GenomeNet

Database: RefSeq
Entry: NC_007273
LinkDB: NC_007273
Original site: NC_007273 
LOCUS       NC_007273            1604637 bp    DNA     linear   CON 18-JUN-2017
DEFINITION  Leishmania major strain Friedlin complete genome, chromosome 32.
ACCESSION   NC_007273 CT005269
VERSION     NC_007273.2
DBLINK      BioProject: PRJNA15564
            BioSample: SAMEA3138173
            Assembly: GCF_000002725.2
KEYWORDS    RefSeq; complete genome.
SOURCE      Leishmania major strain Friedlin
  ORGANISM  Leishmania major strain Friedlin
            Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae;
            Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Rogers,M.B., Hilley,J.D., Dickens,N.J., Wilkes,J., Bates,P.A.,
            Depledge,D.P., Harris,D., Her,Y., Herzyk,P., Imamura,H., Otto,T.D.,
            Sanders,M., Seeger,K., Dujardin,J.C., Berriman,M., Smith,D.F.,
            Hertz-Fowler,C. and Mottram,J.C.
  TITLE     Chromosome and gene copy number variation allow major structural
            change between species and strains of Leishmania
  JOURNAL   Genome Res. 21 (12), 2129-2142 (2011)
   PUBMED   22038252
REFERENCE   2
  AUTHORS   Ivens,A.C., Peacock,C.S., Worthey,E.A., Murphy,L., Aggarwal,G.,
            Berriman,M., Sisk,E., Rajandream,M.A., Adlem,E., Aert,R.,
            Anupama,A., Apostolou,Z., Attipoe,P., Bason,N., Bauser,C., Beck,A.,
            Beverley,S.M., Bianchettin,G., Borzym,K., Bothe,G., Bruschi,C.V.,
            Collins,M., Cadag,E., Ciarloni,L., Clayton,C., Coulson,R.M.,
            Cronin,A., Cruz,A.K., Davies,R.M., De Gaudenzi,J., Dobson,D.E.,
            Duesterhoeft,A., Fazelina,G., Fosker,N., Frasch,A.C., Fraser,A.,
            Fuchs,M., Gabel,C., Goble,A., Goffeau,A., Harris,D.,
            Hertz-Fowler,C., Hilbert,H., Horn,D., Huang,Y., Klages,S.,
            Knights,A., Kube,M., Larke,N., Litvin,L., Lord,A., Louie,T.,
            Marra,M., Masuy,D., Matthews,K., Michaeli,S., Mottram,J.C.,
            Muller-Auer,S., Munden,H., Nelson,S., Norbertczak,H., Oliver,K.,
            O'neil,S., Pentony,M., Pohl,T.M., Price,C., Purnelle,B.,
            Quail,M.A., Rabbinowitsch,E., Reinhardt,R., Rieger,M., Rinta,J.,
            Robben,J., Robertson,L., Ruiz,J.C., Rutter,S., Saunders,D.,
            Schafer,M., Schein,J., Schwartz,D.C., Seeger,K., Seyler,A.,
            Sharp,S., Shin,H., Sivam,D., Squares,R., Squares,S., Tosato,V.,
            Vogt,C., Volckaert,G., Wambutt,R., Warren,T., Wedler,H.,
            Woodward,J., Zhou,S., Zimmermann,W., Smith,D.F., Blackwell,J.M.,
            Stuart,K.D., Barrell,B. and Myler,P.J.
  TITLE     The genome of the kinetoplastid parasite, Leishmania major
  JOURNAL   Science 309 (5733), 436-442 (2005)
   PUBMED   16020728
REFERENCE   3  (bases 1 to 1604637)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 1604637)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR796428.
            On Jun 1, 2012 this sequence version replaced NC_007273.1.
            Data release policy www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1604637
                     /organism="Leishmania major strain Friedlin"
                     /mol_type="genomic DNA"
                     /strain="Friedlin"
                     /db_xref="taxon:347515"
                     /chromosome="32"
     gene            complement(<2384..>2788)
                     /locus_tag="LMJF_32_0010"
                     /db_xref="GeneID:5656524"
     mRNA            complement(<2384..>2788)
                     /locus_tag="LMJF_32_0010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685261.1"
                     /db_xref="GeneID:5656524"
     CDS             complement(2384..2788)
                     /locus_tag="LMJF_32_0010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685313.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656524"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5T5"
                     /translation="MLRFTIVRRLGSPTYGSWPWPSKLPLKKDWYYRLSRRESIADET
                     RQYMVVGDFLLLFVLGFSMYRVYVLNRSNSYQTHLCHLVNYPPAIIANEFDFNDMSAN
                     RVVERRDLDTYREDVVTCKRSGKPIESIIFNY"
     gene            complement(<3791..>5230)
                     /locus_tag="LMJF_32_0020"
                     /db_xref="GeneID:5656110"
     mRNA            complement(<3791..>5230)
                     /locus_tag="LMJF_32_0020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685262.1"
                     /db_xref="GeneID:5656110"
     CDS             complement(3791..5230)
                     /locus_tag="LMJF_32_0020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685314.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656110"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5T4"
                     /translation="MSALEEIAPARRAAKKAPWQSMPGAPTRPNFAHYGTRLAALAEQ
                     RRILIDEIKQLQSSVQNHAVTQARNAERNAFFEELNEIDERRKVQRDRRAVQDAEIAK
                     LRKHRGEISDKLRAVQAEVGGFTNVREIDEAIDYMMRKMESSGGGLGAERRNQQRLHK
                     LEDAKTHLLRLQPLADAIKQITEQEVILQQEYHAICEQIGILNREYEEKLQKKRAKDK
                     EAQADGANRADVYKQCDELRTRVSEITQSMDSLRAEREKVSSEWDAWNKEARKMYFEH
                     LEQQREKRRKEYEERRNAPKIAAKLARAAKRQNPYAAEISACSMLIEYLKQKKMMVQL
                     DEEDRKRREAAAHFDPSQMAPAGSVVVSDSKWSENKPLVKTAKKQRKHQQKQKENTPA
                     VKPSTAENDQKGRVLQHPEDKIRLFQMIEVDPALSLATIDDKIRHIETLKSQYESHIQ
                     TGELVLSSGDDEEGKEQAHDGADTPLQRL"
     gene            complement(<8977..>10080)
                     /locus_tag="LMJF_32_0030"
                     /db_xref="GeneID:5656111"
     mRNA            complement(<8977..>10080)
                     /locus_tag="LMJF_32_0030"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685263.1"
                     /db_xref="GeneID:5656111"
     CDS             complement(8977..10080)
                     /locus_tag="LMJF_32_0030"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685315.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656111"
                     /db_xref="GOA:Q4Q5T3"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5T3"
                     /translation="MQDHMFAKSGVPANGAGLGQNYYTRDLITEVPTIIQIVPVSSEA
                     LATQRSPPKGTSDTFKISLDDVEPTAGWLSDRNNASLDICFMHSFGKCYGKIREKDPR
                     TCHQIHVKRNVLDNLRKYYTNPQRNYFCRTMKANVTEKFAQVLSLLARRRIGLRYLEF
                     RTEDIEVTAGSTEYEVQYRLWLVSDVEPQSRSRAQAANILTDNFISSSNLCWDFALTG
                     RCCKGASCPDLHGHVAKALTKDRYVKAALAEMGKKDSLVPPTETTQPGKTPRVCQPST
                     SAPQQFPPPPPMPQQCASFIVSSPISPPYCFSSLPAASGMSAPSPNPTLAAFPLDMSS
                     LQGTPCFLVDKGSDNVFRLITQSQFASFGNDAS"
     gene            complement(<14800..>15828)
                     /locus_tag="LMJF_32_0040"
                     /db_xref="GeneID:5656112"
     mRNA            complement(<14800..>15828)
                     /locus_tag="LMJF_32_0040"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685264.1"
                     /db_xref="GeneID:5656112"
     CDS             complement(14800..15828)
                     /locus_tag="LMJF_32_0040"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685316.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656112"
                     /db_xref="GOA:Q4Q5T2"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5T2"
                     /translation="MFAVTEDCVEPTKGWINREGKPLLTVCFMHSFGKCVGRTSSNPA
                     TCFQIHIKANVLNALRKHYTNPTRRFFTRTVKAMLSPELRRLLCMRAHKEFKVQYLEY
                     RVSDIFPSTGLLQYEAAYRRWLFSDDTNAEHAGTITVLQCLQFSMTGSCDSSTDCPYI
                     HADLKKAQARDPMLARALRDVSDANQGLPTVSIRVPELLPAGHSSTICPADATYATLT
                     DGANLQSGMPSDPARDFTKVPAFTLVYGEGESGGRCVPLQMHQRESSSSSAGGHANST
                     YPLSHVPFINQDDPASEMTAAKSQPTSGKNEKASVSGKSGSGWVNNSNEGAGSINNHT
                     GSCGSGTD"
     gene            complement(<18267..>19268)
                     /locus_tag="LMJF_32_0050"
                     /db_xref="GeneID:5656113"
     mRNA            complement(<18267..>19268)
                     /locus_tag="LMJF_32_0050"
                     /product="putative protein transport protein Sec13"
                     /transcript_id="XM_001685265.1"
                     /db_xref="GeneID:5656113"
     CDS             complement(18267..19268)
                     /locus_tag="LMJF_32_0050"
                     /codon_start=1
                     /product="putative protein transport protein Sec13"
                     /protein_id="XP_001685317.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656113"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5T1"
                     /translation="MLPHLSNGAAAPAAPQVPAVQEHTDVVHDTQFDYYGLQLATASS
                     DRTIGIHVARAGAPLNRVATLTGHEGPVWMVSWAHPRFGNLLASASYDQKAIIWKEIR
                     QGAPKWTPVHVIDIHHGSVNAVQWAPEEYGPVVATASSDGTVAITAYRDGCWQPSVKL
                     SNNSNQIAHAMGATSVTFAPFKSELADHVVVASGGCDGHVRLWVSASSPERGLGFELH
                     QVIEAHADWVRDVAFCPTSPASRFVILASCGQDKTVVMYRKPWDQLCAETSEGVSQAT
                     EWERSVIEFAEPVWRLSWAPSGEMLVVTNAKSEVFVLREGVDFTEPWIKLPLKDFQQ"
     gene            complement(<19988..>21139)
                     /locus_tag="LMJF_32_0060"
                     /db_xref="GeneID:5656114"
     mRNA            complement(<19988..>21139)
                     /locus_tag="LMJF_32_0060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685266.1"
                     /db_xref="GeneID:5656114"
     CDS             complement(19988..21139)
                     /locus_tag="LMJF_32_0060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685318.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656114"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5T0"
                     /translation="MMTHPKLLPSQELVLHQVSVDSFSPATASVLKFPASPLLPRSPF
                     SNTCAGKTSETTVPCSPLNDSSTIAASSIVRPQIRQRDEWESSLVDVDAFVLGPDCLY
                     TSSFDRREPVSVRYIADKLDRAWLSRRPVLAIRRDDGAVSAVRGKTGGAGSHMPILSN
                     LSTSVLEDTFTALELAAHGHSELPLERLLLYARPFLGEKDVGEEVLEELTAYWLLRRS
                     GTGGLLPGIPDLRVTIREDNELTLCHPAVLRDCPLPFKQRDWYVPVVERRRPAPVGDA
                     PSAKRPRAEALPGSSSTRSLVAQLQACEAYAVKAVCLSRAMLRREETRQAHTQMTVYE
                     LASLRSIVEEARDDSDVVGASLPASALSRCLVAFLPPTDRDAWLDPQTQ"
     gene            complement(<21981..>22718)
                     /locus_tag="LMJF_32_0070"
                     /db_xref="GeneID:5656115"
     mRNA            complement(<21981..>22718)
                     /locus_tag="LMJF_32_0070"
                     /product="Qa-SNARE protein"
                     /transcript_id="XM_001685267.1"
                     /db_xref="GeneID:5656115"
     CDS             complement(21981..22718)
                     /locus_tag="LMJF_32_0070"
                     /codon_start=1
                     /product="Qa-SNARE protein"
                     /protein_id="XP_001685319.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656115"
                     /db_xref="GOA:Q4Q5S9"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5S9"
                     /translation="MRLTQLANCQSVFDDQTAELSELTQMVKSSLQRLHNDAATLEEL
                     KRRAVESQKGSIQAKGDARGMFGSSCNHLRTSEKHSDTVVETLRSRLARTGQQFRTTL
                     QHQSKSLKNTANRRHMFTTADRPQTFESALFQDQEQHQQQQLLLSGMGNTQYYQQRAD
                     AVLEIEAAVQEVGELFNDFTRLVQEQEEVVLRIDTDVDTAVRHVNAGSNELMRYLTNL
                     SSNRGLILKVFAMLFFFLMLFGSLVVR"
     gene            complement(<23830..>25095)
                     /gene="NMT"
                     /locus_tag="LMJF_32_0080"
                     /db_xref="GeneID:5656116"
     mRNA            complement(<23830..>25095)
                     /gene="NMT"
                     /locus_tag="LMJF_32_0080"
                     /product="putative N-myristoyl transferase"
                     /transcript_id="XM_001685268.1"
                     /db_xref="GeneID:5656116"
     CDS             complement(23830..25095)
                     /gene="NMT"
                     /locus_tag="LMJF_32_0080"
                     /EC_number="2.3.1.97"
                     /codon_start=1
                     /product="putative N-myristoyl transferase"
                     /protein_id="XP_001685320.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656116"
                     /db_xref="GOA:Q4Q5S8"
                     /db_xref="InterPro:IPR000903"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR022676"
                     /db_xref="InterPro:IPR022677"
                     /db_xref="InterPro:IPR022678"
                     /db_xref="PDB:2WSA"
                     /db_xref="PDB:3H5Z"
                     /db_xref="PDB:4A2Z"
                     /db_xref="PDB:4A30"
                     /db_xref="PDB:4A31"
                     /db_xref="PDB:4A32"
                     /db_xref="PDB:4A33"
                     /db_xref="PDB:4C7H"
                     /db_xref="PDB:4C7I"
                     /db_xref="PDB:4CGL"
                     /db_xref="PDB:4CGM"
                     /db_xref="PDB:4CGN"
                     /db_xref="PDB:4CGO"
                     /db_xref="PDB:4CGP"
                     /db_xref="PDB:4CYN"
                     /db_xref="PDB:4CYO"
                     /db_xref="PDB:4CYQ"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5S8"
                     /translation="MSRNPSNSDAAHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVAD
                     IPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALC
                     PPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEP
                     RHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYF
                     HRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVR
                     RILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIG
                     NSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKF
                     GAGDGHLRYYFYNWAYPKIKPSQVALVML"
     gene            complement(<27331..>28245)
                     /locus_tag="LMJF_32_0090"
                     /db_xref="GeneID:5656117"
     mRNA            complement(<27331..>28245)
                     /locus_tag="LMJF_32_0090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685269.1"
                     /db_xref="GeneID:5656117"
     CDS             complement(27331..28245)
                     /locus_tag="LMJF_32_0090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685321.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656117"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5S7"
                     /translation="MGGSSDTIGVRTKHDREEEERDRKLMERIMKENQNPFQALVDPL
                     LEQASYMYNTYLYASGVMFLTLAFWGAYPSFVRFRHAHIFRYRRRQLSFRRGLFATEH
                     MPKWNKNRLQRIVVPPLPTFDLVAVDSAAASPVHPTLFSCSAATGNVSVVAAADTTVT
                     TGAASNLDRRFDVMELSATRTSHGSFGAGDTEKSERALIRELQRINRDFFGPQSQLFY
                     RAIPEHAATGDLRQRLKAAVATAKAVVVLVENHSTVRSIPEGWEVWWVSEPEARRRRF
                     CKFWLGGLLCARAFQDLMDMPDMPDFIN"
     gene            complement(<31196..>31891)
                     /locus_tag="LMJF_32_0100"
                     /db_xref="GeneID:5656118"
     mRNA            complement(<31196..>31891)
                     /locus_tag="LMJF_32_0100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685270.1"
                     /db_xref="GeneID:5656118"
     CDS             complement(31196..31891)
                     /locus_tag="LMJF_32_0100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685322.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656118"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5S6"
                     /translation="MADGPPRFFTKPEEYVGVNNHRRTLFLDMDETLVHCYFEKPTFF
                     IDTNEDFFQFTLEDDPSVTYYAFRRPGLNEFLYQCAEHYDMRIFTAGEDLYARTLLRW
                     LLPDNLIDESRWYTRDACVGDGYGRLIKNLSMLDGFQFEERATLILDDSAPDNVYPHQ
                     NALAIPRFAPQTGHTDEENYGRMQADRGLEMFGRMLCGEHFTRCDDVRVPIARFYALI
                     RTYTRSSTAKSEM"
     gene            complement(<33707..>34642)
                     /locus_tag="LMJF_32_0110"
                     /db_xref="GeneID:5656119"
     mRNA            complement(<33707..>34642)
                     /locus_tag="LMJF_32_0110"
                     /product="putative mitochondrial carrier protein"
                     /transcript_id="XM_001685271.1"
                     /db_xref="GeneID:5656119"
     CDS             complement(33707..34642)
                     /locus_tag="LMJF_32_0110"
                     /codon_start=1
                     /product="putative mitochondrial carrier protein"
                     /protein_id="XP_001685323.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656119"
                     /db_xref="GOA:Q4Q5S5"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5S5"
                     /translation="MESLVAGACAGLFVDLSLYPIDTVKTRLQSKEGFLAAGGFSNVY
                     KGLSATAVGSVPGGAAFFFGYDIAKRSFLSLAAPSGAASRIEATSITITPSVMACQAA
                     AAVCGECFACCIRVPVEMVKQQMQAGHHATITSVLRNVTNNTATPVVVPRDSAAAVPS
                     PPIRLSGMHHLFRGMPIMLMRELPFSVIQMSLYESLKAEMHASTDHSYASLSLPFCGA
                     FSGGCAAFLTTPLDVLKTRIMLFRGGPGQENVSIRYVLDELIREPARPGDRFGYAQRF
                     FRGASTRVLWISLGGSIFFGTYEFVKSGFQSVHTL"
     gene            complement(<36562..>39792)
                     /gene="MRK1"
                     /locus_tag="LMJF_32_0120"
                     /db_xref="GeneID:5656120"
     mRNA            complement(<36562..>39792)
                     /gene="MRK1"
                     /locus_tag="LMJF_32_0120"
                     /product="putative protein kinase"
                     /transcript_id="XM_001685272.1"
                     /db_xref="GeneID:5656120"
     CDS             complement(36562..39792)
                     /gene="MRK1"
                     /locus_tag="LMJF_32_0120"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001685324.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656120"
                     /db_xref="GOA:Q4Q5S4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5S4"
                     /translation="MTGRFTRPQWSLATGRHYASSGHSAASSCSTHTLKVNQTESYRP
                     GPDDSGTYSANLRDSPSRTMSNTSVSVSPMDSSSPQEWGRSFRLFNSCRFLTSASGSR
                     QRDGSIGQLYRSTFLHGRQGRGSSIGPEAERPLLGSSMVHQPQNSFFGTFSGQGGRYS
                     FWPPDVNASGVLTAASPYVASNPSAPVSTASPLLSSSRFLGTGISPRGLADGHAVHRV
                     VASCAMGSVVCTVSPGQNELPLAMNALRTHIALRGKTIIQGDAAHPLDIRKGPLIGAG
                     GFAKVFAGVDTIRGELVAIKEIDISRVDDVKALNAIEAEFALLKSLHHPNIVSYSLFE
                     HSKSQKVCRIAMELLAGDSTLHLLQKFGPLTEAVLRIVARSVLRAIRFIHKEGIFHRD
                     IKPANILVSHRGEVKLCDFGCSKRVSELNKAASCIIGTPVYMAPEFIKGEANHKADIW
                     SMACALFELSTGLLPWYHSGVKDNLPLMFYLTTTSESPMVLPSPEAKSEFSAEFFSFM
                     ELCFTRNVANRPEADDLLKHPWITGSRLAPVPNLPSAVFSLHQESSAVLRAFGSPGKS
                     STFSSPRDSAADRDDMSFNGSDGLQKSVSTTPTLNPAEEEMACQQELETVAAATALEL
                     CSLLVCSLEIPPRTAQETVTGEVGSGTGDTSPSLTRTFSIHSPALSHRGGGVSASVAE
                     FLSPVYTPEHSMVHENFYYSQVPLGASAGNFVLPPGLDLDGAPPQQQYLRINEEGNLD
                     MVHLPGDEMEDSVHGRSAFGDSAHGSFHAGRIVSPARNSSFSRGALSPRVATGPNAMG
                     VADGPFSPLLGISGVFSRRESPSRAGPSAPSSPQGIPAPPLLCRPGPPTTFVSQPCSH
                     TGSAHTSHVSPTSASKTGSNLDAVTPRTPRSNSPTSTQRSESFRGLPEKLKAHADGKL
                     HMSFSVNTAPGCAVNVELNVDVADVQCKVVDNQPNFVVAFTDDVRSQIANKIKEVAEH
                     SSSGMPAQTAGAHASSLSPSCGMEAHRSVSAGGGHFYNAPLFASASKATPRPLSHVST
                     GSAQRLVAVPRESLAGYSPYSGEEGSDMDSHTSSPMAAGWNERMDK"
     gene            complement(<42411..>43130)
                     /locus_tag="LMJF_32_0130"
                     /db_xref="GeneID:5656121"
     mRNA            complement(<42411..>43130)
                     /locus_tag="LMJF_32_0130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685273.1"
                     /db_xref="GeneID:5656121"
     CDS             complement(42411..43130)
                     /locus_tag="LMJF_32_0130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685325.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656121"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5S3"
                     /translation="MPTATARDLSGKAPLFVYLQGGERERLPSGEYIRVVAQCSGADK
                     MVNRHDFALHIRGARLCRLLDSLLDSVDVDLKRKIDPVQGLIPPVILPHATREGCECV
                     FRYLELIQTRVPTLLSKPLRAPLEELVCEWEMAYLLEDCFLPGVEDDTKTSAALCHTL
                     AKRGPQTMDRVLEVAMLADFLLIEPLRDLTCALLASLALSAGSEKELLRLCGLDHVLT
                     EEELEPLYMQLPFLRSEDGLG"
     gene            complement(<44555..>47683)
                     /locus_tag="LMJF_32_0140"
                     /db_xref="GeneID:5656122"
     mRNA            complement(<44555..>47683)
                     /locus_tag="LMJF_32_0140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685274.1"
                     /db_xref="GeneID:5656122"
     CDS             complement(44555..47683)
                     /locus_tag="LMJF_32_0140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685326.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656122"
                     /db_xref="InterPro:IPR000225"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5S2"
                     /translation="MKTVGCEIASLLEVLSGSEEAAICPLASFARDIRSLVDTGQVDD
                     LGNVLAQRSAELAKEEEKLNASKEMISVTYDKLRAETTRVEAQMRSQERRLQEVSQQK
                     KLCKLALNLYLAGEVPSLVDADGMAVPCASPGLPDMMKRGAEDGGEEHPNKAAPEPAP
                     MKNSLTSRPHRPVQAVGNDGGGSPKNGASMVSPRSGLAALTSDGLLALLRLPDVKESV
                     LLNSIEGYTQQHLEKNSNWMAAQSYPDILAVMMAVLSHLSEPRPPVQLAELRLLGYAL
                     QSSPAPRQSGNNNNLFKILDTLVRDGRAVPILTNLLNSVNDDVKCEVLEFLAPLVCET
                     HALINAVASNALSAFARKEFLAANGLEPLVNIVIVSTSEAVLERALIFLWGLLTKDEK
                     VEHGGSADASIRSQVRELGGLRAVLDLLYTDSLPILENVSMVIGYITREDASKKEMRE
                     IGGLEKITATLRHPSDSIKTKMAGAVWNCASNADNRKHLRELGAIPALLELLRCPSST
                     AMDNSTYEFVRENAAGALWNLSVETESKTQIIEYGGVPVLVEVMSSSNSVAVVENASG
                     TLWNCSATAEARPILRKAGGIPVLFSLLNHRKPIEPSRAIAVKSTMPLSEKIIDNAAG
                     TLRNCAINDQNKPAIRECGGVELLVAKVKEAYLSTSKRNSADKTPLPLSPSTVDKLVS
                     TLWILTTSPEIKHSVRYAGGIEAFTSILEMSSPSIAGGSKAAGKGASLFAPLRMPTAT
                     SRLGVEAFQAAYSASAIGKLPFATPSLSVPMSVKEKLVGVLRNCSTVAENRPAMIQAG
                     CTRCLVAVVLDCYASSSLFQANAATHKNSRFQEPSTQLKETVASALWHLSRDDKETPR
                     AQGGLELMCMLLLSPQQPSVVLEQAAGALSSLTVNNNENRDAVRTHGGLSALIRLVSE
                     YPQGNTGSRVGKSDVSSHTYATLNALLTIRNCTVNSDENVRACYEALTDKKSALGSAL
