMRGGVGAGSEAAVADTALVDRPCIVQ
                     FCGNDADTVLRAARFAVLGEQAAAAEQTGSSRGASAAPVYPVHVRVNGLSCSEKAPEH
                     LLYQCDAVDVNLGCPQGIARRGHYGSFLMEDWELIHTIVHTLHVELEVPVTVKIRVFD
                     HPGHAEAAGDNRECATDCSFAAFEENDAVCAAAGTSREPLKEAFDEALTILYARMIRD
                     AGAQMLCIHGRTREMKGQQTGLANMELIRRVRDALGGTIPVISNGNVRTYDDVIAHLQ
                     ETRCEGHMCAEPLLWDPKLFSNPSQPVMPGRTHGADKATRLSALHTALVYMQWVRHYP
                     VDIGFVKAHLFKMCFHSYELHTSFREELGQLKTSAAKTKKVEKGNGMEGMGAMRLGAA
                     LRAGDSAVPSGAVHEEGDDEESAAVAMAAAAASVSASAFKQCVDAIEAHLLALVEAER
                     RCSVDGEQPKSAQTEKVKAKQEIVDVWAEGDNLGIDF"
     gene            complement(<951845..>953302)
                     /locus_tag="LMJF_31_1940"
                     /db_xref="GeneID:5654125"
     mRNA            complement(<951845..>953302)
                     /locus_tag="LMJF_31_1940"
                     /product="putative transcription like protein nupm1"
                     /transcript_id="XM_001685128.1"
                     /db_xref="GeneID:5654125"
     CDS             complement(951845..953302)
                     /locus_tag="LMJF_31_1940"
                     /codon_start=1
                     /product="putative transcription like protein nupm1"
                     /protein_id="XP_001685180.1"
                     /db_xref="GeneID:5654125"
                     /db_xref="UniProtKB/TrEMBL:Q4Q668"
                     /translation="MHLSATAAALLCVVSAAALGFGIIFALFALMYFGCLRIPDGGVA
                     NGNRRWLRERNAPEQLGSSSSGEAAAVERQWKGIPLNSRPPRLTPEQEILREKAMEKY
                     KRRRAREERRRAHQERRSQYQAAREARMASVREGAREGAVSEDEFAGDSSDTSQTTLT
                     SGATTVRTTSTVAYGRSSYLRPPSGDCTVHVDEHDDNDDRRSSRSGGSRSSRGSARSR
                     ASQGTVATIKSYLRHRQHQRLRRREEQQQLELFNQWTYAQMVSSSELSSSSKSVSASS
                     QHDGERSATGGGARHRTRTACGSRSCNHAHSGRTASVASSAPRPLEDVLGTDCESYPF
                     LVNVERGNLEGFRVDTQRPSLHQSAPTANTSRCDTVFPGAFTSSKGTTGATSPHVASA
                     EHVEYAGRGESGMHAGEHVDHRQPRRHKRTWKDVEHNVALSGFFNTSTNNNMASVDTA
                     SRSHYNDGEAPAPSLSAPEEPVDRSLGLHEPICHE"
     gene            complement(<954972..>956690)
                     /locus_tag="LMJF_31_1950"
                     /db_xref="GeneID:5654126"
     mRNA            complement(<954972..>956690)
                     /locus_tag="LMJF_31_1950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685129.1"
                     /db_xref="GeneID:5654126"
     CDS             complement(954972..956690)
                     /locus_tag="LMJF_31_1950"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685181.1"
                     /db_xref="GeneID:5654126"
                     /db_xref="UniProtKB/TrEMBL:Q4Q667"
                     /translation="MSSLILISSIAGAILAISSIIWCVTHAYSALRAPSRRVYADAES
                     VTLQEESAFGEAPSAQVGVGRGDDGAAHNSGQRPSQNLRDNYADRDAIDYRGEGNNNY
                     YGLDGSVRPASPNAERVEGIPIETRVRPRRNLPRNRIVVHHGDQDVCLDFRGVERVPQ
                     AGPPPLTVEEKQRLEDEQNRIASPEFYGRAEYEGRRTSDRNTPNMRLSSSLLQELQLQ
                     YSMASASRGALHNYATESSMGSMSFRPGSPAGSARHARHGWQTPTPNSVSLQSGSIGS
                     LHFFRRRKKSPTRHDAGGSTSPSQALYQANSFSSAPRNRREDLESTSDDFEDVSLHNG
                     PVHLRLGQLSEFLAKKEQQTLSQLSPTSRLGNVNGFDQISLHGTSPVFLDRQVSTRAS
                     VASVSPVGLGGGCAAAGIMTSSYDQSVAPYPPHHPTMAAGLPPLNASFHSYHSWRSAS
                     VNSPVVGLAGATSYPHVDSSSPLSGTHSGAEGAGVDARAAVQPPHTALSPRKAAENAH
                     HQTSLSGAGQGRGSNAGAHACHVDTFSPPSNRWSSGLRSPFSLPGSDPVTAPCSASSG
                     GTRAQA"
     gene            complement(<959766..>960326)
                     /locus_tag="LMJF_31_1960"
                     /db_xref="GeneID:5654127"
     mRNA            complement(<959766..>960326)
                     /locus_tag="LMJF_31_1960"
                     /product="tryparedoxin-like protein"
                     /transcript_id="XM_001685130.1"
                     /db_xref="GeneID:5654127"
     CDS             complement(959766..960326)
                     /locus_tag="LMJF_31_1960"
                     /codon_start=1
                     /product="tryparedoxin-like protein"
                     /protein_id="XP_001685182.1"
                     /db_xref="GeneID:5654127"
                     /db_xref="GOA:Q4Q666"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="UniProtKB/TrEMBL:Q4Q666"
                     /translation="MEPNFFNNSGLMLLCKDGSAVRAIDVLKDAEYVLMYFSAHWCPP
                     CRTFTPMLKSFYETHHAKKKFEVVFMSSDRSEEEMMSYFRESHGDYYCLPYADARSMA
                     RVWGDTYKFKTIPTLLVFENANPRKLIARCGREMVIKDPLGNLFPWPDADAQQPAESF
                     IFDYTRKAAIVLGISVLLYSLISRSL"
     gene            complement(<963303..>963845)
                     /locus_tag="LMJF_31_1970"
                     /db_xref="GeneID:5654128"
     mRNA            complement(<963303..>963845)
                     /locus_tag="LMJF_31_1970"
                     /product="tryparedoxin-like protein"
                     /transcript_id="XM_001685131.1"
                     /db_xref="GeneID:5654128"
     CDS             complement(963303..963845)
                     /locus_tag="LMJF_31_1970"
                     /codon_start=1
                     /product="tryparedoxin-like protein"
                     /protein_id="XP_001685183.1"
                     /db_xref="GeneID:5654128"
                     /db_xref="GOA:Q4Q665"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="UniProtKB/TrEMBL:Q4Q665"
                     /translation="MSHLFENAAVELLRKQGTVAAAEALAGKKYVLIYFSAHWCPPCR
                     SFTPKLKAFHEKHHVNHNFEVLFVSSDSSPDEMRTYFSEAHGDWFALLYKDAQTIGRD
                     LAQQHGLFSIPSLLVLENNAERRVVTSYGRDMVLRDPDAQSFPWHNAAAIINAARRSF
                     MKKMAVIVVLAILLLALLIQ"
     gene            complement(<965128..>965790)
                     /locus_tag="LMJF_31_1980"
                     /db_xref="GeneID:5654129"
     mRNA            complement(<965128..>965790)
                     /locus_tag="LMJF_31_1980"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685132.1"
                     /db_xref="GeneID:5654129"
     CDS             complement(965128..965790)
                     /locus_tag="LMJF_31_1980"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685184.1"
                     /db_xref="GeneID:5654129"
                     /db_xref="UniProtKB/TrEMBL:Q4Q664"
                     /translation="MARRLPQQRTTYAHTFTPFLQRCQQELSNTLESTKRAKPERVRV
                     AQEIGGMELYKGALDGLMAFTLTELEYAEAGVEEVVEKRSKEVRSSMEPTRRDAGKSE
                     LWSRLVGHLMWPLLVCVSIEAFSFPLSRKQVCSGIVAQRCFALCAVGRCYGTTSASSP
                     SSSSFARCQSFPVSAPACNHMCMATTSAPPPSPSSSLAFAISHVDTTSSCFATCVLLL
                     SL"
     gene            complement(<970210..>972339)
                     /locus_tag="LMJF_31_1990"
                     /db_xref="GeneID:5654130"
     mRNA            complement(<970210..>972339)
                     /locus_tag="LMJF_31_1990"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685133.1"
                     /db_xref="GeneID:5654130"
     CDS             complement(970210..972339)
                     /locus_tag="LMJF_31_1990"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685185.1"
                     /db_xref="GeneID:5654130"
                     /db_xref="UniProtKB/TrEMBL:Q4Q663"
                     /translation="MSEGNATQPTRRHYPHLSRLPVAHHNCKGLQRAVRMDWWLIVRT
                     AASPLTHTHTRRYSSSSVQPLPIKACEHTDTASALSTAPSALSGDNAPAHGEGDDGAM
                     SRPGNRRSPSSMRHERSLSGWPQSPRDDAVSVAPFRVLSHSQMASHNQMLLSFVSGES
                     PEDAPQSTFGDCPATGEPTPPRSGSPVSALWRRVNSSRALHPASSARRLLTLSPQSHS
                     NDLNVLERGDGGVSADFSKASGYSFSPLDTYLLPPSTESPQRPQPPRPASIGPEYAVF
                     RPLVRFTSNGMASHHTTLEQDQSIGAGESVELNDGRQSGHQKAADASRPASLHTSSIA
                     ESAITPAARRNAATGAERAPQPQPEVRLRLPVAKEGVALLNPIHNVPPQGELHRLLRV
                     YRRELLHQFPQALRGPPLVVRLADGAEASETIDEAECTSDWEDYTNGATSGAGRGGLH
                     RYRTPLATTAAVDVPTVEVNASRPHELYSRLVSDPVGCAVEVVHPGAATASAASFMRS
                     LSVPCSTRQTGGRGGFHVNRSSGAAVLGVSRGSCLSGGGRSACEASSSRSSSQGNPTH
                     GDGAMPVPSRSCAELVANGFYNAEARENKVQQDELQRRRAVAEYGEASYYSLEAPTDG
                     TTQMNGLQSRSSVHVLGVAKAASLSDILYEEEQHMQGLMQLPQLNCAQCAAGCSEPVR
                     RRISASAMVSPQSTPAALQAWMQRRCR"
     gene            complement(974522..976376)
                     /locus_tag="LMJF_31_ncRNA3"
                     /db_xref="GeneID:12981440"
     ncRNA           complement(974522..976376)
                     /ncRNA_class="other"
                     /locus_tag="LMJF_31_ncRNA3"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460987.1"
                     /db_xref="GeneID:12981440"
     gene            complement(<979311..>981221)
                     /locus_tag="LMJF_31_2000"
                     /db_xref="GeneID:5654131"
     mRNA            complement(<979311..>981221)
                     /locus_tag="LMJF_31_2000"
                     /product="GP63-like protein, leishmanolysin-like protein"
                     /transcript_id="XM_001685134.1"
                     /db_xref="GeneID:5654131"
     CDS             complement(979311..981221)
                     /locus_tag="LMJF_31_2000"
                     /EC_number="3.4.24.36"
                     /codon_start=1
                     /product="GP63-like protein, leishmanolysin-like protein"
                     /protein_id="XP_001685186.1"
                     /db_xref="GeneID:5654131"
                     /db_xref="GOA:Q4Q662"
                     /db_xref="InterPro:IPR001577"
                     /db_xref="UniProtKB/TrEMBL:Q4Q662"
                     /translation="MSHVPAVLWRMELWLCALFIYAAFTTAAAPSSCGHSQIVHKQGH
                     LPLTYAALRNNGNGLRYQVEMDLERWNGSATDEQRAVEPQATVTISSDREDSEWAPIR
                     IAVFMPDLEDESKYCTAIGQMRPDSSGSLVPCTSNADLLTDAKKTVLINSILPQAVNM
                     HAQRLKVRRPAASTSIVVNSMPGSYCGSFTVPTAHRTTGVPDADFVVYVAAGPTSTPK
                     SFIAWAVTCQYYPNTATVTSRPAVGVMYFNPRYLPTSEGETQEHVDRYGGNPSGSTNR
                     LRRVASHELLHALGFTSSVFKARGMFATVPSLRGKRNVPVLNSSAVRAAAKAKYGISD
                     TEVFYGVELEDQGAPGTSLSHWKRRAAKDELMAPVFGLARYSSLSLAALEDMGFYKVD
                     FSKAEPVALGATAGGKLFTEPCLTEGTSNTPTVFCDSLSASVRSCTADRLSIGRCALT
                     TYSSALPSYAQYFPNQPTLGGSLSHSDYCPVIQPLSNTGCSGGSLGAMPGSITGDNAR
                     CFDADNLLVKFTFTQPGAICAKVHCKNASRTYEVLVIGANSWLSCGAGGTGVTVQPAV
                     SSPNVFLKGGRIACPPYDDVCYANPVAFAEVEAPPTTSTTASPSAATAATHGMVVSGL
                     VAVAVLLGVCIC"
     gene            complement(<983697..>985517)
                     /locus_tag="LMJF_31_2010"
                     /db_xref="GeneID:5654132"
     mRNA            complement(<983697..>985517)
                     /locus_tag="LMJF_31_2010"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685135.1"
                     /db_xref="GeneID:5654132"
     CDS             complement(983697..985517)
                     /locus_tag="LMJF_31_2010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685187.1"
                     /db_xref="GeneID:5654132"
                     /db_xref="UniProtKB/TrEMBL:Q4Q661"
                     /translation="MECINQESASARSATNVASGVDEPAVAAVPFSPLQVELQRPDPL
                     SKSLCETVQRSQSSASNAAEANDTDVPPLLGGDPAAAHSSSIISSHDASFYNSLMVSR
                     AENLDALESCTSRTGRNLISQSAGAAAERYAQEQSPSAELRLSTPRRRLAPNSAVSQG
                     GKEEVAPNVEAETASQQHVSSGAAVRAVESVVAAAGPHSVGAEDHSSGSQAHAHECLT
                     SPAGNVKTLEGLLDWRAHLSAWQQSVGTQESHHTDGNNNTVKHMCNDQASERNMVGRV
                     NRKGALASEGSQVSSRSECLQGCHGGCHRTPAASSSSPSTDAITSAESNAAGGDTIAV
                     THNPQGQHSHPPSGAASQTEVVDAFFTKESSSASSSHPRSPAQVDGHPWSTQLSAHLE
                     QHFSTGDNLATQAPPTAHVTIIDGRVLRERGGTGKSGRPRGAGSPTLSLSRCVEGIGL
                     EDHHPPNSTGHSSPYSHSALPHGVERRSWVRSALPPSAPTHILLHSSPVGGFDGCRSR
                     DNCNNPHSGSNKSTIGSAGIQRQHSREASLSQATPRTPESWRHRVKAMPPMAKPLREL
                     AVEEKYPVFSVPVDEETNKAVVAFVSGLVLLICLVFICAM"
     gene            complement(<989146..>990876)
                     /locus_tag="LMJF_31_2020"
                     /db_xref="GeneID:5654133"
     mRNA            complement(<989146..>990876)
                     /locus_tag="LMJF_31_2020"
                     /product="succinyl-diaminopimelate desuccinylase-like
                     protein"
                     /transcript_id="XM_001685136.1"
                     /db_xref="GeneID:5654133"
     CDS             complement(989146..990876)
                     /locus_tag="LMJF_31_2020"
                     /codon_start=1
                     /product="succinyl-diaminopimelate desuccinylase-like
                     protein"
                     /protein_id="XP_001685188.1"
                     /db_xref="GeneID:5654133"
                     /db_xref="GOA:Q4Q660"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="UniProtKB/TrEMBL:Q4Q660"
                     /translation="MRAPPLAHDSLSTAHPSPSRSPLRPTPCALAPPPSATDADYTSS
                     PPPPPTQTHPFVFPLASSPIDHHRAVPSSSPHRRSLPLSLCPRCPSTTAHRPLSPFCT
                     FATMSALWAQVRQTVESEWDKTIVPAISAYIEVPNQSPQFDPEWATNGLQEKAFGILI
                     DWMNAQNVQGLTYDYITADGRTPFLLVEIAGTEPTNNTVLMYGHMDKQPPLRPWAEGL
                     DPHKAVVRDGKLYGRGGADDGYALFAAVTAISSLQRHGIPHGRVVITIEAGEESGSPD
                     LDYYMERCKERIGKVDLMVCLDSGSMNYSQVWLTTSLRGVAIGELTVQTLTESMHSGV
                     AGGVVPDTFRITRELLSRIEDCKTGEVTIPEAHCEIPPNAVKAAEAMKTVPFKEQFAM
                     AAGVATVPGDNVELAIQNFWKPSLTVTGANLPDPQIAGNVIRTHTTVKLSMRLPPLVK
                     AEAALQAMKRILEADPPYGAKVAFKGVGAGNGCAAPELKPWLQEVLHEGSTEAFGNTY
                     ACQGMGGAIPFIGMLIDMYPEAQFVVTGLLGPQSNAHGPNEFLHIPYAKGLTYSIARV
                     VAAHLHNTPK"
     gene            complement(<991337..>991723)
                     /locus_tag="LMJF_31_2030"
                     /db_xref="GeneID:5654134"
     mRNA            complement(<991337..>991723)
                     /locus_tag="LMJF_31_2030"
                     /product="ubiquitin-fusion protein"
                     /transcript_id="XM_001685137.1"
                     /db_xref="GeneID:5654134"
     CDS             complement(991337..991723)
                     /locus_tag="LMJF_31_2030"
                     /codon_start=1
                     /product="ubiquitin-fusion protein"
                     /protein_id="XP_001685189.1"
                     /db_xref="GeneID:5654134"
                     /db_xref="GOA:P69201"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR001975"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="InterPro:IPR019954"
                     /db_xref="InterPro:IPR019956"
                     /db_xref="InterPro:IPR029071"
                     /translation="MQIFVKTLTGKTIALEVEPSDTIENVKAKIQDKEGIPPDQQRLI
                     FAGKQLEEGRTLSDYNIQKESTLHLVLRLRGGVMEPTLVALAKKYNWEKKVCRRCYAR
                     LPVRATNCRKKACGHCSNLRMKKKLR"
     gene            complement(<993674..>995176)
                     /locus_tag="LMJF_31_2040"
                     /db_xref="GeneID:5654135"
     mRNA            complement(<993674..>995176)
                     /locus_tag="LMJF_31_2040"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685138.1"
                     /db_xref="GeneID:5654135"
     CDS             complement(993674..995176)
                     /locus_tag="LMJF_31_2040"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685190.1"
                     /db_xref="GeneID:5654135"
                     /db_xref="UniProtKB/TrEMBL:Q4Q658"
                     /translation="MPLYAPLGIRFSDDVNERARLERQRIARLNNILRHGSDEQRRQA
                     LKMKPLPLPGDPEALAVSGTAVLDLPGDADECLDPHNETGVFDPLDAVAQRYGGAQYN
                     DDDRRAAERGVDYSVFMEVLCPNGSSLLESLPLEPRTPPQHLKGLRGESKISQFESAL
                     SSPRCGLRTRLPSTAVAAAMPEASLSLGHNAFVARGPPSASFVNTSTVSEASVQSGLD
                     ETYVDAPVTLGSEAASLRASSAENGFATSTHGVADPASDAARATAATHAEDDDTTPGV
                     FVSAGSFSLAASHRSSRWHSLLSFRRSPSGSSKASHTDSGHRNARGVAHLSLTRSLSQ
                     RALKSSSELSLPTSGATSAQLTPLAATDGCDLGGRVIFTDRFVKAQSHTALPTMISAF
                     KQYMRSASSTAACSSPAHSQTLDIYTPSEHWSFLQHQQLQNAHQYLGPCHRGIPLKSD
                     NTNKEIENCVLEAGQCIRPTFRRMDPAELYGTSHYISSAFIKVTKQSTNI"
     gene            complement(<997684..>999237)
                     /locus_tag="LMJF_31_2050"
                     /db_xref="GeneID:5654136"
     mRNA            complement(<997684..>999237)
                     /locus_tag="LMJF_31_2050"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685139.1"
                     /db_xref="GeneID:5654136"
     CDS             complement(997684..999237)
                     /locus_tag="LMJF_31_2050"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685191.1"
                     /db_xref="GeneID:5654136"
                     /db_xref="GOA:Q4Q657"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="UniProtKB/TrEMBL:Q4Q657"
                     /translation="MATLADGASSEAFTAHSDTHTLTGDQVNKIKALICLMKERYDPL
                     PPQLETYLRLIPPTSGAASGKADGDKKTGPRRSDDDPMSFYCTSFLMSREWDVQKAFA
                     MMQEVVAYRAVNHLDEQSHFPPAFSVRGWSTEDVCRALERSPRKVGERIDRVCAGVAQ
                     GLICGIHYWDKNGRPVFYMVIDSFDEAELMRQLKQMASVGKSHVDVMWEYMVHVLSVT
                     ESLVLYQLIQRGAPLSGRPLTSKTTDEEAPAWDLSEGAVTMVYDMKRLTLKMLWKPII
                     DMFCDNSKTFFNYYPDRIHRIVCVNSPSLVRYAFLLVRGVLPAAFQRKISFVSPHDTL
                     ATLETMIDRKYIPHFLGGDCRCEAHDGECLSGYDPRQTGRTRRTVARTDASSEGNDEA
                     PTVYVKLAAGHECTRVFPVNASEVVVWEFAVEGGGHDIIFTTFFVPQSAASGMQWTQV
                     ELSKLSSYMVTSEALAKGSDAFAVAEDGVVVLKWHNRRHWFASKRLQLRAYKEGAPST
                     LHGQASHPE"
     gene            complement(<1002596..>1004071)
                     /locus_tag="LMJF_31_2060"
                     /db_xref="GeneID:5654137"
     mRNA            complement(<1002596..>1004071)
                     /locus_tag="LMJF_31_2060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685140.1"
                     /db_xref="GeneID:5654137"
     CDS             complement(1002596..1004071)
                     /locus_tag="LMJF_31_2060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685192.1"
                     /db_xref="GeneID:5654137"
                     /db_xref="GOA:Q4Q656"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="UniProtKB/TrEMBL:Q4Q656"
                     /translation="MVAKQSTAKGGSRYPPLTADQEKEVTELMELMRTKYDPLPQQLL
                     ALQRYNPQMEGTASEGAVAGTFFSPIRNYCYYFLISREWDRQKSFEMMQLSVSYREKN
                     ELDSRAELPSAICCRGWEQEKVRIALDKPARPTSQRLDRLSAGIEQYFTFGLHYWDKH
                     GQPVVYLNLGSVDEPGLLKKLKQLANIGQTPNLVMWELVQHLIGVQEQLLFYQQMQYA
                     AGTLKAEADDGLIRSATIVIDLNGLTYKMLWKPALDLFMNMLQTLFQYYPKCVHQILL
                     VNSPPMVMFAYKIVRGALPHGVQRKVHIVNVADTPATMQSFIDAQYVPDYLGGLCHCE
                     GGCVRGYDPHQRGTMKDSGTAKSDTRNVQSGDQDDEAGVVTEEITLKAGQELKRAFSL
                     KRAESVVWEFVSANGRDVAFSTYFVPKKAAPSIDTSKLPTSMLESYVVSKASPSEGSD
                     KYTASDDGIFVIVWDNKKSWFTAKYLQLNVFKQAATLTDGA"
     gene            complement(<1005545..>1006990)
                     /locus_tag="LMJF_31_2070"
                     /db_xref="GeneID:5654138"
     mRNA            complement(<1005545..>1006990)
                     /locus_tag="LMJF_31_2070"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685141.1"
                     /db_xref="GeneID:5654138"
     CDS             complement(1005545..1006990)
                     /locus_tag="LMJF_31_2070"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685193.1"
                     /db_xref="GeneID:5654138"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="UniProtKB/TrEMBL:Q4Q655"
                     /translation="MRSHRACAAPHSRRHGPIILQDQKNGKGTKNEDVHSSIAETRVA
                     FILRACVCVCVCVCVDGWRKVVHFWLKRRRLVVECCRLATLPTSPLLPRFGAFVSILV
                     VGAPPTPLAHFVCIVTSIALLEAIMSAAASAPRHRRYVDMTPEREQKITQLVQLMKET
                     YDPLPKQLQILLSYSPTSEDAPTPHNTTRSYCYCALISCQWEVQKAFEAMKKNVAYRL
                     QCHLDERSELPSAVSIRGWNEMEVVRALGKEERAGNQRADEIIAKLDRYFPCGLHYWD
                     RYGQPVFYLMLGSVDEENLLKELKQTTAVGESVDAVMWEMLQHLLGSGEWLAYYQQMQ
                     YDAGQLKVDASEGLIRATTIVVDLLGFTYKMIWKPAIDLFVTCLKTLFAHYPECVHRI
                     LVVNAPSMVTLAYGIIRHVLPGTVQAKVHMAKPSASLALLQEHIEKQYVPEFYGGACH
                     CQGGCVRSYRPKNAANGTTTVDQDDAQSAAE"
     gene            complement(1007894..1008265)
                     /locus_tag="LMJF_31_ncRNA4"
                     /db_xref="GeneID:12981441"
     ncRNA           complement(1007894..1008265)
                     /ncRNA_class="other"
                     /locus_tag="LMJF_31_ncRNA4"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460988.1"
                     /db_xref="GeneID:12981441"
     gene            complement(<1009373..>1011850)
                     /locus_tag="LMJF_31_2080"
                     /db_xref="GeneID:5654139"
     mRNA            complement(<1009373..>1011850)
                     /locus_tag="LMJF_31_2080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685142.1"
                     /db_xref="GeneID:5654139"
     CDS             complement(1009373..1011850)
                     /locus_tag="LMJF_31_2080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685194.1"
                     /db_xref="GeneID:5654139"
                     /db_xref="UniProtKB/TrEMBL:Q4Q654"
                     /translation="MSSVIDVPCTRKNNPFFSKGNHQRETPAPPIDESMVRERLSANL
                     PDSFNYRRNTLNTGRGRQRRSHRPHSRSSSSNSSNSDRNATPPGRAGRNGPGNERRSR
                     PPHTHTRTSSSTSSSSPRSSSMSSNGDESYAFHARLVKVGCSAHGGESAALSQCCDTV
                     RDTLQLLERAQLRTGDGDGGNGFFWLDLHGVPPPPELHDAGCGDAPMSALWAALGLQA
                     STVHTLAAVCEQRQAHPRPARSSLDNVYEEELVGLSSPADRVLQVEPVQGTSVKRTSR
                     GGVAEPTHYVALELATLLTSVQASEAMSEAAWESALLARASLAEFANEPLNDLTWTEN
                     FARGIRGLPAAAAAMNRYVSSVSSFTLRQVTQASLHGREVATTPLITSIYVVCFPTGC
                     VTWCPASTLGLTSADRRAQRSAPAAEGQRRRRRSPHDPHEDAAAERSRYDALYMGGGN
                     CEEVQYVKSWEQLQASVFSRLRYMSQLSKGTASPSSPHARPAGTSGELSAPPMSASAG
                     SVLCTSVFVSLLLSSVCYAYLPNTVMFLGEVDTIDSMLPLIELDCESDQADALRRVLL
                     LRRRLAVHRRLLFQKICLLEALDRPTMHTVARFIRSLTSPSRTARDSCAGSVADQFKS
                     AQQGAASGGVGGSSLTHRIHTEVPWANVADEQMGDRTGSGKGFEALDARGSDGVAPPN
                     NPSNCHLAQRVTQGATPPQHHMMTSPSLNAIHKSIMGVLHNLEAARTVIGNATLIYNS
                     KVSFTNSRTSETADYYSLFCQYVLLVLLPLNIVASHWGMNCPVPFMRVEGTTPFWSIV
                     GVIAFISVAGTIFPIYAYLTRKIYLIA"
     gene            complement(<1014453..>1015604)
                     /locus_tag="LMJF_31_2090"
                     /db_xref="GeneID:5654140"
     mRNA            complement(<1014453..>1015604)
                     /locus_tag="LMJF_31_2090"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685143.1"
                     /db_xref="GeneID:5654140"
     CDS             complement(1014453..1015604)
                     /locus_tag="LMJF_31_2090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685195.1"
                     /db_xref="GeneID:5654140"
                     /db_xref="UniProtKB/TrEMBL:Q4Q653"
                     /translation="MPAAGDGVCGCRIHRQNRQHSSPIQHARRSLSSSLPDTAVRLAD
                     DFRPRSTKSQLIRRDGGRYNEPYAAIVERDDAVSVLCVQLTRQQVLVRHMPEAEWNRI
                     VREGEKVHPGVEGKTSLHIVAPPEMSTLPAGAAEAADEPHSPEQQASPRTAAAEPPVF
                     DYFVAPENRIEKLANTRKASFFSQLRLRARYSRKELERVAREDRRAMLSVERRNIFLR
                     QYQRDMQQRMASTPLYTVGRELPEEFVQLFFMSQDHHGTMTRRPERSDTARTPQAQHS
                     LQRSAGGRYLFNIDRSFTCFGERLPFAGQAPVDGFVVVTVAPTADAFTSVWGLWDEVH
                     RLSSDAEEKPFVPCDYGSADYLPRAGPDDPRDPGECSEKGEAGTTASAA"
     gene            complement(<1018725..>1019891)
                     /locus_tag="LMJF_31_2100"
                     /db_xref="GeneID:5654141"
     mRNA            complement(<1018725..>1019891)
                     /locus_tag="LMJF_31_2100"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685144.1"
                     /db_xref="GeneID:5654141"
     CDS             complement(1018725..1019891)
                     /locus_tag="LMJF_31_2100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685196.1"
                     /db_xref="GeneID:5654141"
                     /db_xref="UniProtKB/TrEMBL:Q4Q652"
                     /translation="MSRSPKQHRRQQAAHVQQLSPTELCETTPILRRASSVSPLQTSG
                     IFQQLDVRNSQEEVGIRLPFFEAQPIPGVSSLATPHAFTHNSHYSRTASLASSTKDSV
                     ALASGCFLHNRGARPSVHCAPTNQRDSQLAMVPLPSTSFPHLPLVGDENNASFLASIV
                     TDPTSRRSSYSSLAVQRRAHNDASPVSLGNPSVIRHLTKKRERRMSKAARSGQKSRSS
                     SIASCTKETTQRSPMEDQIRGSQLSLYKLFGSSAAASPIFSAARRKSSRGRKAQPETG
                     VTTDVLRNDDSFSYILHREEEETAVRTKSGVKMIRRTTQEVRLPISVDSHRRSDSALD
                     RGDASRGNSRGPSSPAPFNETSSAVPSLFSESSINDMFSGILLVGDERQGKADQ"
     gene            complement(<1024737..>1027763)
                     /locus_tag="LMJF_31_2110"
                     /db_xref="GeneID:5654142"
     mRNA            complement(<1024737..>1027763)
                     /locus_tag="LMJF_31_2110"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685145.1"
                     /db_xref="GeneID:5654142"
     CDS             complement(1024737..1027763)
                     /locus_tag="LMJF_31_2110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685197.1"
                     /db_xref="GeneID:5654142"
                     /db_xref="UniProtKB/TrEMBL:Q4Q651"
                     /translation="MSCRYVYDESASLTSPLTTAVGSVGDNPSASRSGNPTSSTDDFR
                     IPTAHSSFLSHSEYDIPVMHEIDRPPRNTQAYPHPSSPLASPQVPVDRTKPHTRLGPN
                     RQRYLGSLRDESIDSEKLDCVAGSSNTLNSSSARALAPNACGDLFGSQSYLTNMYDDY
                     TSSSSSRLPDLSVTNSSGEGGGLGKSHIDTAVRGALMNSARRLAGLGAAQDSVDASKR
                     ASSPKAHGSLSPIVGTTPAAKTRSDRRRLQDSSNCTVSNTAPTAGLPRLSTSTTCAAQ
                     FASDAVSTGRIKVPSSTVMLSPPYAELTIFDSPLIEDRSGAAKSPGRQSQPSSQTLAS
                     PSSLNPPRGAEGKAEKAGGWTRTNLGVEDGPDRSSSHRSTFGGVWSSGERSDMSPSPH
                     RQSSTRSLHMRSASGNLNCSSSGTSGLSRIRQRRAASEPSPMVFHEGHHLSLRRTVQP
                     SMQPVSPVYTSAGVDEVGNTDASGYSNRDEEEADGSPLAHQPVYDLRCVTGSLEDAAE
                     VVFDSTHFDTDDLVGSGDGYGDLVSRHDESEERVLLNLVEPPSSALSSRRTKKQPLKN
                     STALPKATPPALTPRHAPPMLSKRLLTLGQARTNTSAMMESGHLKLSLDGGAGAKRSN
                     EEVARESSASGSTTLSYLTDLDTPFSPTRPLTTRVPRSPLQNACNERALGAVVSAETP
                     RLSTSRVLSPSPISRMSNSVQPMHATVLSDKPPKPPRQPHSRVRICTGAREIDDSPMT
                     SKAPWPLQEPPSSIIVKRRLFDPKRPRLRGPRTRELPNGKRQANWTAPETHYATTLAD
                     LAAYDEDEDDMPQWHLTDALWRDEVIGMDVAVSRQSEVRDSRPSSSSTPAVESGVVGA