                     LYMIEHGSEECAKEAALTAKNVCFIPAAASYFVQNNGVALVTSLSERASSDSVRRAAA
                     SLLQVLSKAAKK"
     gene            complement(<49013..>52012)
                     /locus_tag="LMJF_32_0150"
                     /db_xref="GeneID:5656123"
     mRNA            complement(<49013..>52012)
                     /locus_tag="LMJF_32_0150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685275.1"
                     /db_xref="GeneID:5656123"
     CDS             complement(49013..52012)
                     /locus_tag="LMJF_32_0150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685327.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656123"
                     /db_xref="GOA:Q4Q5S1"
                     /db_xref="InterPro:IPR006709"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5S1"
                     /translation="MVRRSEVTRGDKKGRRKGSKLARGRGDDEERQQPGKLMLNNPLI
                     PSELDEDIDDDLAFNSEDERLYGDFFAEKVSTKPKLSKKKSSARPSRGSAEHDDDDDD
                     ALLEDGLAVVGKSERCRSPCKGARRKDSRRATAEADDDVDTDHKDSRSSGDDEDYIDL
                     SDMLDMSIKADKKKKQARVKKATRMTESGTKVAKKRRASQLTDEPESVFGLADASASG
                     GTTSYTGAMQRIMQQRETSTDHDMDAVRDRIKRSHQSKRNLVAVDVDDLTKDRLTRKE
                     VRAIVDETMERYTPVLKELDSAKHIQFPMHLPDSTPVASSVGGIVAAADAQFRSDRAV
                     TPALSNSSAYRFGSKMDALLSKAGLSRRQVGDGADTPNSMGNYVKFDDVVADGAQRQG
                     MEDGEAPSSGYVAKLKAMLAYENSRRKRLNRIKSKTYRRILRKEKDREKERRQKAFEL
                     LHPELARQRLAERLLKARIEERVTQKHKNTSAWVKHAKRFAQFDENTKDAIDDQHATH
                     QRLMQKMEQDAGEENYERYVAGDNESEASSEEERTVDALIEKVGASGGAPLSRQDVKS
                     ILWSSVDAVETDENAAARTMTSPISRARTELREMKFMKNAREREEKDYEDQLEALRRD
                     IEAHHREECAGSETQGEEAEDGTGPTRKTSSSAAQPSAAAGRVTFKKGKKSGSVERIQ
                     LRRQSGICIEANDHGAESSRDESEGVELGSVVSASSAEDGGKPSPVAARDTGGRLKAQ
                     GPAKEKTKRATPSALPASEFAGARKDAPLERGLPVNKATSTRVTILPKKRARPGEDAA
                     AEESAPSASTLVDSASVPEEDLRLNQEYLLSRAFAQDDVDEDFVKEKESQVETIMRPE
                     DKNQSLPGWGEWGGEDPELNKRHQEAVLHQTTQRQIEKSFLLKSRADAALEHVIINHD
                     GVELVPNRMTLHMVPRPFSNPQEFARSMRQPMGPEWTSALTFKEGVQPRVEVRQGQSL
                     LPLDLSLRKPKAKTKRRKIEAIPAGTS"
     gene            complement(<53073..>54233)
                     /locus_tag="LMJF_32_0160"
                     /db_xref="GeneID:5656124"
     mRNA            complement(<53073..>54233)
                     /locus_tag="LMJF_32_0160"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685276.1"
                     /db_xref="GeneID:5656124"
     CDS             complement(53073..54233)
                     /locus_tag="LMJF_32_0160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685328.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656124"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5S0"
                     /translation="MDAYCRYVMAVEEVPVPPSAPDAASSSHRSGLLRSRSTKHGTGH
                     SDKSGGALSAALPPSPSLPPSRPFKRFKQGKRMADKRLPRASLDAALPAGGAGAHERL
                     VSAASVQVPSSDALTTAMRQAPPSLFGDNAESLPHAERSGVRVMGIGDSIAQLGGSEM
                     ERKHVVKASLRSGGVVLAVEQDRLWSTERARVLPMFRDRRKDGVVCRVEPPPGSGADA
                     AMQDNESVAPAEAAAKDGAEQPPRQGRGTRQRASAAAAAEAKEAMLAREAWISSFYTT
                     ADASEEIPLQDQVQVNPSAGVTVMAANGSASASPALRRSNKAAAGNTVVASGGPFVVP
                     ADRVALSSFDDKRPAARKGNGGLARTQQPSRNTKRAARLGKATLSGTASSGH"
     gene            complement(<55705..>55980)
                     /locus_tag="LMJF_32_0165"
                     /db_xref="GeneID:5656125"
     mRNA            complement(<55705..>55980)
                     /locus_tag="LMJF_32_0165"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685277.1"
                     /db_xref="GeneID:5656125"
     CDS             complement(55705..55980)
                     /locus_tag="LMJF_32_0165"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685329.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0165"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0165"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656125"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5R9"
                     /translation="MLRTTRFARCASAAAGKKFSFSEKMQRLQADPEHALSGPEYAFM
                     RDRLAEYRKLQQTYAVKQTETERARKAANMCGLEFTGKGSVRKAPSS"
     gene            complement(<56686..>57612)
                     /locus_tag="LMJF_32_0170"
                     /db_xref="GeneID:5656126"
     mRNA            complement(<56686..>57612)
                     /locus_tag="LMJF_32_0170"
                     /product="putative U2 small nuclear ribonucleoprotein 40K"
                     /transcript_id="XM_001685278.1"
                     /db_xref="GeneID:5656126"
     CDS             complement(56686..57612)
                     /locus_tag="LMJF_32_0170"
                     /codon_start=1
                     /product="putative U2 small nuclear ribonucleoprotein 40K"
                     /protein_id="XP_001685330.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656126"
                     /db_xref="GOA:Q4Q5R8"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5R8"
                     /translation="MRLTMDLVRLAPQFTNTMLQREIDLRGLRISSLDEHVLVLLENN
                     FDVVNLSSNALTALEYFPTKSAAGSSDKDVRMSRVTTLVAHRNEIQRVSVASCVSALP
                     NVVHFLADRNRLACVRDLYFLKQWKKLEVVSLEDNPVWETNSSNFDSEKLQAFLVFLC
                     PRLKLINYQRVTQADRERAQKAKDEFKKLVQSWEAPLTLCAVTQSQPSSTVDGKKMRK
                     RGREGRTAAAAAVASNVVTIDDELLNGATSATPAAADVNEDDDVALQARLDQLEERLL
                     SDDVTAEEISQLEEEMTEISERMAAARKRKRH"
     gene            complement(<58334..>58684)
                     /locus_tag="LMJF_32_0180"
                     /db_xref="GeneID:5656127"
     mRNA            complement(<58334..>58684)
                     /locus_tag="LMJF_32_0180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685279.1"
                     /db_xref="GeneID:5656127"
     CDS             complement(58334..58684)
                     /locus_tag="LMJF_32_0180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685331.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656127"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5R7"
                     /translation="MSAPEGTASALTAKPRRSVANYTEPPKKNPYLVKLSRFYSTKIP
                     MGVREFVFTGPLLLITFGVAYFIPSLIPAEQFTQGLTPHKQDMREYTLEPIYGAHGEL
                     KGYRRINTARSAEE"
     gene            complement(<59600..>61906)
                     /locus_tag="LMJF_32_0190"
                     /db_xref="GeneID:5656128"
     mRNA            complement(<59600..>61906)
                     /locus_tag="LMJF_32_0190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685280.1"
                     /db_xref="GeneID:5656128"
     CDS             complement(59600..61906)
                     /locus_tag="LMJF_32_0190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685332.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656128"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5R6"
                     /translation="MYAVSVSLGASSSYVTVAPVSSTTSTAAVSDAAPIKVIANSSGH
                     RNTPVVAALTGQELLFGDNAHHQYSRQPQKVVPYLFAYAAAAASIADAQHVLGTEAEH
                     AAESEETTSDLLRVVEAAANQKYKGHCRLTQAASGTRQLGFEYTSEPDGELVESFISA
                     EDLFIRFLNYIKEHSVDGACGLTTTTGGDEATSSSAKLFLTLVVPRYAFPGAADSAHV
                     AHRGRTVEWLKEAVQSSHLGAVVLNTSVVFSDEAAVTAYDAATQERRVPRLLSTEPHN
                     VLVVDWGAHGLCLSLLCTRGGVLVCPPQHHNVPYRCFTKGSVAVGDGYFAVGAGSGGD
                     ALDVALAERVAAQYMTQQRRLFASPSRNFNALLHLNHALPTIGSTEHPATGLLHEAIP
                     SRAMRRLALLMAEKKVSLNTNPQATSVSVEAEAFYEGMDLIDTQTLTKNKLDNALRSE
                     WGLLDMFSKAVRAFADKYKDTWTEGFVDTVLLAGGMCQMPSLTRLLAASVQSPDQRWL
                     FAAAVRVLDSSLMGNGVCADELFSVGGCHHSCRVAECYTMQRLAMSRQSRKSAGKMQA
                     VVAAQAAETATSVWDALTKDDDDESSDGEDGQQETLMSDPHSGVFLAGNVYLYVGDTT
                     ALTCAATQQLPCASLRVLLAHSAALPCRVAIPWSPTSPETRTVLYLFTDAHGAPSTDS
                     AADLVEVRPVNSAGLVLHAAASPACGGALGPLCLTFTAQAKWNEVSEREVHVSVQLVR
                     VPSVGGADIASLVLTPGVLCSSYEFVLQ"
     gene            complement(<62752..>63837)
                     /locus_tag="LMJF_32_0200"
                     /db_xref="GeneID:5656129"
     mRNA            complement(<62752..>63837)
                     /locus_tag="LMJF_32_0200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685281.1"
                     /db_xref="GeneID:5656129"
     CDS             complement(62752..63837)
                     /locus_tag="LMJF_32_0200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685333.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656129"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5R5"
                     /translation="MPSTSVHHMLNELVDLSHSIAALLEQGQVLSLTAAPSAADRQQE
                     ASLKTQEIERIVRRVEAHFVDRIQSLETLNASLSEEVRQLRGALATQRTNGAEGRANV
                     VQDIRGGDLQEDSKTLDACERASWDEPGNGAASSEVEHLRRVLMAEKRQRLRVEEQTQ
                     SLTEQHAKVVGTLERRLKKQEEQLYDLIAAIDRGYGGGSVTTSASPTRCTERGSSHRL
                     PTPRHLLRQQLAQHQQTQRALQQYKENLRLEPPSPAGSDEVSATMKELGLDDVRRTLE
                     LIRSSKPLTVQEHHHDQEETHTAPAVCSPPHTARDGPAVVHSPRVCSQVPPPAADRAA
                     CTSGTEVDEITAFLENITKELESLDSQ"
     gene            complement(<65052..>66686)
                     /locus_tag="LMJF_32_0210"
                     /db_xref="GeneID:5656130"
     mRNA            complement(<65052..>66686)
                     /locus_tag="LMJF_32_0210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685282.1"
                     /db_xref="GeneID:5656130"
     CDS             complement(65052..66686)
                     /locus_tag="LMJF_32_0210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685334.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656130"
                     /db_xref="InterPro:IPR013719"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5R4"
                     /translation="MSIPLENWGQLKLSVAKPELKSEDGGDVKRDECVLELLALPKGK
                     AKDNPNYVPRPILSIPISAIASASGTTKNDVSLTMRPAATAGAEDLELRSIRFAVPNV
                     CVGYEETEMAGKVILQDIQSSMMQYQEQFLQRHGSGGQGGKLLALAAMGSGQAKHTDE
                     VVVATFDDVLLSYPSGKYKIVISNYNVVLEDKKKGTSSGLLSFSLSEIQNLFLCDVPV
                     YFSPTEEVDANSLPQYVVLILKNPLKIRSTAYNHVVISCPAGLTLDEEHPWRCELKTQ
                     DEINKTLQLPPSKEGEEPPLVPTMSGRVSDILTRTFKAIAKVPAYGGINKEYKSVLTS
                     HSQSSMRCLFHGAEGLLYIVNSGFLYLHRPATRILFNEVARVELDESESGQATFQLTV
                     FATGAKGDDKYVFSGIAKEEKNGLLSYLATKVKVVHTGGDAMESDDDDEKDDTSDEDE
                     SDDSDYDDSDTEDDDSSDDGGDHDSSRKRKREDKKHEKDKKHKKDKKHKKDKKHKKDK
                     KHKKDKKHKKDKKHKKDKKHKKDRKHKKDKHEKSDA"
     gene            complement(<68694..>71774)
                     /locus_tag="LMJF_32_0220"
                     /db_xref="GeneID:5656131"
     mRNA            complement(<68694..>71774)
                     /locus_tag="LMJF_32_0220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685283.1"
                     /db_xref="GeneID:5656131"
     CDS             complement(68694..71774)
                     /locus_tag="LMJF_32_0220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685335.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656131"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5R3"
                     /translation="MFTFSCQCQSCRGNLVATEKEFYFTSSLFRIDLGWGNVKRIRLE
                     TQQVKGVPTSVLVVVLQHNESIKMQASSPSAQKKRLLSSRKYFFYDFHDLLGAEEQMK
                     RLLEQYRASEKAKKDEARDDSEKGSSATTKQQTGKPGEKDEVSTSISGAPKDESLNNT
                     RTTTNRNPDSDARRTALGLPLAGRRAPPSSSLRPKLSGKLVSIPVASASKVQSGKYAR
                     LFLKFYRHVAAVLIVVMLALLTRHYTHFDDLHVQSPLQRAEKLLRDIHALSDVNARLE
                     SYDSHETLRQYNKRRKDLAEESRTFTHQLEQAAMKLMGRYVALQAKMATLRGHRAQRV
                     AHEQQRGTPSPPPPSTMSTVFGTPMTAADRARLFSQRGEACQARAGDGGAAKTGAGRC
                     GSSGAARKKAAKRRVAPLKSMSLLRLKSDVQRWARRAQSAWHYAISFIFEPPVRPSTH
                     PAPSAGEHHGSAGEAAWTVYTEKMGEYFRLTEWVSAAEHKDRLSCLQLTQELLETVEM
                     TERVFATFSNVFLMDRYRKLESGEERASHWMQPPQALRTVTGDNKYYAANAFSSEEVA
                     HVAMLRRFVGSLVHSEPLEADQPRRRRMALRVADAMLSYRESEVQLLRARNQGRPVNA
                     TELWRVLEEKVLRPATMPLRENPDIDNSTVYLRNPIAELRFWHTHEAAWREHVLSFFS
                     PEEQAEIRSSLDTDDHSHQSLVDLTTPPVELQWVNLPLFRGLLCFEGTSHLQGSASEV
                     ADDAAGDLAHASEDEDNGNADETASDIGEDNTEESPSNTSSDRASTRPHTPVISAYLL
                     PAPPTHRTASTTKKMTPSNRTNTATSRSSKTPETPPDVTASPHAQSSRAEDLWKEVKL
                     RWMDDLNVFRLAFDADSAGRSAHAAHLHCTDNDERGVVADAAEVHCRLSGILSLINEF
                     YVRYLTPTALQRFAAFLRVLFPPYFQSHSSREVYISALRSWGAQDPAVQLAIAQVTGF
                     APGTTSDVSRSLLYIVLQPPPLLQASVVSARHTTVAVMVLVLFGGVLTALYMMQ"
     gene            complement(<74108..>74383)
                     /locus_tag="LMJF_32_0230"
                     /db_xref="GeneID:5656132"
     mRNA            complement(<74108..>74383)
                     /locus_tag="LMJF_32_0230"
                     /product="putative dynein light chain, flagellar outer
                     arm"
                     /transcript_id="XM_001685284.1"
                     /db_xref="GeneID:5656132"
     CDS             complement(74108..74383)
                     /locus_tag="LMJF_32_0230"
                     /codon_start=1
                     /product="putative dynein light chain, flagellar outer
                     arm"
                     /protein_id="XP_001685336.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656132"
                     /db_xref="GOA:Q4Q5R2"
                     /db_xref="InterPro:IPR001372"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5R2"
                     /translation="MYNNDHKATVKNADMPEDMQADAIEVTLQAMEKFNIEKDIAAYI
                     KKEFDKKYQPTWHCIVGRNFGSFVTHDTHCFLYFYLGQVAILLFKCG"
     gene            complement(<75408..>78665)
                     /locus_tag="LMJF_32_0240"
                     /db_xref="GeneID:5656133"
     mRNA            complement(<75408..>78665)
                     /locus_tag="LMJF_32_0240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685285.1"
                     /db_xref="GeneID:5656133"
     CDS             complement(75408..78665)
                     /locus_tag="LMJF_32_0240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685337.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656133"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5R1"
                     /translation="MDIDLRDRGIARLCFDAQGANKEEATVASAVAVLLADRNRIDCI
                     SGLNAVFVNLVELRLSHNQLGRLSTPYHRLRQTCLRDHAVASRCCDGVASWIRCLPTT
                     LQVIDVAFNNLHSFLECSCECAAAPERHVAAGGVEVKPSASDATVSLARLLRHRVPFA
                     LPFFFSAQRFPQLRELNLSHNAFDVSLRESDEMQEGHSALQAALVEHSTATTPATLSS
                     VDLSYNKGLASLNCFFLSIPPCAGASAKAAAAAVAASQSTVTPSCSVNLAGTGIEDLQ
                     GISSVNGHDATVQWDLQLYPSPVSLIILRAAPSALLQLTHAIVNMRVDGEQNALVAAL
                     TEVTHEGGTATSAIARLQSVAQLDDLEQIAAAAISREEPDMSNALPDGATWISTLAYA
                     CLLRQVVPSLRTLDRVFRVGRCEQLLLSSLCRLLLGDSRPQRASSSCLLPMKAPPPLH
                     PSAPAALAVPVQRGLGGAAHCVAPELQSRIVVGTEASEAAEPSVGVGVADASAAAAAA
                     VRPGQFQAALAALRPSCSSSVAAPAATTHTSSCHSMMSASSVSAEGDAAVSGSSDVLL
                     FMSGEDWYTPSGLTPGEGALYESLCQEAKELQEAVLASNERCRDIQAHTEALQQQLRQ
                     DRTLVADQWKEISRLRQEKEALEASVGRAKHRLDKRQKEVTYGVTAMQSREVAAREKA
                     AMERLAAREKELARRERQLRRRAAQSGALAVEYQSSGPSGQRKKLRSEVLREAAVRKR
                     LAEQENKDPLAYSPAPFKAEIRRCSARRSLDQRPSMHTAAEEEHGYFELNGDVSTPEL
                     REVAGQYLAHLPLSQQQQLRDASLRLPSSGSFDESRGRRRKASPSQRHGSPTSGDGGD
                     PVMDYAAETGAKNRTPSPEVARDLSSVSLSELLDAAAAIRQKQVALQRLQQQWRGPLP
                     PPMVPPGGEEATRAVDTVVQTAFEKASCLHGGASRGGADDGDASAAQTPLPAARLDMR
                     ASGRRSPFSSPAYEPEGSAPSSAQQLFDRMLEQRASAAAHLMARTTSAKAVAGDHTTH
                     VVDCLSTKQGDRRSPTDACGEEHDDTTGELTSDTFTDKAEDAAGQRLQTNRALFR"
     gene            complement(<81024..>86384)
                     /locus_tag="LMJF_32_0250"
                     /db_xref="GeneID:5656134"
     mRNA            complement(<81024..>86384)
                     /locus_tag="LMJF_32_0250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685286.1"
                     /db_xref="GeneID:5656134"
     CDS             complement(81024..86384)
                     /locus_tag="LMJF_32_0250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685338.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656134"
                     /db_xref="GOA:Q4Q5R0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5R0"
                     /translation="MPPQIPTTRADSRGMSPRTPRGAHSTEAARPSARSHLKNASVAN
                     PLLPLHSLHPVVRPSNRNGTPRSVTVPTETPIEFEVAADTMTDTPSFCTDDSISFQFD
                     RTSAATRQRTADNGNAHRKRRPQIPSPSALDDGPTPLTVDERGQLMPAPRDRVRQTTT
                     ADGRKAWMLYSPRRGDAAATLAQEIPAPPRKLSRRAQDILAAKRRALEDGAKKRHADS
                     EKRRAEPERRLGISRGTHRSFVFHPAAFYSDDLARQHGEEAARMQDNRWAAYVYDGMA
                     VCTETRRASGTATSRWETEKVVRTLQPVQVAPAEGTTGTCGCAVYDSMHTDDDLRRLI
                     DSSGAREDGVRHYLNLQPMQLANVETQQMVDPPLESVGRGSVSPSEAQSAVEARHKSV
                     SEQRGVATLGGLWCTVEALREDGRPAVRKDMSAPRRILRICGGQALSVSPHTGSGKSF
                     DVRCYELLLFPQELLSPSAVNYGWEGLTLGQVVASPASSFPLTPRIIDDPVTLKEYKK
                     RLLATKSRQVSIVNCEDDRATFAVASAASGAGGKVEGGAVQYLTLTTATISSRQKYTI
                     DLTLVLLPFRTSGIFAGKTVAEVPRFCAPTVMSHRRLHGLSLSFSTKSAFMSAYKALL
                     WATECDIVDIKPADSEEGAVSIAGYSKLRVCATTSPMVPWVASLGRGTPGQPKEDTFH
                     GNCLDFAALTLAAPPGAVQRAEADGRDPLTLEDFVITDDAPNADGAGDGTQSGQSGTP
                     TRQRRRSTIFTSTFAPPKGADAEGSSTLHNTDTVVGLTAFGVIRRAVSQKTSEVFDVW
                     VIPRNRGRMAPTTCDDTVATAAGGQTAKAQEEHLLQQDAEAAIMIEYVTRLPFHSRVY
                     GVLVDDQCYYIFQEPWISALSLEESLKGFAEHDALESNEVLSKMTRATTIMSLKDFIH
                     AILRPGECGSGASEEVQLEIARVLAAQLLLLVTSLHGKGMLLGPCPPQRLLVRVEDPT
                     KGIHQAEEESGVDTPRKKTTPPPSVTSSNIQLFVPDIGVNTLAWSYERQQCGVLEYLS
                     PMYVLEQMLSDSFGKKERPWTMRDDWWTYLALCFELFAGDGSALVAPETTAVIPTPTP
                     TLTKFFSPVDILDVWQKVITDSASGLASTAAETIGMRTRRYVHQRVLKSVSRSLDSWV
                     VTKAEQLQYFGTTAPRQARRVVRAVPPPPDAQGKAIGVSLAAMYLKCAQEVSDTSSIA
                     FQTEGEEASDASVENILADMPWLFQVRDFFDTILDAVFSPTLCSVHGPALRLVSHPFF
                     HGVHLATIFDGSHVYSEAVADYAEKYLSKSKVQAALLTYRRRAYRGLLRPRRDMPLMI
                     TSSAYNTSGRANSVAPLLLLPTPSFDDEHTVRENDNSTAWHESEASPTEGLVMSRTSS
                     MVHSAIPSPRSQSSAARMWGQQRLRAMYNPAEWQSLAALETEVRSVLNAHGPGESVCR
                     HRGSADADHASDPVTISNRPMQPVQCYSGPAQTETISVASSGRRRDPREYEHVVDSRA
                     ARMTAEPPQRYAHGSGSTSVLDDATVTTSETVFVQTNTAPFVQPLQTGALCNSHPVTR
                     RESQRGAAPLVAVGPLESVRKEATPARRPHRYADSNEFERSLNDMARSHPHRHRSRAE
                     AASSYHGNGRLAKGYGPGFSQLEIPSSKRGSRPASRHSNRVHQEEYDSQRSWPHQFLD
                     AATVQKKGQPCRLSDPQNPAMYRTTIDQQTQRSVHRHGPHSHHGGSIVDAASGLNACQ
                     ESSSDESYMLVQSDGEAHTERAPMPNYQSNNLNRKSPAPRNPRASRAEVIASDRASYF
                     EF"
     gene            complement(<88901..>92950)
                     /locus_tag="LMJF_32_0260"
                     /db_xref="GeneID:5656135"
     mRNA            complement(<88901..>92950)
                     /locus_tag="LMJF_32_0260"
                     /product="putative serine/threonine-protein kinase Nek1"
                     /transcript_id="XM_001685287.2"
                     /db_xref="GeneID:5656135"
     CDS             complement(88901..92950)
                     /locus_tag="LMJF_32_0260"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative serine/threonine-protein kinase Nek1"
                     /protein_id="XP_001685339.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656135"
                     /db_xref="GOA:Q4Q5Q9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001245"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5Q9"
                     /translation="MDKYQRVKVLGKGSFGSAILIKRKTDGLLFVVKEVGMTRMSKKE
                     RDEARHECTVLQQLQHPNIVRYVEQFENNNNLYIVMEYCDGGDLAEKVKHSRGPMKEA
                     SMLYYFSQICLAIEYLHARHILHRDIKTMNVFLMKNGAVKLGDFGISTVLRTTMGMAN
                     TVCGTPYYFSPELCRNRPYNNKSDIWALGVLMYECATGGRHPFDGTSMNQLMQRIVQG
                     HYAPLSSQYSSDFRKMVDWCLQKDPAKRPSIKQTLALPLMRRSLEQLEENLMLATQCR
                     VRLKDIIDFEGGIDQEERKGSSPQPSPKPSPRAVAKDGVSPGQAAALAMARQNLSPVF
                     QPPTSPSHSPMASPERGGGAPAALGPKPSAAVQQSPTASPKQGNDAHRFYSPCHKRPI
                     ANPLLPGGGARPAPAESPSGAVPPPLAQRPLGEPHHTPPLRIKVTLGGAGNRRGLAAA
                     ALPAAAAAPAPAPGPSPNAADAFHADMRRVDAIIARYGRNADEKAKETIHAYMRRKHE
                     AYLKRQKEEIEARERRNRMRKEELRRVLENQRLAASPLRNNDRRNSPQLNNVNLNGYP
                     DDRSPFRGSPQPRAKPENAHLPSRTPPSSPLQDKEPVFGRDPRRGAPPGERASRPTTP
                     QQQRVPQQPPSPAAAAPNGNPLPKTPPRRVVYAANSPQQAHPPSQHCTEAPEARRAVT
                     PDPLHSPPSRLGAPRGAAFDIERRSLPNSKPETASGGQKAPLTAGLGGGIDGHRMVLQ
                     PSQQHLPQPRRPVDEEQLPARRDRRESRALEDAAVARRPSALSPISGDPYDHCSPCQA
                     ASAAPERASPSTGDPRLQRPGRAPQRYLKPLGGRGENGLSPVPSPTSGQSPRHGAAGV
                     EHRHRGSSGVPPPVKSKALVSAGNANPPSSAPGELVDIPRTAAHSSRAQASPCTPVKE
                     ALRALRRSKVQAGAPAPPPSSAMAAEMKDLPAIVASPEHERGVRRNHPRYRLEEAALY
                     HGMRREQPSRGDERVSVDEHRKPHHAEVSAVPNTLEALRSLRAQQDKAMRAEGGAREE
                     VNPGGQLALLKQRQRMQQRPRQESASSVVSVPLAPWLMTRATEAAASPRSEVPSRHDR
                     KTPVSRDSAAARPSAAHVTALSLGDINRGAAPSRAAPPSAQAGAPPSPNPSTGGGAGV
                     QSSMEGYAEMLQHLKDLLQRRRVSSTGGASAPTSPTTAASAPSAIEHPRDPAVRSPIS
                     MRNRALPPPLNPSPLGGGDMSCASDSGGSGVLVSPPHLKATRPLHPQPNAVPVVVVLP
                     DCEAEEEDDDFEDAVPLSPVRCAELNDAYVRQQDQQEQKWRHAQEDVYTSDVDLTSAA
                     MEEELEGEEGYTGYQKQPSSKEVPKGIKS"
     gene            complement(<96501..>100409)
                     /locus_tag="LMJF_32_0270"
                     /db_xref="GeneID:5656136"
     mRNA            complement(<96501..>100409)
                     /locus_tag="LMJF_32_0270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685288.1"
                     /db_xref="GeneID:5656136"
     CDS             complement(96501..100409)
                     /locus_tag="LMJF_32_0270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685340.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656136"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5Q8"
                     /translation="MTRLPRGRRCAAVVALLALFAVVLSHAAEITYLGVFRATEGEVT
                     TVLLKVGALKAECIAGTLTYSVGADYGNNVTFANVHDPRMEFTAAITNMTSGVRTAYV
                     DLVVVCNDTTPVGGTSRVYFRISPRTTTTTLAPSMVCKSPDDAFVTSGASVTFAADAY
                     TSSCYHPLLDIADVTGPSYDARSLFSVEMVNNSQVLVFNANQTDTSPGTYTVTILVSC
                     SSSSCVVQQVVVVAPPTTTTTTAPAMQCPGNYNYSLILNSDGILVEQVFNLSARAAAT
                     GMFCTSGVISATLKEPVHGALRWNNTGTFVYTPETLEEGDDIDYFEFQLTCSNEGSTC
                     AGTVVISIVSEEKDEIYYAMEGAIVCRGSCDAAAWRTSPTALDLFDVNKTGVAVTPRK
                     DVRAVDGVDFGFTAGGDLVIHAYTTIGNLAARFVTFYPITEASVPGLFNSSAVPDGSH
                     VSFEPSCLNRQAITGQGTDIWSWIDFDALKGHLNTEANAYKSGDNYYQRFGGNHRHCD
                     VYRVDPCRYAPLMTPTLNDDNNDVYNNATPSVQWKLYINDCDATWVGRASVESLRALR
                     QPDGSPTFRLKGNGTYLVGTVYSQSVKPASWTSPLAGIVHSETAYEVRLKIRNTIIVD
                     AVARPSSDATAPLLQMSSDIQYSAGKRTDTQERLYRYSVLLYPYFEANKTAANITFLS
                     LKVVSTTLLNSTWTSPSKVECPMCTGTMISCTGTGNGFETDCGDKALMTFEALDYNAS
                     DFDSTIVNDGSSGKSASTSVSPKNALRVTFAVRVNGAGSAELTDAYPVGTFAISVKLS
                     SGQVFDVVVNQTDYISELNTRFLDTQICRPSAYWPVPDPLGSSVPVKPYSADTLAFPS
                     GSSTAEEEEAKEESESYYGVPERLTSPNVCVTPPNADRTQVDLDNMTATIENGKGQVT
                     VSMCAVADERTFGTTDWVMLSFPGIHEETKEINDDEIQGIIDDEMLINNAYTVAQLQY
                     LTLSVHASEVMSSLLAGDSANGYVNILLDGDNAPKSQRGEEETWMHPESSSSSGQSDA
                     YLPWEMYASSLNYRRIAHHTNANTRETEPFNFAFIPGSLLHSGSSIRVPMIIRAAIKF
                     VTYAFTAANSTHSSQRVKKSEREEALLYIVPVSRGISAALRFDTDTYDPVITQSGIAP
                     KPATAILIVLIVAVVCVLAAFVYVEVTYKRIIHTAKYHPKRPGSPVGIRYGRDGKPKE
                     NQKTAREGSRTEAGVPFPASKAHTASGAATGDATTPSAKTKFGIVFGEQKRVPESVAG
                     SSSGSSEAGDAAKQVDGYIAENPPIGEEQPRAEDDEVAEL"
     gene            complement(<101846..>102550)
                     /locus_tag="LMJF_32_0280"
                     /db_xref="GeneID:5656137"
     mRNA            complement(<101846..>102550)
                     /locus_tag="LMJF_32_0280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685289.1"
                     /db_xref="GeneID:5656137"
     CDS             complement(101846..102550)
                     /locus_tag="LMJF_32_0280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685341.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656137"
                     /db_xref="InterPro:IPR010796"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5Q7"
                     /translation="MNSKASPAALPMRQGRGFQVIVHGVLEGAECVEVGSVFARTQLF
                     FGPDWAFLESNSGYGEDAAADDDDLVEPTYSNNAEVVTQLCDCAKGPVPYFSFTAPFE
                     FALTSTNPFGWPQLVITLHTVEGAGGSSGKGADGNDTQLLGSGESIIGYGRCFIPMKS
                     GYHTKKVPMMQLESTTSKQQLISFLTREKPVLRDLSFLCTGDDQVMLHARPLDGYVKL
                     NFSVMINGMESSGFEV"
     gene            complement(<103830..>104861)
                     /locus_tag="LMJF_32_0290"
                     /db_xref="GeneID:5656138"
     mRNA            complement(<103830..>104861)
                     /locus_tag="LMJF_32_0290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685290.1"
                     /db_xref="GeneID:5656138"
     CDS             complement(103830..104861)
                     /locus_tag="LMJF_32_0290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685342.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656138"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5Q6"
                     /translation="MRLCTRDVNAQGRLSKSPCVPLSQIDVGFLCTSMEAWPPLLPSF
                     SREAVEAMNRFVQGFICKRIEYRCGQLSAEDYEDAFLPRWVRMAEHRTDLMEDFFAQH
                     GSRLSEETFRELFGAFERMQSALRDARQEPGGRVEGRHDKRISFARPVAHRLIRRSRD
                     RFSLRSVADVDEGAELRHLSPSPGPSSAADAWRDSLQPGSSSPIPGGTVVSVSSVTDI
                     ADADDVRTFVLPVEESTDGDHFTGRASGVYYGDLLRSAGSSARNSGEGSHAAAAASFA
                     LAEGRDSLDNGAGFAEAVLQAYSGPVRRATAWRWLWIRCFYHCILPAAVVVSLAAYYW
                     DAFQLYLRL"
     gene            complement(<105904..>108195)
                     /locus_tag="LMJF_32_0300"
                     /db_xref="GeneID:5656139"
     mRNA            complement(<105904..>108195)
                     /locus_tag="LMJF_32_0300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685291.1"
                     /db_xref="GeneID:5656139"
     CDS             complement(105904..108195)
                     /locus_tag="LMJF_32_0300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685343.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656139"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR003591"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5Q5"
                     /translation="MDPAMQAGVQGGVPIHLDVLQSAPPPALVEQEAEAADGGSTHKP
                     ASQGGKERTAVPLKSAAGATSKSDAWAAVRPPLAVLGSDDDLASTLGSSLLPPHLLVH
                     PHGFRILKNASALERNMRSYFRLPQPPNTATREERRRLRRTLQRIESEEAQQKARVAG
                     NQDGVVLDGFLLLSACEAEDPEEVTHVALQSSQLSSSIAEDLQYFTRLTTVDFSDNLL
                     CLGHVLPLPGLEVVHLVCNNIFSLVEVSQSRSSSLATVVALDLAYNHIPAHHLVHLKA
                     FGALQQLDLSHNSLRTLPRDLSGLAHLTHFALESNELSSSDVFYALGTMPALVEVNLS
                     RNRFSSVPPLDTGVCDGDSGPRRAPFPCLQVMSLTGNRFQNVEALQPLAALHQTLRRI
                     DVGENPLLDRRPNQKAELQRVLDEAIVEAYYAALPLPQTDSMDPDTLPEMMGTWHRQS
                     WTRYIPNPVSKSDISETELVGAASIGASSSHNTSPSAPLAAASSTLEKLEPDCPMSEN
                     THHREGVSLPFRTVREYFYCYRIHVRTPRATPPPLPKQPTRYFYSSAFREAEQGAHDT
                     MQLVTLPPYNEFMDVYRVLGRRRSRSRGRGGGGVRRRATARRTAARWGPPPQPVHLPM
                     LPRAPTPPRTEGSASSHQMSDEEAEEGAESVQDGKGFFLTSLDGVVGGAAVVSQRSVP
                     RDRRLTAAAPHAETQPQLADRVASAPAVTVEEPLPRTRLPRSVVSPATANVHAAISEL
                     RAMLRKPLPSLPYEALRVKQTTG"
     gene            complement(<109241..>114208)
                     /locus_tag="LMJF_32_0310"
                     /db_xref="GeneID:5656140"
     mRNA            complement(<109241..>114208)
                     /locus_tag="LMJF_32_0310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685292.1"
                     /db_xref="GeneID:5656140"
     CDS             complement(109241..114208)
                     /locus_tag="LMJF_32_0310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685344.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656140"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5Q4"
                     /translation="MSLFVVNTPEHEGQLKEHLIAAHKRKPLLATAWVNPPSVLITNS
                     EGEVLTPVTGPAGSTGRTHQPTALTWHPSEALLVIGWGNGEMSLWSMPSVSSLALGED
                     YTAAAARSAVQLIAARAATQSDADGAVREHGAGAVLAAEWSTRGLYLVSASQQRQVVM
                     WMLEQTPTETSVDFKLKPLWSVQAREPVVRIIHVPGKAARSPTAFHACDGASAAAAAE
                     DGDDDISFLLADGSSSVAAINEDQQLFPCVRQQEVIVSVLYDATSRTLVTLTTTCMIE
                     VYRVGEDIKGSSTLRRKLSAPSTTATTSAATGERITMSMVWASPGVVAFGSGDDRVRV
                     FDLSSESMDVLLLPQPDLHVSSLATFAAKGILTVGTVEGVLAVFQHRAASLSTNRHAS
                     EAKETTTISSPFAAAAGVASQWEATAVHQVGKCVDRVVYTAFGDVALCRGGSELQVLH
                     EIIRKRSWDGVAAVTQISSDMVVIESVTGCQCLLQNKGNVRGLSIAFPNIALWNGSQI
                     DLYTINETTSEFTFVNFVLTTSPAFAIHRDGLIYVKGNRIVFETMQLAPIAQMTFTES
                     EGIPVIIDIMNDYLVAVSSKNYLRLARVSSRDLQQAGPARPLAFPSAAQPTASDTASD
                     APAAAPSSVNDTNALEVSVSTARVNAQGRRVALMTSLGPLALPDTRIWVYDSDTDKMS
                     SFDFGSRNEMPNSVYWNTPEPNTSTVGEFEYILLACETYQIHMDDKKAASEEVTTPKA
                     GTGGINDKNESADRPAGQENLPEALPNVENYAEKKAELEDARRGSIVATNYVAQRAHN
                     IVTLFATHDGLVVQNVASMRRYQICLVGLTIPDFLLASVKINGNPSNAEDYVIEQKRL
                     RDFEGLKSEKDVAVREALMKFSYYATIGNMDEAYRCVKSIRNPAAWQGLARLCVTSGR
                     LDVAAVCLSTMEDCVAARALREAREDYPDDKDVQLATLALGLGMTEEAEELLRKSKHY
                     DLLTDVYMACGKFEHAQRHSERFDRARIRPVAYKYAQFMESLQNMDAAIMWYYNAKCA
                     GTDVPRIFFQTNRMHELRQLMVTQSQPPSPSAGASAPTAQPGRDERQPAFAAIFPQNR
                     ELLLWWAQHSERRRNVQEALRFYHTGEDVYNIVRILCSLTPPKLDSAVQLVNKEIEKA
                     KTRFQQQQAFAAAAPVHCGGDDQGEPDPVGAAYFVGQLYERQGNAQLALQYYQAAGAY
                     RSGVRVAWKTEQYGVVVNLAIKSSDERLMLETAMTLEKQQTYDKAVQLYRRIGAVQCA
                     LDACVRGGLYETLHEVSATFASGSTDPAVFLGMADHFQSEGDYQKAVEMLLFAKHFDE
                     ALKLCETRSVTLTEEMAESMTSDMGKLSMDERQAVLRRVAHIAKDQGSWSLACKKYTQ
                     AGDRVKAMRMLMRGGETEKVIFFANHSRNVEIYTMAANFLQSQKWSTDASIYKSIILF
                     YTKAKAWTNLLVFYESCAQLHIDENRNYPGALRALEECIAMAESGSAGKANIDREKVE
                     QLKRRAEVLQAFVKAQKTVDSMVVADRGSVAEKAKADSVIASCSDIIKRSRPSSPDHD
                     LIQDALRIGDVFALMVRFYFDKLGESNNALKVMESMSKHGADPQFFIETDYMERVCQA
                     NGKSLANVLPGVMMAGAPGAGWEGARKASTDTRRSSVIDEVDRAV"
     gene            complement(<115335..>116087)
                     /locus_tag="LMJF_32_0320"
                     /db_xref="GeneID:5656141"
     mRNA            complement(<115335..>116087)
                     /locus_tag="LMJF_32_0320"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685293.1"
                     /db_xref="GeneID:5656141"
     CDS             complement(115335..116087)
                     /locus_tag="LMJF_32_0320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685345.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656141"
                     /db_xref="InterPro:IPR005122"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5Q3"
                     /translation="MDEDHPIGPVVHADSRVLFCGTFPPVRRSIRFYYPNANNDMWKV
                     LGQVFYDDADAFYTASACASSLFASPSKRSGGHAATRALDEVRVLRFADSQPVGFFDV
                     CRRVRRRLGTSADSNIEALERTNVVRDVLSHTPHCAGIITTGTLALTMLLDDLSAHGT
                     FLTSSEAPVEVVLKTRQGKRKYSIPPIGGQLKWVPSEVCAFRRAVWIYRGPSTSRALP
                     LKLEEKTRHYRLAVAAHLSLPLASAPAPVANM"
     gene            complement(<117823..>122484)
                     /locus_tag="LMJF_32_0330"
                     /db_xref="GeneID:5656142"
     mRNA            complement(<117823..>122484)
                     /locus_tag="LMJF_32_0330"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685294.1"
                     /db_xref="GeneID:5656142"
     CDS             complement(117823..122484)
                     /locus_tag="LMJF_32_0330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685346.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656142"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5Q2"
                     /translation="MRAESVHRTSSVRTSSSHRSTIETRGAPEFDREYARQLSLAKRG
                     RNSSVKTSQRTTPEQELPSESQLYGSAALAASRIKDYVATHVTPPRLPHLSSARRSGE
                     HGGTSIGASNVGTTHQHSSQALATPTSGKEGAGSETPLFLNSTRRGSAFDDTKAPTEA
                     MASAEVSLLLFSIKTILFVGIVFFTVLCAISFVVSASADYNPSYFAFSGASSTPRPRL
                     RDDTVGRRGWPDRLVPEFHRQVALHMRRALRHVLSYVDVPSFSRLVGSVLAASKAYMW
                     NPVHAMLPRIDRQVHPVLRYIFLNATEDGKGWGLTTVITLAASVARSLVQLLVDPVLI
                     VGCTLQALHRWLGGPMTLLSTSLKPLHATPGNMSSVVAAAKANGTSVTTRAASSALLW
                     LWRPLHSLWGVTMSAYSSLGDIPEPRNYSTSAATPANASTIPNSSPLSNRSGKTLSRT
                     SAEVTPCFVAAHVEVRTAHARRLEGALWPSLLDAHRHEMEGLAKDDVWELLRGEGDAT
                     RRVDVALRAGSLVIDIAVTSQVILESTPRTAGGGVEKTTGAAESARRARQTALNTELQ
                     QWPFPRLQAFYNRAVSTAETQRTSAATLAAAVAACEGRVTKCQQQCASIQRKLERELH
                     NCTSDVTKSNPSHANASEEATKELSALLRECSDELANCHANLSWSTADLAEQERHTEL
                     RERGSHESQLTLAASRQGVTGAAAVLAEGFSNSDEERQRCAASLAAAAQECDQRVRDT
                     RSSLDADHAKQLTSFKEECARQRSALDKASLEKVKLAVQRAEATCSEQLKANVAACNE
                     SAASALERLREALTAAKAEAERRVTTCEDAAEQARVSFSAERAQLDASCAAQLAALDE
                     EMRRTSTAAAQKAETACTGRLSRGLSALNSSAVAAASELQRQLEEGTREALRSASACD
                     TSRRQAKAECEMTLTRVREDCTAQLLKARENSTAAARRAREEEREAQQRISASNWRLE
                     EKRLAAQCAATTQAAVSEASQLLATKHATAQEEAVIEERRRTATLLRRRDEAYQLQSE
                     TLLKHHQAQVRDLGAQVAVCTAQLQAAEATHQEMAQKARQVLHAAMADSATGACLEVT
                     QHNLHVCADVRKAVQEELHKLPLNASSADAFAHLLKSTVEPGRLMWKFSGASVHASRG
                     GETAASSGRQACFTPYLRVSGVLFALLASACVLAKYPRTRRLSDDKIARLDTLIAASK
                     TATTLRSTTLSSRSKRSRSRHPGQFPADGESPLSWDVLFEACMANSLETLLAWHSTCC
                     AVLLERETHRLRGQPHEVNTCEDVLATDASTSLSESVLGDAHALSLSRGGPAGSLSSA
                     STFPVAREDAARLSQLHAAFINGYYDMLEMYYVDLVSAVAHRDLTGRQLQDVKSVAAR
                     QAAALQKQSAVAAQLKLSLAEKENPASFAAIKDKLAKVERCAAAQEETVALLEQLKIS
                     RDELDKARGVVSSPAPSPCTTVATATATAPESSKSRQMRSLQELADDGADGDSNSTSD
                     FSNLERETGAHRDPTSLLPVSAQGSSTLPLAIKKSTMVRNPDSTRRYHKLQWNDDVDM
                     T"
     gene            complement(<123870..>125744)
                     /locus_tag="LMJF_32_0340"
                     /db_xref="GeneID:5656143"
     mRNA            complement(<123870..>125744)
                     /locus_tag="LMJF_32_0340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685295.1"
                     /db_xref="GeneID:5656143"
     CDS             complement(123870..125744)
                     /locus_tag="LMJF_32_0340"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685347.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656143"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5Q1"
                     /translation="MAWPQSLPSYSTTGPTSAHTYAPPSRTFAALEDNALEQLYEDWC
                     LRRGEGDEAEGSAGRSSGDTDAIVPEVFIAADHRAAAFSIAASAAHQSALASLQHEST
                     AMSGAGTGVCPRSVSDAPFTWEELLRGELTRRNTRHGTAYSPGGGVMLSDPDALADQA
                     TRRLQRFLQSVTCVERLVRDRRFMRSVAVFLYEHHKVFLHHYRPAATSSKAAEAAMAD
                     DRGEDLPADIAAHAYMEHTHPEHRVYQEFGERVSAALLSVLTHHVPGFDEAEFVEALY
                     ETPATYAMMEDARAAVGNHPMLGCPQSVLSFPASRLLLAMSGFESFFVWMMDYIYEEY
                     YLDTEIEEGAPSVAVAGVRGLRALIRSTYSRPAAASAADTSAEEVRISAAVQGSAGQQ
                     ETLLHMSNPPVPDSASASFALCPASEPHHPTLQRSPLLTRLSHTPPPPETVALPVRAS
                     LLSSGRGSGEPLRKLFPTPPASADGASRGLNGTGVAPYRKRKTTHPGRDLPPIAPNAN
                     GMMSASCSMATTFSELSASASGLGSSPSQRRSERNVERTPIAESTHAFTSCSDDALEQ
                     PARSIAPKTSTGVMAPIADASARQCGGAVRSKSRFSSTPRTNTGAARKPKPQNPRLNH
                     "
     gene            complement(<128610..>130022)
                     /locus_tag="LMJF_32_0350"
                     /db_xref="GeneID:5656144"
     mRNA            complement(<128610..>130022)
                     /locus_tag="LMJF_32_0350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685296.1"
                     /db_xref="GeneID:5656144"
     CDS             complement(128610..130022)
                     /locus_tag="LMJF_32_0350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685348.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656144"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5Q0"
                     /translation="MIRDQCHAYCRCSYCAQQPREKSFNAGASMWAAMEALDRPGMSK
                     DELYMKSLHQSLRAKAFLDSSKNAGKFIPDEQLLSSTKRREAKELALAAELVPVRRRD
                     RLQELVLLEHKERLREEAALREERRALGLPEEEGEPVSAVHTDSPASTRPSSKESMQQ
                     RLSSGAATPASRCSAEHDLHVMLKGIRDIVDEDPAASSDPLSREQVYKLRQLMHTQKK
                     KTREMIDNCENQPHVCGHCLDVNVQARHLSASPHGSVAFGLTGKVINPEEGVKFGTDT
                     QREPSGLFNASTVDPAMVSAKKSRLTSYNAHPYGTGMVFLPVSSLNGGSRSAVGGQST
                     RFRASFNNNIGSGETVEEELQFPGSTYNVYDTGLAKEATPQAVAKADKAQRTVKIDAA
                     SSNESLQCGANEPKAAVTAAAAAPEQPTYSSSAAMWMTTNQDRELDMKRFMEFQQKLK
                     ANSKRVYAETASRSAKALAA"
     gene            complement(<131111..>132211)
                     /locus_tag="LMJF_32_0360"
                     /db_xref="GeneID:5656145"
     mRNA            complement(<131111..>132211)
                     /locus_tag="LMJF_32_0360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685297.1"
                     /db_xref="GeneID:5656145"
     CDS             complement(131111..132211)
                     /locus_tag="LMJF_32_0360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685349.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656145"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5P9"
                     /translation="MQSTYPKQNCGCDFCCSRRSVNAKKLAASQAAFQRSGTMQRNGC
                     NCCCHSSGPGGVSSFDPDYPVPVNQTALNASRGRNGVPEGNKYTIRNSSTRAAGPGAS
                     QTAGGNGSMKETAEQREAREAAELDALERLLMLEYKARTQATMEAERLKRNATSPTTR
                     GPKPVPEGYTSGSIADRMGYSASGTEGRGRTAAGEGSFVPSAFTIHEAYAMAHDCPAE
                     PPAQCHASHRLQDTLDDVRKVTADPVHTGNRRALQQLLHQHGMAEAPTSDNGAATGKA
                     ASGTEPNAFGSSLAQIRTSYAHPRGAGLVWVPTAPSAAVSQSSMKDSDALVVERGAAA
                     GAGSAKRPPGLSPGAAAALAADEKQASCAACH"
     gene            complement(<133028..>135235)
                     /locus_tag="LMJF_32_0370"
                     /db_xref="GeneID:5656146"
     mRNA            complement(<133028..>135235)
                     /locus_tag="LMJF_32_0370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685298.1"
                     /db_xref="GeneID:5656146"
     CDS             complement(133028..135235)
                     /locus_tag="LMJF_32_0370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685350.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656146"
                     /db_xref="GOA:Q4Q5P8"
                     /db_xref="InterPro:IPR008803"
                     /db_xref="InterPro:IPR027417"
                     /translation="MLVLDFEGTDGLERGEDQCFERQLSLFGLSIADTLIINMWAVDV
                     GRFNAANLNLLRTIFEVNLQLFSHDKYEAEEKPTLLIVLRDFTEDDPAPSLATVRKSF
                     DTIWEGITRPAQFAGASIDALFHLKYYVMPHYKLQKTEFMTSVETLQRWFSDSQCPDY
                     LFSHRAMFRGVPLEGLPAYLTSCWEAIRTSKDLDIPTQREMLAQHRCKEAKMQELKAF
                     RHFARNYEDRLLHGEMLLRLSEVLDEEMETRLTSFYRQTKLYNSDVVGQYANELETEL
                     VNATMRVLNRLSKAIAAEVLSNAEPRVLNSVEESLRQLLKSAQTLPFSAGEGPGAAEA
                     AEVNDVEGDAAHLVGAQRMDSPACQKLVRSFWRSLSRHVNEVVAEVAAMPPRAHLYGR
                     YVALIAQDPTTRLNVLNIVTDALFQKVKSRMVSMADSACDTMHAGFERSLTHNSDGTA
                     RFFATTKGLQKAVPAATQAGVVVLGSLFYFRLKLVAAADDDGIGADAAGTALPQSRSA
                     RRVRQDRHRILFNDNDAEAAFYLSYSTFDTAPKYPYDVPVRSADCDGEEAGAAADCIL
                     LSQQATVRAYELYRQKCDFTTQLQLRTIEAGKQRLPAWVIPALFILGWNELLYVLTSP
                     ALLVLVVVICAVFFKQFFVSQWHAFEETGPASVVIPTKTVIHTLSTLVRPLLDYGPGP
                     RTERTERSHDAAAAVEEMSHVEATCTHVDPTLGSANLPAAPATMRHRTSRKLD"
     gene            complement(<137809..>139122)
                     /locus_tag="LMJF_32_0380"
                     /db_xref="GeneID:5656147"
     mRNA            complement(<137809..>139122)
                     /locus_tag="LMJF_32_0380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685299.1"
                     /db_xref="GeneID:5656147"
     CDS             complement(137809..139122)
                     /locus_tag="LMJF_32_0380"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685351.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656147"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5P7"
                     /translation="MGPHSFRRCPVCIPEQAELQEADLLALQQRCEEARVADRRWRSA
                     LTHVLGSRGHRGGGRNSYQSNTAEMLRRQRNSFYQRAVDDEYMARRRMLQAELDARRN
                     EIVKTQRARETLRMEAALSDAREDRRRSCGPRACSLQRARSADPAAGACLSTPPPQRK
                     EQPPSLPSHSKDSDHAVPPSTQPKIEYPEPLPKVEKRPLPPPPTHPGRESLPQRQHRE
                     RVCSHGPAPLATCCADFHNSSAHGQWHWGWIWCPSFACQGHHSSQSPRNHVRLPRSPP
                     ACEVPMPSLDVEPTSRLISPTTGGDAASGHAKPEKSLECLERDAAAGAPTNPPQPSSA
                     VSAAGADFAAACRAGKGRPECVRGGSSQFRSHSATSVPLTSPRFGRKVFITDDVYCDR
                     RARYIAEWEASGAVQRVPASSRSPSAPFPEKTPKWRTTGNDAFTE"
     gene            complement(<140620..>141699)
                     /locus_tag="LMJF_32_0390"
                     /db_xref="GeneID:5656148"
     mRNA            complement(<140620..>141699)
                     /locus_tag="LMJF_32_0390"
                     /product="putative 26S proteasome regulatory subunit"
                     /transcript_id="XM_001685300.1"
                     /db_xref="GeneID:5656148"
     CDS             complement(140620..141699)
                     /locus_tag="LMJF_32_0390"
                     /codon_start=1
                     /product="putative 26S proteasome regulatory subunit"
                     /protein_id="XP_001685352.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656148"
                     /db_xref="GOA:Q4Q5P6"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="InterPro:IPR024969"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5P6"
                     /translation="MSNDPKPTKPDPRVANNDVASDDGSDGKGDVAAPPAFLPTAGRV
                     EVHPLVLLSLVDHYARMNTSAVQKKRVAGLLLGRYVRDSTGMQTLDINNSFAVPFDED
                     PQDAGVWFFDTNYAQEMFAMHKRVLPKVKVVGWYSSGPTIQPNDMLLHLLVADRFCLN
                     PVYCVVNTDPNNKGVPVRAYTTVQGREGTRSLEFRNIPTHLGAEEAEEIGIEHLLRDL
                     TDSTITTLSTQVQERELSLVHLCKVLQQIEEYLKDVGNAVMPISEDVLEVLQELISLQ
                     PEIYARRSSTEMIRHTNDEAIATFLAAIARCIGALHGVIMNRRKLARELQEIKDRRAR
                     AAETRLENEKMKIEEAAKEKDTNQA"
     gene            complement(<155226..>157073)
                     /locus_tag="LMJF_32_0400"
                     /db_xref="GeneID:5656149"
     mRNA            complement(<155226..>157073)
                     /locus_tag="LMJF_32_0400"
                     /product="putative ATP-dependent RNA helicase"
                     /transcript_id="XM_001685301.2"
                     /db_xref="GeneID:5656149"
     CDS             complement(155226..157073)
                     /locus_tag="LMJF_32_0400"
                     /codon_start=1
                     /product="putative ATP-dependent RNA helicase"
                     /protein_id="XP_001685353.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656149"
                     /db_xref="GOA:Q4Q5P5"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5P5"
                     /translation="MYKNQAQPQLQPQPQPQSQPQPQEPSAIAGAMGGYGSYQQQNRQ
                     YGGGNRGFNDAQGTYGGGFNRNGGGGGFRGGFGGFGGGARGPVRELVGNNHYHREEKS
                     EEEIFKEHTPGINFDQYEAIKVSITPNDVEPAESFATMALAPALAENVNRCRYQKPTP
                     VQKYGIPCVLNGSDLMACAQTGSGKTAAYLIPAINFMLVNNLNRAKPTNSQAAPSALV
                     LSPTRELSIQIYEEGRKFTYRTGFRCVVVYGGADPRHQIHELTRGCGLLVATPGRLSD
                     MFTRGYTRYSDVRFLVLDEADRMLDMGFEPQIRAIVQGPDSDMPPPGERQTLLYSATF
                     PKEIQQMAREFLYHHHFLQVGRVGSTTENITQDVRWVEDMDKRGCLLEVLKEHQGERV
                     LVFVEKKRDADYLERYLRQSRIPCSSIHGDRVQREREEALDIFKSGVCRVLVATDVAS