                     MVLNQPPASTPTVPHMSSLQPVTFSTSLEAPAVAAANMAIPRGWQLARLASLTAAASR
                     DAHASAVQDLQGTSLKIGCRTGGIVVDEVDKVLRLRKESELAQVPGELQSEPSSRPSH
                     GSRAPPLTSSATSPRLGASTHRRHSKSKNVGWGRRK"
     gene            complement(<1031955..>1033037)
                     /locus_tag="LMJF_31_2115"
                     /db_xref="GeneID:12981442"
     mRNA            complement(<1031955..>1033037)
                     /locus_tag="LMJF_31_2115"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722328.1"
                     /db_xref="GeneID:12981442"
     CDS             complement(1031955..1033037)
                     /locus_tag="LMJF_31_2115"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722376.1"
                     /db_xref="GeneID:12981442"
                     /db_xref="UniProtKB/TrEMBL:E9AEF6"
                     /translation="MFRPAEDHMQRMAGYHMQRGAVHDMGMILRMEEEQSLMRQMQEM
                     EMMQMQAMGGMPPYGNGQWVPPPQQQQSAGSLAGPTGSASVPNAIPSSAVQPPAAGAG
                     NASIPPQRAANPTIKGDANSQSPSTTAASRGLGLDDVPSPLGTSSTHAPKGLYSTTPS
                     MNNANGPAAAQDTMYNVSSMYGGDPSAYAPAFTGGGLNENGTSAVGYSMYDANNASSM
                     YQQPSPSSGATNASDAKAAPAADAPAPGNASKAVTPALQRKSSATSLGKKNSTASMNR
                     SDTTSNSTTHRSREIRQKNSELKRQNSSGAINGGSSSRPASAEKKRSSSRHKNKCPSS
                     PSSSKDKNTRPAFASSSARENGKKHH"
     gene            complement(<1034806..>1037097)
                     /locus_tag="LMJF_31_2120"
                     /db_xref="GeneID:5654144"
     mRNA            complement(<1034806..>1037097)
                     /locus_tag="LMJF_31_2120"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685147.1"
                     /db_xref="GeneID:5654144"
     CDS             complement(1034806..1037097)
                     /locus_tag="LMJF_31_2120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685199.1"
                     /db_xref="GeneID:5654144"
                     /db_xref="UniProtKB/TrEMBL:Q4Q649"
                     /translation="MDTTPTSLCVVVHNKQRYAIPVNAAGIQVGPPVLYPNPNRRKRG
                     GYGPGTVDGSSPSRPSLSTVSESTDGRVSSTSESTILHRSSRSRSDCSVCFTDAPAED
                     VNDGDFVQLSTAAALWLQLPQPSILRKGSGLLHALPPLFDFDYKSPHTPRQSPTELMR
                     YLPASAVSSQSYEQGAESAKQEHCCTFCPRVSSAAAVPHRHLLSSPAAHRSPSNNSDV
                     ALRFVMHRDIGNTAAVSRIVHQLPMPEATHVRHSLDGSSEATVKAAPSPPKDSPAVMS
                     KRTAVAAPRPSQSLSSALGTPSLQTVTSDGPYGTTHASYQGITPAYQTDKAEGTASQG
                     NGRDETTPTAPTARKPVKHPPRIKGESTAPIPRAQAAVVEDDKASRIASDLTQGSYNI
                     YCMPSLNRLTPTRREDNSCDMSLLPMHDTVAGKEPIHREAQPSEMECFIDHYFYGGQS
                     SSAAGHARSISPLGNYEEDMESSAIWKPQPPPIGDKATPQSQPSTVVPRGTPESVLPL
                     PRDAAYADYEYVNPSTPITVSVLAVPSPLSVAGFSRTSLYGGEHAAAREPPPREAHKS
                     IRERGGYAMLTLLQRFASTRHPKHTPAVAAEASTMSADFESNEHRKPMVSESPSSTEA
                     LTSLTTASSTDASCSENESLCSTSVSDFEEDDEDAAEMVNSVESQSFSSPEKSPSPPQ
                     PSKDVKNRHQWRWSSIRERLMRPLIPVPSDIEEPRLPSLQKWYRSNIKAKVKEAIQSG
                     RASDSSATLDPLHLHHRPRKTVK"
     gene            complement(<1039407..>1042196)
                     /locus_tag="LMJF_31_2130"
                     /db_xref="GeneID:5654145"
     mRNA            complement(<1039407..>1042196)
                     /locus_tag="LMJF_31_2130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685148.1"
                     /db_xref="GeneID:5654145"
     CDS             complement(1039407..1042196)
                     /locus_tag="LMJF_31_2130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685200.1"
                     /db_xref="GeneID:5654145"
                     /db_xref="GOA:Q4Q648"
                     /db_xref="InterPro:IPR015965"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q648"
                     /translation="MRDSSRGSSGRGGRSRRGSRARQGRGGGGRGPSSSSRPPTASPN
                     MSQGKSEQTEHDVESIAIPNAFDASCAHVSRCREKGRLLRLPPPAAAAAAQCNFVVVE
                     RTISGMDEVVYSRHRDVWERLPQGNARVYVESDSSNGTPTYSLVGAIDGLRKFGCKDS
                     TYGYPDALQTVIAMEEENGECGHLSAFVVPPAKRGEQSTTSQASCDAANEEDTSRRFW
                     VIGSKDVHIVLDYAVSEECLHYYSSLGCRYSQAVKISRLWKAMLPGGGASSGCGGGGG
                     STPSSANADARAAAFRTLTPAQARAFHETLYKKMWTSCFVAIFSDSQYLMEDSGTNEL
                     RFYAVTLSKRAFEAARTGRTDLSSNKAPEREDGDCQEETADAQNEAQQYSQQDGLCIP
                     VAEAEALCAGVGLAFSRYSAPVMYGSPEYVQRIRTINRRIDLEGCVMYGADASGKVVR
                     LWKEKAYPYAMERATREAVTNHKLNGNDLQVWLKKKLDQQRPELRDHFKEWEANRMPW
                     LLHFAAWLQMTQRLTPDMQRNELFQLRKEWRSLQKAFQTVIDSDPKLRDACGQYRPDP
                     VQWGSGTHDLDVIKFVGPQGSGKSTLSRALYVLLQTSRCQPRWVNQDESGKRNKFLAS
                     LRQATQAESTVTHLIIDKMNLDAKMNHDYDNLPLSLTVTWFHPDGEKALYDVCIARVL
                     GRGNGHRSIRVDPNRTLQEREEQVQRTRSFVRKAVRDFETPKDPPELLLELDITSPLH
                     DMVLMMWEKLQANGTHTLRPVTDEDVSEAISLAHQYELYLHNLPRPPTYACISIANQQ
                     DVEKLLKLVPPELTAGQVVQREFHVTTQYFGGKIDPVAFVALAKLLGQSVTLTLESVV
                     ADADGVAITVRRDDAHYPCANPIPHITISNRKGVPPKYSNDLISPTAYPGDPAKRKVL
                     PLPPNCTVMGVFEFR"
     gene            complement(<1045024..>1048173)
                     /locus_tag="LMJF_31_2140"
                     /db_xref="GeneID:5654146"
     mRNA            complement(<1045024..>1048173)
                     /locus_tag="LMJF_31_2140"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685149.1"
                     /db_xref="GeneID:5654146"
     CDS             complement(1045024..1048173)
                     /locus_tag="LMJF_31_2140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685201.1"
                     /db_xref="GeneID:5654146"
                     /db_xref="UniProtKB/TrEMBL:Q4Q647"
                     /translation="MERQSSMISAPFKAPRRRSAITIIVPGEETNPFQKDISKTVHME
                     DCSTFESFKAKPRCPTPDFDGAAHEGEHIHGLPTGAGARMPHPNGNNAMGTENGVWHH
                     NKPRATAQAPVPQGDGTPALLPQVPPSPKQQRQPKNQSLRGAASNRLADMHLFPLAPS
                     STATSMRKAGTRHKVNPVVAASAPSHASLLGATKTEDDTSRRLGAPVSSTSESRRSVA
                     ENSIAFSSAPVLSSSDEMPPRTSRRIRSSSRLSLHPASAHGATAGLSGNSKSKSGAAP
                     ASARPLLSSAGSTASNMVTAIGVHGTRSGLPSPQLRSAPPLQPNTMFNTAARRQSFPS
                     SYASMPSDATDSSRGDYQGVSYSSSSRRSTMPQSRVPHDINLARVPRPHVRRRQQELL
                     AASSRNEVREAESKFISDGLSSPFPSHSVSERGNSNDCGSSSGNTEYSNSSSVAGDLS
                     VVISDSDLASAVSLASAFAARAPPRQRSESPLADLSNLLAPGVTTRSAAVPEKYSLVV
                     SPPASLSDVCAVNGSRSSNGKEAEEHDADSTRSVDVADLPSTTDFPVLMGPPRFLAAA
                     SERQGKLTTVSSRPLNANSGSNSVDGIRDEQSDASISNFSLLPNDDSTAPNVVISSSP
                     ITNVAPASPLSPKFTHVQERTRRARGSTVLLPSPVDLNSLVFWKENERSISSPLASYS
                     KHRAHSASRSGSTKGGSSGGGYAHDGEGGKGSAAVHLETDSNRQETVTKPNTRASSGG
                     HASLFQTRKRNEDGAVDATGDSTLQLSALRTGSRGPASGPPDQVAQPSSAVACLTAAE
                     KERWSVTQSLSIDADLFSFSQLPQEKRGSMVAKLRNMFESSTEKHPRSSSSQAGSLIA
                     TPSPTDQGSPMRHVSSLNSHNNGNSSSSAAKSSSKWKTEDDSRKASPSLWKEVGDSSQ
                     RPISLQCHKSSTAAPPVANCSSPLLFPRSPTVATSEKGALPPLTSTVNSGRVSGAYPQ
                     SSHTNSDCTATGNSATPPPRVHHAKMDLQHEASSVKNSVGMLSCISPQASDPGFSLAC
                     FKVSNVSADTVNMFDRGDF"
     gene            complement(<1050960..>1051814)
                     /gene="PGFS"
                     /locus_tag="LMJF_31_2150"
                     /db_xref="GeneID:5654147"
     mRNA            complement(<1050960..>1051814)
                     /gene="PGFS"
                     /locus_tag="LMJF_31_2150"
                     /product="prostaglandin f2-alpha synthase/D-arabinose
                     dehydrogenase"
                     /transcript_id="XM_001685150.1"
                     /db_xref="GeneID:5654147"
     CDS             complement(1050960..1051814)
                     /gene="PGFS"
                     /locus_tag="LMJF_31_2150"
                     /EC_number="1.1.1.188"
                     /codon_start=1
                     /product="prostaglandin f2-alpha synthase/D-arabinose
                     dehydrogenase"
                     /protein_id="XP_001685202.1"
                     /db_xref="GeneID:5654147"
                     /db_xref="GOA:P22045"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="PDB:4F40"
                     /db_xref="PDB:4G5D"
                     /translation="MAGVDKAMVTLSNGVKMPQFGLGVWQSPAGEVTENAVKWALCAG
                     YRHIDTAAIYKNEESVGAGLRASGVPREDVFITTKLWNTEQGYESTLAAFEESRQKLG
                     VDYIDLYLIHWPRGKDILSKEGKKYLDSWRAFEQLYKEKKVRAIGVSNFHIHHLEDVL
                     AMCTVTPMVNQVELHPLNNQADLRAFCDAKQIKVEAWSPLGQGKLLSNPILSAIGAKY
                     NKTAAQVILRWNIQKNLITIPKSVHRERIEENADIFDFELGAEDVMSIDALNTNSRYG
                     PDPDEAQF"
     gene            complement(<1056420..>1058897)
                     /locus_tag="LMJF_31_2160"
                     /db_xref="GeneID:5654148"
     mRNA            complement(<1056420..>1058897)
                     /locus_tag="LMJF_31_2160"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685151.1"
                     /db_xref="GeneID:5654148"
     CDS             complement(1056420..1058897)
                     /locus_tag="LMJF_31_2160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685203.1"
                     /db_xref="GeneID:5654148"
                     /db_xref="UniProtKB/TrEMBL:Q4Q645"
                     /translation="MKTKPKHSKEESASPYFGATSVPLHSRDEAPSKRRTNSTPRSPQ
                     LKRSSSKSGRLAVDAKATTKVNAACGRARQRPNQNSGKLDARKKSASSSSRRESGKVA
                     TALRRSRPQEAPVNSDDDAPSSTGQLYESIGASPSAVALQSQTSDGEYFLPDWSVSSE
                     APPAIHRTGFPLNRPSSELRRNLLNANSSSDAVPHTTDRTLREHMDMSSSWTPQSQKP
                     LLWGISPKAAPKHPKDSSATPSTVRCYSQYHMASSTSSSLLFGAPYQVQQQRKAARTA
                     PSDLNPENFYPPILMRPPSDRHQRTEDSCNASRQLRSRFDVANGDVAATSGKRGDFLK
                     LCGGSITWLNDSRADDISPLAAQRSSRAVDAGSLGTLSSAFFSTTSRSPPQSLFRVPM
                     SMSPCATPRNTRNGFDRGSVVWKFVYGTDKDGDDEESPLASGRHWTGAAGRRGTGGLY
                     QSPFHSATGPLPLSESDPNGGEAGADERPAQRHGNVSSLYGCMLDGAALVSSSSSDDG
                     VGADEDHDYRISSSTRPGQRCTLESKRAMSVLAWMMKTGKSRLCGKGGGTRGGSDNDD
                     EDSEDAERRQRFSPTSASKREGCGATAHRSDVDSHRSEVVVRNDTGSDESADAEGDSE
                     GNPTSPSRQTVLQRILSGMGKPSDPKEVDEEVAVQEERSTPRIAPSLPSRSGAGRGSR
                     NAHQRVIPAVADCKRPVSVHYYGSPRANMTPPAGYQGWCAGYGAQAAAYLHSRCIYQP
                     LSRSPSPQNENGWNAQLAEFISPSTHIGCGAYASPAPHTVPVACRSLPLMFRQTVTTM
                     AVHELLGLDPEAEIIFVKSPVWKHLPR"
     gene            complement(<1062213..>1065989)
                     /locus_tag="LMJF_31_2170"
                     /db_xref="GeneID:5654149"
     mRNA            complement(<1062213..>1065989)
                     /locus_tag="LMJF_31_2170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685152.1"
                     /db_xref="GeneID:5654149"
     CDS             complement(1062213..1065989)
                     /locus_tag="LMJF_31_2170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685204.1"
                     /db_xref="GeneID:5654149"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q644"
                     /translation="MHRISSLDELLQHVESLSHHSRCATLVEFGRCSVTETTQEPRDL
                     QNVIATLGAPSQGPYQHFLAACALCGAFAETQRAGRAMPAALLATASSLLEDASLKVS
                     QLLMTCMLISTPSNDQQRAAMTINFLQGARLLQFKCLVTRLARAQQTQVLLRLYQTHT
                     VTEPAKTQLLLGSLSPEAFEQLPKEEQATLTIVALRLLCRHHPQWVAQYLTARVNEQV
                     SLNATVDAVLKELVQKACVFLATRGALKDSLSLFTATAHLLGLDQPTLQTVLERYYVS
                     TFPVEIGHYLLEGEGRHMLATFSEPLNCLISRRAWRRLGGHTDLLLRLLDKNILSNEP
                     VDLLNMLPEARRAYFARGCRELQDTRGIPHINWIFCMPSAAERTAFAHRFYNHARLQD
                     LPSERIECLSFLSFPEALRIGAAYVTSNNATIRSQLIRACLGSLRYYPEHLPAALAFC
                     VQRPNEQDGWRREMFKAWAALPHGFWRRTVTHISDETLQDTLTQLIQAAYNAKDMSDS
                     TLRALEKLLFRLVGPQTNFAVSQLATLIRKRKQFTACNADGDDFLQLAQLYPRAVPVL
                     VASLLSLAQMLLGSDNMWATIRILESLLDNKTVVKVLRREVPASSNGESEVWSMVHDV
                     LKAGMSSTDNAVARVSLRLYARHFPQQLAVALPDLIAQRKDWVTVSRVQRLVCDVLQG
                     PLLDMLVIPIENIPSGRFYHANNNSLAFVCELPVGNAHRWTSRQQIRYAQSCLQAIYT
                     PLALEAFQCRRFIKNLARLPSVSATTSWTDTNGRARSLLTLATEAHPVHGEYAMRFAL
                     QALGQLDGDAAAVQALQNALDVAGQRMDALRALATTLRRAPSAEAVRILEPVLTGRQV
                     TAQKEALHLLGAKRDNVAYARIVQFAAERHLPMPAEEDGDCGRVAALSAAAATAPGST
                     EEAVPAMHRDVRGALVTALFHFLDKPQVWSYYTFIVAHDQVAERCAVGAAEPATNARE
                     ESDGDTEDASTADSYEKKQVTTPSSAACVAMSTLPWALLRLPWQVQEYQKLLRRLLRH
                     PMRDVRVSALHKLATVPPYDDLALCKAIAEYLDECTSPEIVQSALRGMFRCSAKEAAP
                     FLISVILTVQPDATLTSVANVLCRIMRCAAAHEHKLLRTVATEVVEQLIAARRQPTIA
                     VSLIFELDISEWVPRLTTMEAAKLMHPGAAVAVIRAVQGDSSAIRDMDAAERLEQEVL
                     RTHPSALMRRLGLAILLEACEKRGWSEDRKLSLGLYCKDTDLWVSSDACIVRQE"
     gene            complement(<1070969..>1073599)
                     /locus_tag="LMJF_31_2180"
                     /db_xref="GeneID:5654150"
     mRNA            complement(<1070969..>1073599)
                     /locus_tag="LMJF_31_2180"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685153.1"
                     /db_xref="GeneID:5654150"
     CDS             complement(1070969..1073599)
                     /locus_tag="LMJF_31_2180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685205.1"
                     /db_xref="GeneID:5654150"
                     /db_xref="UniProtKB/TrEMBL:Q4Q643"
                     /translation="MTTAGKPKPRKRFGTFGEPDRELTQVEREFYTNLARIRKKRTRK
                     KEKPPAESEHRRGKEKRGTESEMSKEKFTDKLLSLRKRSLTPANAASRSTLPAPSSPP
                     RDNRLAVLSAVGLPDRTAPLVWEPDRHKARDRAASECVSSCAQHMPEPRRGFGFNDYQ
                     HAPESLCKPGDSILLPSRYQSARSGHESTPRRQRPRRAPNGPLTSAANSPDRTPDVPL
                     EIGLLEKLQRMKVLSAPQTSAREFSKRGNSNPSSVMSGGGAGENVDLSRVDDFSDDKA
                     DVEGRSDRALSALHREYFSSGSFHIHGLTDEQKPTLEVLVAIEKLLTLRKESTTSTRA
                     DPTTKQASKEAAATQKRGDHGNVHSAPMPKPKATAPAGKGSQARAASFPSMIGSTIQA
                     AAAATTPARTSPPLSRAEAMCAAASPPLAQPLPSLHTNAAGRHAQKSASGTRRQASRQ
                     PSACVSGRSRGANSSRSRQGGFLNPFCCTNGTALRNGLAEKTGRQAAQGALRKDAYTQ
                     TRPASGATAVDEACRQYVEQCHREEQELKKMIESERQRAGTAPRKASAAFSAALSGTA
                     TDADSAVAASSSPTKKVVGGSAFSHHRLTSAAISGASTEERVSPRSSFADRTKRKCDP
                     ACRTGRLTPLSCTDLNHLNTSKSTRKRSGSPSPAHAYPFLAGVAEDACDSSSKCTPSA
                     QPKIAFAGAGGGGGVSPNKTTRMTAVTLPTPMREAGGSRSRPFQHHLQDPDNVASFTA
                     ALSYEPSSAEESQMSSRAISVVDISSTVSHCGTSESVSVAEETVQMVKAHTTEGSPQM
                     NTLHKNAGARSDPARQRANSVGVATEPPSSPSAQQRESRQSVLSGAPVHTPSFDGSGI
                     GVTTDDAYEAGSDLYVFRSY"
     gene            complement(<1078534..>1080840)
                     /locus_tag="LMJF_31_2190"
                     /db_xref="GeneID:5654151"
     mRNA            complement(<1078534..>1080840)
                     /locus_tag="LMJF_31_2190"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685154.1"
                     /db_xref="GeneID:5654151"
     CDS             complement(1078534..1080840)
                     /locus_tag="LMJF_31_2190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685206.1"
                     /db_xref="GeneID:5654151"
                     /db_xref="UniProtKB/TrEMBL:Q4Q642"
                     /translation="MGNAVFCVAENEAGTECNTHRQTSQQRLLAKCPRRQTTLKPHLC
                     DEAKAVWGTTPARAYGRGGRSPELQQQQQNDLSSCTGISAVELSSVSTSISLIPDLGR
                     ASATPQLEWLQSSLPPSVSDPNLEPPHEYAVDFDTLSSDARPDRIAAASHVGGPTESS
                     SHSSYFTPNMSGFEMPPDLGFAAHLERVASPELRASPSDSPTPVQRPLLAVSPVENPH
                     WDGAMLPAAALPVTAVSPTVPVAPSPYSPFAQNASTGPKKPTGNWCSPDSESANPRRK
                     APKMQKEPMHESPTHPTQSQPHRRPFRQVTPMQAVHEVKPTDAVTFSAAHKGSKGHPQ
                     DTLPRRCLTDKGGTSALMLPPLDDAGALCVKAAANAAYTGNASVAGLHGSQPPLVPKD
                     LLRYRENTLTGCGDAYGAKTANNREGAQSRESPRCALVARKMDEASATATLPSGASAL
                     PLPPNGGVSSRQGCTEQGFARLPLVKGASASSTALKPVQVNATQETAQSATNGGVRDN
                     PASHQPPWHVTPDEDDAIPQLKFTAGGAAASSSLTRANWPTATAARTANQNHASTSSV
                     PISNEAHPLSALRGTMKRGSLTLTEGGVRQDTAGTAHVHVSAQGANTPSRLHPANCME
                     VRTRETAQDSLLSALVPLSRSLRQVGAGEQCCSRSDDGNESPGEDKERSSDDGECLPR
                     SQSVCDLPPNLGASHRVNSILKKTSSYRSLNGTPLERTLPAVGSVSFLLCEQEASLAM
                     VSRQGVFKAVSHHAKPRQKEDHRLFEGS"
     gene            complement(1088981..1091021)
                     /locus_tag="LMJF_31_2195"
                     /pseudo
                     /db_xref="GeneID:12981462"
     misc_feature    complement(1088981..1091021)
                     /locus_tag="LMJF_31_2195"
                     /pseudo
                     /db_xref="GeneID:12981462"
     gene            complement(1089035..1089859)
                     /locus_tag="LMJF_31_ncRNA5"
                     /db_xref="GeneID:12981443"
     ncRNA           complement(1089035..1089859)
                     /ncRNA_class="other"
                     /locus_tag="LMJF_31_ncRNA5"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460989.1"
                     /db_xref="GeneID:12981443"
     gene            complement(<1097414..>1098871)
                     /locus_tag="LMJF_31_2200"
                     /db_xref="GeneID:5654152"
     mRNA            complement(<1097414..>1098871)
                     /locus_tag="LMJF_31_2200"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685155.1"
                     /db_xref="GeneID:5654152"
     CDS             complement(1097414..1098871)
                     /locus_tag="LMJF_31_2200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685207.1"
                     /db_xref="GeneID:5654152"
                     /db_xref="UniProtKB/TrEMBL:Q4Q641"
                     /translation="MGVTCTREKNVVSSSAVIRFRLTRRCSHVESTGSPNNLTRETSR
                     RPRPATRARADACIGCDNSSEALRAVESVTLPLPEPIEALLLPSCAERLSSYRNRCHG
                     STAKTTVPPTFLVAETSTARRYSMYRIPDDDNNGYTLVPFKSMYCLPRTTELEPDNFR
                     AMVTHSHAAAAEAPSPETAAYNPKGDNGGENKEAASQETVSRKAFGTAARPFSRHSLR
                     ALRRGFSFGVVSDCADDLAGGHADELSCVSSVESGLAREPDIYTDSTSCWEVSSIFPR
                     ATTGTEADESSSTVLTSQSTLSRRHTFGVMMPTGHSQVVEHTEDGGAWEPALASPSVC
                     LDARRSWQKQKSSMTVANVTEEEEVQGGAFPLQDRHHQHRRHVGRHCHLARAVAAVPP
                     HAPSHIRSKVGRQWPQPIMEGPKSNLSRSRPFNVEATLGYSARSACFVPSPDWERVCG
                     NEEEKLRLAQVLAAHQQRLKKWKRAQAARWNALSL"
     gene            complement(<1103117..>1106143)
                     /locus_tag="LMJF_31_2210"
                     /db_xref="GeneID:5654153"
     mRNA            complement(<1103117..>1106143)
                     /locus_tag="LMJF_31_2210"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685156.1"
                     /db_xref="GeneID:5654153"
     CDS             complement(1103117..1106143)
                     /locus_tag="LMJF_31_2210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685208.1"
                     /db_xref="GeneID:5654153"
                     /db_xref="UniProtKB/TrEMBL:Q4Q640"
                     /translation="MQHLFSIRTPPLNKKIVHISDPLLARTCSRHLSNALVFHEGQPA
                     SLAVVCAHRTTTLSIPGQVAAQRSCISFSFSEPASVADHLPAHVDRKQKPPVACFLFL
                     APLFCDRVVGSTVPHGEPQGHHLRTITARYPSHSRPPVSPSLLDAQTRSRVLPLRKHC
                     ALTGTKMLKKLSALWTVARERICRADAAPSTSGDGSPPHIPHSSPKPCARSATAATNQ
                     QGNPLCVPSDRSQTRSHRSTDVQRGESSGFSPSSVPDRPVSGKAVGDASQGACLPSIS
                     GAPPLSRSPAQQRQSMKALSASPTSSGSHTPFLAPPSQRQPTTSPVAPLREGRQCPPR
                     ANVKAPLDPPTATASTPKTAGTEGCVGSYTMLRRLTADLAHTLDNCAMYGTLYDNSGT
                     EVNKSSPQSHPSAAPYSVLQSRALAVPQPYPAPKGAGEQARDIVPRRSTDSNSVNDSA
                     FVHEPEGEKNFHEAMLYLSRFMNGTRDETTGTMGDGAGGTAIRSGRAHNSGLLRTLRP
                     SRRASDVTSGPAHSPSAKNHDSSEASGFSRLDFASLFMTPSYDLRCDEPTGMYNCTVF
                     NQPVSQSAGVFSLAGTTSDFSTPPVSMTSRQASKRKHNGESGSNARLGRHVEDTAAEA
                     SESVGMHLTKMEEDMEESVCSQTAGTAVLRRVNDLALSQWKYVTLVVSKVMEKKTLVR
                     ASRALSQRVLSASGALELNVLPHDGLQEVSAGGAKRNDSFIFDDTTESRYVFYPDDDE
                     VSVYDADGRPLLIPNMSDLWDDFRSSDSSDESLVFGEADAFTEDGDAARVGTEGESKL
                     CATRPPSPSKMRSGPNTSHNQQAPPSRAAPAPPAAPAQQQTRQQAPPNRSVNSNWGGG
                     GYDYSNGDTNLYPAYQRHPNPRAPEQMKRHRIMQQQRQQLFQQQQQQQRRHFHSLTAG
                     YQKCTQPQPPPYARHRQGRSGSARGCLRSSAKMPWPQPDIYNGPKVYTGQSKFVDFTA
                     RSGIRLSDVKRVKSPCWYSIKLADEKRLQETDDRQS"
     gene            complement(<1107036..>1113437)
                     /locus_tag="LMJF_31_2220"
                     /db_xref="GeneID:5654154"
     mRNA            complement(<1107036..>1113437)
                     /locus_tag="LMJF_31_2220"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685157.1"
                     /db_xref="GeneID:5654154"
     CDS             complement(1107036..1113437)
                     /locus_tag="LMJF_31_2220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685209.1"
                     /db_xref="GeneID:5654154"
                     /db_xref="UniProtKB/TrEMBL:Q4Q639"
                     /translation="MSSVSRQARSANAATSAKATPLLSAKHLPEAMSLTNTPGKVCGA
                     DVSTAEDAVGRSSACRISPISPYRISSEAYTSSHRTGSRQLSSSSEAQVRVTPGVVHE
                     IDIMSTARYGKDFPAEFDTPTAKLRVQKPSEPLAVTLFAPPPAVPERPVLPSPPHAAK
                     EPQTQTARASGVKSDSNGAPSALSPFDPLGKDFAKPPSDLLSLRTPSILPQESHAPPS
                     EQSSATHPTRAGAPKVARNLDQRDMSSVARSNAHLSVLADLVDKKVFSEEDVLLELEA
                     VRKRSLLTSAPFNKRLLPILAWYLLRDKFGDEAATRYVSLLTSPAGATHPDGAVSTTS
                     TIASFLPRVNEIRRVRREVKESNRKKPKHHYAINPPASPTEAAKLSDIEGAHGKRRQL
                     RRTAAFDALEDASDIPTTGLPSPQSRSTLSSTGVRNRSPLTYGRLHVYTREHAIIDRR
                     DAKAEDRPVVDVVMDAANRQDRAKNVFEVVEEQASSVVEEPSVFEGPGHKPPRTKSTA
                     SKSTSKERVPAPPASAHAACALGEATARSCHGLQVHGSDACAMLDVTPSIGVFSEVRR
                     ANESEEGLSLFYRECVGGADQERIPSVSAFWKAITSPDTPAARTAPSRQCLPARHPQH
                     GHVDFSGGPADVMGAVTPCVSNIFALTDYGASAQSSGLAGETVGSSDLSTVANNTTSA
                     RSSVEYLHGLGGDHERYDGEASAVPEENPASQTLASTVAYSALNDPHESRVGAGDTEN
                     TTDAAYCLATSFLLRDGGAAEAADTSKQRLYAGLSSAENPTSRTVMATEYYYSTLPNA
                     STATHRPEYSQRSRSEVSWETSSATMPNMTETFQEEGAAGKETSYGSLIKSRIDTAAM
                     SSADSIKTREDTDTGLHTVAEYSAFAHSEALAMGPRDASGVQSPTISTHGTLRRDTSA
                     AAAAPFSMLKASSDTTDRTGQSAHRVCGAATVSKSRFLDSGVHSSRSGGCKTSFSDPP
                     ATESPHDGTPAHSMFDSRTDTCLSPPSTTIDGSSYAPSAPSGESAFGSLLLTNAKTST
                     MDGGDHRQGHPIEPFHSIAVSDASANTYSALQRDNSANAGHCCASRNTCWAHVAEHSA
                     NGGVQFATPLRDSASPPPAAVATGSRTASTHQRFSSGAATGRRSLSDALAAHLEDASV
                     MHNQRTDDGHSAQSADARDTQSPITAISATSPPSRAGTHHDSVRSRGGYGSLMEADSA
                     VTPDASAASRSNGGYSLGGRSEASVQSRGGYGSLMEADSAVTPDASAASRSNGGYSLG
                     GRSEASVQSRGGYGSLMEADSAVTPDASAASRSNGGYSLGGRSEASVQSRGGYGSLME
                     ADSAVTPDASAASRSDGGYSLADGGRCRCPTDPSALSASTERSLKARKSGGWTMNCSD
                     EQVGGRLANRGFGGCAPAAPESVSVERRAFRVESSRGGDAVASHTTALPVSEAVGDGC
                     SSGLQPRSPMGPAVNPSRLTPSTKEETAASTYTAFSGCEREGATLSSSMDPDELADAL
                     QRLGERHVSWLKENNACTFGELGCQCATGKCQVCTTVATLPPPRRPQPVPPSDEESRA
                     QRFDRVAMRSGSPEKAPGCESPNPPPPAAVPVEEKSWNTAVPLQSLQRKNRVSSAGVS
                     SRSNATLVRVGAGFNLRTSPSPARGAEEVSTRQATQQVSIISELDAVTAAPTKSTPPG
                     RCKDSDASRTESFLEGDGLRSQVTILTCPRSSTDLTVHNMPDAAIERADASIQQLREH
                     QRTGFNFSGYSHADCLMMTPVSILQSSPGSSRIHDPKTVGVSTRPQAAAVAPSAVSVP
                     GDRTAYGALTAGDSAVTRSVIPFPLPPEASVVNPTVCALGDELLRTPHNMTTVLLGGD
                     RQSGRFSITQAAREEASGSDDAEAVHEAEFTREVDAKHRNLATLLCHSRLDASGVTTA
                     HSHVLESSAAATRTRLVNGDRSRSVGVLLSEQTEMDASGVDKTRVDSNGESRETAPPA
                     GSDVDESWISVDPSTTQNTQLAVSVPGRRFVHCPPMHPYNGVRADHDSPEQREQHQGR
                     RTILDVPGVPYVDSPDISTSIDKEARQKEKDRQLFAMRWAERGLMWQRQENEAQRYEE
                     SQAHFGAGKEQPRGPRLMIMKPGRQGAVALPRPRLPNVPRPPMPMHPRSPGYPPRRRH
                     S"
     gene            complement(<1115058..>1116407)
                     /locus_tag="LMJF_31_2230"
                     /db_xref="GeneID:5654155"
     mRNA            complement(<1115058..>1116407)
                     /locus_tag="LMJF_31_2230"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685158.1"
                     /db_xref="GeneID:5654155"
     CDS             complement(1115058..1116407)
                     /locus_tag="LMJF_31_2230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685210.1"
                     /db_xref="GeneID:5654155"
                     /db_xref="UniProtKB/TrEMBL:Q4Q638"
                     /translation="MPSDTESSDVTDGDRPLSAAASVWNMTESSGAAASDRDASAPLL
                     LQIRYSRAAQTPELLVVDTPPSPSRPYIHSQLLAQGLPLGTQGSSNADVHPGTPTTAG
                     ATPHREQKSEMRVAGQQTPSAMAREVSVWSEACATDSFALLRNAREPSLSYSWTESYL
                     AESPSTAKARWMQQRTFGPVVQSEGGGSSTVSSTPRAPCETEAVWSGVQGCSGAARAG
                     AAEAVDLPQDGPGDERSGATRGGGGARRRRFHLTAAETGERALGGERPHDGVFDHVAV
                     DHVGKCAKPTTTKPLFHVNRGDTSMRANSASAMIATVQQPHRMGQIAPIAKLQKVLNA
                     AAAVNTTEGVRLDSDDGKAGVSPSPTTNANLREVGFSSALLDIVAASRSLSSARSVNV
                     AGSRNVLRSRSSSDSPSQCESDGMGCSPTEMEQSRGNLRASRCCPPRGRVLKVIYED"
     gene            complement(<1119937..>1120395)
                     /locus_tag="LMJF_31_2240"
                     /db_xref="GeneID:5654156"
     mRNA            complement(<1119937..>1120395)
                     /locus_tag="LMJF_31_2240"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685159.1"
                     /db_xref="GeneID:5654156"
     CDS             complement(1119937..1120395)
                     /locus_tag="LMJF_31_2240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685211.1"
                     /db_xref="GeneID:5654156"
                     /db_xref="UniProtKB/TrEMBL:Q4Q637"
                     /translation="MPPSTGTNADIYLLTLPVIFGFVLPFVAAIGFYQCISYSRAKAI
                     YEKRIFVMRKKLRHRLRQCKAEGVFTPRHKIREHGFEDLCELSSDDDDHTSPGNSPER
                     GNHSVPSDSRTSDRRKSQRSTNRSGESCPSFVLEDVSMLESEEGTSDDSW"
     gene            complement(<1121176..>1122318)
                     /locus_tag="LMJF_31_2250"
                     /db_xref="GeneID:5654157"
     mRNA            complement(<1121176..>1122318)
                     /locus_tag="LMJF_31_2250"
                     /product="putative 3,2-trans-enoyl-CoA
                     isomerase,mitochondrial precursor"
                     /transcript_id="XM_001685160.1"
                     /db_xref="GeneID:5654157"
     CDS             complement(1121176..1122318)
                     /locus_tag="LMJF_31_2250"
                     /EC_number="5.3.3.8"
                     /codon_start=1
                     /product="putative 3,2-trans-enoyl-CoA
                     isomerase,mitochondrial precursor"
                     /protein_id="XP_001685212.1"
                     /db_xref="GeneID:5654157"
                     /db_xref="GOA:Q4Q636"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="InterPro:IPR018376"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:Q4Q636"
                     /translation="MKSSLRRRVRQASNEDPPYPTFLSHRLFVCCRRSTSAIMRRVIS
                     SSLTRGAGTLGVMSGLFQLTQYRFQSQPPPGVPQGRHQDLNAAHAGSKHSDDAQPEFV
                     PPKKPTEVPKLVRINTNEKGITNVQLARAPVNSMSLELFQELNQWMLWLGSNEETKAV
                     IISSAIPTVFSAGLDLVEVHNPKPDRVAVFWQSFQEMWLILNSFPKPIIAAITGNSPA
                     AGCIIAMGCDYRVMARGPKGNTNNNRLYRIGLNETKLGLVAPPWVMPAYAYLLGSRQA
                     ERMLQLGETPVADDARNLGLIDEVAADEERAIEVAYQQAERFLSVPQQSRWMARDMMR
                     REYLQMLASDEERNYDTEFFTQFVQSPEVQKNLESYLERLKSCSRK"
     gene            complement(<1122645..>1124609)
                     /locus_tag="LMJF_31_2260"
                     /db_xref="GeneID:5654158"
     mRNA            complement(<1122645..>1124609)
                     /locus_tag="LMJF_31_2260"
                     /product="putative aminopeptidase"
                     /transcript_id="XM_001685161.1"
                     /db_xref="GeneID:5654158"
     CDS             complement(1122645..1124609)
                     /locus_tag="LMJF_31_2260"
                     /codon_start=1
                     /product="putative aminopeptidase"
                     /protein_id="XP_001685213.1"
                     /db_xref="GeneID:5654158"
                     /db_xref="GOA:Q4Q635"
                     /db_xref="InterPro:IPR001930"
                     /db_xref="InterPro:IPR014782"
                     /db_xref="UniProtKB/TrEMBL:Q4Q635"
                     /translation="MPSHRHNSPVVVAAEMRGQDFCAAALLDCVCFHMDRSTHIWNPI
                     QCTLQLVFSRPSSGAAIRAGSAYHGTSIIRYRREPYRDTADSAAGAASSGATSPSEGN
                     SEYEDFLRHRRVIAEKNALHLHALTTAGGMYKDVRVLDIQSYQVRCVSASVDTAAAVL
                     KIVSVEQEDACAASADSSTGGGAAKRKGSSKVRKKGGAAVVEHDDQTSGDSPATAAVD
                     WGSKLILFEGSGSLPPLSEVDLTSQFIGRVQSFDCGGIYAACGIGSNPGTEDVPLLTH
                     FEVRFARCAFPAPDDPQYRLDWQLKSIQVPSSFRTILTNGEERGRKKLAAQQAVQVSF
                     SPCGPLPAYVFSFACFPGLAKLESTSAADDGLEVVEGSVDIPKFAGGIASGLSDTSNL
                     SYTLVPVRVLARRQARIATATLERVLRLTIEAVTALQQLFQCPLPLLQCEHLDVLLGP
                     TMPYISGMEHHCSIILNEAIYQPGKKTAAAGGGTAHRTAEVEQTELIVHELTHHWVGN
                     ALGLPFAVKEGICQVIEQCLGDKLLGKPMRTYKADSSASTKPESSSPSSSTATLPKSA
                     IRASEKGREFTGTSYQHALRAIKQLVAAHGFDRFAACLRQLMHVHVVLPAIAVEEGGG
                     LQVLRCIRSDVASPPYLSTEQFLRTVESAL"
     gene            complement(<1125682..>1127070)
                     /locus_tag="LMJF_31_2270"
                     /db_xref="GeneID:5654159"
     mRNA            complement(<1125682..>1127070)
                     /locus_tag="LMJF_31_2270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685162.1"
                     /db_xref="GeneID:5654159"
     CDS             complement(1125682..1127070)
                     /locus_tag="LMJF_31_2270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685214.1"
                     /db_xref="GeneID:5654159"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q634"
                     /translation="MSSDSGINAALLNLCAQLQDGGTRSAANEGPSAPNCAEGSQAMA
                     EQSRTSAAPCATALAAVPAAAAQDPARPASDYEWLRSALASVESPEKRVKQLLFNMEN
                     LTTEGKPGPLAQEERLEALEELADMVEDVNWAAEFALMQGPQRLLDVMRRERAAHPLL
                     VTGSGDASASVEAAIGTGRGDPEVQTATHDGIPSSAVPLFIELAMIIAHSAQLNEPVQ
                     AAYGAAHWEDIILPFMGDCIASVQDLLHVGSDGHVIGAQGDSTEAASVAAGAASLMRL
                     LGALLHACSCLCRDSSPNTVVFFQTSGLAVLMDTLRLTRTLPESRLVGTAEDGRTPVA
                     VTNVASDTASNEEVDDIYAPLLGTMHKVAARALFFVAYLASTGVSSEQIIQLACLHAE
                     SGNSGESVQKAAAHALTALVEKSPKAIKEVVRALMPHRLKEWRTQVQRAMDDRETQDE
                     RLHFLDALDRIS"
     gene            complement(<1130239..>1130787)
                     /locus_tag="LMJF_31_2280"
                     /db_xref="GeneID:5654160"
     mRNA            complement(<1130239..>1130787)
                     /locus_tag="LMJF_31_2280"
                     /product="putative ADP-ribosylation factor"
                     /transcript_id="XM_001685163.1"
                     /db_xref="GeneID:5654160"
     CDS             complement(1130239..1130787)
                     /locus_tag="LMJF_31_2280"
                     /codon_start=1
                     /product="putative ADP-ribosylation factor"
                     /protein_id="XP_001685215.1"
                     /db_xref="GeneID:5654160"
                     /db_xref="GOA:Q6IMM3"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6IMM3"
                     /translation="MGQWLASAFSSLMGKKEVRIVMVGLDAAGKTTIIYKLKLGEVVT
                     TTPTIGFNVETVEYKNLKFTMWDVGGQQKLRSLWHYYYQGSNGVIFVVDSNDPERMML
                     AKEELDKILAEEELRNAVLLVFANKQDLPNALTTTQITEKLGLYNVRNRRWYIQGCCA
                     TTAQGLYEGLDWLSNNISATMQ"
     gene            complement(<1133833..>1134510)
                     /locus_tag="LMJF_31_2290"
                     /db_xref="GeneID:5654161"
     mRNA            complement(<1133833..>1134510)
                     /locus_tag="LMJF_31_2290"
                     /product="phosphatidylethanolaminen-methyltransferase-lik
                     e protein"
                     /transcript_id="XM_001685164.1"
                     /db_xref="GeneID:5654161"
     CDS             complement(1133833..1134510)
                     /locus_tag="LMJF_31_2290"
                     /EC_number="2.1.1.17"
                     /codon_start=1
                     /product="phosphatidylethanolaminen-methyltransferase-lik
                     e protein"
                     /protein_id="XP_001685216.1"
                     /db_xref="GeneID:5654161"
                     /db_xref="GOA:Q4Q632"
                     /db_xref="InterPro:IPR007318"
                     /db_xref="InterPro:IPR024960"
                     /db_xref="UniProtKB/TrEMBL:Q4Q632"
                     /translation="MTQLPTTPAASRIHYRSIGAAAVAIAGLPTVWNIVARNEYRRHT
                     IERAVGGKKVGAYVLAAAIFVASGVRDYAFHNAMAQNPSSVFPILCTQALGPENAGVV
                     RGVMRSVGAALMAAGTTLVVSSFLRLGITGTYLGDYFGILMDERVTAFPFSHFDNPMY
                     IGATLNFLAASIAQNNAVGTLLTGLVGLVYHVSTKYFESPFTGMIYRKRAEDRAAAGV
                     SASVKKQ"
     gene            complement(<1138947..>1140095)
                     /locus_tag="LMJF_31_2300"
                     /db_xref="GeneID:5654162"
     mRNA            complement(<1138947..>1140095)
                     /locus_tag="LMJF_31_2300"
                     /product="putative 3'-nucleotidase/nuclease"
                     /transcript_id="XM_001685165.1"
                     /db_xref="GeneID:5654162"
     CDS             complement(1138947..1140095)
                     /locus_tag="LMJF_31_2300"
                     /EC_number="3.1.30.1"
                     /codon_start=1
                     /product="putative 3'-nucleotidase/nuclease"
                     /protein_id="XP_001685217.1"
                     /db_xref="GeneID:5654162"
                     /db_xref="GOA:Q66VY6"
                     /db_xref="InterPro:IPR003154"
                     /db_xref="InterPro:IPR008947"
                     /db_xref="UniProtKB/TrEMBL:Q66VY6"
                     /translation="MAYAVRTAALYVAVVLVLLCAVALPSVAWWSKGHMAVALIAQRH
                     MDPKLVKKANAAAKVLSLAGPFPKSPDMVQLGPWADDLLESGLKTNFNWHFITTPYYP
                     DSDFTLEFSPVQTVNVASVIPMLESAITKTTATTEIITQCLAFMIHFFGDIHQPLHNA
                     NLFSNEYPLSDYGGNAQMVTIDSNGTKMLLHAYWDSMAEGPASVGYSRPLSKDAYDDL
                     NAFVDYLEATYAGNLTMPEKNLQNTTAISNEGHELAIKYAFPGAFNGATLSSEYKTNA
                     KFITERRVLLAGYRLAKMLNTTLKSVSMDTILQGLNNIQAEVPPLDNTTIVHTFQERG
                     LSTGLTVGIAIALFVAGVLISTGVVLFLSRQRQVRSDYQPCEPIALDL"
     gene            complement(<1141911..>1143047)
                     /locus_tag="LMJF_31_2310"
                     /db_xref="GeneID:5654163"
     mRNA            complement(<1141911..>1143047)
                     /locus_tag="LMJF_31_2310"
                     /product="putative 3'-nucleotidase/nuclease precursor"
                     /transcript_id="XM_001685166.1"
                     /db_xref="GeneID:5654163"
     CDS             complement(1141911..1143047)
                     /locus_tag="LMJF_31_2310"
                     /EC_number="3.1.30.1"
                     /codon_start=1
                     /product="putative 3'-nucleotidase/nuclease precursor"
                     /protein_id="XP_001685218.1"
                     /db_xref="GeneID:5654163"
                     /db_xref="GOA:Q4Q630"
                     /db_xref="InterPro:IPR003154"
                     /db_xref="InterPro:IPR008947"
                     /db_xref="UniProtKB/TrEMBL:Q4Q630"
                     /translation="MARARFLQLLLVTLTLLSVAALPVSAWWSKGHMSVALIAKRHMG
                     ASLVEKAELAAKVLSFSGPYPKSPDMVQTAPWADDIKTIGLKTLSTWHYITTPYYADE
                     GFTLDVSPVQTVNVASVIPMLQTAIENPAANSDVIVQSLALLLHFMGDIHQPLHNVNL
                     FSDQYPESDLGGNKQRVVIDSKGTEMLLHAYWDSMAEGKSGEDVPRPLSEADYEDLNN
                     FVDYLEATYASTLTDEEKNLVNATEISKETFDLALKYAYPGAENGATLSEEYKTNAKK
                     ISERQVLLAGYRLAKMLNATLKPISTAAILQGLENIQSEVDTENKAEVHNHYDQKGIS
                     AAVTAIVAVAFFIVGIVIASLVVLALKCYLPKRDRFGAYEHVLL"
     gene            complement(<1143553..>1146402)
                     /locus_tag="LMJF_31_2320"
                     /db_xref="GeneID:5654164"
     mRNA            complement(<1143553..>1146402)
                     /locus_tag="LMJF_31_2320"
                     /product="helicase-like protein"
                     /transcript_id="XM_001685167.1"
                     /db_xref="GeneID:5654164"
     CDS             complement(1143553..1146402)
                     /locus_tag="LMJF_31_2320"
                     /codon_start=1
                     /product="helicase-like protein"
                     /protein_id="XP_001685219.1"
                     /db_xref="GeneID:5654164"
                     /db_xref="GOA:Q4Q629"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q629"
                     /translation="MQSVFRAHTIKLPRCSTLGSGTGRKREAYRLTSPSHVCCIEMTL
                     QCDELYRAADKMAKASQRTQSRIRAAVETQRQRAALHQLDSGAEFFPDDDACPTYSLT
                     NALTGCVCQPSTATSPPLRLLEHQREGVRWLLALHELGLNGIMADEMGLGKTVQVAAF
                     LAALAKAGVLGTFLIVVPLSTMESWKKELLRWVPWMHIIEFRGTHEVRAKLRSRLRNR
                     HRRAFERQETLRAQWAQGVSVRVLAKTVGGVVLASYESVMMDHGALARLIHWDITIVD
                     EAHRLKKLQCKLLQTLHKAACRMRLILTGTPLQNDLTELWTLLEYVGPQIFSHDDADQ
                     RCLREAVTALSCGCGRRLNERREERRGDGLGGKEPTERHTAAAARFPHAPQANTGANA
                     GEAQGLLLASLKTVLQPFVLRRIKATVGIQLPPKYDLVLPTPLTPAQQLLYARVQSEE
                     RYANSRLTHLRKCCIHPFLIRDFYADSCEWRCTPQSPSSARERLEFMVKASGKLKLLD
                     AMLPELRRRGHRVLLFSQMTRALDLVEEYLSLKNTVLEEAFFGGDETETVMTVDRCCE
                     SGSPKDSTGRKRLETILSQMLVYTRLDGSSSAEARSEAIRHFQGPPSSSSKPGNGAEY
                     DSAPFSVNAAAGGDSVEVFLEHDRQAEKPSAPADRVLPLAKRRWRRVGKGLRTRGIEE
                     DDEVFEVPFLSARTSTPAGVLAERSVNETLPLSFKATGSVKACYAHLVTRKRLASAGS
                     DSLSTRKSLITPSKCEADGASWPSDLSLTSTATSAAHAAQPGVFLFLISTRAGGTGLN
                     LTGADTVILLDSDFNPHNDLQAVDRCHRIGQRNPVAVYRLVSPHTVEDEWHSGIVDRK
                     LKLEHLVLGGDGAGCISQQCCTTSGNVDTQQQPIPAADVLRCAAAAVCAEPPKKRARS
                     CSAVSSSERQALTADELRLLLDRAWLQHVMPHRSV"
     gene            complement(<1149066..>1150115)
                     /locus_tag="LMJF_31_2330"
                     /db_xref="GeneID:5654165"
     mRNA            complement(<1149066..>1150115)
                     /locus_tag="LMJF_31_2330"
                     /product="putative 3,2-trans-enoyl-CoA isomerase
                     mitochondrial precursor"
                     /transcript_id="XM_001685168.1"
                     /db_xref="GeneID:5654165"
     CDS             complement(1149066..1150115)
                     /locus_tag="LMJF_31_2330"
                     /EC_number="1.1.1.35"
                     /EC_number="5.3.3.8"
                     /codon_start=1
                     /product="putative 3,2-trans-enoyl-CoA isomerase
                     mitochondrial precursor"
                     /protein_id="XP_001685220.1"
                     /db_xref="GeneID:5654165"
                     /db_xref="GOA:Q4Q628"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="InterPro:IPR018376"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:Q4Q628"
                     /translation="MRRVISSSLTRGAGTLGVVSGLFQLTQYRFQWQPLPGVPPQLRV
                     APQGRHQDLNAAHAGSKHSDDAQPEFVPPKKPTEVPKLVRINTNEKGITNVQLARAPV
                     NSMSLELFQELNQWMLWLGCNEETKAVIISSAIPTVFSAGLEFSEVHNPKPDRIAVFW
                     QSFQEMWRILDTFPKPIIAAITGNSPAAGCIIAMGCDYRVMARGPKGNTNNNRLYRIG
                     LNETKLGLVPPPWTVSAYAYLLGSRQAEEMLQLGETPVADDARNLGLIDEVAADEERA
                     IEVAYQQAERFLSVPQEARRVSRDMARCEYLRLLATEDDRNYDTEFFTQYMLRPEVQK
                     NLESYLERLKSRSRK"
     gene            complement(<1152129..>1153469)
                     /locus_tag="LMJF_31_2340"
                     /db_xref="GeneID:5654166"
     mRNA            complement(<1152129..>1153469)
                     /locus_tag="LMJF_31_2340"
                     /product="putative p-nitrophenylphosphatase"
                     /transcript_id="XM_001685169.1"
                     /db_xref="GeneID:5654166"
     CDS             complement(1152129..1153469)
                     /locus_tag="LMJF_31_2340"
                     /codon_start=1
                     /product="putative p-nitrophenylphosphatase"
                     /protein_id="XP_001685221.1"
                     /db_xref="GeneID:5654166"
                     /db_xref="InterPro:IPR006357"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023215"
                     /db_xref="UniProtKB/TrEMBL:Q4Q627"
                     /translation="MSPPASAVCSACARPSGVPRSRASQQLCLQTPLHEAGKSAVCRR
                     EGVLSALLFHSPPLSVPVTALGSPCADRNNAPPENLSAMPERMTAALAARLVASPLKY
                     VLLDIDGVIWCGGHVIDRVPETLQYLRGQGKQIRFLSNNASFSREQLMQSLKAKGIEG
                     VTVEECYNSAYTAALRLRQMLGKADVPGEEPLVHGNVFVIGEQGLHDELQQVLAPGFI
                     TYGVELHDAVRAGGYDTDALGSAWRVPCLPPPQKRLVVCNGKACRMVQAGTNSAEKIS
                     LSDLNAAAVVVGLDKHFNIVKLAYGSLVLQGPPKDLREESYTPPLFVATNEDPQLPVG
                     RDGTMIPGAGSMVSALCTAVGKRPDAVCGKPHKDMANILFAAEGVTNPREECIMIGDR
                     LTTDVAFGNAAGCQSMLVLSGAEGLADVEEAEKQGRTALVPKYVAESLACFLPL"
     gene            complement(<1164272..>1168942)
                     /locus_tag="LMJF_31_2350"
                     /db_xref="GeneID:5654167"
     mRNA            complement(<1164272..>1168942)
                     /locus_tag="LMJF_31_2350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685170.1"
                     /db_xref="GeneID:5654167"
     CDS             complement(1164272..1168942)
                     /locus_tag="LMJF_31_2350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685222.1"
                     /db_xref="GeneID:5654167"
                     /db_xref="InterPro:IPR022075"
                     /db_xref="UniProtKB/TrEMBL:Q4Q626"
                     /translation="MLFAFSAALPHGIPSSPLLFSSPPPSPPPPSPRLTFSSAFYPTR
                     NKNAASCLSYSRQKKMETLTSVIGSVDSVDALDLTLLLHGLSTLDEVRQIIEVLLDAY
                     NSHSGTSREVLQKQCVMRSLAEVLELVHARYTRIADASASPVTCTFWRNQAEGAMATT
                     PSTDPQWAFTPDDYLLLSMFLNETATTTNATTFAYWSRATAVVFPHATAIVFPSIEAD
                     GVPPETAGAGEDEEAETTRASLESELHSLREIVAKRFTTSVESLRRVTSYEYARRSLQ
                     SSVWALLGSLAGCRAPSLRERVVEELEAAVEGMLQPLNIALQEPLTGSHGRTANAAGG
                     AIGGGSRSGKKTSPILLTALLQDVEDVLWAILHIAVSASSSTTQPVSSSLEQLCSRAA
                     AFMVEVLLKFAQQYIALQQQRQMEFMEKEGADGDASGRGGARGAKKDVFRVYHVQRSL
                     QRVFSVGLQLRRVAGKSSNAAEVSLVSEAAFTGLQAAASAFGGAVFVINPVRCAMVTE
                     DIDGHVAAAAAAEDDKTSSSAWGDDSNARGRLRECRRVLAPPHHLITSGGAAGGGEGD
                     YDFFNDEEGDTLLGRREAYLKTSLGPVTASALVDMVMLTVSRMDFLSEDAIQELHRRG
                     LEQMQLAAAYQAQKEELEKLRQMERQGVEAIAAGKLIEHVKDSAALHMRGMQVLRKVS
                     ARSRLERAAFTSVLGAYQHVRGEAEARIRLTQALISRCLVQLPPSLADSAMDELLLHL
                     RRELTRTQAQKEAAASGKTITATANPNADVASLFLASSYYQLTLQVLFMYYATQAPMH
                     ERSATWNSALLLGGGAAMVHGEDDGTLFDDGAPHGGGELMQTDAGFSIEVESPIAFLY
                     DDDVHRASQDVGQKRAREEPDGVGGAGEEDAAAGARAAIGEQDFGFLNDTVAAPSTYS
                     HMLCRVLELIRTARLNLILLDVLLQAPVLTRYVWYHLYKHFCLSADKASCVIGMWLLR
                     NLAVRRPVYRTCAVNILLQLCLSTHDYARRFAIKEIDQLLSTTTTQGAPLLDATAEEH
                     LLRYAKKQLFAIPAYQRSSSSKLKRAHDGGDTANGNEAAAVAGDTDEATAKDRARMSA
                     VLSRRLGLFLMLCARQPRELFPALLEVFQQCVERGNILMMQLLPENADVRRMTQYLLK
                     TDASNFVAAVMPLLRKRCREARPLVQSMLWAVREQLGAMAQEVNSAANTMATSPDGIE
                     AASQASTTVTLEALRNISNAVLGHAKAMYELSGIPLGNSAQAVSLLDIRYLAPFLSFL
                     SAKELKQTYLNVFLLFLQVQLQFQRHYHNAFHRLPAKERMYVLEPTELRAFEVQVLRE
                     VFVKCPVSFQDGVPRGLTRVDFFVYLHRAPQESQSRLASSMLSHPLHGGALGGTAGGV
                     LDGMHNGEQTSAGAVTGKEKAEELPPISVGTTKEVVNLCFELTRSFDNTTVEKLYGPP
                     EVQKALQQLMHPPPIPSQLMATVLQASTLFLRSRYTEFISFVVQTILTPLERASVWDT
                     DPQLWKGVVLFTERYYRECSNFLVNLPDQVLTQALREHPQLCEYFKEEHGNNASFMHI
                     LGNL"
     gene            complement(<1170244..>1171863)
                     /locus_tag="LMJF_31_2360"
                     /db_xref="GeneID:5654168"
     mRNA            complement(<1170244..>1171863)
                     /locus_tag="LMJF_31_2360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685171.1"
                     /db_xref="GeneID:5654168"
     CDS             complement(1170244..1171863)
                     /locus_tag="LMJF_31_2360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685223.1"
                     /db_xref="GeneID:5654168"
                     /db_xref="UniProtKB/TrEMBL:Q4Q625"
                     /translation="MHTSTVAMMNKGGDGGEQPTIAVLDRGDCVDLKRESSLLPGEVR
                     TPTMVVTLSEAWGDSSADWAAPGSSSVWEEEAANRPSAQTPLTRYGRSDVWASATGSP
                     LMGDGMAHQHHFGQTEAKGNTDSPDTAELAAAALQALSPQGVLHTDSGEVHVPLPQRQ
                     ASQPRYSATVHYGYESRFGTVHEAPLNNDLTQFFPRPRQPQSPTKLNYFTVQESSAPP
                     SAALAEPTAMSHGGTRTASPGTDAVFSGGPTGMSYVPRLEDEEVAHRIIVSAGLPLAM
                     HSLVEYIHGGQPRAPAHATALGTTQNALRNYPNLSDPPTEEEALGSRGGTGGAYGSRL
                     QRGGYGQALQGRCVPTLPSLKQDNRFAVRGQDAIRDSPQDQALAPSSNYGGGFMVSAG
                     TGTTALSRVSARTPYSTHGNGVAGRHKSESKYLSDLLHFHANFFPPPPPPRVPKDERR
                     NRAELWYHYTSKWDITHRLPPPPRTPLPEMELEYRMRVPQMTRVPYHGDGWLQMSERW
                     FDVMQALFDFPEDNVGDEVDFNVVLQQAVLS"
     gene            complement(<1172563..>1174128)
                     /locus_tag="LMJF_31_2370"
                     /db_xref="GeneID:5654169"
     mRNA            complement(<1172563..>1174128)
                     /locus_tag="LMJF_31_2370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685172.1"
                     /db_xref="GeneID:5654169"
     CDS             complement(1172563..1174128)
                     /locus_tag="LMJF_31_2370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685224.1"
                     /db_xref="GeneID:5654169"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4Q624"
                     /translation="MRAHVPFSLHAADPLHHAHPLFSMCGPCASVFVVLPVNKRLLSL
                     AGHTHTHTRRQEDTSVAMKTLVKRQRSKSVHEARSHRTSGKESTTSSPSAPSPASSHT
                     LAAASDIAATCSATASVPDGREPCKSALLVVSTCHAVMAGLVYRKEKFYIKFSVKRHV
                     GRVNSVAVTERYMASSGVDERVFLFTNKAEERLTAAARKKIREAGEPLAVRLADLGSI
                     APPSEVTALVFADGSQHLLCGCSDGQLLIYRCRDWSVSTTLTVHEKAVVGLAVHPGSH
                     GSLAVTVGEDRVIAVLDLVKAKLLTKWKYNPSLAAAGSVSRKSEDDAQKQAQRPSVFA
                     SAREEPVGVFFSPQGTRLVIFSRFSFVVYEASVMQPICSLRYANPQPPDEMHHFAFFS
                     EAELIVGTEVGALKVCRIEGTPDKPLNMTARLVPIPVTYPESVRAAAAALLATPVKVD
                     VEARLKNPLRHINRVKALQVQGSTIFSIDSSGIVIAWNARMTAEDRLSLQYVTSANCQ
                     GRVTGMELYPLPV"
     gene            complement(<1179112..>1181562)
                     /locus_tag="LMJF_31_2380"
                     /db_xref="GeneID:5654170"
     mRNA            complement(<1179112..>1181562)
                     /locus_tag="LMJF_31_2380"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685173.1"
                     /db_xref="GeneID:5654170"
     CDS             complement(1179112..1181562)
                     /locus_tag="LMJF_31_2380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685225.1"
                     /db_xref="GeneID:5654170"
                     /db_xref="UniProtKB/TrEMBL:Q4Q623"
                     /translation="MISAMQYLSQSSSTTSLHAEPFGSSTPMCSMMGPYTMSDEGPAR
                     PPAMMGSAAGLAMAFSAFSSGFYGHDDAAHPYKPAASLREGPRSGATSHQGVSLAAQL
                     YEYAESSCGCDYSRVTLYGAPCAREAAVHDCAIAAAAFAEPRFGSAHRTNSFATSGTA
                     LSDCHLSRKDGGGFTPASARTFLNSDDSFGGRSVNSRRSLRDSLTAPASSMSCSVRGS
                     VGSGYYLDTTFRGDEHNHDRVACSADGAVVLSAAQHRLSDSIHLASQGGSASRLSSEN
                     IFSLTQRLDAAESGTTNTETLHVQPHLHLSGFSTSQNDRFVSPRKRGTIEDDTEHVSA
                     NTASPATALFGNEFGPTGCSPFYDLGTVALESNKAGQSRSAVLKRDNVVPTTTAENDR
                     SRHFSSVQRRPASERQGTVGTGRSASVSSASSTATSVTPRQPSVLPKTLSGASTEPKK
                     MTCSLGSVDKSKPPAGQAPQSASRKPRRKDPRKWNNSRSTSITASNFEKDGTASSTSS
                     SSPAASRATTDTHRQKATATALAGAPPATRTDDESGCRSFLASPPQQPLQQQLNPARA
                     PNSTTTTFTISPPSYNERHQRPFLRRRYLEGQVKPLNATEMQMAMVPFSPRRDVPPSR
                     SSASGPATQALLKPAVPLQPLQCDQVTLPGTARAWSPSGTVSSSASFSVTPEKFITVA
                     SGGGAWRTQQRLAGFTGFHLSIGMEGLCVTTESSNEKSPRSLGGRSGTELRLPGESSN
                     GIMSRSCPSVEYSVDEGTNPFLIQRSASWSVHSARSITDSGEVPGIARKKRHGEHVLS
                     NAHDLEEEHVTMHPKPSR"
     gene            complement(<1186213..>1187586)
                     /locus_tag="LMJF_31_2390"
                     /db_xref="GeneID:5654171"
     mRNA            complement(<1186213..>1187586)
                     /locus_tag="LMJF_31_2390"
                     /product="zinc transporter-like protein"
                     /transcript_id="XM_001685174.1"
                     /db_xref="GeneID:5654171"
     CDS             complement(1186213..1187586)
                     /locus_tag="LMJF_31_2390"
                     /codon_start=1
                     /product="zinc transporter-like protein"
                     /protein_id="XP_001685226.1"
                     /db_xref="GeneID:5654171"
                     /db_xref="GOA:Q4Q622"
                     /db_xref="InterPro:IPR002524"
                     /db_xref="InterPro:IPR027469"
                     /db_xref="UniProtKB/TrEMBL:Q4Q622"
                     /translation="MSPEQPRETTGLTVATAGPAVTNYHTASNTVHVTLAEERTIDEA
                     LSAVNARRESEKKVLLGALIFCFVFMIVEFASGVIAHSLALLTDAIHLLTDVGSYALS
                     IGALVAAGRTACGRYSYGWHRAEVIGTLISVFSIWALVTWIVIEAGYRTYDMYMCSRV
                     PAQASAGVAKARECQAVDSRLMILVGVLGMVVNVVCASILYFGGSHGHSHFGSSHGHS
                     HGESEVHDHHHSYRDLHEGDHGHNHGHDDRHDHGHDHEHGHDHEHGHGYPAENGGGIG
                     SHKGFAVHAAILHAMGDCVQSVGVIFAGIFIYFSNLAYYGNHMYEHSLFNLADPFCSV
                     MFALITLNMTKALLMDLLSILMESTPASVDYYALETALQQIDGVISVHDLHVWSLSAE
                     YVSLSVHLVADNSAEALQKAQHICKEHFGIGHTTIQIDSVAVGTAGCASACASPTAHD
                     EILSHYM"
     gene            complement(<1189652..>1193329)
                     /locus_tag="LMJF_31_2400"
                     /db_xref="GeneID:5654172"
     mRNA            complement(<1189652..>1193329)
                     /locus_tag="LMJF_31_2400"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685175.1"
                     /db_xref="GeneID:5654172"
     CDS             complement(1189652..1193329)
                     /locus_tag="LMJF_31_2400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685227.1"
                     /db_xref="GeneID:5654172"
                     /db_xref="UniProtKB/TrEMBL:Q4Q621"
                     /translation="MQPTSAADARPPRASRRYRVLFWPHVVSTPTSALSGTGDGNRDE
                     PVELSARLKLKLGQVYLHLTHRPREATLPEHPASAPATPAGGARAKQSSLAPLKRFSR
                     QSRWLLLSLPPSRSSLHRHHSPVTSLEKKHEHAGAPSTSSTSCAHLHPKQHYIVALTE
                     ISPLAAQLPLSAELRSSLHLNRVDRDAATYSSHSTPRAPFMSLASWDLSGAPSALSSN
                     FCCPLGCDLAATSARPWDSNSSARRASSGRARSTTATHGQYLDVAEPLRSSTRTPPSP
                     LLTASSKGMGCGQSSSCPGEGDATRAHHSPCTWTSPVPRGRGSQLLTPLVDKAPASQT
                     LPITHLSSASFSSLTFPQTHAANLRLSTENFILDYEELLGVTFFGVPETAGVGNCSSS
                     DDEGHGLLDKSRRFGDRKLYETLLSSIVPPKQNLWRPQSARAASHPSEVISEDHRGAA
                     TPLHSPRRQLPTPWKGNHATRSPAFAPTAHVCAQQVLELPFKLNQAQAFCLRFLNEAD
                     LRQFLSYYIEMQTYVKQMQGKSAAAKRWAEAGGRDSGGRQLATSRLAEGDEENSVSSE
                     YEVYQRDSTTNSPRSPSTATYHEHSHHSMALGPRGSPLSTEIVSDDLLRDSQPAASEG
                     IDGGQHDNSKRYTELRALSTPARTTARSHDWQEYLRWKGDPRYGISYATVPLFLWHSF
                     LRLASSVLYTCQRGFLIVKRLPTPSSPDHSEYGSHSARCAELEASREASKQRLNDLVC
                     RPLSPIGAALEVAPPTMQPRQRQASPRPEGVSERCPTPLVPVAAPKSLPSASTTRSSC
                     DDVKLVFHSVASAPCQRTDEHITTFKDVFLCLSESHLLFMNSFGHVWFHFSVDEIVLI
                     THSAAMDSFPTHPFLHFRLKPSECFDTPTFVLLFTLIPDVPRHVQLARASASLRPPGA
                     EPATQRGSAQSTSSPSVSVERATSWASEQAPGELVAVTDNCVSLVEAEEKERLLCRHK
                     ALLNIFETVCPRPVEWCTFTELMRGENSKAYRARLRQLLLRASTGVSGSPLVANSSRV
                     YAGASSWMAQQHSTTPILCVKLTAGDISFADSDTRRSEGAHPPANQLPLASSRSFSAR
                     QAQDSQRRLSPPHRTPDGSRISAFAGPTLRWGRDDPGIVLRDAGHDMDFSFERATRTM
                     PLLACKEAVTQDCGASSQAFQSHGLYPTHCGSGSAEAKQKNEDGDGKGSSRGDAEDMY
                     VPMACKKRHSSIVRRVSMKEL"
     gene            complement(<1201131..>1202141)
                     /locus_tag="LMJF_31_2410"
                     /db_xref="GeneID:5654173"
     mRNA            complement(<1201131..>1202141)
                     /locus_tag="LMJF_31_2410"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685176.1"
                     /db_xref="GeneID:5654173"
     CDS             complement(1201131..1202141)