                     RGLDIPNVAVVVQYDLPSNIDDYVHRIGRTGRAGKRGTAISFFNDKNRNIVDDLIPLL
                     RETNQTVLPEVQALAKKPNVQNQPRGRGRGGFRSGGFGGGFGGGYGGGYGGRGGYRGG
                     GGFGGGYGGGYGGGYGGNNGGYRPRGGYGGGYGGGYGGDRNMRSDVFGQ"
     gene            complement(<158190..>160472)
                     /locus_tag="LMJF_32_0410"
                     /db_xref="GeneID:5656150"
     mRNA            complement(<158190..>160472)
                     /locus_tag="LMJF_32_0410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685302.1"
                     /db_xref="GeneID:5656150"
     CDS             complement(158190..160472)
                     /locus_tag="LMJF_32_0410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685354.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656150"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5P4"
                     /translation="MESLSRLAYGPSPPPTDAKGQSRGRNTGKKQRFSPPSSARADAA
                     HAATAPHRKREAKRLVEEYWQSVWHSYHEPPLYHTYSDRYGGSKGIPYASRKAAQGAG
                     AAGSGAAAYSASVPDCLTKADTAFGNGQLAEAKAQLQHALTVLQNAAEPRGLLNVVAL
                     TQFRGDCAEDAQRSFWLAEVLRRMGTLELIHGHCAEARELFNGSIAAGPLNLDSYLLR
                     ASCCEALRCFAEAYEDYSKYMKMTEPSMEVLAHSGKCAAEAGLWEKAREQLGRLLELS
                     EEVLASTAATQQQVVDATRTLNTHRMFSSLPPLTSAAWAAGSLTQNTGTGAPSSLELL
                     RSACAFYVTHAYFYLGYVAEAEAASTTSVTSAEAAALRRKASSYYSVAVRNADYVHSY
                     EDSVRRSMAAGDYALARHLMRYLQRMKPDRAGYFLDAARACRAEGDIQGELRALSAAL
                     DRQQTITERRSTLFARGAVYADQLHDWSRAIRDFTLLIAIPSVWQPVVEADGVAAVVD
                     WFTPLALVRRAAAYRHRQKESSRSSLLQHEDEEAALSDYAAFLDALAEMTANTGCDTA
                     DVPELCQPPHVVAALLVLANGAYHRHQYSNAVHFFCRAIALGWHPESCMPALLPATER
                     LADQLYTSMAHHVMTIYPPGDDMFRVPYEARQATTLSITSSIVASAEARRAMKSNERG
                     NAGGNRVPSAESERSGFACPPLLYLMVDQRYQQLRALEPTFFAAIEDEFLDAWEPYRA
                     EVERLKDEALSTRSGRRGKR"
     gene            complement(<161390..>163546)
                     /locus_tag="LMJF_32_0420"
                     /db_xref="GeneID:5656151"
     mRNA            complement(<161390..>163546)
                     /locus_tag="LMJF_32_0420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685303.1"
                     /db_xref="GeneID:5656151"
     CDS             complement(161390..163546)
                     /locus_tag="LMJF_32_0420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685355.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656151"
                     /db_xref="GOA:Q4Q5P3"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR003409"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5P3"
                     /translation="MSTTDSPPAVHPPVVDRLRIAVRERPASDEEAPLTQVLIRADQD
                     KLIAFAPNAADGLMYDFDYFYPQNARQADVFCTIGLEMVDLVMGGLSANCIVMGYAET
                     GKTHTLFGSPNESGLIQDTVRELFRRLEAQRHTHEYSVGFSYWEMNCNSVLDNLAEDE
                     ASLADGNAAASSTARNHAVYRDGFSRLYLSHMTEVPVKDFAAFETLLGQGNERRVRRG
                     YARQFRWHGFVQLSLMTFDKHTGEKCVLRRMTFVHTKGSERVGANRAPKQILREGSQV
                     NVSSTLLNAAVIHSLEYRAKRADQYRTQAQLHRLIQRSESFFMECRYTQVMSQLMCGH
                     EACFVVGCVDPLSYSETTETLENLQLYRNLLAACVPVVTLSERGRLLRQLRAMETAMG
                     GDEMLQFIYFGTSGRPRTEQEEALLALRGKLEMWGMNNACEAQGSGLLKDAATPCGID
                     AEGRSTRKVVFLNAAKTATYEGQWKGAVFDGFGEHIQANFKYRGEFRNGRREGHGTLF
                     LRDTKESPYRRVYEGEWLGGQRDGRGTQWGSDGEVYEGDFAANERQGLGKLYLANGDV
                     IEGNFSYNKCEGWAVLRQTNGDWFEGYWMNGEREGPGVWHYVSRQRCLRGEWHHNKAV
                     LGTMEDDADKIDDSTGPFIPRLGLLNSEDILAQQRKRLIEKRRLDFSAAGKTWVDYAA
                     MDNRCTVPMAATGTPMTTSEHAAPADSHTVYGLEIE"
     gene            complement(<164728..>165228)
                     /locus_tag="LMJF_32_0430"
                     /db_xref="GeneID:5656152"
     mRNA            complement(<164728..>165228)
                     /locus_tag="LMJF_32_0430"
                     /product="putative 60S ribosomal protein L17"
                     /transcript_id="XM_001685304.1"
                     /db_xref="GeneID:5656152"
     CDS             complement(164728..165228)
                     /locus_tag="LMJF_32_0430"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L17"
                     /protein_id="XP_001685356.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656152"
                     /db_xref="GOA:Q4Q5P2"
                     /db_xref="InterPro:IPR001063"
                     /db_xref="InterPro:IPR005721"
                     /db_xref="InterPro:IPR018260"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5P2"
                     /translation="MTHYSRKPQVSSKSAKAKVSDLRCHYKNTFETANVINGMPLRKA
                     QQLYRQVLAKTRCIPFKRYNGKIGRTAQAKEWGQTKGRWPRKSVVAMMSLLKNAEANA
                     IEKGLDPNQMVIKHVQVDQAARMRRRTYRAHGRITPYMCSPCHVQLFMSEKKERVPAP
                     KSTPKK"
     gene            complement(<166874..>167749)
                     /locus_tag="LMJF_32_0440"
                     /db_xref="GeneID:5656153"
     mRNA            complement(<166874..>167749)
                     /locus_tag="LMJF_32_0440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685305.1"
                     /db_xref="GeneID:5656153"
     CDS             complement(166874..167749)
                     /locus_tag="LMJF_32_0440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685357.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656153"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="InterPro:IPR009688"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5P1"
                     /translation="MRCVPRLRCVRSAVVLSSLLWGQRWSSTSNSTPGEYGESAAASG
                     STVLPGVDLARRAVSPNQEFPATWSEDEPLSPSNPRVCWREHYSLDAQKPYYQNIKTM
                     EVTWVIPEGFVTRFPRLYASNGYHVDATGAVFRTSTASEPPADGTVGTTVAKKAGVKA
                     VSLKQRLAAYGAGGLLWYLIVHNISLACVFTCLYVFRIDLIALARSYGFDVKRSDEVA
                     VNESKRPPFWKTFVLSIVLNKILVPLHLFLTVTSAPLLVHRLEPIATSLFPTIKAFAR
                     SLVGRGAAAGTTAKV"
     gene            complement(<168902..>169696)
                     /locus_tag="LMJF_32_0450"
                     /db_xref="GeneID:5656154"
     mRNA            complement(<168902..>169696)
                     /locus_tag="LMJF_32_0450"
                     /product="40S ribosomal protein S2"
                     /transcript_id="XM_001685306.1"
                     /db_xref="GeneID:5656154"
     CDS             complement(168902..169696)
                     /locus_tag="LMJF_32_0450"
                     /codon_start=1
                     /product="40S ribosomal protein S2"
                     /protein_id="XP_001685358.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656154"
                     /db_xref="GOA:Q4Q5P0"
                     /db_xref="InterPro:IPR000851"
                     /db_xref="InterPro:IPR005324"
                     /db_xref="InterPro:IPR005711"
                     /db_xref="InterPro:IPR013810"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR018192"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5P0"
                     /translation="MADARPAENPGVEAPRAERNFGRGRGGRGGRGRGRGGPGEEKEW
                     VPCTKLGRLVKAQKVTSLEEIFLFSMPIKEHQIVDTLIAEGQLHDEMMKIYPVQKATS
                     AGQRTRFKAFNVVGDCDGHIGIGARVGKEVSLAIRASMIAAKLNIVPVRRGYWGNKIG
                     EPHTIPMKVTGKCGSVAVRLVPAPRGTGIVAAPVPKKILEFAGVEDVYTSSRGKTRTH
                     GNLIMATFYALRKTYGFLTPDLWADTEPSRDPTDEHAELLAEMTTA"
     gene            complement(<171764..>172603)
                     /locus_tag="LMJF_32_0460"
                     /db_xref="GeneID:5656155"
     mRNA            complement(<171764..>172603)
                     /locus_tag="LMJF_32_0460"
                     /product="putative prostaglandin f synthase"
                     /transcript_id="XM_001685307.1"
                     /db_xref="GeneID:5656155"
     CDS             complement(171764..172603)
                     /locus_tag="LMJF_32_0460"
                     /EC_number="1.1.1.188"
                     /codon_start=1
                     /product="putative prostaglandin f synthase"
                     /protein_id="XP_001685359.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656155"
                     /db_xref="GOA:Q4Q5N9"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5N9"
                     /translation="MAVKCTHVTLSNGVQVPQLGIGTWEAKDGNEVVNIKWAVNAGYR
                     HVDTAHYYKNEKGVGQGISECGVPRSDIFVTTKLWNYDHGYESALAAFEQSRQALGVE
                     YVDLYLIHWPGPNRSYIETWRAFEKLYEMKKVRAIGVSNFEPHHLDDLLANCTVPPMV
                     NQVEMHPHFQQKALRAYCAEKNIAVTAWRPLGKGALLTEPQLVELAEKHKRSAAQVII
                     RWLIQLGVIAIPKSSHEERIKQNFDVFDFELSPEDMRRIESMDRNSRIGSSPETFFPT
                     ERK"
     gene            complement(<173552..>176191)
                     /locus_tag="LMJF_32_0470"
                     /db_xref="GeneID:5656156"
     mRNA            complement(<173552..>176191)
                     /locus_tag="LMJF_32_0470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685308.1"
                     /db_xref="GeneID:5656156"
     CDS             complement(173552..176191)
                     /locus_tag="LMJF_32_0470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685360.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656156"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5N8"
                     /translation="MSSKGVMERLRGLVVCGASAATADDVLAEFLSSATKLEELCLVN
                     CALENTVTALMEAVKNTEMKRLGLERSDLGIGSSNSASEGLTTSFCEALKVNKFLTSL
                     NLSNTNLDTTFVVALIDALLESDTKLLPEDLGEDAEEVLGWSLEGRLDKAAFVSGGDR
                     DDSNASLIDDETVGDDDDATPSPDASESDAGEDDADDKDSGDEEADGDAEDEEGSEEE
                     EEEEEEEEAAHEAKARRLRERQEKEEWQLQQKRIRHELKVLLQSELWERSDLAHEYYQ
                     GLQDIVAINSAPIANRRAAERQQKKEAYCSRRSGWSRLETLILRGNQVGDRGCKKLAC
                     LLRDEVPLSEEEVVQRQEAIDAMRGSFGERLGAARSVVERGEKRAWRELLRKAQRESP
                     DFAIERRTSISAALSDLDEEDEYAKEAPPVLLTNVERSPSSSSVEESPASDGDGDTEA
                     SSGFNPEEQREWQEWVAQALPHMPVALTKKGMNTIRAIDLGSCGISRKGVQTLAEVLK
                     TNKVLETLCLRHNPIGSSAPAKKHAQPEDGLTIFPEFAEFAEMLSVNGAVCHLDMGYC
                     HLSPDDVRAVAEALRHNTSMVTLSLEGNQLGVDEGYQQQTYAHSYIYELWMTAARPGS
                     ALRNLNMDHNHIATCLWQEEVAALAALCGQLTSLSLSHVGLRLRHLEAWSEALLPEDP
                     SYSPTVRVLHLAHNELATEADGAALGLLLRHFTALEELSVEEHPLLGSSGVAAALEYL
                     PATMRRLNCTATGLTTPCVGAAQNPVLPVAVVKQLTCLLLGDVEAPTVMALGEWVTFM
                     KRAAPRQLQFLSLWARGMVGREADVMPLQLELAQTCPSLLHMDSGFQPEFHASTFASN
                     CFEQMEQLLFLRRMRCAAEQSKV"
     gene            complement(<178503..>179123)
                     /locus_tag="LMJF_32_0473"
                     /db_xref="GeneID:5656157"
     mRNA            complement(<178503..>179123)
                     /locus_tag="LMJF_32_0473"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685309.1"
                     /db_xref="GeneID:5656157"
     CDS             complement(178503..179123)
                     /locus_tag="LMJF_32_0473"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685361.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0473"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0473"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656157"
                     /db_xref="InterPro:IPR006735"
                     /db_xref="InterPro:IPR027799"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5N7"
                     /translation="MGGDGQALANKRSLLQKSRAYVSAADLESGQAKEKTSQKSRTVE
                     RWSHCALSLQPLEAPVVFDGAGDVFSKQSVINYLLDRKEGSYGSVGDKEDKFCIKKLT
                     DVKEIANEIGSDGSVCCPITDYSTVSGVHSFVGFWGCGHVVSASTLNKSNDLKSQIDV
                     ECPFCGLESFYVRLICEDAEDAENQQTFLRHHVKRFRKRVRDDDAD"
     gene            complement(<179631..>179936)
                     /locus_tag="LMJF_32_0477"
                     /db_xref="GeneID:5656158"
     mRNA            complement(<179631..>179936)
                     /locus_tag="LMJF_32_0477"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685310.1"
                     /db_xref="GeneID:5656158"
     CDS             complement(179631..179936)
                     /locus_tag="LMJF_32_0477"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685362.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0477"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0477"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656158"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5N6"
                     /translation="MKITITTKMVGLSVFDSTAEYDTNDQLYAVVDQIKRCHGSTVSR
                     IRLWKSKVEPTTILRDHLQPLSNIFGAEEQGNESSAHHCIYYDFSPRESKCTILNVN"
     gene            complement(<180396..>181547)
                     /locus_tag="LMJF_32_0480"
                     /db_xref="GeneID:5656159"
     mRNA            complement(<180396..>181547)
                     /locus_tag="LMJF_32_0480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685311.1"
                     /db_xref="GeneID:5656159"
     CDS             complement(180396..181547)
                     /locus_tag="LMJF_32_0480"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685363.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656159"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5N5"
                     /translation="MNASGATASEGKNPPRDARTVSFHPESTFHEQHNAASQRFSHTS
                     EPGWESRESNSGYAAQDGGDTANEGIRRSYYKRLYRFYRKYNPQKLCNVEKLLRECRG
                     EEEQLFAILVGKYGPEPEEESSMLSGDCVFSSAGDSVMHYSGKRCQFPKKVKPEEGNT
                     DCETPYWAGASSLIGDRDLLSLLQNLETPNVELQKCYMGVFAEHPTDCWNGMAYITRA
                     EGIAPANTKFLGHTWVGTLGSGKVLVHEGKKFHRTTLYCTEECQKRGNHERWRLSVYR
                     GEVSYLILLRTVWDPVVVPEPLPLNRSNLSEREVHSSLDGFPTRLSSMSSADSGGSGS
                     RQPIQPPQPQQHTVTPAFVQFTKLLEELESRIIERLEGLERRMSRLENM"
     gene            <183454..>184065
                     /locus_tag="LMJF_32_0490"
                     /db_xref="GeneID:5656160"
     mRNA            <183454..>184065
                     /locus_tag="LMJF_32_0490"
                     /product="putative ras-related rab-4"
                     /transcript_id="XM_001685312.1"
                     /db_xref="GeneID:5656160"
     CDS             183454..184065
                     /locus_tag="LMJF_32_0490"
                     /codon_start=1
                     /product="putative ras-related rab-4"
                     /protein_id="XP_001685364.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656160"
                     /db_xref="GOA:Q4Q5N4"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5N4"
                     /translation="MADKYQQLMKLIVIGDSGVGKSCLLHRFIEDTFSEEQTQTIGIE
                     YGAKIIDVGGAKVKLQIWDTAGQERYKSVTRSYYRGATGCLIVYDVNNRSSYESVPQW
                     LSDVRQLAGSDVVVMLIGNKMDLTKGNSVRAVQHNEASLYAQQNGLLHFETSAATGEF
                     VSEAFLKVAKSAVSLASAAEPESDTQLIQDNTANNSYLSSCSC"
     gene            <184667..>185449
                     /locus_tag="LMJF_32_0500"
                     /db_xref="GeneID:5656161"
     mRNA            <184667..>185449
                     /locus_tag="LMJF_32_0500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685313.1"
                     /db_xref="GeneID:5656161"
     CDS             184667..185449
                     /locus_tag="LMJF_32_0500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685365.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656161"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5N3"
                     /translation="MPAKSAKSKTQTLRDERKLGVEKLVELVFIGRPRTLSFSHRSLG
                     SLRHPYSSLICETSAACASTQDKIMYLLEVFLEAKAEKKAWMRVERIFDSMLGDALME
                     KMKLGLLLSSELLQRFEVLWIRLGGVNGGFIFEDAYKQFHQHLYFTLFGIEQMTLLPA
                     TMQFILEDYQYDSHDKSGIDFGSFAHSMLELADNWAGSREVTDYVAFMDKIIECYPAS
                     AVKPCKTHAPDELTLSKDAFFRGGVVVPRVEGEQIVYHRITL"
     gene            <185996..>187087
                     /locus_tag="LMJF_32_0510"
                     /db_xref="GeneID:5656162"
     mRNA            <185996..>187087
                     /locus_tag="LMJF_32_0510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685314.1"
                     /db_xref="GeneID:5656162"
     CDS             185996..187087
                     /locus_tag="LMJF_32_0510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685366.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656162"
                     /db_xref="GOA:Q4Q5N2"
                     /db_xref="InterPro:IPR005045"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5N2"
                     /translation="MAPLPPKPHSKNRLEQQQLPHIYARYSPLSVSAVFFVLAVAAIP
                     IGVVVIVSGDLTTRLDFRYDHINSYKFVMGAADEYAVNFPFNGTTYSSGVKTRLMFSL
                     SQSLTAPVYMQYRLTPFFQNYRYFTASVDYVQLSGRGSAGSTLCAPFRFPGEATGDQV
                     SGYYNPCGAYPWAIFNDSISLYRIDGTLICDGSAFTANGTSLAPNNKCVKSGIARPSD
                     VKARYRPPSEIPGNGPMWSAGGNTSATDPYLREGYYYKEPGHKIPLSTDEDLIVWLDP
                     AFTSDVTKNYRILNVDLPAGDYYFEITEQYPTAPYASQKFVQLATRSWIGGRNHVLGS
                     LLIIMGGMAFIIAVTLLSMKCLIMQGYTQ"
     gene            <188195..>188647
                     /locus_tag="LMJF_32_0520"
                     /db_xref="GeneID:5656163"
     mRNA            <188195..>188647
                     /locus_tag="LMJF_32_0520"
                     /product="putative profilin"
                     /transcript_id="XM_001685315.1"
                     /db_xref="GeneID:5656163"
     CDS             188195..188647
                     /locus_tag="LMJF_32_0520"
                     /codon_start=1
                     /product="putative profilin"
                     /protein_id="XP_001685367.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656163"
                     /db_xref="GOA:Q4Q5N1"
                     /db_xref="InterPro:IPR005455"
                     /db_xref="InterPro:IPR027310"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5N1"
                     /translation="MSWQAYVDDSLIGSGNMHSAAIIGAADGSYWAYGGSYVPQPEEV
                     QHIQKCLSDFSFVQSSGVNIYGVKFFGLQCGTDGDCKYIFFKKGAAGGCIYTTKQAFI
                     VAVYGNPGDTSSLQQDLEKNTAHAVTVNPADCNTTVKRIADYLIKLGY"
     gene            <191408..>191845
                     /locus_tag="LMJF_32_0530"
                     /db_xref="GeneID:5656164"
     mRNA            <191408..>191845
                     /locus_tag="LMJF_32_0530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685316.1"
                     /db_xref="GeneID:5656164"
     CDS             191408..191845
                     /locus_tag="LMJF_32_0530"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685368.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656164"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5N0"
                     /translation="MLVRSITKCVVPLIKATSYTSSYIVEHPPTPVRLTSMLPLHNKS
                     MPTPLLDPERLQEISCGTGQPAQRGRRKPLVWKRRKPWFDHQWSLDLQRIKKGPETPH
                     FPDGTPFTQIRSFQSFAGRSWKINAGRRRKIRLSLKRGRRKLL"
     gene            <192988..>194523
                     /locus_tag="LMJF_32_0540"
                     /db_xref="GeneID:5656165"
     mRNA            <192988..>194523
                     /locus_tag="LMJF_32_0540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685317.1"
                     /db_xref="GeneID:5656165"
     CDS             192988..194523
                     /locus_tag="LMJF_32_0540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685369.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656165"
                     /db_xref="GOA:Q4Q5M9"
                     /db_xref="InterPro:IPR002781"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5M9"
                     /translation="MTMMWRCRGFKLCAAIVLALMAVLLMSSASAAETSCGFSTQRVQ
                     CGDFACDKEAKICIACRADGDCYPGAMRCDVSSRKCKMRSFTSLFGVRTILAMLSVFV
                     VCSIAVLAGVGGGGILVPLFCGLMEVPMQSGVGMSQSAICGQSTLNIYLAIQQRHPDS
                     SWDRPLINYQYLSLLLPLGLIGTLIGGVLSKLCPDVLRLILLLVLLSVVLYRSWETMK
                     KQYRQDTDPMHVTVEASDANATSHQKSYDSTGKSQSRELTETAGGAKKVLGEDIAVLP
                     TPEQSPPSIERPPQSQYPQQELSMNFACFLVLLLFNILRTYTVCGGFLYWLCVLVPVA
                     FLSVVFYFNREKLRKLAESDPAQMTFTWTERNSVTYPMVAVLAGVSAAMLGIGGGLVL
                     GFVLNEVGIAPQEASVTSGMTTFFIAFSSVLQLLITGSLVVDFGVVFCIVGLCSSALG
                     QLVLMNYIKRRGLNYLIIGSLVFVVGGSLVALGGYGIYSAVISTQTGGSVLAFGRLCA
                     KAK"
     gene            <197512..>197853
                     /locus_tag="LMJF_32_0550"
                     /db_xref="GeneID:5656166"
     mRNA            <197512..>197853
                     /locus_tag="LMJF_32_0550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685318.1"
                     /db_xref="GeneID:5656166"
     CDS             197512..197853
                     /locus_tag="LMJF_32_0550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685370.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656166"
                     /db_xref="InterPro:IPR009069"
                     /db_xref="InterPro:IPR027179"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5M8"
                     /translation="MGGRTAFEDVCANEAKAWSICLETNLGGKDVRKKCGEQQQTFDT
                     CVSAWRTKVGNAVQVKGENEGDPPFQCASMACHIGECLRKYNYDFDRCEPHTQFFKYC
                     VKSFYGQDYIS"
     gene            <198888..>199424
                     /locus_tag="LMJF_32_0560"
                     /db_xref="GeneID:5656167"
     mRNA            <198888..>199424
                     /locus_tag="LMJF_32_0560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685319.1"
                     /db_xref="GeneID:5656167"
     CDS             198888..199424
                     /locus_tag="LMJF_32_0560"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685371.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656167"
                     /db_xref="GOA:Q4Q5M7"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5M7"
                     /translation="MSFHESAAAALQSGEGSLCPCSQGELPSPFGCIPTSAEDTVFIK
                     TNKLVWVNSGAQLIIILVGVIDFLLGTLYFFIRRRRNEERLERSRAARQSLRVNEDGN
                     VSDPPKKHLFSRSPTLHRPLQPVSELNGRCCGCARIADTVLLPCKHAVCCYSCSDHAT
                     YCPFCKEACTDRQRLFAV"
     gene            <201263..>203005
                     /locus_tag="LMJF_32_0570"
                     /db_xref="GeneID:5656168"
     mRNA            <201263..>203005
                     /locus_tag="LMJF_32_0570"
                     /product="putative RNA helicase"
                     /transcript_id="XM_001685320.1"