                     /locus_tag="LMJF_31_2410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685228.1"
                     /db_xref="GeneID:5654173"
                     /db_xref="UniProtKB/TrEMBL:Q4Q620"
                     /translation="MEGDISSSAFVCGFTAHRAHPLSPISDIRDLCVPRTSTPSASSH
                     ALAQALSFPRRPLPHRLLASCLLITTTNRFQAHCSRSAATQPPPPLPCGTTTEREYGW
                     DGLAVFLSADSRVFRSPFSTIVSRFSPFVAAMSDRDVPASMTRTCAPPKAHFLFCSTD
                     ARNAAPASNGDVAKLPAPKKPISAPLTPFQSPVDTHRDRHSSRHASPPRQLGRPLPPT
                     QPSFSDVAKRMGSFNDMCEANSLLSSHVRLGEMSTLGISASTSTIPAGSSGSTTSLHW
                     LRIAEDRVMPHPSSTKPAPAALQRNAEYVLERWVEQKVHRTAAMDDAMMKVAAAFDEL
                     YA"
     gene            complement(<1205789..>1206580)
                     /locus_tag="LMJF_31_2420"
                     /db_xref="GeneID:5654174"
     mRNA            complement(<1205789..>1206580)
                     /locus_tag="LMJF_31_2420"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685177.1"
                     /db_xref="GeneID:5654174"
     CDS             complement(1205789..1206580)
                     /locus_tag="LMJF_31_2420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685229.1"
                     /db_xref="GeneID:5654174"
                     /db_xref="UniProtKB/TrEMBL:Q4Q619"
                     /translation="MPHYHAVALSPRNCASFFPCFHHRRSFFHHGQQCPPMPTLLPRT
                     GKEAAGPTGFRGVSPSAPRLPTLQQFVIEKQGRFDRSFWHTRVLTIDTAHGRLYLSKA
                     HKAENLDHRCMNRIDSVELWPAFNSDNIPEYFGSELARRTVYVRGLVGIKSESFFTRW
                     FRSSDARTKEAEVVAANVAQTRASASRSEPHDIDLDGRRDTIEASVLYPVDSYMRFEA
                     EIWLIRCMTLHDLHEMADAFRAAIPEASPVLKGYQALKQRLAGSD"
     gene            complement(<1211318..>1212355)
                     /locus_tag="LMJF_31_2430"
                     /db_xref="GeneID:5654175"
     mRNA            complement(<1211318..>1212355)
                     /locus_tag="LMJF_31_2430"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685178.1"
                     /db_xref="GeneID:5654175"
     CDS             complement(1211318..1212355)
                     /locus_tag="LMJF_31_2430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685230.1"
                     /db_xref="GeneID:5654175"
                     /db_xref="UniProtKB/TrEMBL:Q4Q618"
                     /translation="MMLLSLTRCRLPSLSPPPSTHSSFSLHTNIQTGVLFVCCSAHPL
                     PHRLPVAVPGCHPSHKCVLPPPSVPSTQLFSLAVRVAPPPHTHTQHFSSTHASPPIPP
                     PHTRICAAGMAAETKPSQQQQEQPNDARPPQIVVRKQGMYERGRWSTRILTIDVDAGT
                     ATISRKSKPQDVLYRSLHVQKVEMWPHYSPYAIESSYDSLKAKMVLCITGTEVSLTNH
                     GSSVGSFLRSNIGPLISASVVAENASWSAKPSKHVRLKGIFAKRNPMFATMASNSAAT
                     DRSTLTWLIHCTSIESYELAVMLFMRFKNEGGARRKVFSNNVVADLACVKRAWIKHAA
                     RFKTATDAETS"
     gene            complement(<1214544..>1215203)
                     /locus_tag="LMJF_31_2440"
                     /db_xref="GeneID:5654176"
     mRNA            complement(<1214544..>1215203)
                     /locus_tag="LMJF_31_2440"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685179.1"
                     /db_xref="GeneID:5654176"
     CDS             complement(1214544..1215203)
                     /locus_tag="LMJF_31_2440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685231.1"
                     /db_xref="GeneID:5654176"
                     /db_xref="UniProtKB/TrEMBL:Q4Q617"
                     /translation="MSKAVQFSVLKQGSLEPGSWTQRVLTIDTKSDTVTISRKHHPEH
                     VFYHSLEVAHVQMWPRYKASEISGHFNSLKAKMTLRIFGKQVPVPKMSVEAVTTADVA
                     EMIRVPSVPSSISLDASLNIERPPVAAATLSQKQKERHPATATSANDDLCDSWMIRFT
                     SIDSYELAVMLLRNMRNTEGKRKRLFGDHVLQDLERVQKAWAEETTGAKSIGGALRSG
                     S"
     gene            complement(<1216718..>1217428)
                     /locus_tag="LMJF_31_2450"
                     /db_xref="GeneID:5654177"
     mRNA            complement(<1216718..>1217428)
                     /locus_tag="LMJF_31_2450"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685180.1"
                     /db_xref="GeneID:5654177"
     CDS             complement(1216718..1217428)
                     /locus_tag="LMJF_31_2450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685232.1"
                     /db_xref="GeneID:5654177"
                     /db_xref="UniProtKB/TrEMBL:Q4Q616"
                     /translation="MVIFRHANCRHLLLPAHPRKYFALHSPPPTHPLQISHKFAEMEE
                     FPVQKQSSLKADKWTGCVLSLHAKLGIAAITDRGRPGDRFHACMRVSRVQVWPQYNKK
                     HVKESFSSTEVMLTVRMKGIPAKIGVREKQSATGPVKIYRYTIKGHKAEKYTWMLRFN
                     NYEDFEKAMHLVQSMQTAGENYSVVRYGETQRLEEGCEGVTGELETEEFLPHPVVYGN
                     LKDVLAPIRAQWQQTRSK"
     gene            complement(<1218315..>1219412)
                     /locus_tag="LMJF_31_2460"
                     /db_xref="GeneID:5654178"
     mRNA            complement(<1218315..>1219412)
                     /locus_tag="LMJF_31_2460"
                     /product="putative lipase"
                     /transcript_id="XM_001685181.1"
                     /db_xref="GeneID:5654178"
     CDS             complement(1218315..1219412)
                     /locus_tag="LMJF_31_2460"
                     /EC_number="3.1.1.3"
                     /codon_start=1
                     /product="putative lipase"
                     /protein_id="XP_001685233.1"
                     /db_xref="GeneID:5654178"
                     /db_xref="GOA:Q4Q615"
                     /db_xref="InterPro:IPR002921"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q4Q615"
                     /translation="MTQLPKLVCFTTVVAGLIVLLTLYTVSTLRTADGDATVVGVNSA
                     GYSVTDGWKALHFSKAAYCDVADLRHWGCGVTCANATPEFQVFNIYENNSTGNVGYSG
                     VDHDAKRIVVAFRGTYNTVNWLQNLDFRLTSYPHPGCGNGCKIHRGFYKAYSSLRAQM
                     IDDVLLLHARYPLYTLFITGHSLGGAMAMLAAVELATWNMLEGDVLGKGVQSRSAASP
                     PLHLAPVELYTFGEPRVGNGYFSNWSLSVLTRKRSFRLTHAKDPVPHVPPRLFTYVHT
                     PQEVWYPTDDEKYHLCQGTGTSEDPLCSDSVLGTKVSDHLIYLGICTRCECTAEEMEK
                     IYSYELPPEIYNIIALDHAMNNPNFTGHRAL"
     gene            complement(1222284..1223291)
                     /locus_tag="LMJF_31_2461"
                     /pseudo
                     /db_xref="GeneID:12981444"
     misc_feature    complement(1222284..1223291)
                     /locus_tag="LMJF_31_2461"
                     /pseudo
                     /db_xref="GeneID:12981444"
     gene            complement(1222287..1223331)
                     /locus_tag="LMJF_31_ncRNA"
                     /db_xref="GeneID:12981445"
     ncRNA           complement(1222287..1223331)
                     /ncRNA_class="other"
                     /locus_tag="LMJF_31_ncRNA"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460984.1"
                     /db_xref="GeneID:12981445"
     gene            complement(<1224360..>1225274)
                     /locus_tag="LMJF_31_2470"
                     /db_xref="GeneID:5654179"
     mRNA            complement(<1224360..>1225274)
                     /locus_tag="LMJF_31_2470"
                     /product="uridine kinase-like protein"
                     /transcript_id="XM_001685182.1"
                     /db_xref="GeneID:5654179"
     CDS             complement(1224360..1225274)
                     /locus_tag="LMJF_31_2470"
                     /EC_number="2.7.1.48"
                     /codon_start=1
                     /product="uridine kinase-like protein"
                     /protein_id="XP_001685234.1"
                     /db_xref="GeneID:5654179"
                     /db_xref="GOA:Q4Q614"
                     /db_xref="InterPro:IPR000764"
                     /db_xref="InterPro:IPR006083"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q614"
                     /translation="MRSPSVSSQRSAAVSESSCHHLYHVQGDVRSLVVTTPWRSAMIQ
                     PPFLPQHMCRSLESTYKHASLLFTGGDSHGVCRARQLLRLGLRQVVAERAHRIGAHPG
                     DRGPNRSGIFCEELYHRDESNVPEGEHPSTDYSHPKSLEQELRATHVFELRAGKRVQV
                     PPYDYVRHARSGNTVTTTPTRIIMVEGILLFTNAELCKAMDCLIFVGTPLDICLIRRA
                     ERDAKERGHTFKAAIEQYATTVRRVHCAYAELSKVHVDISAPCWKNSGVAFGVLRVKQ
                     SHVLPLPHHRKNVMRCHRSAEFDCALGL"
     gene            complement(<1225470..>1225952)
                     /locus_tag="LMJF_31_2480"
                     /db_xref="GeneID:5654180"
     mRNA            complement(<1225470..>1225952)
                     /locus_tag="LMJF_31_2480"
                     /product="ferredoxin 2fe-2s-like protein"
                     /transcript_id="XM_001685183.1"
                     /db_xref="GeneID:5654180"
     CDS             complement(1225470..1225952)
                     /locus_tag="LMJF_31_2480"
                     /codon_start=1
                     /product="ferredoxin 2fe-2s-like protein"
                     /protein_id="XP_001685235.1"
                     /db_xref="GeneID:5654180"
                     /db_xref="GOA:Q4Q613"
                     /db_xref="InterPro:IPR001041"
                     /db_xref="InterPro:IPR001055"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR018298"
                     /db_xref="UniProtKB/TrEMBL:Q4Q613"
                     /translation="MHRLALPRVVLCARHPAASAPLTTSSGASLRWCSSPPPSLSPST
                     TPGKVKVHIKSETEGTEKTVEAALGLTLMEVIRDVAKMDMEAACDGTCACSTCHVIFT
                     AASYQKLLDAPSEDEMDMLDLAPKVTKTSRLSCQVKIAPELDDISVTIPNEMENQMGY
                     "
     gene            complement(<1226647..>1227084)
                     /locus_tag="LMJF_31_2490"
                     /db_xref="GeneID:5654181"
     mRNA            complement(<1226647..>1227084)
                     /locus_tag="LMJF_31_2490"
                     /product="ferredoxin, 2fe-2s-like protein"
                     /transcript_id="XM_001685184.1"
                     /db_xref="GeneID:5654181"
     CDS             complement(1226647..1227084)
                     /locus_tag="LMJF_31_2490"
                     /codon_start=1
                     /product="ferredoxin, 2fe-2s-like protein"
                     /protein_id="XP_001685236.1"
                     /db_xref="GeneID:5654181"
                     /db_xref="GOA:Q4Q612"
                     /db_xref="InterPro:IPR001041"
                     /db_xref="InterPro:IPR001055"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="UniProtKB/TrEMBL:Q4Q612"
                     /translation="MRNHSLLLATGVLLRPPMALAGALYTSRVLYSIPGKVKVCARTR
                     DGTPCDFEAPVGMSLMHAIRDVARLEMDGACDGCAQCSTCHVYLSEACFKKLGKPSEQ
                     EQDVLDKALDLQDTSRLACQITLTPAMDGLEVVLPKNVTNLLM"
     gene            complement(<1227857..>1228282)
                     /locus_tag="LMJF_31_2500"
                     /db_xref="GeneID:5654182"
     mRNA            complement(<1227857..>1228282)
                     /locus_tag="LMJF_31_2500"
                     /product="ferredoxin, 2fe-2s-like protein"
                     /transcript_id="XM_001685185.1"
                     /db_xref="GeneID:5654182"
     CDS             complement(1227857..1228282)
                     /locus_tag="LMJF_31_2500"
                     /codon_start=1
                     /product="ferredoxin, 2fe-2s-like protein"
                     /protein_id="XP_001685237.1"
                     /db_xref="GeneID:5654182"
                     /db_xref="GOA:Q4Q611"
                     /db_xref="InterPro:IPR001041"
                     /db_xref="InterPro:IPR001055"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR018298"
                     /db_xref="UniProtKB/TrEMBL:Q4Q611"
                     /translation="MHRRFILGHVLPRCMLALAPLSASRALSSAPGKVELRVKKRDGT
                     HCHVYVPVGISLMHALRDVSKMDVEGTCNGAMVCATCHVKLSAASFKKIEGPSEVEED
                     VLARALDVEETSRLACQVDLTPELDGLEVELPSQETDRS"
     gene            complement(<1229132..>1229680)
                     /locus_tag="LMJF_31_2510"
                     /db_xref="GeneID:5654183"
     mRNA            complement(<1229132..>1229680)
                     /locus_tag="LMJF_31_2510"
                     /product="ferredoxin, 2fe-2s-like protein"
                     /transcript_id="XM_001685186.1"
                     /db_xref="GeneID:5654183"
     CDS             complement(1229132..1229680)
                     /locus_tag="LMJF_31_2510"
                     /codon_start=1
                     /product="ferredoxin, 2fe-2s-like protein"
                     /protein_id="XP_001685238.1"
                     /db_xref="GeneID:5654183"
                     /db_xref="GOA:Q4Q610"
                     /db_xref="InterPro:IPR001041"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="UniProtKB/TrEMBL:Q4Q610"
                     /translation="MFVRRRGCSLVTLPLPRSLSGTMTPIKLSRLCCASGTGLSPPSV
                     SSATSLRSETPGKVLVRIRDRDGTAYERMYNEGDNLMEAIRDDTTLPVEVPGACNGTC
                     QCSTCHVLLHSAEWLGKVGRLFAITDAEQDCLDKASGVSDASRLSCQLTLSGELNGIE
                     IDLPKSTLDVRWQAAYRRSTKK"
     gene            complement(<1231578..>1234121)
                     /locus_tag="LMJF_31_2520"
                     /db_xref="GeneID:5654184"
     mRNA            complement(<1231578..>1234121)
                     /locus_tag="LMJF_31_2520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685187.1"
                     /db_xref="GeneID:5654184"
     CDS             complement(1231578..1234121)
                     /locus_tag="LMJF_31_2520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685239.1"
                     /db_xref="GeneID:5654184"
                     /db_xref="InterPro:IPR002049"
                     /db_xref="InterPro:IPR013032"
                     /db_xref="UniProtKB/TrEMBL:Q4Q609"
                     /translation="MWPALRRAALWGLWLALAVLCSSSGWVSRASIVNCTVTSVTRSQ
                     LAVLPHEHWAQYQTICGSPNATQTWTDTSLMRFFFPPLSRAGTSAAFYAWNGISWYVS
                     DMGFLSPTPYGMCKSFCQKRIYATLQGNYAFSDNVSLLHDGGGDWPMISFYAAPFAFS
                     GGSPSQVSIVTQDTIADGAVRSAAGEHTPDSSESIRNSGFDGGYTTLEYCNVPILGAT
                     GSAQTQLTAQVVVYANGTIIMRYASLPRTSTLPKYMPSTGLIYSKTLRTVVPTPTTAN
                     GIVAYRFDPVFDGCAAHGDASVCTADTESDCVWCSSTSACCASTVASAVCPRGQWTAP
                     ASSTAAFAPQKFYDVTVDFDTPFVSMSSYNYSYTLEHGYFPLHLEHFERNIPLFQTPS
                     QSIMKCIPGASCPTQADTHPCGLYHSMCMNGNYTLSILALESSLRFAKGGLWTVKALP
                     ERARGEQLCEEEGGCATGLVGQLTGAAVDSYSSTPLFSVQLYADANGVIDITIDCVRC
                     AQGDPMLTYPPMRVGLVRYGVDDASSVMIPQGLLRSGLHVRFVPRSSCKDCGLNGWCD
                     ESSGTCQCQPGYHGRSCVACPACWTGSECDDGINGSGSCLCNGGACEAACVNASSGSV
                     PPRSCAGCDAVGGRCNCGVCECRDGWSGAGCSKAPADACRAYSLDGCKVCGQHEGCVF
                     CHDSTCFNPALSGTRDGYTCSHSTPAADTQACVTYGSLGLHPPLYKGFDFIAIICLAF
                     AAPVVFSLLVLVVAVRRNRRVPNPMDVFSVTGVPEFRNLQTEREVVQAAFARKRVQER
                     EMMGIPLKQISLRRLFNRRAAGLMSGPAQQGRLVGQLFPHPPTEGRRGW"
     gene            complement(<1235744..>1238221)
                     /locus_tag="LMJF_31_2530"
                     /db_xref="GeneID:5654185"
     mRNA            complement(<1235744..>1238221)
                     /locus_tag="LMJF_31_2530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685188.1"
                     /db_xref="GeneID:5654185"
     CDS             complement(1235744..1238221)
                     /locus_tag="LMJF_31_2530"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685240.1"
                     /db_xref="GeneID:5654185"
                     /db_xref="InterPro:IPR002049"
                     /db_xref="InterPro:IPR013032"
                     /db_xref="UniProtKB/TrEMBL:Q4Q608"
                     /translation="MWPALRRAALWGLWLALAVLCSSSGWVSRASIVNCTVTSVTRSQ
                     LAVLPHEHWAQYQTICGSPNATQTWTDTSLMRFFFPPLSRAGTSAAFYAWNGISWYVS
                     DMGFLSPTPYGMCKSFCQKRIYATLQGNYAFSDNVSLLHDGGGDWPMISFYAAPFAFS
                     GGSPSQVSIVTQDTIADGAVRSAAGEHTPDSSESIRNSGFDGGYTTLEYCNVPILGAT
                     GSAQTQLTAQVVVYANGTIIMRYASLPRTSTLPKYMPSTGLIYSKTLRTVVPTPTTAN
                     GIVAYRFDPVFDGCAAHGDASVCTADTESDCVWCSSTSACCASTVASAVCPRGQWTAP
                     ASSTAAFAPQKFYDVTVDFDTPFVSMSSYNYSYTLEHGYFPLHLEHFERNIPLFQTPS
                     QSIMKCIPGASCPTQADTHPCGLYHSMCMNGNYTLSILALESSLRFAKGGLWTVKALP
                     ERARGEQLCEEEGGCATGLVGQLTGAAVDSYSSTPLFSVQLYADANGVIDITIDCVRC
                     AQGDPMLTYPPMRVGLVRYGVDDASSVMIPQGLLRSGLHVRFVPRSSCKDCGLNGWCD
                     ESSGTCQCQPGYHGRSCVACPACWTGSECDDGINGSGSCLCNGGACEAACVNASSGSV
                     PPRSCAGCDAVGGRCNCGVCECRDGWSGAGCSKAPADACRAYSLDGCKVCGQHEGCVF
                     CHDSTCFNPALSGTRDGYTCSHSTPAADTQACVTYGSLGLHPPLYKGFDFIAIICLAF
                     AAPVVFSLLVLVVAVRRNRRVPNPMDVFSVTGVPEFRNLQTEREVVQAAFTRKRVQER
                     EMMGIPLKQISLRRLFKRRKEGLMNAQ"
     gene            complement(<1239844..>1242381)
                     /locus_tag="LMJF_31_2540"
                     /db_xref="GeneID:5654186"
     mRNA            complement(<1239844..>1242381)
                     /locus_tag="LMJF_31_2540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685189.1"
                     /db_xref="GeneID:5654186"
     CDS             complement(1239844..1242381)
                     /locus_tag="LMJF_31_2540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685241.1"
                     /db_xref="GeneID:5654186"
                     /db_xref="InterPro:IPR002049"
                     /db_xref="InterPro:IPR013032"
                     /db_xref="UniProtKB/TrEMBL:Q4Q607"
                     /translation="MHPASLRLANAFRGLLKHGTMPVSIRGLHHVARAVVACLILVVT
                     ATAAAASIVKYTVTSVTRSQLAVLPHEHWAQYQTICGSPNATQTWTDTSLMRFFFPPL
                     SRAGTSAAFYAWNGISWYVSDMGFLSPTPYGMCKSFCQKRIYATLQGNYAFSDNVSLL
                     HDGGGDWPMISFYAAPFAFSGGSPSQVSIVTQDTIADGAVRSAAGEHTPDSSESIRNS
                     GFDGGYTTLEYCNVPILGATGSAQTQLTAQVVVYANGTIIMRYASLPRTSTLPKYMPS
                     TGLIYSKTLRTVVPTPTTANGIVAYRFDPVFDGCAAHGDASVCTADTESDCVWCSSTS
                     ACCASTVASAVCPRGQWTAPASSTAAFAPQKFYDVTVDFDTPFVSMSSYNYSYTLEHG
                     YFPLHLEHFERNIPLFQTPSQSIMKCIPGASCPTQADTHPCGLYHSMCMNGNYTLSIL
                     ALESSLRFAKGGLWTVKALPERARGEQLCEEEGGCATGLVGQLTGAAVDSYSSTPLFS
                     VQLYADANGVIDITIDCVRCAQGDPMLTYPPMRVGLVRYGVDDASSVMIPQGLLRSGL
                     HVRFVPRSSCKDCGLNGWCDESSGTCQCQPGYHGRSCVACPACWTGSECDDGINGSGS
                     CLCNGGACEAACVNASSGSVPPRSCAGCDAVGGRCNCGVCECRDGWSGAGCSKAPADA
                     CRAYSLDGCKVCGQHEGCVFCHDSTCFNPALSGTRDGYTCSHSTPAADTQACVTYGSL
                     GLHPPLYKGFDFIAIICLAFAAPVVFSLLVLVVAVRRNRRVPNPMDVFSVTGVPEFRN
                     LQTEREVVQAAFTRKRVQEREMMGIPLKQISLRRLFKRRKEGLMNAQ"
     gene            complement(<1243626..>1245995)
                     /locus_tag="LMJF_31_2550"
                     /db_xref="GeneID:5654187"
     mRNA            complement(<1243626..>1245995)
                     /locus_tag="LMJF_31_2550"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685190.1"
                     /db_xref="GeneID:5654187"
     CDS             complement(1243626..1245995)
                     /locus_tag="LMJF_31_2550"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685242.1"
                     /db_xref="GeneID:5654187"
                     /db_xref="UniProtKB/TrEMBL:Q4Q606"
                     /translation="MFYTYVEKQGGGFFGSWQTRQVAFDTLRRYLYYSEAVKNELPVV
                     HSHTSEAVDATTTTTGDSGSSGSVAAQPAHTDQATPSSASLEFTVSEVAVPPASFTWR
                     RKVKVTGVLPLATRPEFSADHSLNERDFYQLEIEGESRPMARGETPPAGPLLCPAAGL
                     SQHERSRCHWSNDAYIRDPFFLKELFDSLRDQFEHLEAQRVRAAAAAADSGVGAADLT
                     GNSVVGAGVQTLVSPRGPKGELLHQGAVVPVRLIFRSRDEREFRRLWYVLQSVLGYDK
                     LIVRPYRGLPPYDPRNGVAFAHIPMSVWHTFHSLDKAVFYTFMRGNMYTLEEASSGGT
                     ASNAAAFHESSMSGSFASTPKLKRILKGAYLCVTHDSVLCMRDTGSIPRWLRLAEVQE
                     FHWNLVARDAATNTLAPFCVFISDEPIPDLFFEPLPPALGTDAIAAYTPLVDVRRLAC
                     VIHDSCFASLSTRRVIRMREARDASMESYVARTVQEGQRRPVLGLGAGYNSTLSCPLP
                     KEQLATVWQQVQAELLERGNMANRAAIPIYASNARDVELSEDQLSAVERALDDTRERR
                     DDIVGMPLERARQLERQGRPAATAVTRASRPRQRHRDATVGVDRNPNPVLASAFAARE
                     QTSAATPSTTTTVVRGMPLTMELLQTPQIQGHFAPGTASGQAVQASQRDEGDASSAQS
                     KSCSESTVVASEYSCYLVPGARYISQEEWQSGTYATAGSALSADRPVDVPRHLAAVVG
                     ADGSAASTNKSAIAAASPPYAEERTLNEIIGRSMAALEESRTDLHQLDP"
     gene            complement(<1248207..>1251251)
                     /locus_tag="LMJF_31_2560"
                     /db_xref="GeneID:5654188"
     mRNA            complement(<1248207..>1251251)
                     /locus_tag="LMJF_31_2560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685191.1"
                     /db_xref="GeneID:5654188"
     CDS             complement(1248207..1251251)
                     /locus_tag="LMJF_31_2560"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685243.1"
                     /db_xref="GeneID:5654188"
                     /db_xref="UniProtKB/TrEMBL:Q4Q605"
                     /translation="MNASLTPRLSLSLSLSLGFRAGHFDFPSPFTPPSPAVHAHAEAH
                     TVPLARTSAASLCLVVFSGLRLPLCLARRKRTHREHPFPSGWSLRTLRDTSLAALSPL
                     PYQAATRHRTGLTHSTCSPPLRPRHLRFRSTHIDSFLTPPPPALLKMFYTYAEKQGSV
                     FFDKWQMRQIAFDTLRRHLYYCDCVSPEKIAYPNANDNPFPTIGASDDSLEDGEDFDP
                     DLGATVENPAVSQLFMRPPVSSVNQRRHFNEAPPPPNNPDDVQWRKKIKVDMIVAVGK
                     EHVFLLEDTHLKETDLFQIEIHGEVRPMASGETPAPGPLLCPSAGLSGMPNRCTVEND
                     EFIRDPFFLRELYEALRYQFSNLRMERERAELASGQPVVSANARRTQTLESPRPKGGS
                     VHRGSRIKIVLRMRTDYEFRRFVYVVQTVLGYDKLSARPYRGLPPYDPRNGLIFSVIP
                     MCVWHTFKLLDKTVFYTFLRGDLVGRNAGNQLYVTLRGAYLCITHDSVLVMRDTGNIP
                     RWIKLQEVREFYYNVTSSRPFVAFLSDPGSPDIIFLPQPPVFGREAIRCFSPSLEVLR
                     LRHVIHETCFASLEIRRVINIKIADMSVRSFVECYERETRRVLDLDPARCYAGVLSCP
                     LPKEQLAQVWREVQGIYAARDPSVISNTAIPLYQNNTNDTALTGDQLETLSRRLARER
                     RSRDDVVGMPYEEAQRIQAPVRRDSRLHSRHHLTPLYSHEAITTQSASDATLVHLDPQ
                     SSHSSASPGRGETLAATSSHPRSAGHDSAYNGSAGSQLEGSAVSAASSPRWPISLSAA
                     PPNTSSWTAADAAAGGNTHRLSDVAAPNLSGNAAMPSGVDDAFTQANPRLTQLPNHRL
                     ETPQLSTSVGGGAAGFGASPGLVNASFASSQFGANSVQYQLPGARYLSEDEIKGGSSC
                     VAVDHHTVLMGDTPLVAEGTVTAFLSSTELNVSELVNKSITAMQATAPPPLKRSNSAE
                     LSKDTCKGSEGKTASAALASSRTRAGRSTSQSRKNDDSSVET"
     gene            complement(<1253130..>1256465)
                     /locus_tag="LMJF_31_2570"
                     /db_xref="GeneID:5654189"
     mRNA            complement(<1253130..>1256465)
                     /locus_tag="LMJF_31_2570"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685192.2"
                     /db_xref="GeneID:5654189"
     CDS             complement(1253130..1256465)
                     /locus_tag="LMJF_31_2570"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685244.1"
                     /db_xref="GeneID:5654189"
                     /db_xref="UniProtKB/TrEMBL:Q4Q604"
                     /translation="MHYFFLEKQSPLTQRWQVRQVAFDSKYRYLYYTKSLSRADIEEV
                     MTRCHDGDPSSGACHNSSSGTSSRKVKWSGKVKVTQLRYAADEYIVAPGSSDFDERIL
                     LTLIVVGYERPLGRHRSRGKVVSSGNRSIGGTSEKSFSLWSSVSRHYSTSRISSVRLG
                     DSDGDADEDAASKTTGVHQPLLLNAENDMPEPESPSGFLHMPSYPVNESLDEDFEDED
                     ENMFRDIDLVPDDEEDEEETSVAASEAETEEGSDDSDADDGDDVAFNSPPSTPTGSTR
                     SGYSFFSRRQQSTKGGGKAKDGTMVQLQFRAANYDVFRIVSLRVRQALVRHGLCGPLH
                     AGLPPYDPRNGIALATVPLHLRHAFRRLNDVVFYSLQIGHVVYVRQQREVRGIAGYLC
                     ITHDSILLLQLDGKCPRWLDLEDIVGVQYVLRSNHSFISIRAAEPYPDFVFIPIIPSY
                     PPNSTFNSEECVEGIVSMVRRLLMQRLRAGEEVALAPISSCRLSIQTAEDIEEYDILC
                     HINDLSSTYTDVFKYIAQQQSTGAVPLRWRWDNSKTPSHFTFKRDLYHALEREEGEDS
                     EDEDEAALSRSQRRPSVASAAASHAHMVESLVPSRQQQHLSTGGGLVAVPVSAPASSG
                     AICVHAAARSTLCKAPSCASQQPSRSALPPQDLLYSNASFMPATMTQLMAPPSRGAEL
                     RAKRKLLVTRTDRRNAGVAEAARNATGHHQPPLSRPPQPAGVTAGTNLGLAQESSAAP
                     DITLATAPVSSTPPEGAAPSALPPRPSTGSREAAIGAPAASLGPPPQKDAQRASSTPL
                     STRPASSKPNTYGLVPSQHHTDPATLDFWFSTAAPPVAPVATAQKGVHLSDIHSSVHH
                     GQPAAQHQLATQPTGAASGGHERLGVVPPVNQRGVSAAPAAPAVKLVCGVPGMFGSSL
                     TSTTTPVGAASAPHSFASAPIAGGAFSSALQRAHSPSAGHGGSATNSSCSPKEVTHTT
                     ENMSNDRAADEDEESDEDFDSEDMESMLQRPESRAPPAAAGTTTPAAAAAGASGESAL
                     GAAGAMAAEMKDGVVMSTDGAAFVPVGGGVVTQVVLRAEMLPGYGGRRDKDHRSDAAS
                     SPSPSLQARPEMVAFISPVALPH"
     gene            complement(<1258656..>1259081)
                     /locus_tag="LMJF_31_2580"
                     /db_xref="GeneID:5654190"
     mRNA            complement(<1258656..>1259081)
                     /locus_tag="LMJF_31_2580"
                     /product="ubiquinol-cytochrome-c reductase-like protein"
                     /transcript_id="XM_001685193.1"
                     /db_xref="GeneID:5654190"
     CDS             complement(1258656..1259081)
                     /locus_tag="LMJF_31_2580"
                     /codon_start=1
                     /product="ubiquinol-cytochrome-c reductase-like protein"
                     /protein_id="XP_001685245.1"
                     /db_xref="GeneID:5654190"
                     /db_xref="GOA:Q4Q603"
                     /db_xref="InterPro:IPR003422"
                     /db_xref="InterPro:IPR023184"
                     /db_xref="UniProtKB/TrEMBL:Q4Q603"
                     /translation="MNHHPMYSNPSSSFFRPHFVSAFLPTNNLCGGPANGTLSLPHGD
                     GVCAAHGAALFDSPTFQESTGPFNCPAMASDPVDIKLDLEKECLANECVKKVGAYNAC
                     LERIKTVSPEKEPHCYNQYFAIVHCVDVCVDPKLWPTLK"
     gene            complement(<1260004..>1262793)
                     /locus_tag="LMJF_31_2590"
                     /db_xref="GeneID:5654191"
     mRNA            complement(<1260004..>1262793)
                     /locus_tag="LMJF_31_2590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685194.1"
                     /db_xref="GeneID:5654191"
     CDS             complement(1260004..1262793)
                     /locus_tag="LMJF_31_2590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685246.1"
                     /db_xref="GeneID:5654191"
                     /db_xref="GOA:Q4Q602"
                     /db_xref="InterPro:IPR003325"
                     /db_xref="UniProtKB/TrEMBL:Q4Q602"
                     /translation="MSCADVRQKVFRVPGSIVLSLGLSWDFIGADPVDLDLSAVCFTK
                     EGRFLDVVFFNHLFPEGTDETALRTHYMVDPELLPYMFLSGDSTVGGEDENQLPGLAL