                     /db_xref="GeneID:5656168"
     CDS             201263..203005
                     /locus_tag="LMJF_32_0570"
                     /codon_start=1
                     /product="putative RNA helicase"
                     /protein_id="XP_001685372.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656168"
                     /db_xref="GOA:Q4Q5M6"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5M6"
                     /translation="MDAFRSLTIGTKFSAARNEEAAKLFRNAGKDKGSHGFPDAIGAD
                     GAVTLENASDMGSSSLSVPPPSATLNLFGRPTRSHADANAHLGVSAGSDAAAAANTAS
                     ENKALKAITFKKKRNIWRRNDLQVTGTDLPAPIEHFSDLVRPPLNVPRNVVNNLFARQ
                     HKVPTPIQMQAISSLIHHRDVLACAPTGSGKTIAFLVPLFALLKAPDASCGVRALIVT
                     PTAELAQQIEREAFFLMKGQRWKFVQHGQTTKKKDIFIATPGRILSLLEQKLLDLSNV
                     QYLVFDEGDRLWDSRTDFLTVIDRILTACTRTDKVVSLFTATLSEKVEAAARSVMGAD
                     PVRIIVHGRRSANTHVKQRLVFCGNELGKVVAMRNLVREGITPPVLVFVQSVERSKEL
                     YEEIRMEGLHMAIMHAKMTVEQREETVLQFRLGKIWVLVTTELLARGIDFKNVGTVIN
                     FDFPATVDSYIHRVGRTGRAGKEGTAITFFTEDDKERLPPIAKVMQDSGNAVEDWILG
                     IKVDRSTRRRLERTTPQRTIVSTRKRMLVAQQRVQRQYRRLEAEKAAKQASKRSKGCG
                     DCDRDDGDDSTDDA"
     gene            <204028..>205788
                     /locus_tag="LMJF_32_0580"
                     /db_xref="GeneID:5656169"
     mRNA            <204028..>205788
                     /locus_tag="LMJF_32_0580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685321.1"
                     /db_xref="GeneID:5656169"
     CDS             204028..205788
                     /locus_tag="LMJF_32_0580"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685373.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656169"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5M5"
                     /translation="MPEMSDVWLLGVVLTGETTFWLCEPTHLKPLAEDWKAINCRWLY
                     PVLENLSDFADVSGFESTDAVYEVDWVGTSRVLRPATLAWNVRGKRRKVGDTTYVFVP
                     AEEIKQLDEAFKRFVKLEATMKPPPPRGVTSSPSAAETPGPAEAKTMLTLDASPSAPV
                     HQEEDGKDGKPLVTAASLVSTQSSAPTAGEVPHETVTRAEDERSASRHADIDGSIASS
                     SAPHPRAKHHRGVTNLSSFPSHKRQTPHRGTTIYQAPVHRKPTGEHCSSEAFEWTEMY
                     LVHRGSVDYLCPKATGNAFGFRLDRVMHDGFPVFLLFSSSHNNSEVMDPSARGVPVFE
                     KAQLSGEAGEGAVRSSVLVVTRLSSKKHQPYYRTDTGRTTAGSRRRRRRGDDDSTTTE
                     EDEDVDDFFDDDDDDSESDGTYGEEEHRVGAQGSRRRAGDEAATTATPAAGTAAPAAA
                     KKPRTEAKDPAGESAVAASAARRKEKRKVDAAANKPLQAVSVNFWADPQYAAPAPEQL
                     AREFPFKSEGSDTPQTVVFSNGICVTYTASTAAKHAPPEKKRKTAKHGGAAASSEDMD
                     LSMLNEHILNAFAQVKRDCV"
     gene            <206853..>207803
                     /locus_tag="LMJF_32_0590"
                     /db_xref="GeneID:5656170"
     mRNA            <206853..>207803
                     /locus_tag="LMJF_32_0590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685322.1"
                     /db_xref="GeneID:5656170"
     CDS             206853..207803
                     /locus_tag="LMJF_32_0590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685374.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656170"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5M4"
                     /translation="MHRFRRFAPEHAWAAVRCVFQSKEFLAASKELPTTPEGRNPYDV
                     LEVTVTRATTLDEISKQFRSLVVKYHPDKPGGSTEKMAEVNLAYKIVKENHDAMLRRM
                     REAESTIKANEAYRQHKHARASRDEDLGRSGGLNRRNSRATREAAESTNLRRTRSLKE
                     IEAQWAQYKEDTEAAVKSMCNRYELAVQQGKFFRKSATLNEITVRERWLRKSFVKGAW
                     EDVHELRGELLRRGTRSAQQSELAEEMVSFASTTQRKLNENFQRLTQESVQSQSRMLV
                     ERAFFIVCSVILLVKVWRWFVGFTFNNTLTVKLKRGFLSQ"
     gene            <208634..>211069
                     /locus_tag="LMJF_32_0600"
                     /db_xref="GeneID:5656171"
     mRNA            <208634..>211069
                     /locus_tag="LMJF_32_0600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685323.1"
                     /db_xref="GeneID:5656171"
     CDS             208634..211069
                     /locus_tag="LMJF_32_0600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685375.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656171"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5M3"
                     /translation="MLPRPQTYQAKPYVPVTSAAIDPYEEGQSFLVDNDRLDSWFRYV
                     EAELQRYRSPFVAAEALLTELRLRSHELYQPERLYVSTALRILQACVPHLSPETAQVA
                     QTAVHELLPCLMYTRCTPLTTLTSEPSSSRGLEKVTQLTYAGAFRLLLNRLQQCQTQL
                     RRLEGHARVEAKVMDLLVHGLDHMWLKMCFYSWRTFCRQLEMRKARLRRRLLRVTANE
                     AVPAFLRTWRQHAHAIALDAKTSRNSFLQKQVEALYPLEQEAKSRYDHLCEEIKEKNR
                     LAGDSLKRLEETKCRLKVLEDLIAETQRSLTDHWTTWKECTRLMFDDIGELPGKTNHT
                     LRTEYVMNITDTASALSRRARGRAGRMGLRHVAQFLLFEGELGVDVDTQTVGGMKGSL
                     SAKSGIGSSSSTSWPVPHDAGGTALSVPSKTPVTHTVPTKSKTMVSLQVQPSDPDPQS
                     TVFATSLAANVNDVYWTVATVVQPVLTPLHLIDVLHHNEAHLSITLGFLSTVYSGGHC
                     SLFAPAARAAQRTEKALLPLPSSQGFGKVSPTAAPKDGSDDGGTPAAAEDVKWGALMM
                     QDVTRGMAKVQDCVEASEGYLLSVRQGMMMSELEVVQGYLEDLYRRWAAAGIPLSQQK
                     LESVWQPIVTPARLPILQALYPEHGITCFTELVHYVARVAEFSGCSLQALAERLDATY
                     PYDSLEELRIVRRSDEATELFREHAAHLATLLVYLKDKANSSQYHCAHLSVLLEQEFG
                     LTPAEAADISRYARNEGGDVVNRDDIEWLLLFSALYVDPSPFTSLLDKVARLLEDCTP
                     FFQQLARAASAAT"
     gene            <212217..>213308
                     /locus_tag="LMJF_32_0610"
                     /db_xref="GeneID:5656172"
     mRNA            <212217..>213308
                     /locus_tag="LMJF_32_0610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685324.1"
                     /db_xref="GeneID:5656172"
     CDS             212217..213308
                     /locus_tag="LMJF_32_0610"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685376.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656172"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5M2"
                     /translation="MSRLVTQHKTYVHHVALDPSGSLLASCSSDKTVEVFHRRTLPGG
                     GAVWEPGCAMHDHSGPVLRMAWCQHREHGPLLATAGADRWIYIYRIIISSHEGRTLLH
                     TVRWSPVRGYEKDVITDVAFVPPQQYHALLLSTASLDGCVRLYEVHQPQQFPCVCRIS
                     PEADAAAEAASDSAACAVGVSAGSAVAERREDTSASPSASSVPLLRSGGVTAIGWFPG
                     SAERTMTLAVGTVSGRFFLYRYIKDSNSFMKISLPQVEAGVLRCSAPVCNVSWASCVG
                     RRFQLLSICSRSEVFILRLNCVSPSIDEKRSFELFRVPFGAVSASWGRSSTLLYLATD
                     DRRTQVIVLQMANPLDHQSWKVVSRNAAE"
     gene            <214678..>215841
                     /locus_tag="LMJF_32_0620"
                     /db_xref="GeneID:5656173"
     mRNA            <214678..>215841
                     /locus_tag="LMJF_32_0620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685325.1"
                     /db_xref="GeneID:5656173"
     CDS             214678..215841
                     /locus_tag="LMJF_32_0620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685377.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656173"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5M1"
                     /translation="MERGPRSSSGGPDGGLCALHSKRRSKADLIPWNQQPGKMRCLLQ
                     KECHVRSENRRAGGREQGRASGGGSGSGGGDVRERDRRGGMGRAGSGRERGGRRERGD
                     RSDRRERGDRNDRRERGDKGDTVLCRLHRQRRSARQMREVGAGVFECAEGSRCKQAGD
                     RRIGAAGGRGADERGRFRDQRGPSFVERGAGARQRQRRGERAPRPTQDQRYDDANAAA
                     WAPSAGTGVGGGAAARRRTGKAERKVWCALHGKHLPASQCEFVQDCCYVCLDPSSCLA
                     TPLEAPAMLLTRGCAEVLCSKHHTLRSAGFVELTEKPVAYQCMPGHACRGVTVPHMGQ
                     EAHGAATASGGGPAAMPYAMADMDDDEEVYMGARVNNTFLPQSGREAVSSFFM"
     gene            <216667..>217227
                     /locus_tag="LMJF_32_0630"
                     /db_xref="GeneID:5656174"
     mRNA            <216667..>217227
                     /locus_tag="LMJF_32_0630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685326.1"
                     /db_xref="GeneID:5656174"
     CDS             216667..217227
                     /locus_tag="LMJF_32_0630"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685378.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656174"
                     /db_xref="InterPro:IPR002733"
                     /db_xref="InterPro:IPR023473"
                     /db_xref="InterPro:IPR027485"
                     /db_xref="InterPro:IPR027623"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5M0"
                     /translation="MTATPEMAEYCLRVIAQQISAPDDPSVPLPVIPKEDSACFVTLT
                     TLPQERLRGCIGSLQPGDLKKDMRRLALAAAFQDSRFPKVKEEELPTLRCCFSLLHTF
                     EPCAAWNDWEIGKHGLIADYDGYSATYLPSVAEEQGWDHRETLVSLLEKAGFEKPVTD
                     HVLGKVRLTRYQVSKALKDYKDIIAS"
     gene            <219837..>221654
                     /locus_tag="LMJF_32_0640"
                     /db_xref="GeneID:5656175"
     mRNA            <219837..>221654
                     /locus_tag="LMJF_32_0640"
                     /product="putative phosphatase"
                     /transcript_id="XM_001685327.1"
                     /db_xref="GeneID:5656175"
     CDS             219837..221654
                     /locus_tag="LMJF_32_0640"
                     /codon_start=1
                     /product="putative phosphatase"
                     /protein_id="XP_001685379.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656175"
                     /db_xref="GOA:Q4Q5L9"
                     /db_xref="InterPro:IPR000242"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5L9"
                     /translation="MLADVTDTYGRLPSERSARGHGGAKHQKKKKRKTKLRRVDESEQ
                     DGWLDRARQGLHCSLFCGGTKCRQESWEAMKEKDQRAAAIEGLQSNWVGNDVIASQRP
                     STSLFLKYPIIAQFHAKNVTGVLNLQEKGEHGNCGPDGIYESSGYSYNGAEDLMPHGI
                     SYYEFPWPDMTAPQQDIVLRSVQVMDYHIKQKGKVLVHCHAGLGRTGLMIACYYVYSQ
                     HIPSDEAIALVRKMRPGAIQTTRQAQFIADFEKHLWRLSQAFRVEISDALIDLNLFIQ
                     RQRLVLHGEQADLYKSVPLFLHTILCRLLNLTKDNPEAARLALQSLGPSAAPTDTTLS
                     ACRIAINRRRFRVQSVRDVSILSFLVCDWFRSTSSPALTEENCDQIVESMRASISKQE
                     GLPLEIRRILSKPARHTLGMVISAFFIISRQVGCVSLTNFAFRCVVDSFNHAFNPIKV
                     RHSPLERELIHKFFLEWGESVGDLYFNYDTVPAAHRTIKRIALASSIVLEATKNTDPP
                     RRSSPSVRTLSVPSSTPEMSSNPAKQTGAPDSALVFSTQSRASHLFDMPLAVETDSES
                     KTRLWRQHLIEYRRDTDGRRGRGERQRPPASSADAKVKR"
     gene            <223268..>224116
                     /locus_tag="LMJF_32_0650"
                     /db_xref="GeneID:5656176"
     mRNA            <223268..>224116
                     /locus_tag="LMJF_32_0650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685328.1"
                     /db_xref="GeneID:5656176"
     CDS             223268..224116
                     /locus_tag="LMJF_32_0650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685380.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656176"
                     /db_xref="GOA:Q4Q5L8"
                     /db_xref="InterPro:IPR009097"
                     /db_xref="InterPro:IPR019510"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5L8"
                     /translation="MRTQCSRALYGRSERGLYFPINHRIVDQRNTLGSGAEEADIQSR
                     YRRQLRSSFVTRETRQTEPPAWSRSTRPTHFLSLPLPARCTLRVRVKEMHESMIFANQ
                     SIEPLLIPAAKLHVTLGVMTIGGEMVTAEAVSAAAAPDVLAAIQDCVGQACHDTCKEP
                     LQLRFRGLGTFAHGRVLFAGCITEAHFTTLDTLVRRIRRDVGLGLGVDMKGNPHDSYV
                     PHVTVAKIRPSQIGQFGRQLPISMWADHQHHDFGDVTFNRVDLCSMKGEGKDGYYHVV
                     SSIAVQ"
     gene            <225079..>225708
                     /locus_tag="LMJF_32_0660"
                     /db_xref="GeneID:5656177"
     mRNA            <225079..>225708
                     /locus_tag="LMJF_32_0660"
                     /product="putative centrin"
                     /transcript_id="XM_001685329.1"
                     /db_xref="GeneID:5656177"
     CDS             225079..225708
                     /locus_tag="LMJF_32_0660"
                     /codon_start=1
                     /product="putative centrin"
                     /protein_id="XP_001685381.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656177"
                     /db_xref="GOA:Q4Q5L7"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR029527"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5L7"
                     /translation="MPTATKKGPRTGTSKSAKGSIVCAVPGTDAKHTAAPSPFTPAAL
                     LEVPPEYKQQLRQAFDKFDDSGKGLIPAHEAVVALYALGYDVGSTELQQLLQEVGAAG
                     AESIDFNDFYNVLVLKMSKKESKTESVRAFKQMDRDDKGYIGLEDLRSMSNSLHMNLT
                     DDELSEMIQFARSVGYHAPAQGQSEFDARDMLAVSEAEYLRLMKRANVY"
     gene            <227021..>227929
                     /locus_tag="LMJF_32_0670"
                     /db_xref="GeneID:5656178"
     mRNA            <227021..>227929
                     /locus_tag="LMJF_32_0670"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685330.1"
                     /db_xref="GeneID:5656178"
     CDS             227021..227929
                     /locus_tag="LMJF_32_0670"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685382.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656178"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5L6"
                     /translation="MSIFGVSSYFLWTQKGQTVLPLVRGSGFVMSFQQLNTFYSYHVM
                     SAAHVTCPVKHRKLYGDTIGLKAIGERHISTRLLIPDEATHRVQSSFELEFRQQYMPN
                     TDVASLRLCKEEQFKKAMLPPQDSGTGTASPLQVILPDLDRIEEGDELILCGVHTEEE
                     RANPNDDGLVLNPMRLIATCKAALLSLDYGTVLLASIDGPAEEARESGSGSAASASRP
                     VTVPPLPLSMCGGPVLRRSSGRCVGVIAARVMANAPPRDPQSTSLYQDPYLDISEHIA
                     LHAHWPLDVAFVPIGEFYDPLRRCEM"
     gene            <230016..>233369
                     /locus_tag="LMJF_32_0680"
                     /db_xref="GeneID:5656179"
     mRNA            <230016..>233369
                     /locus_tag="LMJF_32_0680"
                     /product="putative OSM3-like kinesin"
                     /transcript_id="XM_001685331.1"
                     /db_xref="GeneID:5656179"
     CDS             230016..233369
                     /locus_tag="LMJF_32_0680"
                     /codon_start=1
                     /product="putative OSM3-like kinesin"
                     /protein_id="XP_001685383.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656179"
                     /db_xref="GOA:Q4Q5L5"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5L5"
                     /translation="MVKANSGAENIRVVIRCRDILPYEAERGDKALVRLDLATNQVVV
                     QHPIGDADVFAFDAVYNNSFTQRDIFLQEVQPLADAVLQGYNATVFAYGQSGSGKTHT
                     MTGKLSQRNMWGMMPQVVDYLFSEIKKLTSSTKTFKVKVSYVELYNGKSRDLLSSKQV
                     NLEIKQNTSKNFYVKGAEMPEVTSFEDAIKWFNAGTERRQTASTDLNDTSSRSHSLFT
                     VQIEHFDFENDPSSPIVMTSKINVVDLAGSEKLSKTNATGETAKEGCNINLSLSALAT
                     VIDTIVKGAKHIPYRGSPLTMLLKDSLGGNAKTVMFANVGPSDKNLSETISTLRFALR
                     AKQIENKPIKNMDPKDARIQDLMEQIEELKKRLGNVDLNVEDSLRQRIEELEVENSDL
                     RGGSEKNNIELEERNRFLLAQIEEKEQEVVERQHEIRKEMERRELVESNLSNESSRLR
                     DLRLANVNFLKRVCTDEQLEQIRMHMSPNKAAKKKSDEWDVKEIGFYLHGFAEQYEQW
                     RKVTYTQEDMEKYARRAMAELERQTQRQLNDAAHAKEDLQRQRDEEAARRTAEQGATS
                     QLKVDLNALREENVKLREKIERDQEKIKVKLAKAKDDMKALQDQVESAKSKVTDKERE
                     VKRLRLMLEERGGASIVGAAGGPRSSLSAPGQDPTEWGNGGERAAIMHELEVARHAKS
                     VLENRIRETNVSLRRFGVCIANPQSLEGAGATTANEVQAFVLAATEEEPVDGDVVAQL
                     QQQLRTKQRLAELMHQHQMRLNDMICKYELLKTGHVTVYSAATGSAAAGAVSAGVAQG
                     IPADMNGIGGIDEATANQVRELLQRKEDQLEAMRLEKDQACDKLVKKLNKSERKLREL
                     ESLLEEERTQFTEEKAEMTKEVAELQSYNQQLALELENERSQLAFVKAEMASAVRAKE
                     GEVDYYKTQVEEANQRLDDIRNTAAEFEEQRKSYQRLQEQVARTEDALAIKNGELESN
                     RQMVQWSNRQLEKEKQKNEELEQALQDKQLELRQQEQNFHAEMADRLNALAASNNRRL
                     AENAAQCEERINEERMKEKALQKKIKNAKTTASKAAQRYDEMILENEALLSKLEELKV
                     TSMKMYLERQESQREQDYRPGNTIRSRGL"
     gene            <235181..>235861
                     /locus_tag="LMJF_32_0690"
                     /db_xref="GeneID:5656180"
     mRNA            <235181..>235861
                     /locus_tag="LMJF_32_0690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685332.1"
                     /db_xref="GeneID:5656180"
     CDS             235181..235861
                     /locus_tag="LMJF_32_0690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685384.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656180"
                     /db_xref="InterPro:IPR022801"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5L4"
                     /translation="MVRDTAEKKGFKAAMGMEAMKAKMESVKRSKRSKYTPASQHSHG
                     NPIHRPLKFHERKLLKKHDFMQYPQDNWHEPFCITKYHLEDREDYRRYMRLVGLIRQL
                     QTQLRYLPAESKIRIQITQQLMEKLYNMGLIHEKLGLAEVDKVGVEAFCKRRLPTILR
                     DLKMAGNCKLGAEIVHHGHVRVGTTQIRDPAFLVPRGLDDYVTWMPGSKIRQHVDTFN
                     AMRDDYNY"
     gene            <241132..>241836
                     /locus_tag="LMJF_32_0700"
                     /db_xref="GeneID:5656181"
     mRNA            <241132..>241836
                     /locus_tag="LMJF_32_0700"
                     /product="putative ubiquitin carrier protein 4"
                     /transcript_id="XM_001685333.1"
                     /db_xref="GeneID:5656181"
     CDS             241132..241836
                     /locus_tag="LMJF_32_0700"
                     /EC_number="6.3.2.19"
                     /codon_start=1
                     /product="putative ubiquitin carrier protein 4"
                     /protein_id="XP_001685385.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656181"
                     /db_xref="GOA:Q4Q5L3"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="PDB:1YF9"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5L3"
                     /translation="MSGAGNLRSNRRREMDYMRLCNSTRKVYPSDTVAEFWVEFKGPE
                     GTPYEDGTWMLHVQLPSDYPFKSPSIGFCNRILHPNVDERSGSVCLDVINQTWTPMYQ
                     LENIFDVFLPQLLRYPNPSDPLNVQAAHLLHADRVGFDALLREHVSTHATPQKALESI
                     PEAYRPHDNTHEEEPDEANAKDTASDGPVNAGHSKGLTDSSVTPTEDHRVMHDDIAID
                     GDEDVEAEYEPEEIDL"
     gene            <247473..>248363
                     /locus_tag="LMJF_32_0710"
                     /db_xref="GeneID:5656182"
     mRNA            <247473..>248363
                     /locus_tag="LMJF_32_0710"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685334.1"
                     /db_xref="GeneID:5656182"
     CDS             247473..248363
                     /locus_tag="LMJF_32_0710"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685386.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656182"
                     /db_xref="InterPro:IPR002782"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5L2"
                     /translation="MPCNVSCSTSPNSVTGEPRFIMDFSMNKVAKYFRLLGYDTLCSR
                     DVPQANLIPTACAEGRILVTCSRPLARSVQLHNQRVRTMRLGIAKAMTGAAHHVIAYD
                     SDGESIYSEDSEEVDVELRCLFTQQWCSGEFKRAMIELIQQAGVTYDLNRVFRRCVTC
                     NELLVTMEKEEVRGRVVAKIYEIYDEFTECPTCRKVFWGFDGVFAINYKSFRSLNLLR
                     SLCICAGAPVEEERTRLNRLRCFRSFPRIAKVLIFSYLEDVDLANMTVVFPALRDLAE
                     EVQASRQTGEPVRKMQLRKH"
     gene            <249062..>249631
                     /locus_tag="LMJF_32_0715"
                     /db_xref="GeneID:5656183"
     mRNA            <249062..>249631
                     /locus_tag="LMJF_32_0715"
                     /product="U6 snRNA-associated Sm-like protein LSm4p"
                     /transcript_id="XM_001685335.1"
                     /db_xref="GeneID:5656183"
     CDS             249062..249631
                     /locus_tag="LMJF_32_0715"
                     /codon_start=1
                     /product="U6 snRNA-associated Sm-like protein LSm4p"
                     /protein_id="XP_001685387.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0715"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0715"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656183"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR027141"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5L1"
                     /translation="MHPFKRLSWTHLFFKPFWSSPRISCASIVTCTHQSFSSPCTRAC
                     KHTSRRQEVPSTGNSVFIVHTLSLKQTFRMSFARRPITPIEILRNCRGKEVSIELADG
                     ETVNGTVMRTDRAMNVVIKQCTRTGADGESFWKSRECFIRGASVKNVRMTDSALVAVP
                     VLSKRKAAGSKGADTRKEKSVAGGKRPRR"
     gene            <251421..>252866
                     /locus_tag="LMJF_32_0720"
                     /db_xref="GeneID:5656184"
     mRNA            <251421..>252866
                     /locus_tag="LMJF_32_0720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685336.1"
                     /db_xref="GeneID:5656184"
     CDS             251421..252866
                     /locus_tag="LMJF_32_0720"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685388.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656184"
                     /db_xref="GOA:Q4Q5L0"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5L0"
                     /translation="MNPVTGSIPGVANGAQMMSPTFPSPHSLYSPQHHMDVYRTNGNL
                     SLAADPFPVTPYTPISSLFMSPSVRNSLTTPHSVRPRRPVTHVTSSKFSMYTTIYNLE
                     PEPKPSVMMPKVRMQVYQTSARYTGKDILLRRLVNVPVKEEECAAVKEALRQYRHPNL
                     VPLTNLFATEEFVMGSTDVIMEYRYMSGAKSLQEAFFTEGRRATEGLLWSFTCQLVGL
                     LRSFHETLIPLHGLHWSKIIYVETTGRFYFTGLGLTDLLEPRGTTVQQHILMKQDIQA
                     LGFILFQLASRNLNVKLETFTNKQPLPGFSQSFWELIKTCLEGHADSAQLCHALGERM
                     SMEVGHQEGHTDFLMSQCQKEMHNGRVMRLLIKLSFALESPAEVHEYTSENQRYVLRL
                     FNQFLFNQVDEQNRVNVDWGHVYHCLNKLDIGSDETIQLIGTDTSNTVLVVSYADLRA
                     MLDSVFDRVQQVSQMTTDVDPQRYTMTPGSI"
     gene            <255330..>257123
                     /locus_tag="LMJF_32_0730"
                     /db_xref="GeneID:5656185"
     mRNA            <255330..>257123
                     /locus_tag="LMJF_32_0730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685337.1"
                     /db_xref="GeneID:5656185"
     CDS             255330..257123
                     /locus_tag="LMJF_32_0730"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685389.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656185"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR003603"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5K9"
                     /translation="MAAMTKDVIVASCKANGGYAAPCLNDQLFLHCCGFTSIQNLEPY
                     TDVKVLWLEQNALSELSGLESQKDALVSLFVQNNFIRSLSSLTATLHGLRVLNVSHNY
                     LTSLHGIAAGCPSLETLQASHNQLTSLEVCEELWQLAGSLTSVDLSFNRIETAREPAG
                     SAVAALCATATTAAVRDSGCTADDDDVRIVDASVISAVAPAAAPTTALALPKPEPLAI
                     AQFFQHLPLVSVIYFQGNGLSHRLRHYRRNMILHLPALTYLDDRPVFPEERRVTEAWG
                     RGGDTAEAAERATIREEKRAHLTRCVILLTEQREEQRVLRDRLTRQLDQRRAQELEEL
                     TQRRRRDRDDRAAVESAESVARDVVAKAEQDARWDVEELYQEAHRAMLVTETERRHAY
                     EQHVAVTEAAQSAAQEAVTERKAEAGADSGDDDSNTASAAAAAAVKVLEDAATCSPDG
                     FSSTCRDSDVSDTIATTLEPPLSPPSSVLAALLQLDDDVLKEMEMEIERVLHDVNSSA
                     HPTKCASTAPGAGAEELDESRAMFSSRQVWDRAALRMEKNMRVAVGHVSKQLQAQRKQ
                     QRRRSSDVQQEEVWQRFEQWKARRASQPLDS"
     gene            <258388..>259557
                     /locus_tag="LMJF_32_0740"
                     /db_xref="GeneID:5656186"
     mRNA            <258388..>259557
                     /locus_tag="LMJF_32_0740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685338.1"
                     /db_xref="GeneID:5656186"
     CDS             258388..259557
                     /locus_tag="LMJF_32_0740"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685390.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656186"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5K8"
                     /translation="MPGASDRGTAYVSCRIHCLPACFSRAVVAVCKLTSPAPGIPPLV
                     SLCRYGLPGYSAQEGEAFSAAASGLHPRHQLPFVLSRVAASKAIASLSPDKRAACPGE
                     EDGPAVVFTDRREAAPTLHGCCLSIAHEDSAAASVAWSVPSPDSSSFKDYHAAPERLY
                     MEAQLVCSHSTLPDATATSFAYAIDVVNVAEVHRVRSRFPHFGQRWMPQCTTTASADD
                     VGRALTCVQKQHQECVAAVGAPGGSHGGEGVSACQAACRRDEWWKHLVTPYVTEADAY
                     AAVVLAQHWGVRECAVKLVGIPGRSFAYECVRALPPRGGAVVTESTPFTASFLMSHTL
                     YSAEVHGAEAATLAQQRLHPLLYLYTWTEWVPLNSTVDLPYVVVLACAPCRSDAR"
     gene            <260237..>260944
                     /locus_tag="LMJF_32_0750"
                     /db_xref="GeneID:5656187"
     mRNA            <260237..>260944
                     /locus_tag="LMJF_32_0750"
                     /product="putative RNA binding protein"
                     /transcript_id="XM_001685339.1"
                     /db_xref="GeneID:5656187"
     CDS             260237..260944
                     /locus_tag="LMJF_32_0750"
                     /codon_start=1
                     /product="putative RNA binding protein"
                     /protein_id="XP_001685391.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656187"
                     /db_xref="GOA:Q4Q5K7"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5K7"
                     /translation="MPAKAAAKPVKPAAKAAPKPANKAPAPKAAAAKPVAKAAPKAAA
                     PAARPASGSSNGVYVKNWGTGSVADAANVFSAAGKVVKVQLRRQRYAIVFFENSAAVK
                     KAIDLFNEKEVLGKTVLVVPAKTSPKPDAHENSSCVFVSPIFRPSTTKAQVMELFAGV
                     KVQRLRMYRQNFAYAYLDSPAAAKKFVEEKNGTEFRGHTLRVALSARSLEKLRARQEA
                     ANVVIAAHRHYKTHERQ"
     gene            <262632..>263522
                     /gene="CYC9"
                     /locus_tag="LMJF_32_0760"
                     /db_xref="GeneID:5656188"
     mRNA            <262632..>263522
                     /gene="CYC9"
                     /locus_tag="LMJF_32_0760"
                     /product="putative cyclin 9"
                     /transcript_id="XM_001685340.1"
                     /db_xref="GeneID:5656188"
     CDS             262632..263522
                     /gene="CYC9"
                     /locus_tag="LMJF_32_0760"
                     /codon_start=1
                     /product="putative cyclin 9"
                     /protein_id="XP_001685392.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656188"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5K6"
                     /translation="MSSSPLSPVYSSPASTGFGAPYLPSFTRRYFRLSQSAFVISDYL
                     VRKFCLTESVLLTSLCYWHEFVAAHGLRKVNEVVLATTCVFLAAKVEHAHIRLARLVE
                     TALDLDANTTAAAELEQWCRAVLDVELVLCDTIRFDFVRIFPLADTLRSVQTLAEAGQ
                     LQDAARQEIGTAVRRVFLFSFVTPLCTKVSMQRLCTSILYMIVTAARREPVPAFQSIW
                     SAPEAEFPDEAELEGITAVLMDVFAYLHKKFGVPALDDVNEARYKRRRSQHGNDVGVA
                     SSVFSSASADFTPLMKMSEQ"
     gene            <264566..>269497
                     /locus_tag="LMJF_32_0770"
                     /db_xref="GeneID:5656189"
     mRNA            <264566..>269497
                     /locus_tag="LMJF_32_0770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685341.1"
                     /db_xref="GeneID:5656189"
     CDS             264566..269497
                     /locus_tag="LMJF_32_0770"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685393.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656189"
                     /db_xref="InterPro:IPR009771"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5K5"
                     /translation="MQLCSGTVSVHCREDVCQDGESVQFMAVNTSGTILAVLTQLRIQ
                     FWSAGPKVVYLTSLAVPGTSLEDNPAMYALWRQRPGNHLAVVTARHVVFFEADINLRT
                     PDFLQAIERNRHVVYLQHVDSASRVCYSSDVPLVTGLVTSAAAAGPYAFLVTTTAGVV
                     YVLGWHQQDILHQWTIVGLQGGGHTFRCATKDEACDFMTAAGCPDVLAAPDKAPGNSS
                     LSSPAVRSTKPLTSPQSRVDPLQRRYRQDLPVSSSDAVGDSTTSTAAAASAPAAVQPP
                     GTAVRAHATQFRSNDTTTASPPLPDGEATNTAAPPEKDKDTEGLAADAHSICASATMG
                     TRPQKPWQPSSLLPSSSPTDCAAARSSAGAELLSGTILHASFASRMKVLTFVFSSGSV
                     LLCRPSCGTNFTHQKVQLQGFVTPIVSACMVAINVRHLLLAVCTQAGALSCRRIDSTS
                     LAVHPSPLWKGLRGVSDAVSKYSCGVPPASQSLGLIAGMEWSPSEELLCVAFYKHGIA
                     LVHYSGGVVARHLSGPASATLLRTPPVPPIDSQWPPDDAAALIGENAQASSLRNEQEK
                     EAVLGCSAISWKPDGTRLWMAAPRQPCFFSTQLSRVLTVDTVGPTSGNHTPLALLADN
                     ALYLVSVSEATAAQGVREMVLLPDDYLRDQYPLLHGAVSSDGSWMTCAGRRGLVLFNR
                     ERYSWKLASKEEEESFSCVADPVWLRDVAVAVPALRTDSKTFELIVFSTSSVSPSHAS
                     ARVALDGRPTQLSCLHQDHRGEGYVVAVDCNQMVRVFRYDVFTDVATERSSATPYVAL
                     TPVQQLALPSELSNPLRVIPVCLRGEEGDRESPQRTEDHMELRLLLHKRSDHTLVWVR
                     GERCAAGDAGCGCASSAGSWPSLNAVVEPVDLANRCFVFRCWVDRTAPTRGAVVLAHE
                     EEQGLVMYQLHLSGLRPNATVAPVAHRMKVAATRDSELLPLCPSPFDGYMLCVATDMS
                     APRPSRRRSATGVIGGVSQASPRPQLALRPILYAHRILSLLLLAAMPSSPASHRVSNA
                     PEASASLPSLISSAPPRLEGCATASAANASSTSSCRAAEVDGCVATFMWDRSLFYWLE
                     HMRLNDTFTAVLDYFLHTALNESPPAAVPGLGRYSAVRAAISLLRNYPEFYAIVVGCV
                     RKIDFARWHLVMDFLGTPTDLFHECVAHHCYAEAVHLVRVIMMGTYKPAATLPVDRTA
                     ELGSGGRSGSDVTRLQQASQCAVELFVLSVENGSYTAAYDIMRFMALLEEEIGMPAAG
                     GLDLHGGSGGGAGGSAASSVDFLTWWLRQLTFSGSARYDGEAAVEEPSGKKKASTGAS
                     SGDVTKTHSVEGFPALVFDVTRCDPVQSGRTAEEAAEETQRQAAVHHMFRRHGALPDA
                     VHREALRLLRTGYVTQLAKLMDTFSFSVAEFLQAVRPVLVEAAAADTNDAADGGVGCD
                     RVTACLHDIFDGLHKELGLPRSFAANVSPTASTTWSAWLVEKQTAQAAALPGVLSSTN
                     PKVWTVVQSALYASPSLLSSVESLHQLFAPVFVDNLAFCVLLMRKSNLISLLLSHEAP
                     ACASAGRPEHVSTDSMTQSGVSPTKLIDVLGQLDALLAVPENAGYRPFLQDIFTSLPP
                     SVLHAIAPPVASRASGVAAASPEVDANSTGAAE"
     gene            <272153..>275578
                     /locus_tag="LMJF_32_0780"
                     /db_xref="GeneID:5656190"
     mRNA            <272153..>275578
                     /locus_tag="LMJF_32_0780"
                     /product="putative protein kinase"
                     /transcript_id="XM_001685342.1"
                     /db_xref="GeneID:5656190"
     CDS             272153..275578
                     /locus_tag="LMJF_32_0780"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001685394.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656190"
                     /db_xref="GOA:Q4Q5K4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5K4"
                     /translation="MDSTLAKLPATRWDRLIAVLEENEPERAIDAPNILERAKKLNLS
                     DLELFYLLLMRYQDKQPKILLDVVSLYAMMSTWMEWIVQVQRCLDAKKRKMDASSPSH
                     TATGGSVLMPTSSDFADSGCTFLSCSSGYCTNTPLSSNPVYSSENYDNDFGSGPDSAT
                     HVARNPVSSSVRGFHDKSGRRSHSTSFHRCFDLGPDWKWDGSLDFLRNGRVLSCLVEE
                     TLDHCGKLEVLQDDHCVHPGTPNPITHEILYPSLADIDRVFKGAAEDGATGVVSASRS
                     FSTLNYLSTLDLSRGLQLSRSDKAQPSKALKLIEEQGKNLAAAEQWVRKLNSMCERFL
                     GWEKSAHKNRAFFDLCNPGNLVRPLNSDDARLLYRMHWLAVALYRAVKDASIIPEPPR
                     MSFIVCRDDLGGLPDTSAEDDEIGLLVATRCSCLPLKARLNVTMKDFNSMQLLHPDMK
                     HAPRVLPCTIVKDEVFAYFEEHHTFVPVWSVFQYHLQQFDGLTWCFEMSRQEREQERQ
                     VLGTNFSAARPDLGASDDFAFNGSSAAFDLTVRSSTVRHDRQRRPPESPGNTQWMRGS
                     TTPKPFDLSTDCKASVTLLPQRFSHQPAAQSGTGVEMGVGVSKVRPSRIATPSPRPFS
                     VSPSLPSLPSSPATTSRVADTFAQLNATSAAGTGITKNANAVSSTTCGISTAAVTSAS
                     SSGTEAVVNAIKSPISDLSLPMTASRQATAVCTTGEQETPSAHIAYSLPSKRSSETLD
                     EPTEDTELTSQEVVVCMEAKKKEVVERDRIVGAVASDAAVLKSSCTISCSPSSQMMVA
                     LEAHYHGGVDSLEEDDDVISDATMTVVGSESHTVIRNFTAAVVQESEQSGISILSHHF
                     RVSSGPIGKGAFGAVYRALNLDTGRIVAVKQSRYSYDDKTADLNWREFQMWSKLPPHA
                     NVITFYGASREVDTNQLLLVMEYASGGSIVQLYRYFRPIPEPLFYDHAVGIARGLKHL
                     HDHNVIHGDVKPENVLTRSDGSVAISDFGCSSFSLVSSDNGSPLLRSSNQENGSLQLF
                     GTAAYMAPEVILNEPHLKSDVWAYVCTLVQLWLGKPPWSYGELRFSVLDSIPLMFYIA
                     NEDVVPFTTEQLERSPRWLQCIARRAFERNVERRCTMAEIISILADYSKVYRP"
     gene            <277219..>277716
                     /locus_tag="LMJF_32_0790"
                     /db_xref="GeneID:5656191"
     mRNA            <277219..>277716
                     /locus_tag="LMJF_32_0790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685343.1"
                     /db_xref="GeneID:5656191"
     CDS             277219..277716
                     /locus_tag="LMJF_32_0790"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685395.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656191"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5K3"
                     /translation="MGLDILEIDTTTPHPGVTIDGTTAQRETNGGWVTLRAKTPLSAT
                     NHQWAIRIIDQGEGADGSGLMIGLLPQLSAQLASATGSKYISELGGWCLSRAGDTYGA
                     WKCDRFPYSTDCVVEFDWDAVTGTLCMVSGNKKGTGHIPGLKESDVLYPAVSMYYLNQ
                     KVAFV"
     gene            279509..282499
                     /locus_tag="LMJF_32_0795"
                     /pseudo
                     /db_xref="GeneID:12982105"
     misc_feature    279509..282499
                     /locus_tag="LMJF_32_0795"
                     /pseudo
                     /db_xref="GeneID:12982105"
     gene            <282970..>286362
                     /locus_tag="LMJF_32_0800"
                     /db_xref="GeneID:5656193"
     mRNA            <282970..>286362
                     /locus_tag="LMJF_32_0800"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685344.1"
                     /db_xref="GeneID:5656193"
     CDS             282970..286362
                     /locus_tag="LMJF_32_0800"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685396.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656193"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5K2"
                     /translation="MLSTHASHQLAALTFLLRDPRQFPVVIVAGRSMSAVTALYRVLP
                     TAAYMMYNTEARGDGCTAFIKADYPDLPRPSSVRLVPHTAALLGPELCEKSGAYVDIM
                     RAAAEPVGTAEVAASSEADDGVAAEFCGGGSIPPGAQDEELRHSITSSFTEQFISLIE
                     DECSPPCAHQSCIETVPVQPAGKREARLWGREFLHHSKLHGARSGSVFSHHDMHHEAV
                     QHGIHWVVPRWLIDGKVDLRTAMDAWRSLLSQSRPGEVVSLVLFVNVDVVDLTSLIGH
                     SDLCASRERSLLRSDAVEKEKLCRASPPPEGCGSCAALRWPLHASSQLRASLLSLQAN
                     ATAFAASSSGRAPSAEVVGARTPLQSIGARSGAAADLPPRRRSLEVPIVNCWATARTM
                     EIEHAKHAHRLTVDAFRHLFSVFDVHHPMHRRRLLCQRSLHESLQRIPDPLQKWQWVL
                     HQDSSPYPVPPSDATLSRALPYVLVKDAKEQRRQHQRAFRRNVVDAAMLQSLNSRGLS
                     AALSTAGSTRALAPFPRPRYFTTLVSDAGSLLVRDGCLSDLFVVEFQPTLLEAELSSH
                     YWRSVRETTPGGITGLSLRQHHVFLKLLSAAEELVAAAMPSTSLTRDVLENAVRFLYT
                     CGRGRSLLAWPLTDPAEGHHRLRVAFTLSYEFYADPLVFSRRFRGAARAGYVGEAQIR
                     RLASGADVASSHAAAAAGFGSAESPCRTETLKDVVSYILATMRRLGWVLVWQEDHHHW
                     PTAVPPPHMHPHINGMPSAFPLSRCAGPALQERIAASLERWRHEQLRLHNKRYDADVS
                     AGALKTPSSHQTVVSTRAAAADAAAASPYTSLDVWQAALIPEDAGVYLWEGQTVFLDE
                     GCPGVIVEFRPPPAELFTSIERHPTEAKRAYWRVQQDLHADFIHFYRWRQHCFAAADP
                     REVRAAFTSLPHYVRAREMTHFPVVELLHASPGGKRPRVQVLPIRAKQHYVGYPRVCV
                     VSGAEQKNWHEAHGRLAPSKDEFRDLVWRLSTTDVDDRSASRVTLLRLPLSPFRIEAA
                     ALPFVSRVMELSRRPVGQRTQRALSHATTTKKRQALFQRLNVEWASCHGKTVVHDRLS
                     ALQLRPVKERAHINWRSLPTSHHSAAALYFAFFTAHPETVLP"
     gene            <291757..>295863
                     /locus_tag="LMJF_32_0810"
                     /db_xref="GeneID:5656194"
     mRNA            <291757..>295863
                     /locus_tag="LMJF_32_0810"
                     /product="putative serine/threonine protein kinase"
                     /transcript_id="XM_001685345.1"
                     /db_xref="GeneID:5656194"
     CDS             291757..295863
                     /locus_tag="LMJF_32_0810"
                     /codon_start=1
                     /product="putative serine/threonine protein kinase"
                     /protein_id="XP_001685397.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656194"
                     /db_xref="GOA:Q4Q5K1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5K1"
                     /translation="MIRNATIPAHIQSSPSHSSRDHMSLSLSLQRQKGSNADDEDYAD
                     GRRILMHNPLKGHLFSSSSDSSLHSSIGQPEMIAAASSSVQKGSSDAGNRLDTALGFF
                     GEETAHGLVAEQVEGPCDEKHVNLIEVHAIDSDDDPSLLEEQEPQVCCTIPSLPAVAF
                     IMCFGAIFVGLLGFLPFYFVGVQSNAHTTEYLLSEAMKGVASITQNSLAILPAFVHIV
                     TFNYIKRHNTTLEETNLPKDPDQLLISLLTVLTRFNEAISYLRFVYEGGLYTNAGYTD
                     PRPTDANQTRRIYGGYSRTHNTVPMLEMYNESVTVVEPPNVLGYFDFHREVTLPEGAM
                     NQIVKTWVADPQNNTRWLLASDNTTPTYFNFVMPFAVNGSLGFFEAGTSSDTIIEETV
                     TLVSFLRKNGRIFLVDATRNILVGNSWNQSVQSRTNDNAIGATIYTPTRIYEITEPII
                     LAAMQVVNESGSLTEVLKGKDTALITFRYKGNNAFLNLTKVRDSYGLDLVLGVVVVRA
                     DFEKAFSTARTAAFTVTVLVVVIAAVVAVVTAWFVVREMKRLIPQLIRASNLEVSRGD
                     GKDHRVQGWLAYITEIRGIHEAFVRVERSLREMRTFVPAAVMTLAPSDDSHSNADLSD
                     GKTRRARTRFNANIVKDNTNEFSRVDVAMVLVDVHRAMDTMEACIIMDIISQRAEEHT
                     GYIESVSSSSFFVNFGTQSQNPLVVSKICRFALEVYQSVPDFMRNRVVCFAVRMPFLV
                     GTCGARHSKARVVFDTQRMLDISKVLWDIGCHVASTTDTLSHFATSSAQIPWYRIDCV
                     RFPDEVSQVTLCELRDPCSLLQDDENMPKKMVDGLSKMCKGEYKQALMIFDSAHSENV
                     QLKRLRKICIDRIASGDTSKYIHLIQDVYALDAAPSNHEDMAEGDGAAMYDYDAGSPV
                     GVATSSGEVCDPSNESPLFACSSFGNGAGMPAPVLSQPAAHASSPVARHTAPTGHSKT
                     SPTPTPSVTTGGEAAEPSRLTERAVTAAMGPREFPLCGAPQVAGASGAGPGLPPFHPR
                     TPGTTTTAASVPGSSPPLGARDDNASEAPSFLTNAFVFDSSMASVASADAVGATVQGA
                     DEPQVLRDVNQHEWQVSLYPIGSGAFSFIYLGMSDDGVQVAIKRIPRLHRGIKEEEMV
                     SEVCTCAKLRHPNIVPYISCCVTQSYLAIIMEYMPGGSLHDIIDNFGKLPRTVVRRFM
                     LDIVNGLAYLHESTTHGDVKPHNILLGVDGVCKLSDFGSASDRLTEACCVNEDRLMRG
                     TAVYISPEGARNHPLTSASDIYSLGISFLEMVLGRLPWKWADSERTDALPLRHDHEFV
                     QCLTANAIVVDIPDDLDNDMRELALASCAENPEKRPTAQELLSFAFLI"
     gene            <303917..>304411
                     /gene="CYC2"
                     /locus_tag="LMJF_32_0820"
                     /db_xref="GeneID:5656195"
     mRNA            <303917..>304411
                     /gene="CYC2"
                     /locus_tag="LMJF_32_0820"
                     /product="putative CYC2-like cyclin"
                     /transcript_id="XM_001685346.1"
                     /db_xref="GeneID:5656195"
     CDS             303917..304411
                     /gene="CYC2"
                     /locus_tag="LMJF_32_0820"
                     /codon_start=1
                     /product="putative CYC2-like cyclin"
                     /protein_id="XP_001685398.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656195"
                     /db_xref="GOA:Q4Q5K0"
                     /db_xref="InterPro:IPR012389"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5K0"
                     /translation="MPPLAQLCALALQYRCDLSQEIDQNIRSCFHSSRVPSISLWDYI
                     RRFAKYSVCSEECFILAMVLMDRYVCKTQIPITLRNVHRLYITAMTLSVKLRDDSYYS
                     NAYYASIGGVVNAELNVLELELLDIVQWFTWVEKSVYDAYVARLEALFGDAMPKLLVA
                     SPNK"
     gene            <308874..>310274
                     /locus_tag="LMJF_32_0830"
                     /db_xref="GeneID:5656196"
     mRNA            <308874..>310274
                     /locus_tag="LMJF_32_0830"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685347.1"
                     /db_xref="GeneID:5656196"
     CDS             308874..310274
                     /locus_tag="LMJF_32_0830"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685399.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656196"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5J9"
                     /translation="MSQESSTSPPRAERHDPSTSPSRGSTSSTNTNIPCESALQLGPT
                     LWVEMFENQRWYPVIGWGTSRFLTDLPAFCFVPPAHRLCGAHPNDFDTAFQLVNPPSP
                     HAPNPQWPAHRILTVALPAGYRWVGFWEVYTEHPHGTDMAGWRYGEQFLRPVDKTSTD
                     PANAASPQQVLAPFKKTHTPLCVVRRRLWRRRVALAGVDEPASSKDDLFPGHSEQQLH
                     SYLSEKEEEMEMAEHLKEAEYMAAQAGEPWSQEQQMRAEAELRKFCRERQNRESESRM
                     RSTKLSFVNSFSETEGSFHVFPGDDDDDGPTDVNVHPEEQFSGAVAAASWVRDSWSNR
                     AAPVVSSSVATPDDTTAGQSTESSHGGCTLEAYSTTAPSRVDGSDLVGQNTVQEFVAS
                     TPTDAESSRTDGADAAAENAVDQFVASSLTDPAALNDDDQAAGVSIGGIRDPTDADFR
                     AIFSQFMTPSCDHKPS"
     gene            <311453..>313030
                     /locus_tag="LMJF_32_0840"
                     /db_xref="GeneID:5656197"
     mRNA            <311453..>313030
                     /locus_tag="LMJF_32_0840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685348.1"
                     /db_xref="GeneID:5656197"
     CDS             311453..313030
                     /locus_tag="LMJF_32_0840"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685400.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656197"
                     /db_xref="GOA:Q4Q5J8"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5J8"
                     /translation="MRGRGGRGGRGGSFGGFSQQPTNTISIRVSEIQQPVTEDVMRRV
                     FQSVGVSCNSIQITPTNNPQETSVVAQFPDNFAAERVMSSLNNRNIFNNGNKMTMQYT
                     NWTPSGSPTPMNSNGGGVLQTSAFENGNIFAAQQLPPQPQMPPQPQMPPQPQMPPQPQ
                     MPPQPQMPPQPQMPLQPQIQLPAPHIQQPSQMPQQMPPQPMPQMQHMPQPQPQPQMSV
                     FNNPGPGMMPPQPMDPWYGANPAMDMMSVTVGFPGAVRGNAMMRGGRARGRGGRGGCG
                     LDTMGMQAGYMPFPQVGGMARGGANMMPRMNYVQYQPFGQPPTVFVSVTLVPITEPLQ
                     TIFTLMEAFGGVVAIRRNQNKKEILTVKAASPDDALAIVTFMHRVPYVGGQVSGKLFP
                     NYVERYPCTDEGDPLDPETLQYDFTASRHRSPGQRSKAVPSRVIKITGCSTYEDTEVM
                     TYLNSKGINPERVTKSEDGSFEVHLRDVATSVKVLLECQGSVCDEEKSNVIFVEGPRD
                     DSVSTEQKATELQASEQ"
     gene            <319004..>321295
                     /locus_tag="LMJF_32_0850"
                     /db_xref="GeneID:5656198"
     mRNA            <319004..>321295
                     /locus_tag="LMJF_32_0850"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685349.1"
                     /db_xref="GeneID:5656198"
     CDS             319004..321295
                     /locus_tag="LMJF_32_0850"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685401.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656198"
                     /db_xref="GOA:Q4Q5J7"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5J7"
                     /translation="MTTVVLSNLPMGCIESDIHRALLMYGTAVNIEMNSHASQATVTM
                     RTKQEAQALLNRRSVNVIGTSVRVDAQMQAPLPPQQLQQQHQHQLPQQQQMVPQPPQH
                     LPQQQVGSYGYGSGSGGQQQQPIYDSMAPQQYPQHELNHQPQHSQQQYAQPQPSYPQQ
                     PQQMPLQSPPQSTGSYKPTTSHRSGGSGQAIMPVPPQPSRRLRVLVEDCRYPITRDVL
                     MQMFSMIAPPVSVSCGPYGPTTTGAVEFADPAAAQQAMDQFHSNAIYPNCCYVKLFFE
                     PMWDQVDPVQPPLQSHQPHSYGGSNSGYGYPAQGPTNAPPSVHANPYGVASHAPAQSN
                     AYGAGWGGSDGAQYYGGSAPSSAAPQSQPPLHPQPGQPATDPFGRDRGGCGAGSDCAK
                     DSDPAVQRSSESRATRGLAPGPMVRGGRGALRGGIGGRGSGTGLGAATGFSPFEPSGT
                     TPARGGGASVGRYPGSETNGCTVMVSCVNESVPLCDLWVLLEVFGNVNSLKRQFRDRT
                     NVVAQFQHPGDTLTAIQYLQHCPFRGSVLRLKRFSGYQERDTEWETKSATDPATLAAL
                     FTTGYHHRTAPRAPVNVRGRVHPDKNLYITNLTEAISDDELKGIMKEAGFEPDAFFRR
                     GPKGAIVAYKDTETAVDALIALHAKEVRERFLRVTFSRFPPGPRPSRDGVDKGDEDDD
                     GDAEQCDGHQETQPEPPRQQQQVPQPSQLNEPAPQESAEPPVSPPQEPEPAREEADGN
                     EVESTVPEAAPRVAKVKAKSAKR"
     gene            <322076..>323899
                     /locus_tag="LMJF_32_0860"
                     /db_xref="GeneID:5656199"
     mRNA            <322076..>323899
                     /locus_tag="LMJF_32_0860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685350.1"
                     /db_xref="GeneID:5656199"
     CDS             322076..323899
                     /locus_tag="LMJF_32_0860"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685402.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656199"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5J6"
                     /translation="MTHLSFYHYCCSLYHTPLSTQATTLTTRVPLLPSTLSLRMEAAG
                     SLEQAWDPSAPGAGALRATAIAQLYFRMTSHHPLTILVVDAMCLVFGADGVTVQELVN
                     YLGITEDRVRFGLEGIPAGIRCTARQLESEGSLVGAAPDTVGDADAAQRGRRVGTGET
                     GSREVRYYLNYKRMLPLVYAHGTRLLLSACVTDVPPCRYVESVQQAQLAAYQKADASI
                     AHAFFASGHPPHAEKALPTSGGVGPSDKGVGDHIDVSEAMRRRNAIRGVLCLGCSCYF
                     LVEEFCETLTRCPRCDKDILSLCLQVIQAQLQALVREKQTLVTLLPPVRQVWKRVVAR
                     EQSQALSAAAKASSSTAEAQKTAAHNTTAGTGASVSAAALPVRLQLDCMLSRDPFLFQ