                     AARRLHQRLRRRAKHQATARGGILGTRDYTNAAANVFDRLYDEEQLADVQRAADEAIG
                     YDEDAADNEVGAGQRPLRRRPCRHRELADEVLTFVMSKIPGEAEVIFITVSSYTGQDF
                     TVLSRAKLVIYNESTNERVGVMDVRQTTENGTANLAAMLIRLPPSQEEEGVYGTDLGS
                     VNGGVAAQEWDLRELNVRTFGYSFVDTLPLMMDVLGVPRRSLLDVLQNVPDYSLSKAK
                     AEIASWTLSDVRLGVGWSGEHDIDAFLVFLDENHNYVDHLYPKNGKLRSIARDAARHS
                     GDALCGSSSAGDEEFIDLLTYRVPDNVGSIVVGATWMESFGPEKRTCKSIFDVPDLYL
                     RLQNRTVMNPHSMEVDRWPLNREAHDPNVKKQLPTSYKDAENKEQPVRAVVLGALMKT
                     GTQPFEALFPNGRRIDQHFHKHGRSLSVSGAGQSRSASVASRADDGGGVAVSECEADR
                     EEEVPLFQLVPIHQYVPVDPREGMSRVIPYLQCMMAYAATVERHTIAAARRRVAEAEA
                     ARRGHATLYSGVESCKAAPLDTRAGTADTRLVLNRENNMVGWNPATSASLRRGGRGEV
                     TVQTARKQAEREQAASDTAETTLLRNRYECMWEKIKHYDNRTDLFAIAVQFLEVVEVQ
                     PQMPDRFRCHGEVWVFGQTNCIVPVHGSVSVFDNKPYRSPVLVDREKLAWADPSSSSS
                     SCGYFIVHKYDRLRVMLFETASVGVADLDLLSMDALWAGKDNVRDGTLADRFNPVECN
                     VRLEGGANEAGTGELVYSAEVRLRVSRVPLNAAMKRLQQQADRINAQRGHVQKLQNRY
                     DERYYNKQYKRCTVM"
     gene            complement(<1264535..>1265737)
                     /locus_tag="LMJF_31_2600"
                     /db_xref="GeneID:5654192"
     mRNA            complement(<1264535..>1265737)
                     /locus_tag="LMJF_31_2600"
                     /product="putative calreticulin"
                     /transcript_id="XM_001685195.1"
                     /db_xref="GeneID:5654192"
     CDS             complement(1264535..1265737)
                     /locus_tag="LMJF_31_2600"
                     /codon_start=1
                     /product="putative calreticulin"
                     /protein_id="XP_001685247.1"
                     /db_xref="GeneID:5654192"
                     /db_xref="GOA:Q4Q601"
                     /db_xref="InterPro:IPR001580"
                     /db_xref="InterPro:IPR009033"
                     /db_xref="InterPro:IPR009169"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR018124"
                     /db_xref="UniProtKB/TrEMBL:Q4Q601"
                     /translation="MAQRAMLAAIVGVLVLCVYVVQAEIFFHEEFNTMDGWVQSEHTS
                     DYGKVALSVGAIHVDAEKEQGLKLMEDAKFYAVSKKLPKAVSNDGKPIVVSFSVKNEQ
                     KLTCGGTYLKFFSELDQKDLHGESAYWLMFGPDICGSNKRLQFILSYNGTNHLWKKLS
                     TPKTDTATHVYTVEIAPNNTYQLYVDGMHIQEGSLEEEWDMLPPKTISDPTDKKPADW
                     VDDMMMDDPSDTKPEDWEDEPATITDSEAVKPVDWDDSEDGVWEAPKVPNPNYRGAWK
                     PRRIHNPDYKGEWAARQIPNPVYKKDPNLYKVPAPLQYVGIDVWQVEGGSIFDDIIIG
                     DDITEVLRVVKSTYGAMAEKERDLIQAEAKKEAMKEPAEAAAEKPNMDEHADHTPDED
                     KSEGEEDL"
     gene            complement(<1266766..>1271754)
                     /gene="RPOIILS"
                     /locus_tag="LMJF_31_2610"
                     /db_xref="GeneID:5654193"
     mRNA            complement(<1266766..>1271754)
                     /gene="RPOIILS"
                     /locus_tag="LMJF_31_2610"
                     /product="RNA polymerase ii largest subunit"
                     /transcript_id="XM_001685196.1"
                     /db_xref="GeneID:5654193"
     CDS             complement(1266766..1271754)
                     /gene="RPOIILS"
                     /locus_tag="LMJF_31_2610"
                     /codon_start=1
                     /product="RNA polymerase ii largest subunit"
                     /protein_id="XP_001685248.1"
                     /db_xref="GeneID:5654193"
                     /db_xref="GOA:Q4Q600"
                     /db_xref="InterPro:IPR000722"
                     /db_xref="InterPro:IPR006592"
                     /db_xref="InterPro:IPR007066"
                     /db_xref="InterPro:IPR007073"
                     /db_xref="InterPro:IPR007075"
                     /db_xref="InterPro:IPR007080"
                     /db_xref="InterPro:IPR007081"
                     /db_xref="InterPro:IPR007083"
                     /db_xref="UniProtKB/TrEMBL:Q4Q600"
                     /translation="MSGGAPLPPSQMPLQKVHEVQFEVFKEAQIKAYAKCIIEHAKSY
                     EHGQPVRGGINDLRMGTTDFEYSCETCGLRHPECPGHFGYVELAEPIFNINVFDVVLI
                     ALKCVCKYCGALLMDTNDPSEMKKIAHLQGLNRLRMVAKLCGSVCKRSKDIQGCEGKG
                     RQPRIGRFVGIYPGLQIKVTQEEQDYVWHAENARQVLDRVSDSDALIMGFDRRFCHPR
                     DLILTVLPIPPPQVRPAVTFGSAKSDDELTHQIMSIVKRNIQLRKDKESGVKAAVDRS
                     RALLQEHVATFFNNASTYYKPAKVGDTKKLKSLTERLKGKYGRLRGNLMGKRVDFSAR
                     TVITGDPNIDVDEVGVPFSVAMTLTFPERVNVINKKRLTEFVQRTTYPSANYIIRPNG
                     NVTKLALVKDRSAVHLDVGDVVERHVIDGDVVLFNRQPTLHRMSMMGHRVRVLNYNTF
                     RLNLSCTTPYNADFDGDEMNLHVPQSLLTKAELIEMMMVPKNFVSPNKSAPCMGIVQD
                     SLLGSYRLTDKDTFVDKYFIQSVALWLDLWELPIPAILKPRPLWTGKQIFSLILPEVN
                     HPASPYDKPPFPHNDKKIMIQRGQLLVGAITKGVVGAAPGSLIHVIFNERGSDEVAKF
                     INGVQRITTYFNYCFAFSVGVQDTVADATTLKEMNNVLHKTRQSVEKIGAAANNGKLT
                     RKAGMSLLQSFEADVNSALNKCREEAAKKALSNVRRTNSFKVMIEAGSKGSDLNICQI
                     AVFVGQQNVAGSRIPFGFRRRTLPHFMLDDYGETSRGMATRGYVEGLQPHEFYFHTMA
                     GREGLIDTAVKTSDTGYLQRKLVKALEDVHASYDGTVRNANQELIQLAYGEDGLDGAR
                     IEGNQAFPIPHMTNSEMADKYRYEYNDEGSFSENMGGHYMDPFVRDSLLRDPQSVLKL
                     QEEFEQLMRDRAMSRLVIDMEDKNKLKMNLPVNVARLIQNARTTMGKRSQVSNLNPIT
                     VINRVRELQEDLVQLFPSYHKDYNGRFVNVLSQQRVERALTLFGIHLRQILGSKRVLK
                     EYKLNDKAFEYLLKEIRTKYQQSLITPGEIIGAIAAQSCGEPATQMTLNTFHNAGISS
                     KNVTLGVPRLLELLNVSRNQRNASVAVCLIREYQKRNKAQEAQQFIEYCTLANITTTV
                     QIIYDPDPRNTVVAEDEEMIRWEQAVMNAEDEEPDAEQPPSPFIARLILDNDLFNDKR
                     LNMKDVKSAIRQVDDTYMVQANMENDGQRIVRLRPRKCTGADSVPALTKAVAQLLQSV
                     HLRGIPGIKKTLLKEGNTFRVDPEAGGIKNESSWMVDTEGTALQRIFVGVVNSEGKNI
                     IDFSKTSSNKIPEVVTVLGIEAARRKLLSELREAYLAYGLNINYRHYTILVDTMCQRG
                     YLMAVSRTGINRSETSGPLMRCSFEETVKVLMTAAAFGEKDPVRGVSASLVLGNQARI
                     GTGLFDLLLDMSKLQHVVPLDKATEARTSNVYHTDASVAPGSSTLQGSHGELPPSTVH
                     ENSSLAAGASSVYPRHERAGMYGGIPIEASEVQFSSALPTVMRTALAASNTTEYHSSH
                     HLSGASTYLASSALPSASALDTELSSYHLQSVARSTAYGYAPMAASGMPMPGATQLSV
                     GEGGSLPYPYEASNGERFGSLGGAASSRASAPYDPTQQPSQEFSQTEEQEEP"
     gene            complement(<1272676..>1273854)
                     /locus_tag="LMJF_31_2620"
                     /db_xref="GeneID:5654194"
     mRNA            complement(<1272676..>1273854)
                     /locus_tag="LMJF_31_2620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685197.1"
                     /db_xref="GeneID:5654194"
     CDS             complement(1272676..1273854)
                     /locus_tag="LMJF_31_2620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685249.1"
                     /db_xref="GeneID:5654194"
                     /db_xref="GOA:Q4Q5Z9"
                     /db_xref="InterPro:IPR003691"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5Z9"
                     /translation="MNRCSLWQQRARLDTVEPVKQAFPADVPPAAHSPAGAPDGHGTV
                     FSHHDGEEHNDSANRDEQASYPSQSPLPPSPSAATPYTGNWPPYALLLVSCLIVAAAG
                     LGGSAARVALQKCFEKNPFFPKYTYIGPNSLGSFLMGFSVTVLPPEGALPLTHRALCV
                     GFCGSFTTFSSWIVKAMVQNTVADALEHLFIGGTMPLVFFLWGRDCGRGVRWCCEHVV
                     DSPWETWPLHRSLLRAVDAVMFVLVFLASILAPVLVLVYIGEGGIRVISTDDVRMVVL
                     APAGAVTRFMLSVYLNKKACAAQFPLGTLAANLLGVLLAIIMYNMEVNHLSCEWCIAV
                     QNGICGALSTVSSVANELVSFYGSGRMLSAYVYALVSVGFSVFIAGVGRPQLYRHAVS
                     "
     gene            complement(<1275807..>1276904)
                     /locus_tag="LMJF_31_2630"
                     /db_xref="GeneID:5654195"
     mRNA            complement(<1275807..>1276904)
                     /locus_tag="LMJF_31_2630"
                     /product="putative serine/threonine protein phosphatase
                     pp1(5.9)"
                     /transcript_id="XM_001685198.1"
                     /db_xref="GeneID:5654195"
     CDS             complement(1275807..1276904)
                     /locus_tag="LMJF_31_2630"
                     /EC_number="3.1.3.16"
                     /codon_start=1
                     /product="putative serine/threonine protein phosphatase
                     pp1(5.9)"
                     /protein_id="XP_001685250.1"
                     /db_xref="GeneID:5654195"
                     /db_xref="GOA:Q4Q5Z8"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5Z8"
                     /translation="MIGLSKAEVIIGKLLLNPAHNTAALKRDANSPLSSFSRQSRLQA
                     FQAETAAAVAAAAPKADSANRTGRTRGLSSSSISDPREFATGEMTEEEVVYLVMESRK
                     LFMSQPMLIEIEAPVNVCGDVHGQYHDLLRLFELGGYPPDSNYIFLGDYVDRGEQSLE
                     TVCLLLAYKLNFPNNFFLLRGNHESSSINRIYGFFDECKRRYSVKLWKLFTDTFNCMP
                     VAGLINGRILCMHGGLSPELHSLDQIRRILRPSDVPDSGLICDLLWSDPADDPIIGFG
                     ENDRGVSWTFGENVVENITQALDLDLICRAHQVAEEGYKFFAKRKLLTVFSAPNYCGE
                     FNNYGAFLCVDENLMCSVKQLVPLFEVDDFE"
     gene            complement(<1277858..>1279726)
                     /locus_tag="LMJF_31_2640"
                     /db_xref="GeneID:5654196"
     mRNA            complement(<1277858..>1279726)
                     /locus_tag="LMJF_31_2640"
                     /product="2-oxoglutarate dehydrogenase, e3
                     component,lipoamidedehydrogenase-like protein"
                     /transcript_id="XM_001685199.1"
                     /db_xref="GeneID:5654196"
     CDS             complement(1277858..1279726)
                     /locus_tag="LMJF_31_2640"
                     /EC_number="1.2.4.2"
                     /codon_start=1
                     /product="2-oxoglutarate dehydrogenase, e3
                     component,lipoamidedehydrogenase-like protein"
                     /protein_id="XP_001685251.1"
                     /db_xref="GeneID:5654196"
                     /db_xref="GOA:Q4Q5Z7"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR004099"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR016156"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5Z7"
                     /translation="MLCGRESSGRGENAHGGLRSLARTPLELTALFPFLPLSPNTQLV
                     PPLLSDPLCLPSPSDSPRWGGSRASQFASDPYCYELPSSSCPPRCAVAPSLPFSPVSA
                     AVKMLFRSSVQCNVPFPVLRSAGAFPRVDLCVIGGGPGGIAAAMRAIGYGKSVCIVEG
                     GRVGGADLGGTVPSKMMYEIAHFAASLTGPEFVRDLVKPDEMQSIVDGIPSERITQLL
                     RKTCTGKEREYRAFLEASGVQLIEGKATFANPNEIDVHTEGTGEYRSLQADNVVIATG
                     AIPRSHAFAKCDHNRILNSTSLFEMPIPASMVVIGAGAMGCEVASMFAKLGRTKVRLV
                     DKAPRILPKEDEDVASYVQRHLIRRGVVIHQGCRLFDLEAGEEDCRYSLRDIFSGDIE
                     TYHAERAMVAVGRQPNLGALGLENTKMRVENGQLDCDEYGRCKPYKHIYCIGDATGRQ
                     KTVNTAQTAGQAVVDTMFGCSPKLAVSNNALTNIATDMFLEDEVASIGLSEKQCRASG
                     IGYIVARLEYKHLTRPIVMGAKDGFVKMIVTNDREKRVLGVRAVGPHAGSVVEVASLP
                     ILKNESVYTMLKHNPAYPSLVSGVIECAAMLVGRGARCSNVVEGISIKNWTPVDKA"
     gene            complement(<1281243..>1282916)
                     /locus_tag="LMJF_31_2650"
                     /db_xref="GeneID:5654197"
     mRNA            complement(<1281243..>1282916)
                     /locus_tag="LMJF_31_2650"
                     /product="acetoin dehydrogenase e3 component-like protein"
                     /transcript_id="XM_001685200.1"
                     /db_xref="GeneID:5654197"
     CDS             complement(1281243..1282916)
                     /locus_tag="LMJF_31_2650"
                     /EC_number="1.1.1.303"
                     /codon_start=1
                     /product="acetoin dehydrogenase e3 component-like protein"
                     /protein_id="XP_001685252.1"
                     /db_xref="GeneID:5654197"
                     /db_xref="GOA:Q4Q5Z6"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR004099"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR016156"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5Z6"
                     /translation="MLRRTLYALTRPRDSAAASRDKAHFDVCVIGGGPAGIAAALRAA
                     DYNKRVCVVEKARLGGNDLWDGALQSKTMWECSAIMAKMRGDAAMRLYGESLDRYLEI
                     DEVKMRQSMEQVSRIREEQIQAALKASPNVELVLGRATFSSNHEIQCHSKRTKEFRSI
                     TADYFIVATGSKPRKHPYVAADGRLVMTSDHIMRAPLPKSLVIVGAGVIGCEFASIIG
                     RLGKTKVSIIDKAPHILPREDPDIVRMIESGMDRAGIVVHHNSDLYDMQPWEETVEEA
                     KARHPADPAPQSGVQYTVMDRTTRKLTTFQVERALISIGRVPDYSRLGIENTTLKTRG
                     SQLHVNEFGQCVGTPHIFAVGDAATHMQLVSMGEAQAKLAVDYIYGTEPKVVPNLTET
                     MSSVAFLTRAVASVGYNESQCREKGIAYIAARYSYEVVSRAVAAANTKGFVKIICADD
                     PERRILGVRALGMNASTLVDIGALAIQNGQGVFDLAGRLTAYPAVSQAFQECLRSILD
                     LSAQLHADPARGVKLTKWTPPDMSRGVAYKGKATAPGESSPRQSGWVIH"
     gene            complement(<1287504..>1289237)
                     /locus_tag="LMJF_31_2655"
                     /db_xref="GeneID:5654198"
     mRNA            complement(<1287504..>1289237)
                     /locus_tag="LMJF_31_2655"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685201.1"
                     /db_xref="GeneID:5654198"
     CDS             complement(1287504..1289237)
                     /locus_tag="LMJF_31_2655"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685253.1"
                     /db_xref="GeneID:5654198"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5Z5"
                     /translation="MGVGLCHPKSTTALHAEQLEKLEAVPTEGPASASAPKMPLLVEP
                     HDTKSTCQPAPADPSPVNEREVNGRCSSLSRSTIIEGCGSPGWAPGTRTFAGRDDSAH
                     RGASPKTGALATDSIFDASFQHGSDVASRTFNCTSAAHSSNTSPLSLRGTRTGKPGSL
                     SVTDMHTITNGVADHTRSIDGPADALQPSSILRRSSGWTNSRSPLAQNRPPSIEHWSS
                     SQSSGPQTTLVPSRGSVCFLGSDGKAAKPQGTGSNEVSHQGDQDRLKETSDGAGTSTG
                     TPTSQGNRQRVPRSLIAENAGADGGSPKKKTDAKFCSPAPTAASVSRETPSPWPSVEG
                     PPSSPSHNNGFFNDLTYFCFSDNNDQSGVFYDNGGSGEMPPAAPLLTATSRASQSPKS
                     ILLRPSANTSGVGGLWAPQCPASLPWQDSVSSGLRRVSRRRKGEQDRLLSERRPSFDV
                     GLPHCPSSSGLHRSSRDEDSGRDNEQIIASVRRTMMRLQRSDGAGSVCSNSPSRHGGR
                     LSSADINARALRTAERISDAMLSVPKAVKMIVESKGSMSCSATSDSGSTETMRGARAP
                     APDPKNPTTSQ"
     gene            complement(1291593..1293244)
                     /locus_tag="LMJF_31_2660"
                     /pseudo
                     /db_xref="GeneID:12981446"
     misc_feature    complement(1291593..1293244)
                     /locus_tag="LMJF_31_2660"
                     /pseudo
                     /db_xref="GeneID:12981446"
     gene            complement(<1295285..>1297810)
                     /locus_tag="LMJF_31_2670"
                     /db_xref="GeneID:5654200"
     mRNA            complement(<1295285..>1297810)
                     /locus_tag="LMJF_31_2670"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685202.1"
                     /db_xref="GeneID:5654200"
     CDS             complement(1295285..1297810)
                     /locus_tag="LMJF_31_2670"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685254.1"
                     /db_xref="GeneID:5654200"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5Z4"
                     /translation="MWGAAGECVMRVSVHGSRLTPELRHLSRVLLHPFLFLHSRLVHL
                     PLCGFLTLSQRHRHPLPAPQMCLRLGLCSSLSLSLSVLRVSVTVTHAHRLASPSLAQP
                     RVRLRCLCVHPRPPRPSLPPASPKKEEVCALRPEEKEPRDSSELYAIGPLTDLRTSTG
                     FTRAPMPLIRCASLTAVLLLLLLCSADGQARVVAVVLAPSVEHGTATLSGQSRLRWKH
                     AIGKGSMFGLPSVRMQVAGEVFGDAAPSSRSESASPSTSSTTSTTTTTTTTTTTEAPQ
                     ATTTTTEAPTTTGTTTEAPTTTTTTTEAPTTTTTTTEAPTTTTTTTEAPTTTTTTTEA
                     PTTTTTTTEAPTTTTTTTEAPTTTTTTTEPPTATTSTTTTTTAVPSRSPSTTFSAVAL
                     AGVIIGSIAFGILLGASAVFLVFVRTCSLPCCRQSPQADQEEDDNLAETREMKSESYG
                     SSQWSSEYGNPERQVKSFANQLHKDGLLSVHDHRNANPLALPSAHSPKRAPPPVAGDP
                     AHVNNFNNRPYVQNGIVPWTGRPPVLRGPQPACMIPTITKEGKVIPRAQRVLPGLGLF
                     ETPIIPITLPAPPSLPPKTGTAAAFTRAKEFVQSKVLRRLRGAKSAEEEQAAAEAAMK
                     NQPVVQWFHHLVYFTALSRSPEISSLDESEAEEGGQHDDRGTRAADVTVPAAAAASAA
                     SGGTAGKLPLPETTGTPMLAPCAAPATPGVAPTPTQRANTEHPAPQGVYDAQYYPSAH
                     SQITGSSSAMMMCPPLYIVDHPVQPAYGMGGGGGGGAMLRSPAPGGQVVSCATAGGGS
                     STSFPCPSQQAPSLQMQPYQQQLSLLPKQAILSQASRCFNPYA"
     gene            complement(<1299132..>1299374)
                     /locus_tag="LMJF_31_2680"
                     /db_xref="GeneID:5654201"
     mRNA            complement(<1299132..>1299374)
                     /locus_tag="LMJF_31_2680"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685203.1"
                     /db_xref="GeneID:5654201"
     CDS             complement(1299132..1299374)
                     /locus_tag="LMJF_31_2680"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685255.1"
                     /db_xref="GeneID:5654201"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5Z3"
                     /translation="MDGYPLMVTEWILPPELRRPADSQRTAENQTYAVEAKSTEVARV
                     RRALRCMCVLRCRGRAIQASVVTAGAAATAAGRAAR"
     gene            complement(<1302768..>1306718)
                     /locus_tag="LMJF_31_2690"
                     /db_xref="GeneID:5654202"
     mRNA            complement(<1302768..>1306718)
                     /locus_tag="LMJF_31_2690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685204.1"
                     /db_xref="GeneID:5654202"
     CDS             complement(1302768..1306718)
                     /locus_tag="LMJF_31_2690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685256.1"
                     /db_xref="GeneID:5654202"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5Z2"
                     /translation="MSSRSSVSPSRASLARALVEARQRQQSRHASSAQLQRYLLRWFP
                     RGLWSFIYRASPRGGQGVAAKANVYRRFCRDPPRVSHEWTAALQLVELACLVGTMPGT
                     SLSKGHHKAGLPTSTPTPEPDSVVQATEHLLRYGVFPPAGWALTLQLLHKWRERQPRT
                     RLQVFPTSLSPPAAAQLLHHISLAPPSQQAWQDALCLYHLCAAEVHTPFSNGRPLSTK
                     TVASPSPPRSAADTAAHSAFLKALRHMTLTTFLQANEWERGLHFYYHTLYQRDLPGPI
                     TTSYLVQQLGRAGQWAAVLQVYELCVKLLHAQRHQREQQQRLPPHGDDWSSRQWGTTL
                     SMAMAAAQNSPGAPASTLAAMMRQLQPGIGTTSTLSTDVTGAASSSSPPLVRLSGHFL
                     SALQALPSEKDRLAVLGLARRGSLLDIFKLIRGLISKHKWEEALLLFEEAMRSTPART
                     PSPDPRGGGAPGPHTSAEPTIRKPLALSRREIGEARLSFLHEATIDSVTAVVAALNGH
                     RSATGKRSAGAQREGEGAHHSPSAAEVNSMRLMLNDREVECVLSKTLALREAEHRVLS
                     PAALGTREHFWRYCLELLAFNYGALPCGDASAKVSRLPEQANEGHSAPPRSPRRTPTL
                     AALSFLLRHPQLPWHVALRLLRHYGVLETCPDERAAASTCATGRRAASPSSVVQRTRS
                     SSPPTPHSLALAAAVELLRTQGQLQAAETLALESLDREVAEKSLGAGAVVSLSAALLE
                     VAQYPALRSVLLEREEERLTVEGSTLFHLLHESTRVRRTQAEDHGDDGVHGTSCETAN
                     SSAPPWWAGSAAFFHHPSGRALTVVWLLMQRRMRPHMTTTDAARQDGSASLLASLFLC
                     VPPPPTASVAAASLTAPLHSWLLAYPVGVHCEVVRVIKCLTSPSSPSMPSTSSSPEAD
                     LCYTKRWVWMRRYLASLAAHFSAPCTDTRARSEEESFAENEPGHAAADAVAREAYYGA
                     TFEAVVSLLDAAVPRTPDSRDRVRQRMQMDAFAAATVAEQDEAAPRSSAQRVQQLHQL
                     LERAIIRYGCLPPTHMLLPNQMDRLLPPLPRSSLPSADMSVRERRSRHGCVDRDGACA
                     ERCAVALHLVRLVLGALKDAGAHHSVEPVLLHNLLKLCCRVAEYEQAFLTVAKGTIGS
                     DIDSSAEVSRAGAMLVRLQCELCGLQTVRQGTLSLLYHLCAAAQSCASSYGHTVPRQV
                     ALETTRYLLEAQTAAAARKDPRRQRQEGALSSATSASTASSSRLQKGQQRLDPLSPCC
                     AVQARHCRLFFSLLGWEEALEVWYGAFPHEVLTQLSRNPQAVEACLSLGERSQL"
     gene            complement(<1307319..>1309994)
                     /locus_tag="LMJF_31_2700"
                     /db_xref="GeneID:5654203"
     mRNA            complement(<1307319..>1309994)
                     /locus_tag="LMJF_31_2700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685205.1"
                     /db_xref="GeneID:5654203"
     CDS             complement(1307319..1309994)
                     /locus_tag="LMJF_31_2700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685257.1"
                     /db_xref="GeneID:5654203"
                     /db_xref="GOA:Q4Q5Z1"
                     /db_xref="InterPro:IPR002562"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5Z1"
                     /translation="MVRRRLVIDPIWRVIDAQQYQSLWEALSAEAVSYGFVGFDMEWT
                     TTLQVPDADSDNNRPPTACGASRKSKVRRLLGPVATIQLSTHSCTIVVKWIHLHALTA
                     GGFADVLRDPFAPASACWPCYREGQRQNSVALLHKVYTDLLRLIHDRRIFKTGVGIHG
                     DEVKLHRDYPAVQLRSAVDLVELADACLPDMVPDHSRKHTNEEVTLVRTDSLRSLKNM
                     CSALTGRELGKDMAVVMSDWGGCHGALTPLQIEYAAQDAEASYDVCVAVLKSGGFMVD
                     NPICATHSDNTTTHLLWCTVKELDCREVLACCARSPMSAFTGTTAALKDTGNAAGGTL
                     CNALGAGVNASVSKERCTTAADEGGPLQWCKGRERPYYDNISVFDPNMQLVFTVDKTK
                     ADWYVNKKGLARVVQWRTPAGAIVREEEKATLSGAVDNLEVTAIQLSFAPNFSRYNDV
                     HIRRNMDYFKQPKENICVVCGSGGSLVRFAVVPLMYRRFFPSVYMSHNSYDLLLLCSH
                     CFAKSRRLHDRLRQNVADDFGIPLMHLRGKQRDEYADVILKTEQAIDALSAAYEEAKG
                     RVLPTPGREDVPERDCDLHPRLRLRGMQDFLSLMVHREILEKVFSFAKALHHHYESLQ
                     GHGGACNSGIDEENVVATPGGACHPSGTPTSRKRSDRRHRQRAGTSRAAAATILPEER
                     RTMMIEYLQTHASVYPFFARQRGEDSCQAGWQLQDAVFHAERDGAASAQGVRFILTGV
                     SALLDAAGYAYNESAGVQQGNSIRSVLTRYWVGEHSELLTLVPTLTRAEERLRRPASS
                     DEMKESNSSPAQRSSPPADMRADSEVSEVPYVDSHAFLVVRLLLEKYSDASSGAKTGD
                     HAVGQFIFRWRSSFVEGMHPQHLPRGWTPEDGILR"
     gene            complement(<1311059..>1314313)
                     /locus_tag="LMJF_31_2710"
                     /db_xref="GeneID:5654204"
     mRNA            complement(<1311059..>1314313)
                     /locus_tag="LMJF_31_2710"
                     /product="phosphatidylinositol-4-phosphate 5-kinase-like
                     protein"
                     /transcript_id="XM_001685206.1"
                     /db_xref="GeneID:5654204"
     CDS             complement(1311059..1314313)
                     /locus_tag="LMJF_31_2710"
                     /codon_start=1
                     /product="phosphatidylinositol-4-phosphate 5-kinase-like
                     protein"
                     /protein_id="XP_001685258.1"
                     /db_xref="GeneID:5654204"
                     /db_xref="GOA:Q4Q5Z0"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR003409"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5Z0"
                     /translation="MSAHSSAEAAVPAPASPQGSSSDISGTLTTAGNQPTVKRIKKLL
                     NVANIKLTFPSGATYEGSFRDGRIEGYGIYTYAKTGDVYEGEWKADLKHGQGCYTFAN
                     SDKYTGQWYMGSKQGKGQFVFANGNEYVGSWRANKMNGYGVFVLASNGDRYEGYWNEG
                     VRQGEGCLYYGNGDLYDGEWCSGQQQGLGVFLQSNDDLYCGQWEAGVMDGKGVLREKG
                     ILFLVEYVGGYLISKQRQSDTLDETEKEWAPAYRHYLAWIKDHPAPAASTLTTEDSKL
                     RGELQAALAENSILRKRLEDLLALHRPKARSDNSGGKSPSTFRLAALKEAGTEYWKES
                     LRKLESRVKLLECTLAERDVEVRKLSERLKKSDAKVHGLELENAERKEWLRGTKHNSA
                     KKTLPSNAQTLSAPPAPLEMDTIDAGEADKLREQNAGLVQLNEELQRKVAFLAAENAK
                     LALKEEAAEEQYDKLMEEVERLRVTVENERRVNMSSEPPKTGDTAAAAAVSESVAVGV
                     SSPLSSPISREKSLAHEELQQRLIQANQLNIELRLRMGKLERTAQPKPSVARLSLSTP
                     EASGLARENEMLHSVVTSLKAELAVMQSASNDAEQQIVLAHQRQVELEESMKMITYRK
                     AANPQLQEALERKSARIANLELENAELARLLVETCADLEERQAISVATKRQPSFESST
                     VGGALSELESAQKEVKRLQRRMKKFTGERNSLTEQVYELRMLLARTDRTLGALQGRVT
                     VVASIADDGISGTAAADAAVRVDAADSTKLVLCDCGEETTYQYDYCFDKDASVEQVFA
                     ELCGPLAFVWSGYQLALMTVGGFRSGKTSLVKEILPLFTKYLSKEAAENPQRLFFSFT
                     YRVAVVEISARGGFDCASGDNVTEVCCDSNGFVQPKNVRFIDCTSGSIPIVVDNLLAK
                     RRQHYNGRSHTWIQLQCVRTSVARQCQTVGRLTIFDWCGSALLASQKKDIESARFANA
                     SSQSLRDLATALAGKLSVIPYAKSVETSLLFDLLGGNSITAVVGRIRSSTEHIEESLR
                     TLHVLTSLFGVRNGPLAADNQTSDEIRWQCLVAALCSDHQAERELKAIENIRDL"
     gene            complement(<1314660..>1315100)
                     /locus_tag="LMJF_31_2715"
                     /db_xref="GeneID:5654205"
     mRNA            complement(<1314660..>1315100)
                     /locus_tag="LMJF_31_2715"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685207.1"
                     /db_xref="GeneID:5654205"
     CDS             complement(1314660..1315100)
                     /locus_tag="LMJF_31_2715"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685259.1"
                     /db_xref="GeneID:5654205"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5Y9"
                     /translation="MVSFLALEVNLVMVPVLTLFLLYCVPIRAISATAERITRLVEGY
                     NISGLTMMSAMAIISSFSFLFHILEWNSKYAAKQRFTDISLQLQHDNKRLRLERNMYI
                     QLVICVLCLAVKKCTALLSHQEPRREASAALSRGTAAAAHTKAA"
     gene            1315549..1315621
                     /locus_tag="LMJF_31_TRNAPHE_01"
                     /db_xref="GeneID:12981447"
     tRNA            1315549..1315621
                     /locus_tag="LMJF_31_TRNAPHE_01"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:12981447"
     gene            complement(1315674..1315754)
                     /locus_tag="LMJF_31_TRNASER_01"
                     /db_xref="GeneID:12981457"
     tRNA            complement(1315674..1315754)
                     /locus_tag="LMJF_31_TRNASER_01"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:12981457"
     gene            complement(<1316124..>1317731)
                     /locus_tag="LMJF_31_2720"
                     /db_xref="GeneID:5654208"
     mRNA            complement(<1316124..>1317731)
                     /locus_tag="LMJF_31_2720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685208.1"
                     /db_xref="GeneID:5654208"
     CDS             complement(1316124..1317731)
                     /locus_tag="LMJF_31_2720"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685260.1"
                     /db_xref="GeneID:5654208"
                     /db_xref="InterPro:IPR000408"
                     /db_xref="InterPro:IPR009091"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5Y8"
                     /translation="MLRRLHTRIIGMGSVCGHAPSPPAELFFKSLPSPCDVDPAKYRR
                     FQREEAEAHAARPPLTTAAASPLSAPEPFYEVVDAAAGHKHVVMLTREGNLITVGDNR
                     YGQTGALNSEGEDSGGDAAASPSLSRSGTRHGTGSSSVVRASSVVADLDPLYIDLDGA
                     FPQTGSSVIRVACGSNFTLVYQRNGRRVIAFGNNHMGQLGVGHKQRIDGVRGFMEWDP