                     QAVAFLSLYSTPFASVSDAASVVDVQEILTEREYQDRLRGRASVADQFRSLHRHAAAV
                     HVRLMSQREIDAARQQESHQKLLKRAMLPPWLRNTTALEELGGSHIYASADKGAAATQ
                     EVEMDVAKEPWEMADLRFRETTKGHVPTGRAVWAAGSSVSRSSVTATAVQKRRRATSD
                     ADEKAELTRAASFIATHYYDDEFDAVALPQTRPLRGRTREP"
     gene            <326923..>328422
                     /locus_tag="LMJF_32_0870"
                     /db_xref="GeneID:5656200"
     mRNA            <326923..>328422
                     /locus_tag="LMJF_32_0870"
                     /product="putative phenylalanyl-tRNA synthetase alpha
                     chain"
                     /transcript_id="XM_001685351.1"
                     /db_xref="GeneID:5656200"
     CDS             326923..328422
                     /locus_tag="LMJF_32_0870"
                     /codon_start=1
                     /product="putative phenylalanyl-tRNA synthetase alpha
                     chain"
                     /protein_id="XP_001685403.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656200"
                     /db_xref="GOA:Q4Q5J5"
                     /db_xref="InterPro:IPR002319"
                     /db_xref="InterPro:IPR004529"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5J5"
                     /translation="MEQALIEAAILKALSSAERVLSTDVAESIRVDHQDIVGAGKSLE
                     ADNYIRSEMEQRMVLKLSNEAQQIMESGSPEYLAWCLLQDGRMSQEDVASKLGKEATG
                     VALANGIKSKMFKTTKEDGKVFLERVPGSDNVVDAVRESLKQAAAAAGAVDTKTLETL
                     KKRKLAAMEAKKVFAYTKGAAYAPERSAKAVGDLTREMLVDGSWKNRQFKEYNFSAQG
                     AEVGGGALHPLLKVRQEFREILMELGFQEMDTQHWAEVSFWNFDSLIIPQQHPARDLQ
                     DTFFLSKPETSKVNDLEYVARVKAQHEESFRTPWKLEEASRNVLRTHTTGSSAFVLKN
                     LAKFASRGPDGKLHFSPGRYYSIDRVFRNEEMDRTHLCEFHQVEGFVIDRDISLAKMM
                     HTFDSFFRRIGVSQLRFKPAFNPYTEPSMEIFGFHTGLNKWIEVGNSGLFRPELLRPM
                     GFEDGVTVMAWGLSLERPTMIKYGINNIHELFGHRVDIRFIKRAAIARY"
     gene            <330365..>330904
                     /locus_tag="LMJF_32_0880"
                     /db_xref="GeneID:5656201"
     mRNA            <330365..>330904
                     /locus_tag="LMJF_32_0880"
                     /product="putative 60S ribosomal protein L18a"
                     /transcript_id="XM_001685352.1"
                     /db_xref="GeneID:5656201"
     CDS             330365..330904
                     /locus_tag="LMJF_32_0880"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L18a"
                     /protein_id="XP_001685404.1"
                     /db_xref="GeneID:5656201"
                     /db_xref="GOA:Q4Q5J4"
                     /db_xref="InterPro:IPR021138"
                     /db_xref="InterPro:IPR023573"
                     /db_xref="InterPro:IPR028877"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5J4"
                     /translation="MVKPHLRHYQVVGRESPSEKNPEPTVYKFEVFAPNFVVAKSRFW
                     RMMRVKNKVKATHGDVLSCKVVKDAKLVARNYLVDIAYYSQRCGYTRMVKEFRDVSKT
                     GAVSQAYHDLASRHRARYHNIEVLNVKSIPDHEVKHLSIAQYHAPNLSFPLLQRRTKA
                     TRKDRAIFVKKNTKRAVVA"
     gene            <332335..>333543
                     /locus_tag="LMJF_32_0890"
                     /db_xref="GeneID:5656202"
     mRNA            <332335..>333543
                     /locus_tag="LMJF_32_0890"
                     /product="putative ethanolamine-phosphate
                     cytidylyltransferase"
                     /transcript_id="XM_001685353.1"
                     /db_xref="GeneID:5656202"
     CDS             332335..333543
                     /locus_tag="LMJF_32_0890"
                     /EC_number="2.7.7.14"
                     /codon_start=1
                     /product="putative ethanolamine-phosphate
                     cytidylyltransferase"
                     /protein_id="XP_001685405.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656202"
                     /db_xref="GOA:Q4Q5J3"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5J3"
                     /translation="MPTVSSSTPSPASTPTVGVPPGKVWLNADEPNDEYSLFCTEAIP
                     PKVPGTVRIWVDGCFDMLHFGHANALRRARRLGDELFVGCHSDEEVMRFKGPPIMHAE
                     ERYEALRACKWVDHVVENYPYCTRLKDIERFEIDYVVHGDDISVDLNGRNSYQEIIDA
                     GKFKVVKRTKGISTTDLVGRMLLCTKNHMLKSVDEVQLENSLLEHSPTMPCLTTSRKI
                     VQFSNNSSPKPGDRIVYVDGSFDLFHIGHIRVLQKARELGDYVIAGVYEDQVVNEHKG
                     KNYPIMSFNERVLGVLSCRYVDEVVMGVPFDVSKDVIDGLHINVVVGDKFSDLVVEEG
                     GSTRYEVPKAMGIYHEVDSGCILSTDSLIDRVVENRLDFLKRQAEKRIKDTKSQEIKP
                     DEYRKLREAS"
     gene            <335597..>335998
                     /locus_tag="LMJF_32_0900"
                     /db_xref="GeneID:5656203"
     mRNA            <335597..>335998
                     /locus_tag="LMJF_32_0900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685354.1"
                     /db_xref="GeneID:5656203"
     CDS             335597..335998
                     /locus_tag="LMJF_32_0900"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685406.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656203"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5J2"
                     /translation="MSSSTSVTDGMTQMVVSQASLDGVFFEALLGQDLNLALWRSCGA
                     PQEALQCALEEMQRLDRAACEEDAVLRYLNTTRFAEQRTYKRRRAELQSQLHKTREKV
                     FALEKLVDVGAAGSSPRKVGAGERLRACLLE"
     gene            <336872..>337714
                     /locus_tag="LMJF_32_0910"
                     /db_xref="GeneID:5656204"
     mRNA            <336872..>337714
                     /locus_tag="LMJF_32_0910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685355.1"
                     /db_xref="GeneID:5656204"
     CDS             336872..337714
                     /locus_tag="LMJF_32_0910"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685407.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656204"
                     /db_xref="GOA:Q4Q5J1"
                     /db_xref="InterPro:IPR016812"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5J1"
                     /translation="MPPSTYAATAANAEAQGDDVDMHVMTYDQRCHGRSTFVGGEDHL
                     SIEVLVRDFLDVLQYAKTELYSNSNVYVLGHSLGGAVVARALSGNKSALERVSGVLLV
                     DVVEGTAQLSLQHMKSFLKNRPNTFPEVKDAEVWFLRMGGMQNPQGAAVSVPPLLQKN
                     DETGLWQWRTDIRKMESVWDGWFAGLDEAFISLPCAKMLCTANAERLDKTLTVAQMQG
                     KFQLEVIGNGCGHYVMDDATPTVVAKVRRFVKRNEELAQKLQLMNKNLSGQKINTTVP
                     PTRT"
     gene            <339859..>342540
                     /locus_tag="LMJF_32_0920"
                     /db_xref="GeneID:5656205"
     mRNA            <339859..>342540
                     /locus_tag="LMJF_32_0920"
                     /product="putative vacuolar proton-ATPase-like protein"
                     /transcript_id="XM_001685356.1"
                     /db_xref="GeneID:5656205"
     CDS             339859..342540
                     /locus_tag="LMJF_32_0920"
                     /codon_start=1
                     /product="putative vacuolar proton-ATPase-like protein"
                     /protein_id="XP_001685408.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656205"
                     /db_xref="GOA:Q4Q5J0"
                     /db_xref="InterPro:IPR002490"
                     /db_xref="InterPro:IPR026028"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5J0"
                     /translation="MPWHQEQCSGLWRSEDMIRVNIILQREVLHDTMYEVGMLGCVQF
                     LDMNEGVTAFARPFTEELRRCEELQRKLHFIEESMCKDADLLERYPEDVHMSATVEEM
                     RSSLLRGQMHMIDDRIESTVNELTAMLTSLEGFQHEMNQNQEMALLYYKYRLLVETPC
                     DMAASNSSYAHHGAAVSSEAFSRLASLFGFIDSKLSEELYRLCYRITRGNAIVEISNE
                     PAMFVDVQTGERNVAKTSFMVLCASPTMITRLKKLMIGLGADVYTLDEVQSRGIELTT
                     STTAHHVEDTIEGVERRKRDVLTLWYEEHRLYKTYLKVEKVVLTAMNTCAMSGSTCTA
                     SAWVPLRHEQSLRRALQDAVASANGSVESIVTLHAEQKHPPTFFETNRFTESFQGIVD
                     SYGMARYKEVNPGVFTIITFPYLFGIMYGDIGHGFLLLFIALFFISKEKAWRTAQLNE
                     IVAMAFGGRYLLLLMSLFAIYMGVLYNDFFGFSLNLFSSGYTWAPISEQKGTTYPTTP
                     NGLPSVKPPRVYAMGLDAAWAETDNKLEFYNSVKMKHAVIVGVAQMFAGLFLSLNNSI
                     YEKNWYKIAFLFVPEFVFLLCTFGYMSILIMVKWCRTWENTNKAPSILEIMTNFFLQP
                     GSVPNPLFGGQAGLQVFLLLAAFAMVPFMLLGMPYIEMRDYKRWQRRRQVWGSRRRHG
                     RALRTSVVTIENSDYTDAFLNEPSASLQHRQTSDSGDESAHRNLMSDDDETANIFGDD
                     NMHPFGVPAASSEEGSTATVIERENEKFEHFDVSELIIHYVIHTIEYVLSSVSNTASY
                     LRLWALSLAHSQLSEVFFSFTVAKTLDIDNSSGFVIAIGVLLWIGTTLGVLVGMEALS
                     AFLHALRLHWVEFQNKFYAGDGRAFDPLDLTNLNTAN"
     gene            <350303..>352417
                     /locus_tag="LMJF_32_0930"
                     /db_xref="GeneID:5656206"
     mRNA            <350303..>352417
                     /locus_tag="LMJF_32_0930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685357.1"
                     /db_xref="GeneID:5656206"
     CDS             350303..352417
                     /locus_tag="LMJF_32_0930"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685409.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656206"
                     /db_xref="GOA:Q4Q5I9"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5I9"
                     /translation="MFVEAVVLVVVLFIYWYVNFRPRSTNQLRPSYQSHHSTSSVPAS
                     DYVVIGGGAAGLAAAAELLRRTSEACHIVLIESGGDPQPASSAALLFEAGRRDRLLSF
                     APDLVRVPLEARLKGMHPTFLGGTPDEGYVAQRPCHFFQAEEALVAAPARAGGTTLAA
                     AARKANRYLLLQYAPYPRGVGLGGTAQLDWGMHVNSLWPVTDEAVPGAENASSRTAQS
                     SCEALPQWTRLPVRFPAVRNPLSWAFAEAAKALKLAAPYLPTTAVPVKRGVVFPCYLY
                     LDEDGRRLALPSALLGDIATDTLHRRLSVLTGHTAVNVDVATQDGGESEERGVRVTGV
                     QVRPSHGDAGAIVSIPVGKGVVVAAGALHSPRLLHKMAKHPALRVRKPPPSTVPVRDA
                     LALPLIFSAVPAVSADSFNARNARSTAMWWLTQRGPYLTPLCDTLLSLPLPHIAPQAE
                     LRVILFPFGGRDAARFKGMGWDTVLGTPLQAFTMLLIVHGIDGLEHAVALDTKASPPG
                     AAHVRALCSHQAVCPLSEEVHRQVQNAFLAGIKECRRLSETPPLANLTLEPGVESTDF
                     TLLVASDEAKAVRLAQLSRLPPSKHSARGKVELKELREWSRRVAATETYMRRYADAHA
                     YWLGFASGSSETFLASSSSASCSSRVTGLRNVFVGDSSAVTTAEWSDVGKRDTLAAGS
                     RSTSMDAAVRAATELVKSCGDG"
     gene            <353459..>356653
                     /locus_tag="LMJF_32_0940"
                     /db_xref="GeneID:5656207"
     mRNA            <353459..>356653
                     /locus_tag="LMJF_32_0940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685358.1"
                     /db_xref="GeneID:5656207"
     CDS             353459..356653
                     /locus_tag="LMJF_32_0940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685410.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656207"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024395"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5I8"
                     /translation="MARTSNVALKDEEVLRRVQLLGDAIAEEQRQTKASAGLRQPLRD
                     WHIQARLLEEVTCLLADDISGRRAFVGWMSLHMRNCLLHALQSRRAPIALAAVNAVGA
                     LVQHGACRAAVAVVCSWFLACLVRLAASSSATSAVSAAAMRVLLSMTQKRVLTIEGVN
                     SLLCDCGASSAAVRRRSVEVLRSYLEAAKGTSIQLSVKAYAEAVHRVISDRMRDADAE
                     VRRGARRCFWALHVLEPASTGALLRVLPAGLQRQLAAERADAMQELKVVELSPVPPTS
                     SSSLALRRGSSMHRNPHALDAAHASRTVTLKDDLQSAVARRARAFTPRPTSPSKARRQ
                     LLRSAKEAAAHQERGTILPKPDVYASGAGALATSTGSARLYAASRRAGGGTSLLTSME
                     STDWSVRRAAVLEGQRLCESDSLASEDIAQLLAGLLIRVQDIHFRVVEAAQSFLRTLM
                     VRAPAATQNEFQSLLPFLVSALVRNTSHTRPVVRAGACHLLDRITRTHEPPQGVLNAV
                     LRAADDVGGGSAAMDQRCAELLHYVIVVHPSLFAETSSMGIAVRGILAHLRVLESRQP
                     KESHRAGVRVAQVSWFTALGAALLACPESFRQIAERLAPSEQEEVRAALRESFGLMDT
                     DWEEKLSDVCAIGKGRLRCLFAEELKACTMTEHGVTGTTEPLSGAAGRMTKDGGVSGV
                     APLCSRALQKASKLLREFLSVDEARPLSSGTVRELPEDPVTGAASTPVLAPLPELAQP
                     ATVSCTPSPVLAGVDGGGESCVAHATVPRRAWPGAQRDRDPVAHFLRQRPCCRDTEEQ
                     RCALLSLAEALRAGGASAERERGADVYCPNCVPEEVERLLLYWERELSGVEGATHHNV
                     RWAVLTALQALLQWPGARSAVSRQLARVLSICRAGLDDPFLEAQLQAACCLDTLLTVR
                     KPPADLCLSAIASCVMRWLEGPMGDGATSGWLDLVHTILRVVKQAQPTLAGAKGTNRL
                     ACVVLPDETGYQRHPTLTAPVLHRVVAVLNRCLNHCHVSVRLCAVLVLVGIRRALGDA
                     VTLPFLAPLSAAHMRLVDVYLDKVMEERPWRLLT"
     gene            <357682..>360486
                     /locus_tag="LMJF_32_0950"
                     /db_xref="GeneID:5656208"
     mRNA            <357682..>360486
                     /locus_tag="LMJF_32_0950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685359.1"
                     /db_xref="GeneID:5656208"
     CDS             357682..360486
                     /locus_tag="LMJF_32_0950"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685411.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656208"
                     /db_xref="GOA:Q4Q5I7"
                     /db_xref="InterPro:IPR002999"
                     /db_xref="InterPro:IPR016071"
                     /db_xref="InterPro:IPR016685"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5I7"
                     /translation="MSYVVYAVENADRMILMGPTVADQPTFKAITLSYIQAPKLARRT
                     ASGDFTPEEPYAYEAAELIRSTFIGKQVQFVEDYYIEALQRSAGRIMGSNHQEATGML
                     LKEGLATLPDRLPPRIEKELYEIYSQMSASARAARKGLFSGDGAKHVRHMRSYAPEEL
                     AEKIEGVKGQQLLSRVEKVVSPTLLIISVKELGDTQFAAHLTGVTAKDNGDESINAEA
                     KFFVERLLQNRNVKVRYDGLDGFNNVMISIMSPKGSFQEELLSKGYVKVQNMTLPLST
                     RIDEIISAEAAAKKKRVGCWKNYVEPVVVAPTETAEGDNGASAPAANGEEAPVDSKAP
                     AAPKVAGLPTTLPDGTPGPVYTGPIEFVGTLVQVVHGDTVVVRDDASGHLFRVSLAGV
                     RSSKNIDRDQDGNSPETRVTYRDYAWEAKEFLRSRYIGSKVVVLVEYARVMPETKEIR
                     PAATVEVKHTGVNIGVALLETGYATFFLGRNDKNSKASELAAAEDGAKEEKKGIHRDT
                     PAPPMKVVELNHLGETRSRYYLSFLQRGMQGNRPPPLKGVVDLVLGPSSLRVYIPKEN
                     FQIPVKVAGIVTPSAAFNANEKADPFAQEAKDFVIDLVQQRNVTIQVFTSDRAGNFIS
                     SITMEDGTNISVALVAKGFATVANADRLPFAQQLVDAEGAAREAKKHIWSATGAIPQR
                     AVKMEQERAASNPQALARVVDETSKFSLYMITEIADDGLSVYLQGYDAEQDRKKGHIQ
                     DLINRTVAGDGHTPKKGESVIAQYSGDKTWCRATVLKAPRDDKAEVKFIDFGNTETVP
                     VKNIRAVPRGPEYALVRDTPAFAKLARLAYLKSGDANEMFAGATYAAVEEYSDGEVLA
                     KAVYRDGLGNVYYTVTTNEKVPSLSEMLLQRGLALLDRRASAVDPTDYRRHEAAQEIA
                     RKGHKNLWQYGDVDEGDVDY"
     gene            <363992..>364807
                     /locus_tag="LMJF_32_0960"
                     /db_xref="GeneID:5656209"
     mRNA            <363992..>364807
                     /locus_tag="LMJF_32_0960"
                     /product="putative ubiquitin-conjugating enzyme protein"
                     /transcript_id="XM_001685360.1"
                     /db_xref="GeneID:5656209"
     CDS             363992..364807
                     /locus_tag="LMJF_32_0960"
                     /EC_number="6.3.2.19"
                     /codon_start=1
                     /product="putative ubiquitin-conjugating enzyme protein"
                     /protein_id="XP_001685412.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656209"
                     /db_xref="GOA:Q4Q5I6"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5I6"
                     /translation="MSALPHIQKEFRNLTKDPPAGFRVELKDNSFFTWIVWFTGPEGT
                     PYAGGQYKASLTFPKEFPMEPPTFRVISSFWHPNVYADGRVCISILHPPGVDEMNSEE
                     TAMMRWTPVQTIRSVLLSIVSLWSDPDPSDAGAPANVDALVQYRNRRAEFDAKCRSLA
                     EKSLAELPGDFEPPCMEEKVEVTKAPGDTFDYMLSEDDLEDEDDFDDFSIPAPAASAS
                     AGAAVSSDPVKKYAEELMQLRAMGVGEGKPDADLLHLLIKHRGELASVIGDLS"
     gene            <365843..>371527
                     /locus_tag="LMJF_32_0970"
                     /db_xref="GeneID:5656210"
     mRNA            <365843..>371527
                     /locus_tag="LMJF_32_0970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685361.1"
                     /db_xref="GeneID:5656210"
     CDS             365843..371527
                     /locus_tag="LMJF_32_0970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685413.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656210"
                     /db_xref="GOA:Q4Q5I5"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5I5"
                     /translation="MPSKASSVPSRAALPVACSSFVNNRFCSLPLWDDAQVAQENWGG
                     PLAVSVPSGGGDGGKEAKQALSKAKTLTGGRNAPTCAGEAHFEDEATRHSVEAFIALL
                     GPPLQSDAEAGQVCDGSSPDKVTWLRPAEVFSPFRPVVHRNVTPFVNPYATAEALVPV
                     DAKAEEDRCEELLSAAACNASSSTGHRKSAGLARQSDVATPEPQAFHLLYPETISVLD
                     TFSHEERGLWSNCTPTESVRRYRALPSLMQPYDGALIAGCAETPAQACESRYSTSLRH
                     KLKQAEQLAALTKAPPFLMSAFNSALLAVEQAQRYVPEGWYLWELVYPHAPGTCHPVY
                     NPFGKYAVKLFVDGAYRKVLVDDCLPVDVLGRPLLSTTSRKELWPCLIAKAVLKALGA
                     VSGVQALTSSPELIVATLLGNWVPQYLSPRHNAVSATALLLLYQRQLTQLESLAEPFV
                     KESIGSAAGHGGADSAGDVTRKDRKSSARGHHVSVVASPPKRTPANGADKPSVRRQQN
                     SRSSGVSGGEKEEEGALKPLRATEYCEPVMDEPLPEQPFYVCGLHAPPAEALKSEAAR
                     TARGGYGFGPQLYTIHAMRPFRNTVALLLHTTPRACLSEGIFEEDRDADDVSALHDWS
                     SRTARRGAQAAGAMKPPRVLDGVAPADANAAQGDPTPITDMVVMDSDRAASVTSCWLT
                     LEEFILRMDTIIVWRKLTGRYTNAVSVSGESLLRHQGHVSATGDNGPSDSSSSAASRR
                     KSPPARRGETATTAAAASGATTQPPTPSPPSSMWWKLTAEKAVEAVVIVSSPALTEAV
                     GRGALAEKVPPATALLSQSWLSVGFPDKVASCGESLESAEAQLQRRVHFHRVQWDRAE
                     PLNHIGSLTYANGVLCSTVLYFRPGVHLIRVDLHHVQAADKISFLSDAEMDVQLDLSH
                     DASRDGFACVTDAGVYPAVQSCDTETVWLKRVFSLAAPTCVTLQLSTLDSTEDVGAHR
                     QIYTAASRASAAASGGRSGGNHSNAAASGRGAPQGGGTAAGAGKSGYASPAPGGSTAA
                     DGKKRGEGPLTADATNGAVSTVPARDTSVSILRFTSLVLVNLDRPEDFCVGTAGRLVK
                     LHLKPNEKGYLIMAYTIVPSLMAQNVQRQNKAADVAGGAGSLLPTVASMDSLAEEEGL
                     QPPESSSLGNSFSPAASTAPPPLFPAGRWKLVLRSNAELQTFDTVSHDLHNVAIVADL
                     PRGGSPVLFRRTCTIAETTHVSIVADLHAPVPMPYTVRIVRLPAPTASASTSTTPRAL
                     RGPNNNILPAGVSEPLAADAGRGAGAVPSRGSMFVVYESPPTQQRLFVADVLLSAAAD
                     TSLAKGGKGLATSSSTGGGMTVYGIEATVAEADAAAWNERCRRSQEDAFLQYREAAEE
                     QASVSNERDLVEYQQNPVAFVQRKREASAQRRQFATEAAEKAIPRSSTIARKRSGMTQ
                     RQSHHLSAGPENLPKDSPRRQSLCAQPETAQEGDIRHSLDNVDPDTIVRMNVHLSFST
                     SRAEVRADTPVPDALAELRKHMRETVSWLQEWNELGSAGGESAAAACSVNPMGAATSS
                     GSKLGAQRGQRDAAAAAAAAATAEDALRTEAARQSRVEYLRNPQHLFVPSFDSEYNTD
                     AAETPTLTSSASFAHRARHDASGNSSGTGAAHPAATGGAQGARSYRRELSQASVGTSA
                     SLSDDPQSPYPPPVLMQDGPATQFRYAAPLQQPQYCIELLPLRSWEESPSVASQGKDG
                     AGGSGAAGAAASNRGKRLKSSGSASAALSAPARPHSSGSVMPSGSSPRSFAEVTPSGL
                     CAAAAAAACTLSCPLTAAERETFLLLLRRPLADASESWDLALGQARVAKSESQAQLRS
                     GFHAYYEAMVEQKAASGDTSGIAAPIVYRSLLSLKEEELGVSLRPTKSLVFT"
     gene            <376416..>378098
                     /locus_tag="LMJF_32_0980"
                     /db_xref="GeneID:5656211"
     mRNA            <376416..>378098
                     /locus_tag="LMJF_32_0980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685362.1"
                     /db_xref="GeneID:5656211"
     CDS             376416..378098
                     /locus_tag="LMJF_32_0980"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685414.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656211"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5I4"
                     /translation="MSAMDEPSDDELRTNALNDPGLFLDIEDDDEDVVLSAGLPTPAV
                     LLQRQQQQQQQNATSATAGGQVNSVPKLDVRALTSFPVDSNQHPGAGFMAAAASNSPI
                     SFSRELGVDHTTGNVYLMGAAPSSSPASSPQNTSQSFSSMNVYAGIANPPLCARSLPF
                     RDFLNQKSVPPHIENEESTGIFVGQLPSSYAEDDIEALLKAIGHERGKIVQVRDVKCH
                     NRDRTCAFIMINASALAAILEFTKRVLCDINCVWIVEHNQAAHLPLFIQQMPREQLRG
                     VPKAALVLEKLTPQSKSRHSNHKSNVATSPNTGCSAIQTRMLSPMQHSVPGVSMLSHP
                     VFLQQQGVGASPAAAATGHLDMSALQATSPFGGSNYVRAANVNGLPQLFGSSRFQPGA
                     PTGTFFAPGGVTPCSNSVYTMQLSNSGIANIEVANQMLLAASRSCGEYPNYQLNMFPT
                     SPTSKEASAPPIKPTTVTLQPALQSEHCSCGQMLLLSQYPEQGACAKCQCVISPNDVA
                     YWCVSGHIAVCANCAVKSNKPQGGQEDMTGRRMPADTKLQRTDAGLTNRAIH"
     gene            <390204..>391436
                     /locus_tag="LMJF_32_0985"
                     /db_xref="GeneID:12982106"
     mRNA            <390204..>391436
                     /locus_tag="LMJF_32_0985"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722329.1"
                     /db_xref="GeneID:12982106"
     CDS             390204..391436
                     /locus_tag="LMJF_32_0985"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722377.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0985"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0985"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982106"
                     /db_xref="InterPro:IPR017916"
                     /db_xref="UniProtKB/TrEMBL:E9AEF7"
                     /translation="MELTLHQAADIAIVSQYYSPVAASAITYAISNFLPYATNFPNSK
                     VRLTLGTNIAEPLHFECFLTIRKSPQDSQGTPLLVVISFADHYPQQMPSAVLVPPPGG
                     EKIKHPYSVMSIDGRIQVECLPFLRGVVRPYSLLDMLLAISEQFELEYPLVGANCVPP
                     TAAASELPSVESAELSGMDPARQSLIQEAAERVVIDVNEKAGKYLDMRKQALLYLQKL
                     NESNRELQRAKEILTEHQNELQEYLPSVGNVSSLVRQLDGHEDTVEEHGNCLVPADPL
                     QARALELLAEIHAADDTLALLEEGLKRELMTCDEYVKNVSDVGREQFVSRHLYLRVSD
                     KLVKTRSGVAFPTPVSTPPLGQSPRSPPEVPQRLAPTDALRMEFPSADVDVIRDVLAS
                     VEGDLTIARQQLKMMFTQ"
     gene            <394120..>398655
                     /locus_tag="LMJF_32_0990"
                     /db_xref="GeneID:5656212"
     mRNA            <394120..>398655
                     /locus_tag="LMJF_32_0990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685363.2"
                     /db_xref="GeneID:5656212"
     CDS             394120..398655
                     /locus_tag="LMJF_32_0990"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685415.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.0990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.0990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656212"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5I3"