                     TASWWPAGRPSVLETVYCGFNHAVATLSDGGLYAFGCNNWGELGIGNSDAPMSPTRIA
                     FFEERGMRVVKVALGNSFTLFLTKEGRVFGCGATNGGQLPPNAFDPVPIPLTRSFQQH
                     GCNEAPHTVGGAPKLIRVKDIACVGSLAAFLSAKNELLIQGSLPEYGVMIPSPRFAAV
                     DQGPALKYFAARMGAQTSGTDYDIVGLTGGPSTLLVRYRNGCVAALGANTEGQLHNVT
                     KVLNGQRVNLAPAFKATELFPMFVPATPLWDAAWFASGKGFNLLFDKNEAYHVPESVA
                     PIELPPGSGNARCVALNRQQRLRASLK"
     gene            complement(<1318261..>1319052)
                     /locus_tag="LMJF_31_2730"
                     /db_xref="GeneID:5654209"
     mRNA            complement(<1318261..>1319052)
                     /locus_tag="LMJF_31_2730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685209.1"
                     /db_xref="GeneID:5654209"
     CDS             complement(1318261..1319052)
                     /locus_tag="LMJF_31_2730"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685261.1"
                     /db_xref="GeneID:5654209"
                     /db_xref="GOA:Q4Q5Y7"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR015720"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5Y7"
                     /translation="MLLFCQAAVGGVLAPVGNVVLPLLLLLLHSSSIIVTAATYGSKI
                     EAGETECYTEVLEAGGTLGFTFRVTDGGAFDVNAVMKVRFTPPVDRTMDLSRFHYNAH
                     FAGLRDRQRETVLNTWQRATDGSYSYTAPPILKTRHGLPEEVSVCFDNSFSTLSPKWV
                     RFNIMKRDVLEVDPDAVNKVESAMEEELHRYGTILFGLAQDANALQLVGESDRVKLNS
                     LAKIMGAGLVLNALVLLTMAAYQYVSLSRFLACQVRRGKFSISTT"
     gene            complement(<1319715..>1321118)
                     /locus_tag="LMJF_31_2740"
                     /db_xref="GeneID:5654210"
     mRNA            complement(<1319715..>1321118)
                     /locus_tag="LMJF_31_2740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685210.1"
                     /db_xref="GeneID:5654210"
     CDS             complement(1319715..1321118)
                     /locus_tag="LMJF_31_2740"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685262.1"
                     /db_xref="GeneID:5654210"
                     /db_xref="InterPro:IPR012936"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5Y6"
                     /translation="MSPFFVDSSSNASDLLRNTATTAAPLRQPPQVHPGTVRVLHTRA
                     LWLLLSHSFLSTKHVHTMRQLKRLDVFPKFDRKFEQDARHRTVSGGVLSVVAIVIIIW
                     LLVGEVRYFLSVEEHQEMFVDTKVGGDMQVTVNITFNHVPCDLITLDAVDIFGVFAND
                     VEGNTVKQRIDAATGQVISAARAMVDEKKVMTKAIDADGAEKENCPSCYGAERNPGDC
                     CHTCEDVRQAYARRGWKLDIDEISVEQCAEDRINMAAAASGKEGCNLYATFAASRATG
                     SLQFIPGRIYETLGRRMHDLMGSTTRKLDLSHTVHTLEFGDPFPGQQNPLDGTAQGSA
                     LSGDAKDAMNGRFSYFVKLVPTTYQRYSLITGLQDVVESNQYSATHHFTPSEAAKAAS
                     QAPKKQEIVPGVFMTYDLSPVRILVQERHPYPSLAHFVLQLCAVCGGVLTVAGLVDSL
                     CFHSARKIRKMCTGKLL"
     gene            complement(<1321718..>1323037)
                     /locus_tag="LMJF_31_2750"
                     /db_xref="GeneID:5654211"
     mRNA            complement(<1321718..>1323037)
                     /locus_tag="LMJF_31_2750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685211.1"
                     /db_xref="GeneID:5654211"
     CDS             complement(1321718..1323037)
                     /locus_tag="LMJF_31_2750"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685263.1"
                     /db_xref="GeneID:5654211"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5Y5"
                     /translation="MSAHPYSALRSTTPPLYYRRPEGTAPSYYTVPAREVEELRIPSS
                     SSHPAAAMTAGAPTTVAGEYPRPSASLHPSVDCSSLNRVPTATAAAPPPPSPRLSGYV
                     MPSVVNPYSQGASQQPAMAHVSEPVNPASYLQQANAMGRWSYQQPPLQQPQYPTLDPV
                     ATRVAAIDAEEAAMAAEEMTMRAKLAELQVARKQQEEEQLYLSHGWAQMLEKEERYYT
                     EPVIDLRPDIMAREQQCAMLHNHLQQVEAQAQHAQSQLQGTEYILRDAESFEQERRRV
                     QDAFQEVERRRRECVARAERYFDVEAKRVVEGNKVIRKLDSQLREMTQRGPLAQLQDG
                     NRHPSTGRRSASRAVTFAPDKSIVLDSGREESASSAEPVTIDNESGSMTNSYTSAHST
                     APRYEGHSTYAFCGLPDEDIGGTSVAFSLNDTRDSLMKRRKVEIASV"
     gene            complement(<1324478..>1328365)
                     /locus_tag="LMJF_31_2760"
                     /db_xref="GeneID:5654212"
     mRNA            complement(<1324478..>1328365)
                     /locus_tag="LMJF_31_2760"
                     /product="kinetoplast-associated protein-like protein"
                     /transcript_id="XM_001685212.1"
                     /db_xref="GeneID:5654212"
     CDS             complement(1324478..1328365)
                     /locus_tag="LMJF_31_2760"
                     /codon_start=1
                     /product="kinetoplast-associated protein-like protein"
                     /protein_id="XP_001685264.1"
                     /db_xref="GeneID:5654212"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5Y4"
                     /translation="MAPRRSCAKRLNLPGAARRLAAQPSAAPHVTVASPVAPSPAATA
                     PAAKPPRSVEPPVAACVQPATTSLEPAATVARVPVVEETPAAPAPNFTSAETVRTREH
                     AAEVQCPPDVTPASVTATASAVPAGEAMPPATPVLAAPSVHSPRTAISAHRGRLRAKR
                     RAAAALARKAKHHRNTISAPQQAISPSTSSQPPAPAAAPETVPVATVEAPAAEAAVEP
                     TPDAAAPKIAQAGSAASKLKGPAAATVVSSPPASPPISAPHRSAISRIPKKRKFFAEL
                     DDNVALPAAEATPPPASSERHLQASDTAVDAPSVTAVPSAVPPATPTAAGEEVTKKTS
                     AVADALHAPAAARRMVTRRTSKLHANGAAAKLQRSRSNLVSAQATLEAAPAVIAPVTG
                     RAPAFSAATLTMPEKPAAPTAPTVAAPSVEPPQRSASSTPQSTAPHVTSAAAVAPSGR
                     ATISRISKKRKHFFEEVDEPPASDAAPSVQGTSTVPAVAHAAATLNSTGAAATITAAE
                     PAAPTVEAVVAPPAAAVAVADVRATKATATRATARRRNMKRGRLPPQAAVAEAPSAAE
                     ALASEATAPTPVTPAVEATSAPVPEAVQAAEVEAPAELVGEAVTTADAAPPVEAATPP
                     AAQRKPRTAKKKVKRLTAAAIRRRELAAYNRIPKRFRPPEVPRSVLSTPAAEPQSTPA
                     PTDTPAATAIVEAAEVNGTPQPAAVSATQAKSMEATAEMRAEGQTPAAVEAIVETPAV
                     ELAQPPPGASTASAAAAVKPEVPLTETTKSAAPFAAPAEEQCLMGQARVATKSMKVRI
                     AQSIKKRFFTALEDVPAANPTEAAATETTAAAVEAIESSPQVAGDSTTVDAELTAAAE
                     EAVAPKSTRNAESKAAPATSAVEEASTEAPQPMADHQPTETTSAEKPPFKAVNALCTA
                     GGALASESVAGHTDAPALAQRKVVRVTNVREMLKAIRKAKRAGKRGCSKKRLSHGPLS
                     QHLATEVTGAVDKVVNAEASSTAAEANLPAEVSDSRIHAPLPEEAEAVTSVEKTETPS
                     ATEQQTVVQAQTAEAEAETYVASTTTMATPEVTEARSTETVDKEALQPPEALQHAEIL
                     LAPAQAAVAAPVKDFLPRAFSSPSPARRQAAKQKIKKHAKLAAARLNKRQTYTVSAAA
                     PLAAVHAPAETIDAPLVEAVHAAAEPPVPPAEEASAATLVRRSALVLPSGNVVVESFT
                     DSEMVLRRTALDDSWDVGLRFDWQERTLAISSFPTFEETDKRSAHPFVHRFKSKPRWL
                     LKEVNETNAAHMKKALDSMSRSLTARFVFRHLR"
     gene            complement(<1332225..>1333163)
                     /locus_tag="LMJF_31_2770"
                     /db_xref="GeneID:5654213"
     mRNA            complement(<1332225..>1333163)
                     /locus_tag="LMJF_31_2770"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685213.1"
                     /db_xref="GeneID:5654213"
     CDS             complement(1332225..1333163)
                     /locus_tag="LMJF_31_2770"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685265.1"
                     /db_xref="GeneID:5654213"
                     /db_xref="GOA:Q4Q5Y3"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5Y3"
                     /translation="MSHNVRPSRYAVSQSKARIFVGQLEPYVTEQDLYPVFSCYGKIL
                     HLNIVRHSTTVTPNEERRIPTAFVWYETTTEADAAIAALHNVFTFSSPDEEENKVRYI
                     QVSYADKSPECTPWGRWQKTQAEIMRRTNPSGTGTGSNMPGQYSHITGGGPSTYSSSA
                     LNNDGGFTVSATGPAIRSSQSSGDISSMRYPRNPARGLRSMAPHIDHPEVQYYSSYDN
                     LYNLGNRNQLYSMGGAANSMMGYTKHRGMPPHESTSSGDLGRGSTSSFWNMSEEVKKN
                     TAANPNRFRHTARYTAPEPDEDLIMAAPTFTVTSGP"
     gene            complement(<1338641..>1339354)
                     /locus_tag="LMJF_31_2780"
                     /db_xref="GeneID:5654214"
     mRNA            complement(<1338641..>1339354)
                     /locus_tag="LMJF_31_2780"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685214.1"
                     /db_xref="GeneID:5654214"
     CDS             complement(1338641..1339354)
                     /locus_tag="LMJF_31_2780"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685266.1"
                     /db_xref="GeneID:5654214"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5Y2"
                     /translation="MFSQTGGAATVEEISWQYSTEQAMAAKEMAAENQVQVVLPEKVG
                     ECRRSHQSSQACNGSHETPITSYGEAAPKQTVSRVLVRMPNEVRRRRSLSREAHQRHT
                     HTEPEESKMPNATPTTVPAAAAMSTAEDGHVSPEKQCPEPELPASGLAMQPAGEEAVD
                     QEPSTEPSPAAQEGARCGRLNDAASQVEMELTGSGSTAVIAETNREMEDNAAPYENSD
                     EHPMIKSKENGKHGCCMVM"
     gene            complement(1340177..1342312)
                     /locus_tag="LMJF_31_2785"
                     /pseudo
                     /db_xref="GeneID:12981451"
     misc_feature    complement(1340177..1342312)
                     /locus_tag="LMJF_31_2785"
                     /pseudo
                     /db_xref="GeneID:12981451"
     gene            complement(<1343996..>1344532)
                     /locus_tag="LMJF_31_2790"
                     /db_xref="GeneID:5654216"
     mRNA            complement(<1343996..>1344532)
                     /locus_tag="LMJF_31_2790"
                     /product="putative ADP-ribosylation factor"
                     /transcript_id="XM_001685216.1"
                     /db_xref="GeneID:5654216"
     CDS             complement(1343996..1344532)
                     /locus_tag="LMJF_31_2790"
                     /codon_start=1
                     /product="putative ADP-ribosylation factor"
                     /protein_id="XP_001685268.1"
                     /db_xref="GeneID:5654216"
                     /db_xref="GOA:Q4Q5Y0"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5Y0"
                     /translation="MGGWLSSLLGKKEVRILMVGLDAAGKTTILYKLKLGEVVTTIPT
                     IGFNVETLEYKNLKFTMWDVGGQDKLRPLWRHYYQNTNGIIFVVDSNDRDRMRDARAE
                     LEKMLVEDDLRAATLLVFANKQDLPNAMSTTEVTEKLGLHALRQRNWYIQGCCGTTAQ
                     GLYEGLDWLSANIKKSMN"
     gene            complement(<1349019..>1349828)
                     /locus_tag="LMJF_31_2800"
                     /db_xref="GeneID:5654217"
     mRNA            complement(<1349019..>1349828)
                     /locus_tag="LMJF_31_2800"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685217.1"
                     /db_xref="GeneID:5654217"
     CDS             complement(1349019..1349828)
                     /locus_tag="LMJF_31_2800"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685269.1"
                     /db_xref="GeneID:5654217"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5X9"
                     /translation="MCRNNDSEDGDCLGCCGFLASWFPGLRYPAQRCTSPDRSTSSSC
                     SSGSMGTMGASNDVTDVDDENLLSEELQSSSTGSWSSMGDLQTTESAESDAPSEESDP
                     DERVRRATASFLQWKNKEYVPLSLDEKRAIKEYRKMVAQEEGSYTSTRAQRQRDRAPK
                     LFISREDDWVDLGSPAEGDGLARRRSRKIRFVAAVIASKEVDVHNDGLVVLTDAGEEV
                     PELPRSASILRMSCVKNLTEEAPVFVDDLNSCMMEDEGRSCESAVRWEFPR"
     gene            complement(<1351383..>1352222)
                     /locus_tag="LMJF_31_2810"
                     /db_xref="GeneID:5654218"
     mRNA            complement(<1351383..>1352222)
                     /locus_tag="LMJF_31_2810"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685218.1"
                     /db_xref="GeneID:5654218"
     CDS             complement(1351383..1352222)
                     /locus_tag="LMJF_31_2810"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685270.1"
                     /db_xref="GeneID:5654218"
                     /db_xref="GOA:Q4Q5X8"
                     /db_xref="InterPro:IPR002625"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="InterPro:IPR013899"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5X8"
                     /translation="MPERCIGITTVQVGHIVGRGGSTLKGIQERTGATLCIVENGLQV
                     KITADDAAKVAAAEAEVHKIVASQQNPDYEGPCGARLRKEAVELGQKRSKLFEEATRM
                     REAGDHEGANKLVAMAKKAGEDMKARHREAALAIAKHNNEEKGKGPNYFDMHGLHLEE
                     AMEMLKVRMSKLEEKPVGSTTAFEVIPGAGHHSAPGTQKLKRATLEYVQWKGYPCEEV
                     NAGAFLVKVPGLGEGVLSKPEDGDKVPTKPKESATGVANKPKASGSAAASKSKAQSCC
                     ACM"
     gene            complement(<1353147..>1353959)
                     /locus_tag="LMJF_31_2820"
                     /db_xref="GeneID:5654219"
     mRNA            complement(<1353147..>1353959)
                     /locus_tag="LMJF_31_2820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685219.1"
                     /db_xref="GeneID:5654219"
     CDS             complement(1353147..1353959)
                     /locus_tag="LMJF_31_2820"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685271.1"
                     /db_xref="GeneID:5654219"
                     /db_xref="GOA:Q4Q5X7"
                     /db_xref="InterPro:IPR015257"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5X7"
                     /translation="MKFIPLDSFSALNSLLQGVEAQGCCITMRLEAYTCRHTKEERQI
                     ANSIACYQNNVQLTPPISPLPTIGAYAGCTQEALPPLVLGGSAENVAASYSLVSPNEI
                     DDRLVYFVAALNTVYESDGYDFSVLRENDFVRYTEPQFRTEVSSTLQSLPEQCRPAVQ
                     RFWPTIEEVVENAESGCEYYEFRCPSCNPLADTTVYARHYFVYNRRKKVLVLLVEYGE
                     SNPYRGDDGLPHAGDPTSAWDAESPTYASTPDLGEEGEAYDGGKNRQFYGYY"
     gene            complement(<1355940..>1357817)
                     /locus_tag="LMJF_31_2830"
                     /db_xref="GeneID:5654220"
     mRNA            complement(<1355940..>1357817)
                     /locus_tag="LMJF_31_2830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685220.1"
                     /db_xref="GeneID:5654220"
     CDS             complement(1355940..1357817)
                     /locus_tag="LMJF_31_2830"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685272.1"
                     /db_xref="GeneID:5654220"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5X6"
                     /translation="MMLRPTLVKWLERKGVRPIVERVARSTLRGPSVSHSASHVAAGS
                     ASSSLYHTGDIDDIDGAESLDMMDGIPNESFGFPPSAALRRNAHPPEPRARAANSYSW
                     SSGADSAGAGSGTVDHRDRPRRDERSATPTRRVITVARRNHSSPAEAAPASRHAHVPV
                     THAPLSSSPREAQVMDHAKSAPHRDKPVHTATPVNSSDVDDDASGTIAETGESAGSAA
                     TKAKSSDAYRFLLHHIDAEIAALQRRHASVTTRRQSVQTRQTQRIKELFEVMENPWTL
                     LPTEMQPALPATGVDVYIKEQQIARQQQNHVHPIPEGQDKMYVLALHKNYKSMPAGRK
                     RFYEEAAHYNAAVREELKYLLTRGCSRFEAFLDTIKECTMEMAREGQVPELPTTHAQN
                     RFHAARAGVSNYRHANTPRTLPAGGDAGTTRSRKSHQHAQPQQVIAAQETSARAEAEA
                     EEGDTTADWEDEGDTAEDTAKEAARGARHGSVGRKRGRRASQRIQSAAKKTHAEVAAA
                     AAGVHSSAREPKRRQRSQTSATRQPDARPMRRGGGSSKADADAHAKSDRQKTVRRAGR
                     STGVSRSIPLPNLDHLAVKKIKRMLTSPSGSGGAAKKAAKAKRASPSRKPAAGGAKKK
                     R"
     gene            complement(<1358872..>1360011)
                     /locus_tag="LMJF_31_2840"
                     /db_xref="GeneID:5654221"
     mRNA            complement(<1358872..>1360011)
                     /locus_tag="LMJF_31_2840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685221.1"
                     /db_xref="GeneID:5654221"
     CDS             complement(1358872..1360011)
                     /locus_tag="LMJF_31_2840"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685273.1"
                     /db_xref="GeneID:5654221"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5X5"
                     /translation="MLPIFFSVGCARRRSPSQATRFAIFPLRCPAFPPSPMPRRPHAN
                     RHHAPCARPPQMLPGPLSVSSRHFLHQREAGRCTCANASPPPSFSRTPLSAGRHTRPS
                     HLAAVMSESLPGVLCFLGLIVFFVADFFYAKKLNEQKNAHPELDDCAPATSPDLDTIA
                     VLDSLTATAVDLYRHERQRFTGVAAPASPNEYAAVGENGVSEEPAANLDFGGQTGKTV
                     MHTIVVVCSIAAPMLTVLVALMPSLFGWTRFGVHSSIAYLAAVPGMAATGFYAMRSYE
                     LTQVFDVTKTEWIAMMWLRLDAIFVMSAVAFFGVGAWVVTGCMVTTAMYLAHRLMRME
                     KQLNRVQRHTQLVRDEVDVTRVLVPGTEESKRASGINDGYSAFSS"
     gene            complement(<1360363..>1361001)
                     /locus_tag="LMJF_31_2850"
                     /db_xref="GeneID:5654222"
     mRNA            complement(<1360363..>1361001)
                     /locus_tag="LMJF_31_2850"
                     /product="ribosomal protein l7/l12-like protein"
                     /transcript_id="XM_001685222.1"
                     /db_xref="GeneID:5654222"
     CDS             complement(1360363..1361001)
                     /locus_tag="LMJF_31_2850"
                     /codon_start=1
                     /product="ribosomal protein l7/l12-like protein"
                     /protein_id="XP_001685274.1"
                     /db_xref="GeneID:5654222"
                     /db_xref="GOA:Q4Q5X4"
                     /db_xref="InterPro:IPR000206"
                     /db_xref="InterPro:IPR013823"
                     /db_xref="InterPro:IPR014719"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5X4"
                     /translation="MRQSVLACDVVRRRVATAALFTSHRAIINGVASNRIPRGMTPLG
                     VPCSEDVLEALAEAYVNMDMATMTAFHKKAMTEMLRAGGGDGGAEPAAVDYEEHLLRA
                     SGGFSGAAVATSTPAAPVAPGGDAAAAESAAPLVKKAPEKTAFDITLKMFPAETKIKL
                     IKELRSVCGLSIQEAKTAIDKCPGVIARQVPKSDAEKLKDAMVKLGAEVELM"
     gene            complement(<1361754..>1363784)
                     /locus_tag="LMJF_31_2860"
                     /db_xref="GeneID:5654223"
     mRNA            complement(<1361754..>1363784)
                     /locus_tag="LMJF_31_2860"
                     /product="putative protein kinase"
                     /transcript_id="XM_001685223.1"
                     /db_xref="GeneID:5654223"
     CDS             complement(1361754..1363784)
                     /locus_tag="LMJF_31_2860"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001685275.1"
                     /db_xref="GeneID:5654223"
                     /db_xref="GOA:Q4Q5X3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5X3"
                     /translation="MEAAPAAAAPRLPQAPKRPREESDAPLQESSNGSVPANFSNEAS
                     VTTPVAGTELVVDVDQPETNAQASAVDAPRSRSRGLAAVGPGSTSPVAASRSGTDGAN
                     NCQPAAAVTTLSSSSASADARRFKQPTLAAYGLVSDTMTLKKEISDRDSHIEELNREV
                     EGLRAEAGRRNDQINFMDGQCRQYQRKLEHFQSVMRQEMLSAAQKDRSEARRVLYQKH
                     FELGQTATWHSNGQTVWMEGDRVRTLFLKLADLTQKREEVEALKKAAQSNVKHLARQE
                     REREDSGAGPDLQDALMAAQMEYQLRASEHAALTNTIADVKLKQTEIEHEKKAFVKEM
                     RRVNDEDTSEFLAIPTIGEGDRYVLMHLLGKGGFSEVWKAFDLVEGRYVACKIHHIQR
                     EWPAQTRTHYLRHAQRELDIMRALDHPHLTHLYDVFPRGDNMFISVMEYSNGMDLDTY
                     LKRYRIFKEADARLIFLQVVDVLRYLASLDSPIIHYDLKPANILLHRDDPTILDIKIT
                     DFGLSKIIGATREGPSDNPSIELTSQGTGTYWYLPPECFETSSTPRISNKVDIWSAGV
                     IFYQMLFGKRPFAEGESQRRIWQEKLIIQSARTLHFPDTPKVSEEAKDIIRGCLAFNE
                     RERCDVFQLSQDPYLFRTSRRSAHKAKSAAPAGVGSSNSPLMPPVTDATPAS"
     gene            complement(<1364547..>1365242)
                     /locus_tag="LMJF_31_2870"
                     /db_xref="GeneID:5654224"
     mRNA            complement(<1364547..>1365242)
                     /locus_tag="LMJF_31_2870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685224.1"
                     /db_xref="GeneID:5654224"
     CDS             complement(1364547..1365242)
                     /locus_tag="LMJF_31_2870"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685276.1"
                     /db_xref="GeneID:5654224"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5X2"
                     /translation="MLRFSSPPSLPLCLRCWSSALDHRAACIETHRRGTQKAWMFVTH
                     GNGTSRPFHRICSVLPSLSLSSSPSLYPQPPPPVADVGMGRKKRASDVETTPELSFVQ
                     GGVLNTIIVKGAEEMQQIAVDTTAFLEDKRVVRSTNMDQVTFSQNAIFKVTLDFAEAM
                     PCIPETAVRESTDWMLLSCTGNHAHYSTVDQRLILQQCKASLQSNIPELEFPVYLVLR
                     FDDDEWVVERIIR"
     gene            complement(<1365756..>1366616)
                     /locus_tag="LMJF_31_2880"
                     /db_xref="GeneID:5654225"
     mRNA            complement(<1365756..>1366616)
                     /locus_tag="LMJF_31_2880"
                     /product="putative aldehyde reductase"
                     /transcript_id="XM_001685225.1"
                     /db_xref="GeneID:5654225"
     CDS             complement(1365756..1366616)
                     /locus_tag="LMJF_31_2880"
                     /codon_start=1
                     /product="putative aldehyde reductase"
                     /protein_id="XP_001685277.1"
                     /db_xref="GeneID:5654225"
                     /db_xref="GOA:Q4Q5X1"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5X1"
                     /translation="MAARRVVRLPDGTAAPALGQGVWMMGETPENRTRELAALRAGME
                     AGMTLIDTAEMYGNGRSERLVAEAIKETPRERLFIVSKVLPTNASRAAIFRSCDASLQ
                     NIGTDYLDLYLLHWRGRVPLSETVTCMEELVKSGKIRRWGVSNFDVDDMKELWRVPGG
                     DKCAVNQVLYHLGSRGIEYDLLPWLREHKVPVMAYCPIAQAGELKSELYKSTVVRSVA
                     ARHNATVTQVLLAFVLRSGHVIAIPRSSNPAHTEENAAADSIELTEADMAQLDAAFPA
                     PKRKTHLDIV"
     gene            complement(<1367309..>1371031)
                     /locus_tag="LMJF_31_2890"
                     /db_xref="GeneID:5654226"
     mRNA            complement(<1367309..>1371031)
                     /locus_tag="LMJF_31_2890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685226.1"
                     /db_xref="GeneID:5654226"
     CDS             complement(1367309..1371031)
                     /locus_tag="LMJF_31_2890"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685278.1"
                     /db_xref="GeneID:5654226"
                     /db_xref="GOA:Q4Q5X0"
                     /db_xref="InterPro:IPR000547"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5X0"
                     /translation="MTDGVWRSFRFFDSEALAAASSLAELNVVCMCLTPTSLVVGDCE
                     GQVLFLERHPASTAASPGGRWCFQAYAGPVTHIRYCALRNTLITIGNDDAVHNTILRV
                     WDLDQLVALYRGLLGLNPADVSTSIPGASAADAPLRWRPPCQEHRILPASKGASGGAS
                     SAHAAGEEAPLVTILLDESKQVQCHFKPSCTAAGTRSPSPTGNSTGKGFSSRAGEAGS
                     TGVVSCGSIRSAVVSFDVAPDLSCAAVGLFTRDCVVLQGDLAKERSVRVLTIRSGLAK
                     GALTFVGLPSTQFVTLWETKGSGHASDTSGGGTSAFSFLTESARALTRSTSASKVKCS
                     SSAVAAAGVQVLYTVYEDVVTCWALRTNGNWSEYPCPTPGGGAPRFGAALTSRGELLV
                     LCKQGASPVTTGSRVVRLGPANPAPSAPVPYDPTVKSCVHLIHVDHVPGRCFLYTHRQ
                     YLVLLVQHDRRPAQFQLQCYDLAYRIRGLSRPQEAYTNCAMLLADGTDMLVLFLDPVV
                     RTRQLALRGVRLREADTQTKLELLFSKECYGIAQQLVQTMEGADPTLQLRIRKRYGDY
                     LYGKRKFDEAMTQYVGTIGQLESSYVIQRYMGSAHMEQLIRYLEELHNEKQSAHTNVA
                     HTTLLLKCYIKRKDDARLTAFIHRDDVRFDAKNAIEVCREGGYAAAALYIADRYAAVY
                     DCARIRLYDMQEPLETLSYVRTLGIDEAEPICLQLGKDLLLAAPRATTELLIELCVHW
                     RGPGRRLVDVPALPALAPDATLLPTCTGDAIGGGPRHPHHANASAFLHILVDAPVCLM
                     NFLRAVVESGVLHEDAAAPAPMQMSVEGNAAAPSSPAPPSPTVTPSPHAVLYNTLLEL
                     YMTRELKSTLRLVPQTSAATAGGVSSADATAEFPLEPYERRLEQARTFLEAHKGRYDH
                     YLALSLAHQNGFEDGILYLLRLLGLSEEILGYYGAKLNDPNSTPAERHEATSKLFQAC
                     QDSPASDSSTTTMWMTLLSQLMRTAKTESLDIVKVLDYINAHDALSPVVVLQILSSDP
                     ESTLDLRTVRNYCQRCLLKQTQQLQEVLAQTSQRLGEMERIKKEVVALQTSAVVFQAT
                     TCAHCHQALDTPTVYFMCRHAFHHRCLYTAAECNVCAAAHRQQLDTIREVEQRNLQLQ
                     NPSSSAAQFFQDVKCDRDAAEEVAGASAGPNGSIPQDGFRVVADYVACGALGAPPPYK
                     DAGPFGCQPPPVPLHPGGSHQRGAADGAGADDLDIW"
     gene            complement(<1371501..>1372925)
                     /locus_tag="LMJF_31_2900"
                     /db_xref="GeneID:5654227"
     mRNA            complement(<1371501..>1372925)
                     /locus_tag="LMJF_31_2900"
                     /product="putative nucleoporin (NUP54/57)"
                     /transcript_id="XM_001685227.1"
                     /db_xref="GeneID:5654227"
     CDS             complement(1371501..1372925)
                     /locus_tag="LMJF_31_2900"
                     /codon_start=1
                     /product="putative nucleoporin (NUP54/57)"
                     /protein_id="XP_001685279.1"
                     /db_xref="GeneID:5654227"
                     /db_xref="GOA:Q4Q5W9"
                     /db_xref="InterPro:IPR024864"
                     /db_xref="InterPro:IPR025712"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5W9"
                     /translation="MFGANAPSTGIGAPAAGFGKPPATFGTSALSGANTTATAGRGFG
                     AATGASATPGFGIAFAAPSTSTAAAGGASGFGSSAASGTTGFGGAAGFGSSAASGTTG
                     FGGAAGFGSSAASGTTGFGAGGGFGAKPGSGFGVSATSGFGAPATGTTGFGAGATAPA
                     AIGGWGAQQPNPAMQPQAPQQPQPTVTLQDFARQSALASYLVKLDESYNALHPNCRFR
                     AFVYNSCGAGQVMDAIQKERYTAHLNGGGCSEEAYMQALHQNPDPGRLYPSPIHFSQE
                     LLRRTEKQREAVKVLQKKVTELLQDIDTVAAMDAANVRRQREVEQEEVMLQHRWYSLL
                     CKMELLRRHGSSCGEEGLLNSRVEQLRKLLRAPGRFSQLLSELRPFLTEEASRVAMIT
                     QQSANKTEARQQQQQCRFVGSAPAAWRNAGSQPLLRTEVDPYIMKDWVQFAKQMQDGI
                     ETLNELLKTDLKEMQAIRSRVEAS"
     gene            complement(<1373534..>1373785)
                     /locus_tag="LMJF_31_2905"
                     /db_xref="GeneID:5654228"
     mRNA            complement(<1373534..>1373785)
                     /locus_tag="LMJF_31_2905"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685228.1"
                     /db_xref="GeneID:5654228"
     CDS             complement(1373534..1373785)
                     /locus_tag="LMJF_31_2905"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685280.1"
                     /db_xref="GeneID:5654228"
                     /db_xref="InterPro:IPR003117"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5W8"
                     /translation="MSGKAPAPLRLRSLKKEDLNYEGRVRAEKHKDELIMDYTAYLAA
                     HPEITPLLHDIMQHLLVQKPDRPLEAMSEFVRTRTSSSL"
     gene            complement(<1375162..>1375905)
                     /locus_tag="LMJF_31_2910"
                     /db_xref="GeneID:5654229"
     mRNA            complement(<1375162..>1375905)
                     /locus_tag="LMJF_31_2910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685229.1"
                     /db_xref="GeneID:5654229"
     CDS             complement(1375162..1375905)
                     /locus_tag="LMJF_31_2910"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685281.1"
                     /db_xref="GeneID:5654229"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5W7"
                     /translation="MPPASNTPAREKEHLHRMFSAAANALADLYRESSNSYEAGYRDA
                     LLFVQRYLQSSSPVTERGLPPSSAFSICETVNAQHMAQFLQHTIATRRERMAAVRGIH
                     SLRRRGRESEQGNSGIDDAGIARDDGDATENDEDDDGEEPCLTPRSSPAVARELTADL
                     TALAASGVVSAATPRFSPGALVTVNSTSPALSREMEHVIHREHPAPGRLPYQPRRQRL
                     RMERVHGHGSLGSVDGRPLSTQLRIGRRS"
     gene            complement(<1378464..>1379351)
                     /locus_tag="LMJF_31_2920"
                     /db_xref="GeneID:5654230"
     mRNA            complement(<1378464..>1379351)
                     /locus_tag="LMJF_31_2920"
                     /product="putative inositol polyphosphate 1-phosphatase"
                     /transcript_id="XM_001685230.1"
                     /db_xref="GeneID:5654230"
     CDS             complement(1378464..1379351)
                     /locus_tag="LMJF_31_2920"
                     /EC_number="3.1.3.57"
                     /codon_start=1
                     /product="putative inositol polyphosphate 1-phosphatase"
                     /protein_id="XP_001685282.1"
                     /db_xref="GeneID:5654230"
                     /db_xref="GOA:Q4Q5W6"
                     /db_xref="InterPro:IPR000760"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5W6"
                     /translation="MAKHYKAIFAMSYEAELYAHLQASQRFNAGADAAVVLHADSDEA
                     MRRHLGISIDPINGTNCCVGGVWQAPMTLVGIALDGVPIAGVMNRIFDYPLTCTYGPA
                     ATEPQEKACVPGLAVVLNTPTPASPFVVFDGGLVPAPGQMEQQLECTCETPLAVCRSS
                     TTKEVFLQRLLTQLEPCNAVYSRGAGYKQYHLLKKMLTGRHVAHEAITPADIFVCPPG
                     TIEKWDCCVVHAFLYALGGEIFDQNGVPIRYPLVGTYGAATTSLSEIAALTDGLVAVT
                     PYAMHEVARRLGWTLTLAP"
     gene            complement(<1380461..>1381345)
                     /locus_tag="LMJF_31_2930"
                     /db_xref="GeneID:5654231"
     mRNA            complement(<1380461..>1381345)
                     /locus_tag="LMJF_31_2930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685231.1"
                     /db_xref="GeneID:5654231"
     CDS             complement(1380461..1381345)
                     /locus_tag="LMJF_31_2930"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685283.1"
                     /db_xref="GeneID:5654231"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5W5"
                     /translation="MTLARCIDCTLTHTHTHTHTQAGNRLKSDSIIRVRCPSRSHVLQ
                     GMNALGNRCRSVIVLVNTALYTSPLLDEGCGYHCGCVVVSSDLALERDIVRHAEHFCE
                     ENNISYRVVTISEKATEIDEMMRTSATAEEWLTSPLTLIDCTAVVDEEVRVASLLAWL
                     YGTYPSAASREGSATEAPYTLVAVLDAARQVPCPPPITAGSSAGGDTLAWLRPTPSYY
                     SELMESVGSSADSCVVFPVHMYSRYPALRDCGLREGRTDGGATAPVPLAAWPNKCTLS
                     ALLRELAFKAGQLAKYGA"
     gene            complement(<1384854..>1386098)
                     /locus_tag="LMJF_31_2940"
                     /db_xref="GeneID:5654232"
     mRNA            complement(<1384854..>1386098)
                     /locus_tag="LMJF_31_2940"
                     /product="putative squalene synthase"
                     /transcript_id="XM_001685232.1"
                     /db_xref="GeneID:5654232"
     CDS             complement(1384854..1386098)
                     /locus_tag="LMJF_31_2940"
                     /EC_number="2.5.1.21"
                     /codon_start=1
                     /product="putative squalene synthase"
                     /protein_id="XP_001685284.1"
                     /db_xref="GeneID:5654232"
                     /db_xref="GOA:Q4Q5W4"
                     /db_xref="InterPro:IPR002060"
                     /db_xref="InterPro:IPR006449"
                     /db_xref="InterPro:IPR008949"
                     /db_xref="InterPro:IPR019845"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5W4"
                     /translation="MGFFSDSVAMMRVKWQMRSVKIQVPPEETDLRFCYDIMNDVSRS
                     FAVVVAQLADQQLRDAICIFYLVLRALDTLEDDMSVPVDVKLKELPKFHTHTSDMSWC
                     MSGVGEGRERELLAKYPCVSREFKKLKKEYQDVIANICERMANGMCEFLKRPVVTKDD
                     YNQYCHYVAGLVGHGLTQLFARCGFEDPSLDDDLTSSNHMGLFLQKTNIIRDYYEDIR
                     EEPPRMFWPKEIWGTYVTELKELKSESNNAAAVQCLNAMVADALVHVPYIVDYLSALR
                     DPSVFRFCAIPQVMAIATLKEVYNNPDTFQVKVKVSRPESCRIMLKATTLYSSLSMFR
                     DYCVELQEKLDMQDASSVSIANSLAAAIERIDLQLKKCQDVSYTRSLLARYPGLGGQF
                     LLTVMDTVAGFFGGRKEIAGHA"
     gene            complement(<1386856..>1387833)
                     /locus_tag="LMJF_31_2950"
                     /db_xref="GeneID:5654233"
     mRNA            complement(<1386856..>1387833)
                     /locus_tag="LMJF_31_2950"
                     /product="mutt/nudix family protein-like protein"
                     /transcript_id="XM_001685233.1"
                     /db_xref="GeneID:5654233"
     CDS             complement(1386856..1387833)
                     /locus_tag="LMJF_31_2950"
                     /codon_start=1
                     /product="mutt/nudix family protein-like protein"
                     /protein_id="XP_001685285.1"
                     /db_xref="GeneID:5654233"
                     /db_xref="GOA:Q4Q5W3"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015376"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="InterPro:IPR020084"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5W3"
                     /translation="MGRLLELTFSGGHLRRLEQERMVPGFQAQRLQPSHKPRVVIVKK
                     ESVGCVPRAQRQPNVAWWQHSLCDGALAVKNLKELIYVGEDPRTGENIFSSMADNLAG
                     RRLSQLVWAPSKDGHVFEMSRPEQAAYGLAMSLVRWHAFNRFCANCGTATDPTRDVGF
                     SRFCPKCRKQHFPQLVPAVLVAVLDGKGNVILSQRRKESKVLTLLSGFVLHGESAEET
                     VRREVEEESGARVSKVRYIGSQPWPYPYLMMMCYYAVADASPSLVVDASELERVMWVS
                     KQDVRRALEGQHSDMELRGPGTTPYAMLKPWVDGKVDDRGRITKPQSQL"
     gene            complement(<1390908..>1392233)
                     /locus_tag="LMJF_31_2960"
                     /db_xref="GeneID:5654234"
     mRNA            complement(<1390908..>1392233)
                     /locus_tag="LMJF_31_2960"
                     /product="putative serine/threonine-protein kinase"
                     /transcript_id="XM_001685234.1"
                     /db_xref="GeneID:5654234"
     CDS             complement(1390908..1392233)
                     /locus_tag="LMJF_31_2960"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative serine/threonine-protein kinase"
                     /protein_id="XP_001685286.1"
                     /db_xref="GeneID:5654234"
                     /db_xref="GOA:Q4Q5W2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5W2"
                     /translation="MEEQDQRKPNGGNNGLPVPPSTTETGQGPLQDILGRTPNCQYVK
                     KRLLGQGSFGSAWRVEESATGNVFAAKVMDLNNMSEKDRGFVTNEVKCLSRCCNPHVV
                     RCENAIEREGQLLIVMEYADGGDLYKQIKARVREMKFFREHEVVFIFLQLCLALDHIH
                     SNKMMHRDLKTANILLTTTGLVKLGDFGFSRQYEDSLSNAVGSTFCGTPYYLSPELWH
                     RQPYSKKSEMWALGVVLYEVMALRRPFTGKNMDELITNICHGRCSDLPSSYSASLRDV
                     CNRLLSVDPNTRPTIHELFHEPFIRSNLETLKRSVEKHNRIPADVREAIARCITQSLN
                     TEEPPAHLEEPEPLIGTVKRHTALRGWQKCLLSFDEKQISIRDPSGVDPEEVVPVATL
                     TSVCPIDVMMAGEEFVFAMKNQAGKAFWFMAPSQRAYEQWLTTLQEAAP"
     gene            complement(<1395180..>1401686)
                     /locus_tag="LMJF_31_2970"
                     /db_xref="GeneID:5654235"
     mRNA            complement(<1395180..>1401686)
                     /locus_tag="LMJF_31_2970"
                     /product="putative acetyl-CoA carboxylase"
                     /transcript_id="XM_001685235.1"
                     /db_xref="GeneID:5654235"
     CDS             complement(1395180..1401686)
                     /locus_tag="LMJF_31_2970"
                     /EC_number="6.4.1.2"
                     /codon_start=1
                     /product="putative acetyl-CoA carboxylase"
                     /protein_id="XP_001685287.1"
                     /db_xref="GeneID:5654235"
                     /db_xref="GOA:Q4Q5W1"
                     /db_xref="InterPro:IPR000022"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001882"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005482"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR011054"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR011763"
                     /db_xref="InterPro:IPR011764"
                     /db_xref="InterPro:IPR013537"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5W1"
                     /translation="MKAMQETSSPVGFRYDSMEQLCSSLGAIMPIKRLLIANNGLAAV
                     KGMDSIRSWMYEHTGDSEAVQFVVMATPEDLKANAEFISLADKHIPVPGGMNSNNYAN
                     VDVIMQTALQNMCDAIYPGWGHASENSALPRECMKSKRVTFLGPSEDAMFALGDKIAS
                     TIVAQSNGVPTVPWSGDSIRLPPKTFSVDAAAYEKAYVNSPEECEEVCRRIGFPVMIK
                     ASEGGGGKGIRSCKCLKDVKNLFFAVSEEVKGCHIFVMRMLENVRHLEVQLLADCYGH
                     CIAVRTRDCSVQRRHQKIIEEGPAFGVDPAIITAMESAAIQLACAVKYCGLGTVEYMY
                     DKETHKFYFLELNPRIQVEHPVSEMISGVNLPAALFCVGMGIPLDRIPEVRAFYGEDP
                     YGTTPIDFSARQSVPPKCHTIAVRVTAEDTDEGFRPTSGKVEEIAFKNSKECWGYFSV
                     GSGGEIHQYADSQFGHIFSSGETREEARRGMVLALRKLVVRGEIRTSTSYAMDLLETP
                     AFRDCDVSTAWLDGMIAKKAAEAPAHQRSIHSALIAASIYRNMRWMQEHKDKYIAFLA
                     AGHVPSTEYLSNLHTESYVSRSEKYTLSAGMVSLNEYAISLNGSIVLVPYRILKSGAL
                     QLTIGDKTLVAYVAEEPNSLRITIGGKVTNFSGDVDPTKIMASVPGRLVRYVVDDDGH
                     VNEDDAFAELEVMKMILPLRARTTGTLHHRAVPGTTIAMGALLGEITPDDPSKVARPK
                     EIKDPWPTELLVARQYERPDGVMRARRAAESLWLLVNGFHFKEIPIEERVRRAFADLA
                     SLSLSSVTLKAVHLPFIPAEMCEETEARPQTPSEKYRAIIDAIVDRYVTVEQPFDGHS
                     RQEAIEGLRNTFDDNEAVFQIDFAHNQECHHYVMRSVLKYLEGNALLLKSLKGTLSKL
                     VTLKSFAYGSLLLQARYLLRLCSLPSFTERKAQFAEALEEGSLRSLVASSFGYDLLCS
                     IMFDRQMEHLVHICLELFIRREYSGESEIEDLDILKQGTNWYASYNFDPIEDAEVLHM
                     TDELAVGSRRIIGGRGICVMLPDEKLLQSTLASSFRDVVSHYSDDIVIATVFFSVSRE
                     STQSDVARMCRRLMEENAAVFQNFEKLETVYFMAHGMPEGPHFFTFRAETGFQEDTLL
                     RNVLPQSARRLELDRLSNYEVSMHPTPYKDVHVFKAAPKKAGASALEHRMFARVAVTP
                     HDMGMTPWTEATDVDVGHMLAKCLAALQVAHDDSTVKFPDSNHVFVKMIELTFDVRSL
                     QTLLVAAASSYQEKLTELGVRDVEVSFHVKVPSGLIPMRVIASSPSGYGVSVHVYYES
                     LSNGQLQLHRAETSEDVYYSSTGRPAELLLEMSLASPMMPPSRETPHLVRTASKLGDL
                     REMLPSEKEQQISVDMMSEPTEARHRAITLGPYPQLEARDVKRLQARRAGTTYVHDWP
                     AVLNLILRKEWMKQRCALDLSQASIPKNPLRATELFLCEDGESLSTKKTFAQPCGMVV
                     WMVEYAPPRYFDMELKTAPTRRIVVVANDITFQSGSFAVPEDCVFKAASVLARAQHVP
                     FVYISTNSGARLGLSTEVKKRFLVEFTEKNDIAYLYLTKSDYEELRERKEIRMEVEPL
                     EVKGETRYVIKGVVGGPTEYIGVENLSGSGLVAGEMSKNYSEIPTISLVSGRSVGIGA
                     YLNRLGRRVIQTNDSPLILTGSGALNRLLGKDVYMGNSQLGGKQIMVPNGVTHWCTHH
                     DYGSARVLLRWLDYVPAVLHPGRCTPHRLLWAAADPIDRDVTFCPTSNTQYDPRLLVT
                     GLLGQTGLFDRGSWMETLEGWARTVVVGRATLGGIPCGVILVETRLTKKFDPADPADP
                     TSTSSFITQAGQVWFPDSARKTADALDDFHHERLPCFILANWRGFSGGMRDMFDEVLK
                     FGASIVDNLRVYTAPVFIYIPPGGELRGGAWVVVDPTINHNGVVEMYCEPSSRGGILE
                     PSGVVEIKFRDDDVLQLIRRNRPDLAAMEVKAAREAEKELLPYYRDVAVRFADLHDTY
                     VRMKATGVVRDVVPWKDSRRHFYHKLQRKLKELEVANDMLEGGVVGSLAGGVRKVEER
                     YSAAHPNGPAWGTADQDQLKWLRGLDGTWTGESNGHTVLNSSEWAKELQRLLTQNGGE
                     ESSMERALAKLFENPAIAKAAKVALDSSACAHSTAE"
     gene            complement(<1402486..>1405449)
                     /locus_tag="LMJF_31_2980"
                     /db_xref="GeneID:5654236"
     mRNA            complement(<1402486..>1405449)
                     /locus_tag="LMJF_31_2980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685236.1"
                     /db_xref="GeneID:5654236"
     CDS             complement(1402486..1405449)
                     /locus_tag="LMJF_31_2980"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685288.1"
                     /db_xref="GeneID:5654236"
                     /db_xref="InterPro:IPR006887"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5W0"
                     /translation="MENADPITKAKLFASHETGQWTEIGLGVVSIVKEQLPISTADGS
                     IGAGGAAGVSAGGGGKRGKATDEETGTRLAARLQIFSTDNPNDLLLSSYVSLDDVYTI
                     QGETILLWYDEAVSNEIACSFDDKDGCEFIYRQIKSYQQSERLRRVQDERMPALADKF
                     LVHPHNLAGILDAAQSQNKRFGLYVREDSQYFTKLAQLFHASREKQDTASMELIARIV
                     LMLFQSPYNTEGKIVAQLVENERIDDCIDIVQYGLGRRDKESGFVSFEERRATFHDPC
                     HLPESMLPRIHVLYSCGFLRDLIPLNLEPADAASYSLLSTFTLRFTMNLLTDVVASPT
                     ILPNAFRTTVEAVRLDSPSADPASIEPSKVAHLFELAAFVGDVAKTVKNAMIGIDMRA
                     EIFSSLVRVGALPFLTAVLECALRYYGSTLAHPPAQQWAVGPPRAVQLVCDTLYSCAS
                     HFPECVEDLVVEAHAVPDRCLLRLLLRAITVVRSAAEAQSVVDAVQCCGVGVPLTLAM
                     FGDNAQLEARRHEVLRFWIEGDNVDRPPLFYLAEHLVQMLDQAARVTAPAPSLGGGVN
                     GACLPFTGGALQLSLVQERQIVYGLRIVAVVISKVDASRCDSLLEVLTLSKLMPALAT
                     TLVSPQRRISNLQASVTSFLATVLDRRDARLVTLATGDPSPSLLHTALSLYLQCSHRD
                     NVLSSSLAHLVAAVCEGVHREKLQGTSSMSSGGSLGPSPFVTILRGDDSISKAEKTSP
                     AAAPPARPFEAVATVLLSQFGERLSKKVPVLYDRLQRALEETPEQAQLAEAETSSLAS
                     SVERSAISGFADFDAAAIDFGLESPLGTPMVDGGSEARLHGLIHSTAATSDEDGENEG
                     DPLASLSSIDDDSDNEEVGKPVPPSAQPSTSSPSAADSPPGAAATSSAADQRSSSTAG
                     ISSLAASTSLASSAVAALECLDPPSGRGSLLEDEENRLPRRVSIKRSRADADKLNDDE
                     EEAEAKRVRAEESAA"
     gene            complement(<1407025..>1412832)
                     /locus_tag="LMJF_31_2990"
                     /db_xref="GeneID:5654237"
     mRNA            complement(<1407025..>1412832)
                     /locus_tag="LMJF_31_2990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685237.1"
                     /db_xref="GeneID:5654237"
     CDS             complement(1407025..1412832)
                     /locus_tag="LMJF_31_2990"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685289.1"
                     /db_xref="GeneID:5654237"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5V9"
                     /translation="MRAACTRHRPSQRHSGYPISFGWGGPIKGRHGLSTHATKRHMEE
                     LAKSLQQAQAAVLGVQDDLALLRAHEEEEAEGWGADKVVKAAAVALETGVTLTNSYYV
                     DLHTSVHRKQEAASLLLQRCAHIFYEQFGALEEKAARLENVRVKEKELQSAKKSMQRY
                     FDAHSKELAEERDRHDGVLRLEWERRHHLEDGILCLKLERRQQRLAHRVLLMWMKKAM
                     VRNLAREYTRRREATRETYQSATCDALVQRQRVTATQRALCTWRSRMQQRRCQRLKTA
                     AAEAEQRAQFFRGELAATQQNLHERLNRDVGGRDRVAAAVATQEKECAQYEDEVHRLR
                     TALRDMTVEFSERTRTYVRQQEATEQLFARKEATLRETVCSLQAALTTEQQAHLAFAA
                     SSEHFINSVHACWKAQLQELAEAVRRKEEYAYHTILGLTGRLQHRHGSLRQEAAKLAR
                     DVDTLAPLSERCVRLENALAESEQLLKRSKASSQSWERRCKAAHVVEALLTDRVASAE
                     SAALRARSFIRWLGHSHTTSSEKSQRSICSLSDKMETQRRQLLVQQQEQSSRQHAEMA
                     QLRDELEQLRRANVRLQSQLEAAARTQRERDGAYYDSEVRNGELSAAMLREKMERRGV
                     EDKWWSSRASGLLLQEAQQRLYIEAQEGQWRTTLLMRESKVLKVWTASLQCDATQLTA
                     VCEGWQQHCHQIEAAHAAVQKTAAARTACALERGVLHAQTLAVWTWWREWARQRRGVA
                     ALEAQLSASRREIMERHGKELARAHTSHDTALQRLQREHTLEKTQLQSIHEERCAALR
                     RAQAEEVEQLAERHAQQLKIAQTAYAADVAQRDEQASAMQEQLDHVGCLVVEYCAQAT
                     YSRWRAWAAERQAQRTARQRRGLSMRVWEWQTVRTTLIDACAAAKASLWASSTIELAQ
                     ECAVEVRRQVRHVAQEKELCHSQQHKLQAAKEVAEEEAAYLRGELQHVRTLYDAEVHY
                     TELLLRTATEERRAHRSTLVCTARMAEWRELAHCSLAEHQAAAMEAFADAAGKAMTEV
                     LAARRDELAAYVAQVEEEVMVRNARVSGAVAPPPEETGVEKARTSDGDSALDVNGRAP
                     GEREVDANNAEVSTGDGGGQRRSTGAMAMTPPLVQVVPEDLVSRLRSIESYVTATGDS
                     CEAECEADTAFSAQCCPLLAGPFLETLVLSSPHLAAAFSHQVQQADVPLTVRHLLELV
                     RLAALRGAAAHRRNHAAELAAIQEKRAGSEEALASLRESMGDLLAEQRSLAGEMHADA
                     QQQRQQCPTYRETGSAQTSSASTGTWQKRLSALADRYTQVLDAFYADITGHQETFYSV
                     NGMLVEADELSERLLQRFSENASAMAQLRAQVLAHVPASASAHERGAGPDATLPADTA
                     AAVGTIPPSSPAPKAPSLPVTPPSSPGLPDNPIHAACSQRSSLGATASSTGSTPERNR
                     LRDRVRFLERLLVETKVQLAEAKSLVGVAHRAASLSKASAEAQVWAAQDAEDFSQLAL
                     SKEQLLALYAASEPTTRTLMTAMREYDTQLRTACAAVEEALQARHRVDVERYEAKVRA
                     LSDSLAAAAREQSKAKARYGELEQQLKSEAASWAEKYSRDTQLIRQSCLSEIDELAGH
                     QRLLEDELQQCRRATQSSIQQAVERQTELLRLEHTDKLRRSERNAARLATEKALLEGR
                     LRSVEEDCERQVQQERAAVARLQHRLAGDAGAAAEVACVATLASFEMYLFGATELFAR
                     CAAEKATWLTACVAGLMEQEREQWETEVMQLRERVVFLLEASGADPAAPVRDDSFHQG
                     SRNVQESGRTTSPQDKAENSSQALTVSPSPRRSNQGVSPGEGGASIAACGTTAQSTPR
                     RAVSSPSAAKTSRGTQGTISLASHDTTPTRCRSLSVDSLELSQSFLRYSKMLSDQRSR
                     NATRLERANALAAEVDDLLLRGAQLGHSAASQSAR"
     gene            complement(<1414111..>1416897)
                     /locus_tag="LMJF_31_3000"
                     /db_xref="GeneID:5654238"
     mRNA            complement(<1414111..>1416897)
                     /locus_tag="LMJF_31_3000"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685238.1"
                     /db_xref="GeneID:5654238"
     CDS             complement(1414111..1416897)
                     /locus_tag="LMJF_31_3000"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685290.1"
                     /db_xref="GeneID:5654238"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5V8"
                     /translation="MLAYRVHRIQTGVYIYPWVNGEEATLSVPGDRQVTLHCAGDSVS
                     DPFPFDEAVFAPFHNTMYSCCVADGLRLQFGSAVQRRAPSFRDVPRRTTIVHGDPVSY
                     VGETFYNVLLLAAKEVERIAGARHSQSAYECAFNVFRVCPWGEEELLEAAGRAHCRGS
                     ASSSGTAVEQGISLWNKRTSMPLRTSAQRQLFKSTLKQLCRGPRSEGRDDAAACVQQV
                     RLAVYAPAGDSTADDRVLCAEHLFSLAPSVCDVGASFGTTMEALCEMLVCRRQGNVLG
                     NPLLPVLLPGVSVDCLTILTCISARGEHSSRPCIDACCFGCSSERQRRPTAASSLAVP
                     PAAASKNGTAKGTPAQDLAPLLRQPVSCSALFQRMTGELLMPVAPSIRNASWQTSQPQ
                     KLSAATPPTPFSDPPRASNSDPFAQLDESVDRLLWLRRLRESPAGKPSLLRDGTTSTS
                     PPAETRHTVSALPATLGTSALSMAVEPLAATPPGRARNESCESSRGGEIGKLDLLKEA
                     SALIDDANMVASGRAARACRREESASARALEMEARVRKRCPDCDAKDAVLSLHREELQ
                     TPCAELVHREGKRHLRVDKGQYHTAELRRTARLFQSLEHPVESLRQREQELSTYLKML
                     DSYAAYVNATCRLYTDQVNAKMLRMDGVKRYLTRRISIAAWVERAGILHQRCELYDRR
                     VDALQRQEAVLSRQMHSMELEATALRTEVQRLEELRDTTERDIAEDKRAAAARQGKAL
                     EECEESLASVRRVQGERDAVAREVANLAARRAEAAEEVARREAELAGLQATLDAAREA
                     GAAEATASSSVHGTENAASKQLSGNDGALSDSSLASAKGVIEEEQRKVIEELAVATEE
                     LAEVEDVMIEEADRAVLVLHRCDGEMTLRFDHLMDRFSSFIDVESRLAGRSASMFSES
                     SSQRHTRMSHSERK"
     gene            complement(<1418125..>1419690)
                     /locus_tag="LMJF_31_3010"
                     /db_xref="GeneID:5654239"
     mRNA            complement(<1418125..>1419690)
                     /locus_tag="LMJF_31_3010"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685239.1"
                     /db_xref="GeneID:5654239"
     CDS             complement(1418125..1419690)
                     /locus_tag="LMJF_31_3010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685291.1"
                     /db_xref="GeneID:5654239"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5V7"
                     /translation="MLAAVWTLAAPSHCSSLSSSAWLYLSNVFHYRSFAISPLFPVLL
                     AYILRPPLPHLACSAPMNTEMPMASNGRGLPSPAPLRRQSAKKLASNVTSPVLASLST
                     FAEYADRRHELLAGIHDGLEGHVREMEERARQAVAHASAVAEACRAQERECLEYIERL
                     EDNIGDLHRAKRECAAELKALQTSTERGRQELEKELHDLRQAVEEARRQKLLAQEEQQ
                     HYEMLRDAAKRRYELIEAYLKDFTAKVEFRFHGAVASLQATAQERKRWADEQCALDEK
                     RVREAALEAEQSDFSALLCRATKDAERTGAAKPAEQCAAAVEPQLMRDVERDAAALAA
                     SVAARLQLIVEQQSAAEAGLDRLPPRITGEGCDSIHAFCRTAAESTLARDQENWKRDQ
                     RKSCGAASVSRATRALGTLEVTVKQALLDLCAAAASASSTPSTKGPACPHESSTGAAA
                     PLHIRAANASVSSSAPPSSRGKALSPTPVKTSSSPGSSHRQSESVAFPERRLIDDFSC
                     STDAFATIFTPRK"
     gene            complement(<1420003..>1421829)
                     /locus_tag="LMJF_31_3020"
                     /db_xref="GeneID:5654240"
     mRNA            complement(<1420003..>1421829)
                     /locus_tag="LMJF_31_3020"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685240.1"
                     /db_xref="GeneID:5654240"
     CDS             complement(1420003..1421829)
                     /locus_tag="LMJF_31_3020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685292.1"
                     /db_xref="GeneID:5654240"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5V6"
                     /translation="MRSLRFLSPQANQHCGLSFLSCSFLLVELLDLSRCPPRVPHSID
                     TAAAATPICFLCIPCLVHPPTPKRFGCPVGRRYNPVRRLEQTVLDLLVSSATPSTAWV
                     YVLSTPAGSYTPPLSPFPPTSARVRAVPTHLPRRGGWMSAAAALVAYSCGSRGELFRV
                     RAVPADITAVMSDRYESIETSLQFSSSSRLSTVLPPIDEEGCTDVWVSVVAGASSDKR
                     QGGKGSGTRARSLQRVVPPSFLLNEEATASLESQLRIHRALSALSSRQESGNRVHDSA
                     TATADSEYYFLSTIRGSTSPPGMSTYFGGAVAPEAPVARVPETAISLMSDIESFESIE
                     TPRSTVVSAVAAAQVSRTISPSPPTPLLHSRKPGACGGLLHVEVVVVNAEEARAAHAL
                     LTSSSAAIIARYRLVKLKVVQRIYRLYYDKWRWRIVQSTSAVPPLQVTKGIQPSAPCQ
                     RSASVGTDFADIDSFHASRSMSLSGDSPGVHVAVTVPPRDAQPLRSSPVAPTPSPRLG
                     EGESEGGIVTWSPAPAFRLETFASASPPPPSQPSKYRTPTFSILPAAPPRDGIGVRTK
                     PAKLVDFGHPSEGPQRKTLHVTSTPAVNLPAVVSSPERIFRC"
     gene            complement(<1422046..>1427397)
                     /locus_tag="LMJF_31_3030"
                     /db_xref="GeneID:5654241"
     mRNA            complement(<1422046..>1427397)
                     /locus_tag="LMJF_31_3030"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685241.1"
                     /db_xref="GeneID:5654241"
     CDS             complement(1422046..1427397)
                     /locus_tag="LMJF_31_3030"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685293.1"
                     /db_xref="GeneID:5654241"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5V5"
                     /translation="MEYNGAKPPMPQLRLPADYVYNPLYFVRDSNAVFKGGMGEDDAV
                     EPLHGLSHAVLPATTYLHRPLHFSLSSSNATPVRSHDNRSRSRESRPTRRSGDSSPAA
                     ASAPRQRRSSSMAAAHAARRRRGHALTQEVAAWQRRSGTACMEESSVAAPSQEVTVDA
                     TRADLSTSILRPTRATQLREDYLLQYIEERDEAAQNIFFRPRGWRLSGAALNSPYGQH
                     CTSSASPLRNDVLTPTRPENSSAAYSPTPRFTKAAQLRQQSAVQLMEKLERCGLEKAA
                     EEALTHVVAEASSRRALMRLRTGAHSNSSSRFVAVQRSGGARDAGAAMRFNGMHPSHH
                     GPRCHHTSRTGSPGGAINGAGDRIRVATRSASTHSASREEWRSAASTSFDGRENTLNK
                     QQHVAEGTHAPCRGLVPDAPAPLPSSKYRPCEARKEALKVPRRELSAAKPTDAMGLLP
                     KPASRNGGERVPSRHHRRRRCLYAAQRDADSLSPVAIRDVRGPAHPTPSTAALASPPA
                     AVHRECGQRGIHTPLAVRDTETTMASREDAPLAQRATSSKSSHRRDSDDASSSSVSSI
                     MFTVLSAPQDDTTGAHPPEARHDWQQVAAQGSRMRENGDDADDSSLEFQSTGRSDCEH
                     SASLLACLAPVAAVPPSAVRGAELSSFTSPDFSRVPSPTQASASVTGDEARMSAATAA
                     VLHEQETTTSCAESEVERTPHAVGADASPAPRRPLEQTLQGTREEPSAGSSARCLGRQ
                     GACPPPVDAYLAPAHAPQTPSTERSGDVSLRSLSQDSYHAGSSISSRSGDFEVQLRIQ
                     SESTDRSAQAAATTLPQRARSQVGEGDLEKAPSDAAEVRHEGSASSTQSSFASIASYH
                     TEVHVHVPAVVSDAADEPLEAATLQKELLAFYRIAKPSSAAVESRLHRRAEHDWSLKS
                     NVHASSREDDASRAGDDKQVLRGHDGAAPPSPSWLLNASEGISSALYGFVPSTASGES
                     DVSRSVTTDAYTVVAGGGGRVLPAWGFPVPPTNCTHVVAAKEARQRAVVEAGLSKLCT
                     ASEQPRSLLTGHIADSRMQQFTAADVDSMSRYQPRMEGPVVQEALDSPRQPSMQESGR
                     RTSAPPSAAGAPSAAVAASAENGTRNDAGPEVVVDKAMALAHGKTTDDAPSAAVPLAA
                     VAVLGADAKGDVDSPSVQREGVHPRDATRSLATVTVAAAREKSSLSVMGAEQPAAITN
                     ALAESLPVKDAPFSRAVLSCSSCVAIGREDRPAEKAMGSLALSVDSVSPQSRAESIRS
                     VQETDASTSDGTAGSQTTVLASLHHSLADVHAGAAVAKAEGRQNDVVLRDRAEAAAVP
                     CIAKIRSATSSVRKSAQPEKVSDIPPSAAAVQPEDATLHRSRSSSAEVDDANRAERMA
                     VAGMSTPLSLSTWPRTVELALATASTLATEHGSFSLYFTEAEQSPRERSVYARQAASF
                     SNGGGEELGEGVPHSHAPTPLHCRLPQQRRLATPPYEGVQLPGASAAEERKSDAPLAQ
                     VFSRSDTSTRCLCAASTEFQADVHVREHTSDRAERIPAVPFGAPVNGVSSVREQSRRE
                     GGRQAAAQDSVALDSSAPPSEDVTLELAAVSVPYSHDSPARPLSTSTSSSTHFLARNP
                     FSSPSQSGSSPTTPTATSHFMPSSLGGLDAPKQGFGVKVDFEMRANGDCDVLLTGNAA
                     DANRSTFSRSTSCDSMEHAALVQLTEPTSTDTAVITTPFRPSSPVPGSEFNTTCSQIS
                     ERITWSAGTWVDRERASASPDHGEAGAAESDLGVLRKGTRSAPSVPLTRVRYLNQDM"
     gene            complement(1428248..1429693)
                     /locus_tag="LMJF_31_3035"
                     /pseudo
                     /db_xref="GeneID:12981452"
     misc_feature    complement(1428248..1429693)
                     /locus_tag="LMJF_31_3035"
                     /pseudo
                     /db_xref="GeneID:12981452"
     gene            complement(<1430498..>1431244)
                     /locus_tag="LMJF_31_3040"
                     /db_xref="GeneID:5654243"
     mRNA            complement(<1430498..>1431244)
                     /locus_tag="LMJF_31_3040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685243.1"
                     /db_xref="GeneID:5654243"
     CDS             complement(1430498..1431244)
                     /locus_tag="LMJF_31_3040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685295.1"
                     /db_xref="GeneID:5654243"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5V3"
                     /translation="MWRSMRRTSCAVPWMTVARWQSTSGKDAAAAAAPAANGTGEPMR
                     VDTSASVKMPDAVNGGSSAQSPAKSDAYRFPADEVMDAVKKRDFNAMQTHATKLVQSQ
                     WKEEYNVPAACVVIFIVMWYWIAWTRRSIRRKCEATKASVKQQTDEMVEIVRNMTEKW
                     KVDMAKANKQMQGIIDKNSELTRDIDRMTTALRSCSIRPTAASAAAIAPTVSVVKRVD
                     PVEEEVPAEATETAAGESREALVVVEEDKD"
     gene            complement(<1431876..>1432400)
                     /locus_tag="LMJF_31_3050"
                     /db_xref="GeneID:5654244"
     mRNA            complement(<1431876..>1432400)
                     /locus_tag="LMJF_31_3050"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685244.1"
                     /db_xref="GeneID:5654244"
     CDS             complement(1431876..1432400)
                     /locus_tag="LMJF_31_3050"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685296.1"
                     /db_xref="GeneID:5654244"
                     /db_xref="GOA:Q4Q5V2"
                     /db_xref="InterPro:IPR007325"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5V2"
                     /translation="MRLVDLSLPLYDGMPVYDGDPPVHVTKVCTREKDGWEVRHLQMG
                     SHTGTHVDAPAHMHEDGSNLDEVPLTRFCGPAVVVKVADSSFPPNKGLLFYEAVPADC
                     VPRIVAANAPFVGGPLEEKAERLLLGCGIITYTGLVNVEQLIGESFTFYGLPLRIRGG
                     DGSPVRAVAVMDDK"
     gene            complement(<1435777..>1437075)
                     /locus_tag="LMJF_31_3060"
                     /db_xref="GeneID:5654245"
     mRNA            complement(<1435777..>1437075)
                     /locus_tag="LMJF_31_3060"
                     /product="iron/zinc transporter protein-like protein"
                     /transcript_id="XM_001685245.1"
                     /db_xref="GeneID:5654245"
     CDS             complement(1435777..1437075)
                     /locus_tag="LMJF_31_3060"
                     /codon_start=1
                     /product="iron/zinc transporter protein-like protein"
                     /protein_id="XP_001685297.1"
                     /db_xref="GeneID:5654245"
                     /db_xref="GOA:Q4Q5V1"
                     /db_xref="InterPro:IPR003689"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5V1"
                     /translation="METAKLSVEASTRYLMELGYHVSAPLNADGSSAASAGEAGDSLC
                     KGFAGAYSLGLHVGALFLILFVSLLGTAIPILGKCIPSLMRYPYVFSVAKSAATGVLL
                     SVSTIHLIFEGAEAFSEDCIPAVLKSYRPLYFLLALIAVLLMQALDMQLADIAERWMK
                     AKLKRETEAVKAESKCNDECCGLSPDVDVGVTTGPAQADGPLIDERKSTSSKSDVQTT
                     VPAAALDDCKVPLVAVSPKHPEHYHHCDEPSAHGHQHLSVAPLRDMGYLRYVISAVCL
                     EFGVTLHSVFVGLDVGLKKDSELKPLLVALVFHQLFEGMAVGSRLVDAKFSVTLDVVL
                     ALVFSLSAPAGMAASAIAVSVSPSAMSGSVFATVVAVLDTLCGGILLYLAFTLLLGDF
                     VADVKHYCCDGQRHRMAKKIILFVSLWVGMGLMALVGNWL"
     gene            complement(<1439906..>1441204)
                     /locus_tag="LMJF_31_3070"
                     /db_xref="GeneID:5654246"
     mRNA            complement(<1439906..>1441204)
                     /locus_tag="LMJF_31_3070"
                     /product="iron/zinc transporter protein-like protein"
                     /transcript_id="XM_001685246.1"
                     /db_xref="GeneID:5654246"
     CDS             complement(1439906..1441204)
                     /locus_tag="LMJF_31_3070"
                     /codon_start=1
                     /product="iron/zinc transporter protein-like protein"
                     /protein_id="XP_001685298.1"
                     /db_xref="GeneID:5654246"
                     /db_xref="GOA:Q4Q5V0"
                     /db_xref="InterPro:IPR003689"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5V0"
                     /translation="METAKLSVEASTRYLMELGYHVSAPLNADGSSAASAGEAGDSLC
                     KGFAGAYSLGLHVGALFLILFVSLLGTAIPILGKCIPSLMRYPYVFSVAKSAATGVLL
                     SVSTIHLIFEGAEAFSEDCIPAVLKSYRPLYFLLALIAVLLMQALDMQLADIAERWMK
                     AKLKRETEAVKAESKCNDECCGLSPDVDVGVTTGPAQADGPLIDERKSTSSKSDVQTT
                     VPAAALDDCKVPLVAVSPEHPEHYHHCDEPSAHGHQHLSVAPLRDMGYLRYVISAVCL
                     EFGVTLHSVFVGLDVGLKTDSELKPLLVALVFHQLFEGMAVGSRLVDAKFSATLDVVL
                     ALVFSLSAPAGMAASAIAVSVSPSAMSGSVFATVVAVLDTLCGGILLYLAFTLLLGDF
                     VADVKHYCCDGQRHRMAKKIILFVSLWVGMGLMALVGNWL"
     gene            complement(1442750..1443346)
                     /locus_tag="LMJF_31_ncRNA7"
                     /db_xref="GeneID:12981453"
     ncRNA           complement(1442750..1443346)
                     /ncRNA_class="other"
                     /locus_tag="LMJF_31_ncRNA7"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460990.1"
                     /db_xref="GeneID:12981453"
     gene            complement(<1444976..>1446061)
                     /locus_tag="LMJF_31_3080"
                     /db_xref="GeneID:5654247"
     mRNA            complement(<1444976..>1446061)
                     /locus_tag="LMJF_31_3080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685247.1"
                     /db_xref="GeneID:5654247"
     CDS             complement(1444976..1446061)
                     /locus_tag="LMJF_31_3080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685299.1"
                     /db_xref="GeneID:5654247"
                     /db_xref="GOA:Q4Q5U9"
                     /db_xref="InterPro:IPR003131"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5U9"
                     /translation="MGGSCMGLQSIILVCIVGPLIHGMDSDEEPPAAVANTFSTTAAR
                     GVSSSLISRPLLSSGVGFRRESDSLAELCAHLKRRYEGLARLPSQVPPVVCFCVGGKD
                     FAVSRALLEKDPGSLLFSLARLHFCSTSSAKGAAAASAHGRKRSRDDSDETMTDAVVS
                     IPERNARLFGMLLNLLRGYKNAIPEDWMDSCREEAAFYGLSGLWNSRFHITSSQYYFR
                     NPLHNSKLISDAVLGVASDFFSTGQHHIDFSVSQCDRVAVGMISSNVGSAEDPVTPPH
                     DGNNGAFYWNDGKLSFYLGEPRVVETGLPFPAGAIIRVIFDADERIVRWIVNGEYCVA
                     MERLPAGRQYAFSSIAARSSQVTIVPT"
     gene            complement(<1446708..>1450100)
                     /gene="SCG5"
                     /locus_tag="LMJF_31_3090"
                     /db_xref="GeneID:5654248"
     mRNA            complement(<1446708..>1450100)
                     /gene="SCG5"
                     /locus_tag="LMJF_31_3090"
                     /product="phosphoglycan beta 1,3 galactosyltransferase 5"
                     /transcript_id="XM_001685248.1"
                     /db_xref="GeneID:5654248"
     CDS             complement(1446708..1450100)
                     /gene="SCG5"
                     /locus_tag="LMJF_31_3090"
                     /codon_start=1
                     /product="phosphoglycan beta 1,3 galactosyltransferase 5"
                     /protein_id="XP_001685300.1"
                     /db_xref="GeneID:5654248"
                     /db_xref="GOA:Q4Q5U8"
                     /db_xref="InterPro:IPR001431"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5U8"
                     /translation="MATAVALSQSILSLTLCFAHPRSSCGSFSTLTQNAGSCCLACAH
                     PARQAAMASAAQHIITPAVIRAKYSGYVLSNGVKCVIVQDANAKMPAAAMSIRAGQLN
                     DPVDLPGLAHFCEHMLFMGTEKFPKEDEFDSFVSKASGLTNAFTEGCDTVYYFSVSDG
                     SLKGALERFVEFFASPSFSPGAMAREVNAVHSEDEKNHNNDYWRLDELIRDFCNPKHP
                     RSRYGNGNLTTLRDKPQRRGIDVREALKTFHSRYYLADGATIAVVSMRPADEVLSLIE
                     GPLTRMKKGAVPRFSFLEAGEHLFTSAALGSWTNVRTVQKMRELRLMWAVRSPSSAWR
                     TTPSAYIAHLLGHECNTSVLGVLKKRNWATGMLAGSYRVDDDFEVLEASVTLTVEGFR
                     NVLKVVDLLYQGIGQSIAHDVDAEVYKGMKAEERLFFESVDAGAPANHCVTLAQNANV
                     TDLEHCWIGGNVVLEDDMEAALAYVRQLTPQNCVMVMQWGDMPSDAPAGATSAEENPV
                     ECHAKQHDEEDDEDSQSAEEETAEETEQAEESDASAEELFLSLPAFAQVRVSSVSRFH
                     RALYQTVKIPEEYEARWQSLISGPYPPELALPSTNPFIATDFTIHPPAAAEAVDEIAS
                     PHAVTYVRRDAGHHSTFKMALRCNVLSPVASASPLNRLYTRVMHGILSNAITETAYYA
                     MLASLTNAVILSETGLGFAVEGPSQKLYEFFFAVVRKGLSTQVLQGTAEEYATYLETG
                     VQKLKNVGMSQPYKVLHETQKKATRHTYYLFNEMVACESAATYEGYCTFVKQYLESGL
                     LLECFVAGNVLSTQDVREMLVGPLEDLLATLTIPIPLKESIPRVRDTYGPRTEDGKAN
                     ESVLCTFDVLSMPPSNPADPNAAVLVDVIIGEATPRVMALTDTAMKLISSSFFNVLRT
                     REALGYVVFAESSVVYCTAHALFVVQSALKDVDCVYLLSRIVAFFSAVEAQLDTLCSA
                     EEVEKVKGGLIAALEKVPDSVEGDVRRLEGEYFSLSKFESRQRTIAALLAITSEDVKS
                     HLRKFFFNNRSGSRALALCINNARTAATDVLAEPGSRRVPLPRARSRPEDSDDAPGDA
                     SEDTEPLTLPTFSDGGSCAEITSYASALEYQHGRCVVKCNAY"
     gene            complement(<1451138..>1451791)
                     /locus_tag="LMJF_31_3100"
                     /db_xref="GeneID:5654249"
     mRNA            complement(<1451138..>1451791)
                     /locus_tag="LMJF_31_3100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685249.1"
                     /db_xref="GeneID:5654249"
     CDS             complement(1451138..1451791)
                     /locus_tag="LMJF_31_3100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685301.1"
                     /db_xref="GeneID:5654249"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5U7"
                     /translation="MLRLSRRFLGAAGAGPFDPYKILGVKPDASKDEIKKAYHRLALR
                     FHPDSGAEGNAARFAAVNEAYEAVKDGKWKYSAQQQQKAEEQSRGGWKDPKMRMYVYE
                     QPGSTTDGYVSGDTERYMRFFMIGCFLFIFVRVSLFFLLPATRNGGRGETVLDRERFD
                     GSLPLDAVGNQETLFEQSLDNVANGCSNGSVHADEEVEYKWVENGASAHLKDPLSYR"
     gene            complement(<1452256..>1453023)
                     /locus_tag="LMJF_31_3105"
                     /db_xref="GeneID:5654250"
     mRNA            complement(<1452256..>1453023)
                     /locus_tag="LMJF_31_3105"
                     /product="autophagy protein 10 (ATG10)"
                     /transcript_id="XM_001685250.1"
                     /db_xref="GeneID:5654250"
     CDS             complement(1452256..1453023)
                     /locus_tag="LMJF_31_3105"
                     /codon_start=1
                     /product="autophagy protein 10 (ATG10)"
                     /protein_id="XP_001685302.1"
                     /db_xref="GeneID:5654250"
                     /db_xref="GOA:Q4Q5U6"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5U6"
                     /translation="MDCSEAVLVCRCCVVHYVVYISPSPPPHSVPHFSILSRAIRLRL
                     TEVAPQRCRLCAAGLPATPPHQTMKTDTASVHCTRASFAQFARQRCADSPWELRSKRD
                     PFGVPLEWLEATYNVCSLFEGSASAVLITVCVLFNADFAVPQLGFYNSTVTSLEGLQM
                     AVPNLTFVNAPSTVEPADVTGSLHRPLVSFSWSQELGQYMWLVHPCDTENLLRCRRYD
                     GEQGDVLSVFLRAMCDYFPFAPLLVPRAGGNFDTARA"
     gene            complement(<1454006..>1456546)
                     /locus_tag="LMJF_31_3110"
                     /db_xref="GeneID:5654251"
     mRNA            complement(<1454006..>1456546)
                     /locus_tag="LMJF_31_3110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685251.1"
                     /db_xref="GeneID:5654251"
     CDS             complement(1454006..1456546)
                     /locus_tag="LMJF_31_3110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685303.1"
                     /db_xref="GeneID:5654251"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5U5"
                     /translation="MSLPREEIRVEWGADTPDHSRTDYPFNRSRCDSLASSRFSSRLS
                     RRSSVRDEVQSLDEFLRKQRVIRYMQEERERAERSKLLREEHDFWVEFRDRERAERLK
                     YMTEQEIVELLQREADEATRESNRADQLHQRAMEDALRRRHITADVQRGGEDTVLARR
                     KGEVQVDGIRLAAERETSVMVGAMTVAERTRRAGVERQQREEDLTAKCQQLMTELEEA
                     RASATRAQRYQKRAEDDLTREQENTRKEQSDAAACKETNDKLLKELAEVRQQLTASEA
                     ERKKAEAAKVQAAREVAQKEKELTCLRKRDDELAAQQASQKAAAEDEKQRAFTFQEEL
                     KTYRDALEKEQAARNRAETELAALREQAKTLEAKVAAASAPDPKQVADNMRKLKAVAD
                     DARKAQADLVKERQARESAEAAAVEARDALAKEQAVREKVEKEAQRALAASSVSVLHV
                     QKAESDRKKLAEAEKKLEEMRRARNRDEVEKAALKREMEKVKRDLEGEASARAQFEQL
                     ASQAVSADDRVPQREVDQLRKALQISQEQCNAARRDTVACQQNAAREIALLKAWCERL
                     QQQHRMQQQVLQSDEEFTPRTATPTPHCRTPRSVRKRIPQDLVADQRQAEEKAASDQR
                     IRELEAHVTRLQVDLGRSKDQERRAIAGAEQARKALEASTATSMPDSGKASPGPSERG
                     IAKEQEAKERAMVQRLNALERECAEAQKKYDDLVVAHRQSEAARCEAELQVAAQRAQI
                     EQRQREEPQSYTSALGNYETSRLEPISATAGESTSALEERIKELERHLAEERAARQAA
                     ERRAEESQKLCAAPGTDAMSAAKRAEANVSSSGAGAKGKPQKVKSACC"
     gene            complement(<1457517..>1459265)
                     /locus_tag="LMJF_31_3120"
                     /db_xref="GeneID:5654252"
     mRNA            complement(<1457517..>1459265)
                     /locus_tag="LMJF_31_3120"
                     /product="phosphatidylethanolaminen-methyltransferase-lik
                     e protein"
                     /transcript_id="XM_001685252.1"
                     /db_xref="GeneID:5654252"
     CDS             complement(1457517..1459265)
                     /locus_tag="LMJF_31_3120"
                     /EC_number="2.1.1.17"
                     /codon_start=1
                     /product="phosphatidylethanolaminen-methyltransferase-lik
                     e protein"
                     /protein_id="XP_001685304.1"
                     /db_xref="GeneID:5654252"
                     /db_xref="GOA:Q4Q5U4"
                     /db_xref="InterPro:IPR007318"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5U4"
                     /translation="MSLESASGCAKLSLTSSEDGESYGLLHDGTRFRVPDTMSVMDAL
                     LTPKSWRSPATLIWIASWFAVGMTGLLYFTHGLPMWFFCAHFAFWRLAYNIGIGAILH
                     YHSRYGSFLKFYRRVVSDCPVTRRLLEASVVFQDNTEYKVSSFPDEFNAWMLFRQIEN
                     VILANDLVSYGVLSVVCWEKMSLRSPVDIFCFVFGSASIAFALWSKFDAHRVIGDFAW
                     YWGDFFFLLDKNLTFDGIFQMFPHPMYTVGYAFMYGVPVMAKSYTLFYMSVFGHLCQL
                     AFLAFVENPHIDRTYNVLSSPTPEEQQRHAVLYGKGSEAYLEHNELVVLMHFDIFRAS
                     DLLLALTIIYLLATLLLPLPAWVYAVHVMAWRLFHNGFLGYLLKRESCEKWFSRNYAS
                     PQAAFNNWKRIYNASVTITNLSYCLCAVKYFTWAMPLFSSGEARCFVMIVGTLLVGIN
                     AYVSWSIYEAIGDYGYFYGDFFIENVPAKLNYSGIYRYLNNPDSSLGMSAYYGIALLS
                     GSPVMLVVAMMSHAAAKIFEAVVEEPHMRKRYGNQVREAGGMQAEFVRRMKVSKAEYD
                     KKMRAIKAKLECRKNQ"
     gene            complement(<1460058..>1462121)
                     /locus_tag="LMJF_31_3130"
                     /db_xref="GeneID:5654253"
     mRNA            complement(<1460058..>1462121)
                     /locus_tag="LMJF_31_3130"
                     /product="methylcrotonoyl-coa carboxylase biotinylated
                     subunitprotein-like protein"
                     /transcript_id="XM_001685253.1"
                     /db_xref="GeneID:5654253"
     CDS             complement(1460058..1462121)
                     /locus_tag="LMJF_31_3130"
                     /EC_number="6.4.1.4"
                     /codon_start=1
                     /product="methylcrotonoyl-coa carboxylase biotinylated
                     subunitprotein-like protein"
                     /protein_id="XP_001685305.1"
                     /db_xref="GeneID:5654253"
                     /db_xref="GOA:Q4Q5U3"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001882"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005482"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR011054"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR011764"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5U3"
                     /translation="MLRRTDRCGQRKVEKLLVANRGEIACRVFRTCREMHIRTVALFC
                     EAERNAKHVVEADEAVCIGPPPAVNSYLRGDHIISVAKQLNVDAIHPGYGFLSENADF
                     AEAVTRSGIEFIGPPASAISLMGSKSESKRIMEAAGVPVVPGYYGENQNVSFLAEEAN
                     RVGFPILIKAVSGGGGKGMKIVERPEDFAFMLESAKREAANFFKDDRVILERYVKRPR
                     HIECQIFFDKHGRGVFFFERDCSVQRRYQKVLEEAPAPHLSMEMRQRIGEVALQAAKA
                     VGYVGAGTVEFIFDTSTGDFYFMEMNTRLQVEHPVTEEVCRIKGAPLDLVKLQIKTAM
                     GKPLTFSQEDVALVGSCIEARVYAESPERGFLPESGPLTFIREPFQGVRGPTRTRLDT
                     GFCEGDNVLIHYDPMLAKVISWGRNREDALKGLRQALGEYKVAGINTNIEFLKRCCEA
                     PEFARGGVTTNFISEHEKQLLNAPAVTPKVAAMAATAWLLNRCDNWRGAFRLNGDTSA
                     TVHFYIDNRPVEVRLHTEGANYHKIFFSVWDHEGSFAVGSGPVTSKHRDQRSIVNGFT
                     FLFENGMRHTVLAVATEGDVTIIGSFGLHQIRLLPLTDGFGDASMAGGTSAKIVSPMP
                     GKVSKFLVNSGDFVEKGQALMIVEAMKMEHPVKALQDGQVSFLVKEGEVVGSDHVLAT
                     VVQKE"
     gene            complement(<1462685..>1463968)
                     /locus_tag="LMJF_31_3140"
                     /db_xref="GeneID:5654254"
     mRNA            complement(<1462685..>1463968)
                     /locus_tag="LMJF_31_3140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685254.1"
                     /db_xref="GeneID:5654254"
     CDS             complement(1462685..1463968)
                     /locus_tag="LMJF_31_3140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685306.1"
                     /db_xref="GeneID:5654254"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5U2"
                     /translation="MGKPPPTSATRASSSLLWRTTSHMVTLSFSALSLPLGSSVALMY
                     AVKPWGHVILVGGCVGTYAMGIGMRWRESNVTIVERRRSPAYERAEMRRCVLTDQTVK
                     LLTDLGCTEKKVLSVLRPACGWRFLSPDLIPLREGSAFPGCAIGESAYHCTEGVLLRT
                     LRTEFLRFGGTIDWETEAHSADANNDGSDTWCLRRDYGLSTNVEAIITMAKATPFAEM
                     LVARDPSRIAVLFDVERGVCKLESRDTSVLFDQQSDVSIVVGNGIALHCWRSGTGECA
                     WRLVRSATTHSSLDASLDGMHDVLKTVIQKSQQRSRSVCALPGTTPAIKDEAVRFRVG
                     LLGDGLLPIDPFEWRGDNARCMIEEASVVCRLLYGKKYHRGDVASLLRGAEQDSITKR
                     ANLLQRDLQDAEHFLAVHPLLESEPAARAMRRVGS"
     gene            complement(<1464193..>1464552)
                     /locus_tag="LMJF_31_3145"
                     /db_xref="GeneID:5654255"
     mRNA            complement(<1464193..>1464552)
                     /locus_tag="LMJF_31_3145"
                     /product="putative dynein-associated protein"
                     /transcript_id="XM_001685255.1"
                     /db_xref="GeneID:5654255"
     CDS             complement(1464193..1464552)
                     /locus_tag="LMJF_31_3145"
                     /codon_start=1
                     /product="putative dynein-associated protein"
                     /protein_id="XP_001685307.1"
                     /db_xref="GeneID:5654255"
                     /db_xref="InterPro:IPR004942"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5U1"
                     /translation="MNKANPSAAEREAHLQNVEDTLNRIAHHEGVLGYFIMEPQKGKL
                     LSFAGFRGSSREAHRYADTLKGFIDLTTSTVRTIDWKDEMTFLRISCDAVDILVAPDA
                     NKEYTMVVVQTVKGRCA"
     gene            complement(<1465014..>1469423)
                     /locus_tag="LMJF_31_3150"
                     /db_xref="GeneID:5654256"
     mRNA            complement(<1465014..>1469423)
                     /locus_tag="LMJF_31_3150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685256.1"
                     /db_xref="GeneID:5654256"
     CDS             complement(1465014..1469423)
                     /locus_tag="LMJF_31_3150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685308.1"
                     /db_xref="GeneID:5654256"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5U0"
                     /translation="MVQSIARVIGCSGPAAFAAHDSRTFFPADNGVVVVENGGEHLWL
                     PFPSGKYPIDKVAISSAGVLCVTEKRLRVTLHFFDVTSLHSLGCTETEISVSVADIVF
                     SADGTELFVLATVPDTAVSVFCRSTRDGAYSFADCVPLQHSGEPKSLLAGSAEEAVVR
                     FAICRSDGIVGYSHGDDGKRFQKCLFVEACVESACFSGPNMVCYATKEGSVHVYSHDS
                     QTSREVCKAPAAGGAAAMLALEDTAFIFTRSGALLSVDLADGTCCSLSLGCLPSCPGR
                     IAATSGGELLLSTQTGLLAVAVPTATSRGGAAPRLVKGWMEASTLKCLSVNGGALVAW
                     VLRDGSVALYERNAVRVFASGEARGPAVHACVLSASQIAILFEDATVVCFDCMGGKDV
                     WAHKCLECTPIFVEADGCGALACCGRDAVRFLSCLGDSVEDRGIVRATLLASICLARW
                     VPLETSLLVVCENGDAFLMEAPADGDAMTTHPAETLVRKSWRLDFPITDALVCYATPD
                     VLNLLVHSADHDSKVYTLDRQREGDVKVSRPLFLIHDHSSGGSCLLRLSDATVISCGR
                     DGSIAARDLTPYQVQMTPIPPSREKRKPLWIHAARSSFCGGITTAAIADAGAEVVCGG
                     DDGVMQCVALKAQGAQATWQEPEWTHAVRARLGTVEDEATAVQASDATPEREALLCEL
                     SRVRELWAKAMSEKDADVPLEAFLTPEQREQFAAECESAVLEMREGHYYHAILNEYLQ
                     DTIKRRCFEAMEVTRMKVVSMNTPGLEVHNFHIHRRTRAEASLSRKALFLRQLQEKIS
                     AGRRTPPGMQIVSKTATHVAVSPSGAEDFDTAMLNDADVYTQCRMVLQSLLVKGRSLV
                     LKDAFNACFTHLQDLKRQSVMQMEERTQRCITIGKQLGSLPAQLFSAVVDSEESPNSL
                     FVVEDKELGAEAQALIPPSKGTVVVSPVDEAALHLWMDGLEKEVERLEVHVPLPDFAD
                     DTRDTFVPPEERTEEQTRIVEAYAKRLKEENECVEAKREALRGEFKALQEKNQEAAET
                     LEEQLRQIRQLRLSTAEEVDEAELQLALLFQHRLCVSAAYRQHRSLARKREALRDGLT
                     VAESIAAQQKRTLTAAQARLTAAESKTDSYAASARVLSPFDDAATGEKLHRRFVRWQR
                     RFEDGKAPLPDADTPAPDCTAEQWAAFCDHCQTVAKLQQLVDGAEGEVQRAAEDFREA
                     QQRCKLIAHQIDVAGEEMDAVRESSVTRLLDVHALCRLHQGQIQDESATTATAFSSFN
                     LRWHDDVAQYNDLILQSDAESRALLNKVFARRKLMKLLEWEGERLRHCAGTLQLELRQ
                     LHTLRVTRQMQEWLNGEVDLSEEKTLAHIQRHMDLVETNMSRKVEELRSVVRQLKNQI
                     AERVTENTIIGEQCGDLDDTVRASGAVYRLVETRADGSHARAARATEIFVTSELEELA
                     RSQQEELVRLKHDVDRLRERTFPSFAVVSKQTR"
     gene            complement(<1470274..>1471563)
                     /locus_tag="LMJF_31_3160"
                     /db_xref="GeneID:5654257"
     mRNA            complement(<1470274..>1471563)
                     /locus_tag="LMJF_31_3160"
                     /product="putative protein kinase"
                     /transcript_id="XM_001685257.1"
                     /db_xref="GeneID:5654257"
     CDS             complement(1470274..1471563)
                     /locus_tag="LMJF_31_3160"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001685309.1"
                     /db_xref="GeneID:5654257"
                     /db_xref="GOA:Q4Q5T9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5T9"
                     /translation="MSAFSSVLGVPGTTGDVKYVKKKLIGTGSYGEAWLVERVSDKAI
                     FVAKTMDLGKMSARDRTYAYSEIKCLASCHHPNIIKYIEDKEDNEHLLIVMEFADSGD
                     LDRQIKARATDFKHFQEHEALFLFLQLCLALDHIHGHKMLHRDIKGANVLLTSTGLIK
                     IGDFGFSHQYDDTVSGVVANTFCGTPYYLAPELWNNQRYSKKADVWSLGVLLYEIMAL
                     KRPFTSTNMKGLMAKVLSGDYEPLPEVYSADFRDVVRKILVCDAVQRPSVRDIFRFPY
                     VREGLKVFMHTMKKNSRIDNEVKDALMEHVTEILSSESVVVPKSTPVGQINKDVFFSG
                     YLNKLKGGDNHSWKKRYLQVQKGHFIMSDKESDTEGKALSLEHIQSVCPVPVSTAKRE
                     HVFALHTTSGKSMWFEAASLENMEEWIHAIQCGLGVA"
     gene            <1473242..>1475149
                     /locus_tag="LMJF_31_3170"
                     /db_xref="GeneID:5654258"
     mRNA            <1473242..>1475149
                     /locus_tag="LMJF_31_3170"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685258.1"
                     /db_xref="GeneID:5654258"
     CDS             1473242..1475149
                     /locus_tag="LMJF_31_3170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685310.1"
                     /db_xref="GeneID:5654258"
                     /db_xref="GOA:Q4Q5T8"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5T8"
                     /translation="MSVVEEVYAEGRRSIQETRSSQAPRFCPSRTITINEPKRFFMLL
                     IGVYACICASISYVYNLFSGQLQQKYNFTQKEMSAITTMSNILGLVVFPLAGLYDYYG
                     PRPLFLIGMIILPLGEALFGLSFADAVDGSVVRFTIFSAFLGVGTSMFDIAGLMTILS
                     VFPSSRGAVIAVMKTFIGLGSAIFGAIQLGFFENNITGFFYFLSAFAAFVGFLCVLFV
                     EQPPYQLSGYEEKYLTEAEKAKKLSTKKAYLEKVPSPRRFKYGFVLVAFLIVLLPVQS
                     AVVAYMQLGHLYKVTFALITIGAMALYSIIAIPLRWLDVGSANIIEQLPEENETPEAA
                     PAVASERRMTAAQRLSMRINTTRTSIAEQAIFNAASIDESAHIAPQYQTSFFESVCTL
                     KLWALAYSLFAICGTQMVIIVNARFVYAAASETHTTPEVASLLTIFNGAGSAMGRILM
                     SIFEVWTQKRKPEERIPLTIALFIPSLIVLVASLMLLFVQKEWLLISFGLTALGNGFS
                     AASIVLVMRTLYAKDVANHYNCMSLSSLASSVLLNQMLYGNWYTKEASKQGSNICMGR
                     QCIFVPFAIMSGLLFTSLFSDLYVHLQYKKFCDEVLAERAQLRGARVSTPQTDEPDVL
                     DEHEPLLSSTN"
     gene            <1475649..>1475951
                     /locus_tag="LMJF_31_3180"
                     /db_xref="GeneID:5654259"
     mRNA            <1475649..>1475951
                     /locus_tag="LMJF_31_3180"
                     /product="histone H4"
                     /transcript_id="XM_001685259.1"
                     /db_xref="GeneID:5654259"
     CDS             1475649..1475951
                     /locus_tag="LMJF_31_3180"
                     /codon_start=1
                     /product="histone H4"
                     /protein_id="XP_001685311.1"
                     /db_xref="GeneID:5654259"
                     /db_xref="GOA:Q4Q277"
                     /db_xref="InterPro:IPR001951"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:Q4Q277"
                     /translation="MAKGKRSTDAKGSQRRQKKVLRDNIRGITRGCVRRMARRGGVKR
                     ISSEVYEEVRRVLKAYVEDIVRCSTAYTEYARKKTVTACDVVTALRKQGHILYGYA"
     gene            <1477827..>1480277
                     /gene="SCG5"
                     /locus_tag="LMJF_31_3190"
                     /db_xref="GeneID:5654260"
     mRNA            <1477827..>1480277
                     /gene="SCG5"
                     /locus_tag="LMJF_31_3190"
                     /product="phosphoglycan beta 1,3 galactosyltransferase 5"
                     /transcript_id="XM_001685260.1"
                     /db_xref="GeneID:5654260"
     CDS             1477827..1480277
                     /gene="SCG5"
                     /locus_tag="LMJF_31_3190"
                     /codon_start=1
                     /product="phosphoglycan beta 1,3 galactosyltransferase 5"
                     /protein_id="XP_001685312.1"
                     /db_xref="GeneID:5654260"
                     /db_xref="GOA:Q4Q5T6"
                     /db_xref="InterPro:IPR002659"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5T6"
                     /translation="MREENNVPAEWAPRDTHRLDPLQLLPPSQRHCGQSSAAESGEGC
                     HSRSRGKPEVHSTRASSGGKRSTGTLPRSDDCLNAVAQTPLFNSCGHPRRSAAQCLCL
                     HTRQRRLVVLAVLLALIVIVHWVIIEFTTNIDAQQKSSIELLNEANREYESSSPFSVL
                     VQHESAVERLTTAQRGLAASGAGSLARLDRDQLPSWTLRVIDEDCTMCFDNVTYASAV
                     AADAGRSTNKTGHHKQKGLSVFATTSAPLGLMGPMLFAMASVTDDVDVAAELPRWQWV
                     TWSYAQQRRFVHASQSRSTGERPRHLIVVGIPSTDQPMRYPLRDAQRATWLTYREVAR
                     TENNFTGALLQLYVFAAAEHDSEDSTHSAVDMVQLAPTVSEYAAATEQHLAVEGGDVN
                     NAPPYLQRRVVLRDGWRDIPRSDDAVWRSPCAGVRTTVVTAASLVAGTSSLAALSAQL
                     SLPVTPAFTAAAQYVCHASAALWQEALHHRNSLWLDFWTDRKPTTKKKMGMSISWGIP
                     TEVGMSQKTVLWLNYAYTAFPDVPYIMKGDDDTYLKVPQYLSDLRHVRGGWQKPRNLT
                     ATLPHRGVVPPTLAIDDAEECLYRVWWWYDNHNVVFGHGPGYALDRRLIKAVLNPFDI
                     TNQRLLMLLTVPYTLVYHGHYLSLLMQYEDLFVGRQLQSLSARVKEVCMKRPLRYVSD
                     REPRSLQVLRPAPSSQTWTWSSVLMHYAMPEIPYFIHYYFKHEFKVAEAAKGALAQGI
                     NASAIDANATKKMKEWVASQVPTVLTGLKRVKNVRWVRGAPRTAYVVAEGDGVAVYDI
                     AYRRRKTMLIECAIESGK"
CONTIG      join(FR796427.1:1..1484324)
//
DBGET integrated database retrieval system