                     /translation="MSNSSLSGNPPPPPHDAEVSVMRQDDDEARPQLLESSPAASRPP
                     APLPALPPPPRVVQVLNPAVAPPSPSWSNLVGRPNHTAALASLATAPGGSDRDVARLR
                     RPSVTRVRGALSLSSTLSELPVLPAIPVPDIAVSSVAPPPVASRQQNASPSVDLGALP
                     VTVSETCPSVHGPPSSSAGPSASPLVQDTSPMLTPPLEATALSLPAPRPPPALPPTSK
                     HADDAAPAKIPLYPLHPPAAALATPSCGEGVRSMDTTTSAAPANLPHAVTSLLPAPST
                     PAVVVPALPLRSPSANVTPASLVGAPALATALTAMPSPVTDSRPQYLHPQRGTLETGV
                     RDLLSARNEPKDRVICDTSTSSCGRSSDRSSTGGDSVCVRRTTRISHTRARGRRRQRR
                     GGAYPEAAASRVCSRRRRNTHSSHGALLKVQRPTAVRLFEGEGRHGPWSSSALRDKAS
                     MSSQSTTALALDGDTKRRKKGRGDGTSRGSGNTTVTDVTGMDGAAPAALAGGGASPTV
                     GDGSDAPLLFTSPAARLHAVYQNSTKNKGLTKAEASRLTQGSLLASTDAGRRHETNRW
                     SDVIAAADGADTGAAGGVGRERAVQFRATGAFNGDDEWAPPRPTSSSDVGGCQRSGSA
                     ENTTSSKLTAGDISDDDDLVLVLTIRGMSPLHADAGVVHPLVRAWVVSCATGRSLVQA
                     STSVPCAVTHPFDLRAHKTRAPWWNAQVALRLSAERRRTAADDAMLLLEVLDFGNETI
                     HGFPLMREGLYPICWGFLMLRDCVGHSNLLAADDLHLQLYRYPSRTPWYLSLLSALIP
                     GSWSPAGAAFEPHGSSAAPCCSSGPRASIANDVPTIYTVFVNANTRKIPYEGGIVLRV
                     RQTSNTAFVPDTTEMLLYEEYLLSMLASDGGSGAVPRSSRCVCAAANDEVSLGRMREE
                     DGVRGAAIPASPWSTIVVPENYYRMDGERSLLPHEILQTTAVLGVVTCVSFAHSGSLV
                     ALGVCRHLQHVVELRNPLLPDMAVVACLVGHTGHVHRVVFQKEDKYLLSCSSDGTVRV
                     WQPVSSDGVLAPEPSAGPDSMQCVCTLPHGFPVYTAVFHQDKIIAGGFSDQLFIWDYE
                     PTIEGEMESMITTGNTTLRLITTFTPAQHTRAPPTDSPRSTRALLGQLVQRVDTAGAT
                     AARECASTMTLSLASNEHSNRVWSVHSNDSVVCWRATTETASRGEGESLWQMSARHTA
                     DCSGAAEVQVKGEYAIVTCRSAPVVFVFDATTCEQLRVVNTRLSFATPLHLLPDGEAF
                     VAVMGDPGRLLAWECFDGGLCTPASGYAKASPLFNVARMAWAESQQLAVFVSRSPSSE
                     GEMARYTQGPMQPAAGQSAAAFHYRRQEQQYRQSDIPTEATLITVAGTVRRKSTVLLK
                     TDPHSSDAFVAMFGGDVQPKRKATYLAKRERAMHQRAAERATRNARLHPTTASAELSA
                     LFATPVATSIPYDATEKGARMSAIVNFWRGLVSQHRRTEARPQDSQRFSSSADAFGTQ
                     PAAWRALQYIENIEDAL"
     gene            <399729..>401345
                     /locus_tag="LMJF_32_1000"
                     /db_xref="GeneID:5656213"
     mRNA            <399729..>401345
                     /locus_tag="LMJF_32_1000"
                     /product="putative chaperonin containing t-complex
                     protein"
                     /transcript_id="XM_001685364.1"
                     /db_xref="GeneID:5656213"
     CDS             399729..401345
                     /locus_tag="LMJF_32_1000"
                     /codon_start=1
                     /product="putative chaperonin containing t-complex
                     protein"
                     /protein_id="XP_001685416.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656213"
                     /db_xref="GOA:Q4Q5I2"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012718"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5I2"
                     /translation="MSLAFDEYGRPFLLVKEQQQKERVSGVEAQRANILAALGVANVL
                     KSSLGPRGMDKILTTPDNEVVVTNDGATILDLMDIDNEVGQLMVELSKSQDSEIGDGT
                     TGVVCFAGALLEQATALLDKGIHSSRISEGYEKACEMACKRLEEVAESISLEKKEVLL
                     QTARSTLNSKVVNRDRDRLAQICVDAVLAVADMERRDVNMDLIKVEGKVGGRLEETCL
                     VDGIVLDKDFSHPQMPKELTNPKMAILTCAFEPPKPKTKHTLQINSAEHMRELHEQEQ
                     EYFRSEVQRCKDAGADLVICQWGFDDEANYLLYRNQLPAVRWVGGVELEMIAIATAGR
                     IVPRFEDLTAEKLGTCGRVREVGFGTTKDRMIFVENCPNSKAVTVFIRGGNKMMIEEA
                     KRSLHDAICMVRNLIRDNRIVYGGGSAELAASSAVLAHADAVSTVDQYAIRAFADALE
                     SIPINLALNSGLDPIRALSDARKAQIQGNNPYAGIDCMDRGTIDMKQQEVFETLSGKC
                     SQLRLATQVVKMILKIDDVIVTKPDEEQQQ"
     gene            <405045..>406316
                     /locus_tag="LMJF_32_1010"
                     /db_xref="GeneID:5656214"
     mRNA            <405045..>406316
                     /locus_tag="LMJF_32_1010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685365.1"
                     /db_xref="GeneID:5656214"
     CDS             405045..406316
                     /locus_tag="LMJF_32_1010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685417.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656214"
                     /db_xref="InterPro:IPR004861"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5I1"
                     /translation="MTFSSRANGPLLVPPSNFSMVEDGVYRSAYPTEENVLYLRHIGI
                     TNLVLLSIEQLPGPVKRLLGSEVTGKAATNCLTRGPIRIINIVDMRTWRADGVNSGDD
                     FSPRDVTRALDFAVDRRWHPVLFACPLGELQTNVLIGCMRRYQHWALSAIFSECELYT
                     SVCRTLRQSILLFIESWDPANHPVSAVNIQYRNRKMALRERLRAHQDRRKHRHAAAFD
                     HDRDRTSESDSFEDSAGEVEQEAPLSVMSDLLDQNSADGQHSSTVSSTQWTFSEVSVR
                     STSLPMKVKVPNPDAAFISTSGQRPPMMMRRAAAAAAAARLREQQDQQLHKKASASEA
                     DEQASVVQMEEGKVAGVIWAEWYLEALRAAEELKACTYSSPCMSYSGADACFGAELPP
                     PHVLYAGVRNPPALDARSTFTKESIVEEDDD"
     gene            <408212..>410647
                     /locus_tag="LMJF_32_1020"
                     /db_xref="GeneID:5656215"
     mRNA            <408212..>410647
                     /locus_tag="LMJF_32_1020"
                     /product="putative protein kinase"
                     /transcript_id="XM_001685366.1"
                     /db_xref="GeneID:5656215"
     CDS             408212..410647
                     /locus_tag="LMJF_32_1020"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001685418.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656215"
                     /db_xref="GOA:Q4Q5I0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5I0"
                     /translation="MRAKRPLRKSGLYFDLAGLMDHAAPELQVQQKNEQELNKFFIDV
                     DDNIVSPMITTGPSFRTTNTAGPSSNNSTVESTAREMAGIGGNASVEKRTMVSPQNEA
                     KFIHVNDTNIFVLIDGISMFVEGKSTFTGTEDARLLVERLRQKKLARSVDTVQEAILN
                     IQMSADHCGRKETAPVVSAVPSGSPVVPAKASLGQSTANTLRMSAPPLQSAVAPTAVP
                     VPLPPPKPVPIANPWASLFEDAKVPPGSPLFRSFKAKSLGSTSSYGFPPVHSTQLCES
                     AETGATLSSPATTISPVTVTTPTSALSPTNGFNASSRLTHSVSFSSLRHQDSSSSLLS
                     TTSGAGHRHGGHASRGAAARRAKQIAAEEIGHSNCSLDMDEVVVEVMIGKGTQGTVFR
                     VRLDGKLYALKCMNIDEAMNATNDVERQGYKKGLVKELTMITLQRSRPPPAYLMQMFN
                     AVASLDAEKKQLSILMELMSFTVENIQQMVSRIPSEELMRVTQSTFRNYMSGDPSAQQ
                     AMRECCKDQLLYGSPRHALGRSTYKEPATWEKNVKRETPMPEVLLSMLARDVLMGLNE
                     LHTDYSIIHCDLKPANVMLCCDQQKFKLADFGCGSVMEDRQHVERRGIDLGTILYKAP
                     ERFAANILHRIADIDDGGTGEAVVFTAKADVWSLGIMLMELAAGIHPCDQFKSDFWNY
                     GTMLKLSKMTKPLNWSESFYDFILRSVCVDVSLRWSVQQLLKHPFVIKFNHVPREKLK
                     QFVQRLEADSKTFHKRQQSELLKEQILLSTTRRHKDTFQLQSRKVWSTYTAYLKQAPP
                     TKDQTMFPELRHT"
     gene            <411433..>412098
                     /locus_tag="LMJF_32_1030"
                     /db_xref="GeneID:5656216"
     mRNA            <411433..>412098
                     /locus_tag="LMJF_32_1030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685367.1"
                     /db_xref="GeneID:5656216"
     CDS             411433..412098
                     /locus_tag="LMJF_32_1030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685419.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656216"
                     /db_xref="GOA:Q4Q5H9"
                     /db_xref="InterPro:IPR003697"
                     /db_xref="InterPro:IPR029001"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5H9"
                     /translation="MQKPIMIVGTSAPRRREIAQRHFGATYDLVYLSPDIDEKQIRDS
                     DPFTLTRAIAQAKMDELRVKVARDAALQDRVAKRPGSVAITFDQVVDYHGEIREKPAS
                     EQQAAAFIHAYSNDNLGTVMTTVLYDFGTGKQVSMPNTTLTFYGEIPDETVARVVERG
                     ACLRTAGGFVVEDVDMKRCEIKIDPGTEEEVCGFCEKSVRALLEGVQRPWVQSDHCSD
                     GKR"
     gene            <412746..>414560
                     /locus_tag="LMJF_32_1040"
                     /db_xref="GeneID:5656217"
     mRNA            <412746..>414560
                     /locus_tag="LMJF_32_1040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685368.1"
                     /db_xref="GeneID:5656217"
     CDS             412746..414560
                     /locus_tag="LMJF_32_1040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685420.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656217"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5H8"
                     /translation="MQLRQLSFSSSSFHHKYKLARGRLFCFVVPLPPLLSSMNSLLKT
                     FRNVVELGEEESPGAFAPSQHGNVDEQSNPEVLRQHISTLSRKLARQVQLYEELRGES
                     ISVEKELTRMRLRFAAARKLWESTNTSLEHSIQNLVEHRLFGAASTAPARPSTAFGSS
                     SGKVSPNLADTPLLDATYVASLREQIQRLKEMVMRSGEERSQLQSEKQYEEVQRVLRA
                     SGLTASHLDAQVRAAVQKLVAQWGDERAYYESLIESLEQNAAKHAEREALLSGCVKQE
                     QERRAEATAPNSAAESDELRRLREELEQWKRGERTVMENVSGDPHRFSQTASPISANA
                     TQHPANEDVSDASPLPHVAKDRHFLVSFETAGAHDVTGAPLQGDAALGFVVGDRALAE
                     KLELLSRDCSAREEALDNLYRDNRSLQEVELRHCQKKMDELAQQLSCEQYRARQLEDE
                     KRRSAVSEEKLREQVTQLRQAVNAAAAGQASLVAPSGLSTGISITLAAPVHVRLPLNA
                     SILEQSVPYEKAATWKDCARGAARWWKELRLNTVPLRCSQVHNAKSAARAQGSGVLRR
                     GPRAPLMLGGIFVTLMFIYLLFLCVDSARAVRRARYTA"
     gene            <416338..>416952
                     /locus_tag="LMJF_32_1050"
                     /db_xref="GeneID:5656218"
     mRNA            <416338..>416952
                     /locus_tag="LMJF_32_1050"
                     /product="vacuolar sorting-like protein"
                     /transcript_id="XM_001685369.1"
                     /db_xref="GeneID:5656218"
     CDS             416338..416952
                     /locus_tag="LMJF_32_1050"
                     /codon_start=1
                     /product="vacuolar sorting-like protein"
                     /protein_id="XP_001685421.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656218"
                     /db_xref="InterPro:IPR000979"
                     /db_xref="InterPro:IPR024654"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5H7"
                     /translation="MVLVLVVGDTWVPQRASGVPEVFCKMFSPGRIHKLLITGGVGSK
                     EMYDYLRTIAPEVHCVTSSVDRQWADHMPESVVLTVEGLKLGLIHGHQVPVGDKDSLA
                     AVQRELDVDVLVSGSTHQSKYFEFDSHLFVNPGSLSGADTEYDVNVVPSFMLLDIQDK
                     SVVTFIYQFHPEDETGGGGTATEDLAAAGMVPGLRIKKKEWAKE"
     gene            <418504..>420309
                     /locus_tag="LMJF_32_1060"
                     /db_xref="GeneID:5656219"
     mRNA            <418504..>420309
                     /locus_tag="LMJF_32_1060"
                     /product="putative dynein"
                     /transcript_id="XM_001685370.1"
                     /db_xref="GeneID:5656219"
     CDS             418504..420309
                     /locus_tag="LMJF_32_1060"
                     /codon_start=1
                     /product="putative dynein"
                     /protein_id="XP_001685422.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656219"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5H6"
                     /translation="MTEITYSYSRLAREFGRMPEFQANDSEIIADIAPNEVVKDTFTS
                     QNPRESQVQNVPQLSEASTNTESVRIKNHAQFHGEGGWPHAVDPTEFEEKMKYCKKVE
                     REEVYLQTCARLAEQCVECCVKQNTAMDIYGHYFPEALPDEEETMGPASLKVWAVLKD
                     PSEEKRTAAALSWQNEGRRIAVAYSRLKFQSQTPTMSTNSHIWDIMNHNEPVETLVTP
                     SPLCSIEYYSKDPHLIAGGSWNGVVQFWDTRQPNRPAARSLIEESHKDPVWALKWLQS
                     KSGELLSVSTDGNVFVWDCRLPEKPMTIHSIAEDNLVLHPRSNDGGARGVLGGLCLDY
                     DPQVGGPAKYMIGTEQGTILSCNRKGKTQHEKLLPNTFNGHHGPVYSVQRNPVFSKYF
                     LTVGDWTARLWFEDFKFTPMFSTFYHKAYLTCGMWHTVRPGVFFTTRMDGYVDVWDLM
                     LRQTTPSVSFQVSDYALHTIKPSQNGNYVATGGIDGNVSLIELSPSLCTLAPDEKNVI
                     GTLLENESLRDKNLDRAMKERRAVERQRQRRTTHLSAITRTPTTEEAALDDVAAKYIE
                     KVNAEKAEDIHTREETDALRLKALEDLEDGIDLYD"
     gene            <421967..>422212
                     /locus_tag="LMJF_32_1070"
                     /db_xref="GeneID:5656220"
     mRNA            <421967..>422212
                     /locus_tag="LMJF_32_1070"
                     /product="putative small nuclear ribonucleoprotein"
                     /transcript_id="XM_001685371.1"
                     /db_xref="GeneID:5656220"
     CDS             421967..422212
                     /locus_tag="LMJF_32_1070"
                     /codon_start=1
                     /product="putative small nuclear ribonucleoprotein"
                     /protein_id="XP_001685423.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656220"
                     /db_xref="GOA:Q4Q5H5"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5H5"
                     /translation="MPAHKTLPNLNHFMEKRIVVKIQGGRSISGVLRGVDEHMSIVLH
                     DAMDETRNAAVSEEARLALGTTVIRGSAIVEIVSADV"
     gene            <423556..>424122
                     /locus_tag="LMJF_32_1080"
                     /db_xref="GeneID:5656221"
     mRNA            <423556..>424122
                     /locus_tag="LMJF_32_1080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685372.1"
                     /db_xref="GeneID:5656221"
     CDS             423556..424122
                     /locus_tag="LMJF_32_1080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685424.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656221"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5H4"
                     /translation="MAGLDVAWIPFTVMYLLYLIPPTLMEVYSYYSRGGLVRYEDLKY
                     DDSFCPQYQWNRDTEVYYKRFLDRPNSEAGKAFFSWLDWSSESYDRTIYILRRNLAKQ
                     DGEVSPWWRYIYGPFIFNWPKKTWLRGDDAACRKAPAWGVGGEARARKEYEEAKAKGF
                     NKNYHYQIMRKIRREQALRAAQAKPAIE"
     gene            <426240..>431126
                     /locus_tag="LMJF_32_1090"
                     /db_xref="GeneID:5656222"
     mRNA            <426240..>431126
                     /locus_tag="LMJF_32_1090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685373.1"
                     /db_xref="GeneID:5656222"
     CDS             426240..431126
                     /locus_tag="LMJF_32_1090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685425.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656222"
                     /db_xref="GOA:Q4Q5H3"
                     /db_xref="InterPro:IPR000433"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5H3"
                     /translation="MDGFRLYMEGISLPEGSMRRANAELIGAINSPDPMVQHSGLQML
                     CDQLTMSSFISPSTMTTIPLVLPSLLRCIASSQVREVFITAARALTYIIDAFPRTFET
                     FPTRDTLIEVLLQHLRSIQDVELSEQCITCLEMITRSQTGSRELLHNNGVEAVLGFAD
                     FFTLHKQRQIWTIVQRLVGEVDESSVQHITACLPTLRIGMTNGDSEIRQKAIATLAQA
                     IEGVKTDRAIVETVFGDAADRIAVLLHERDVNDDTLSSALSLLYAGVQWSAGIAASVI
                     QSDLLNTLLSLLQSTPVPAVVAEQHTAPSAGAGRVARRSAAAELVVGRDSTTDSGGGA
                     GTEPAAARTTMLTSHQRTIVCRLLASLLIPCRTGAAEQLERLEMLTQRPLLTGARAHG
                     SRSGMDDGDDEGEDYTTEEDENGEEMHEFDEDSDADATLTHLRQRVAQEQGLKIETKL
                     AYARCRASGFMCDGCGKNCTPGDWYRCNECPDKDYCTACVLEHYKDDHGGQHSYTDME
                     QVVGAAARNRDKLELYRKSPQRLQRVLEAIPTVVGVCVSSELVTVRTSCLDFLVSAVD
                     MASKEQLLASDITKVSLGEFLNNNLRGADLVCNALAVALAGRLLQKLSDIYQVQFVRE
                     GVKLSLQVLKQRCKVKGRATLTREARAALTTCTAGWSTIIGTEASMLLQRFLDVEDEQ
                     ATESLRRVVEELRQDHFSTAAGLLRDVLAGDVTAFEFFSSGVVRELRNCLSRQQSIYA
                     VMHLVAALSTSPATTRSGKAKKSAGASPTLTATTAGRVGPGSASLLSHFVHHLHTILT
                     LLDDFTVPTYDFIGGVHNYFVVSFEPHRASVAVAGDTTADTSTPSARGDGDSSVSPRQ
                     CIKARIRPISSVSAMAQALQQEVLQQESEDGDNGDNEGEAVTNVLPNLHPRHSPTARD
                     AETPVPAGPSSPAPAPANSNVWIRYGAHVLPLSMTMLQIMEHLVLPAAAASEDEARGS
                     HDDNAERRAKSRHQRRGKRHDTTAPEEGAHEAEEARHGAHSRLVPLDTSTAAGYSLQR
                     PVVLYYSTTPYNPQYYTLYKVPNAFPASGNPLAPLQVCLPSQDQRPSAVRVVQEQLAG
                     AFHYSKHVLSDSQRDVLGLLGTLHAAVANWAVLLNYVRTQAATGSKHLRGIDATCILN
                     TFAPAISIAEFQHAKLNSKAIQQCSQMLLAGQQRGTWAVKLALDCTYLFSYSTRKFLF
                     DVGFTSTDRCLIQMRKYRELFGLNEPQISSEQMRGIYGQLKKETKRVWREDVLECAKK
                     VLGAQDARARNRVWSFHFYNENGWGDGPTREFYTLVSQELRQRKLGLWRDGNEAADDT
                     EYNTAAYGLFPKPVPPGSTQKDHLVPFFRLIGRFIGRALVDEHVPGLPLSPVFLRLLR
                     GDVCGVHDVQDVSDEVGRLLVAMAGAAASGHTRVQLPGQTKAVEVQDLALDFTLPGDD
                     SVELCADGAKTAVTANNMMAYCDAVTSFLLDRGVAAAVHALREGFHWYIPLVALQMLS
                     VDELYQLIAGHETAITRDDFEKYSEANYGYTLSCKHVQWLFDILAAFTVEEQKQFFFF
                     LTGSAHLPVGGLSRLRPSFTIVRKTSEDASIKEEDMLPSAMTCQNYLKLPQYNTKEEM
                     ETKLRFAMTEGSGVFLLS"
     gene            <432779..>435892
                     /locus_tag="LMJF_32_1100"
                     /db_xref="GeneID:5656223"
     mRNA            <432779..>435892
                     /locus_tag="LMJF_32_1100"
                     /product="putative exportin 1"
                     /transcript_id="XM_001685374.1"
                     /db_xref="GeneID:5656223"
     CDS             432779..435892
                     /locus_tag="LMJF_32_1100"
                     /codon_start=1
                     /product="putative exportin 1"
                     /protein_id="XP_001685426.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656223"
                     /db_xref="GOA:Q4Q5H2"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013598"
                     /db_xref="InterPro:IPR014877"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5H2"
                     /translation="MDAILDFSKPVDVQRFEQVVTAMSSGSPAEIMEAQEVLTRFKAN
                     PEAFFRVDKLLTESRNTNTRFFALQVLDDTILHRWNTLSTDNQQAIRNFVVSLIVREC
                     TSFSHIRQNRTLLTKMNMTLVSIAKREWPVRWPNFVQEISTSASPSEPMVENNLNLLR
                     LVGEEVFEFGEKTLTSRWVERKKQALAQDFRFIMELCVMVIVNAEDTVLLRTALSTLE
                     VYVPWMTPELIFNEQVLQSISRLVVSDGNVRSEAVRCLTEMCSAATSSGAAGDQQMRC
                     ILETFKTALGNIMSAFPTTHSSVMERVVTLYEQGSLVDKEYVVNLNLLLIAFLRHYYT
                     SISYDDMLLVTCHEMLVGMSNINEKELFKACVEYWWWLGDLLLRAPASVVKRNLMSKL
                     PRVLSDVRFVLIRRMAKPEEVIIVEEEGEIRRQHVTDVEELQLYNLMRQTLVFFTHLD
                     PKDTRNIMTDLMKRQLDRSEWSWHNCNTLCWAVGSISMALSEQDESDLFVKIITDLLT
                     LFKTMSGKDNRAVIASDVMFIVGQYPRYLRNHATFLSTVTRKVFQFMREKFPGVQDMA
                     VDTFVKLSKQLDAKYAEVNGSTSLASEVAKTWSSITEMLSLQQVQTCFNAAGYMIAAG
                     STEQQRALLLETFLTDTNARFKASTASAAAAGTAFCQSEEAMVELLHYLRVFSNVADS
                     CGDVFVYEMMMITQDLYGFYRMFSEAQVRAIADGGEAALHRPDMKYVRLAKREILRIF
                     ERFVSHATQLKFIAESCLPDMFSVVLLDYENAIAAAKEPGALALATACVRTLGRCIEN
                     NCEAILDHTFNTTVAIIAQDMESHPDFRVNLFKLLQALNAHCFEAFICYTSTHEDVLL
                     GMLWAIKHTDYPTMSTGLETLDLFLENVSKSEYAEVFFKAYMQRILVDVMVASMDSLH
                     ASGFQHHVRILQKLFNVSSMVPPDTPTIGKDVIRAYLLDSLTVIPTLTTTSILSFVDT
                     CYESFTDDERFRTQFADFLIEVKVWGAEQENKMQEEDERRLREETIPGFSNLSMEDPP
                     ANLFTSL"
     gene            <437332..>438294
                     /locus_tag="LMJF_32_1110"
                     /db_xref="GeneID:5656224"
     mRNA            <437332..>438294
                     /locus_tag="LMJF_32_1110"
                     /product="putative mitochondrial carrier protein"
                     /transcript_id="XM_001685375.1"
                     /db_xref="GeneID:5656224"
     CDS             437332..438294
                     /locus_tag="LMJF_32_1110"
                     /codon_start=1
                     /product="putative mitochondrial carrier protein"
                     /protein_id="XP_001685427.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656224"
                     /db_xref="GOA:Q4Q5H1"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5H1"
                     /translation="MNKLNDDVEDTGWVPTSLNAIGRHAPVTIHTVSSQLASATSTCI
                     FYPFDTLKTRFMSQDGTAVRRHNGRVYSSIRGSLALIYREEGLRTLFRGCPVAVAGAV
                     VAWGVYMYLYRHLCNFTEYTSYVGRSGVSVLSSAISSCVTCPIFLIKSRMQLEEANRS
                     SHYRSFWRGVRHTVQTTGARSLWRGLSPQLFLIFPNALSIPTYDTLKRFVLRYRWHHA
                     EITELNLFEIAVCSTLTKVWILILSHPLVVMKVRMQDERATLGKYQYRSVAQSISNVL
                     KTQGLQGMYRGFRTALAHSLPRSLLHYCIYEKTLSLLCRRSPSS"
     gene            <439299..>440312
                     /locus_tag="LMJF_32_1120"
                     /db_xref="GeneID:5656225"
     mRNA            <439299..>440312
                     /locus_tag="LMJF_32_1120"
                     /product="mitochondrial carrier protein-like protein"
                     /transcript_id="XM_001685376.1"
                     /db_xref="GeneID:5656225"
     CDS             439299..440312
                     /locus_tag="LMJF_32_1120"
                     /codon_start=1
                     /product="mitochondrial carrier protein-like protein"
                     /protein_id="XP_001685428.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656225"
                     /db_xref="GOA:Q4Q5H0"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5H0"
                     /translation="MAEKEFTAPKATALQHTVASQLGGATSTILLYPVDVVRIRFTSQ
                     DGTHTREHNGQTYRSIVKAFQLIYREEGGLPAFFRGCHVSVCGTACAWGVYMYLYRRQ
                     WTWYEAWQAKRREAHRSGSGGSRFSEPGSPAACYAATWQNLLERFGFSIVASCTSAVV
                     CNPIWLLKTRMQLEEASARTADVPRNFRTFRGGLLNTVQTTGVRSLWRGVSAQMVLAV
                     PNAFNLPLYDTIKAAVIGVRRGEVSVLDVCVCSTVTKVVLALVCQPVLVVKTRLQDHR
                     ARTGELQYRSFLQSIRAMWNQGGLAAFYRGTVPSMCQTVPRSVFMFVFYEHFLKAAQH
                     ISP"
     gene            <441727..>446550
                     /locus_tag="LMJF_32_1130"
                     /db_xref="GeneID:5656226"
     mRNA            <441727..>446550
                     /locus_tag="LMJF_32_1130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685377.1"
                     /db_xref="GeneID:5656226"
     CDS             441727..446550
                     /locus_tag="LMJF_32_1130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685429.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656226"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5G9"
                     /translation="MAEDKKPRFLQQTTSQLLHQQEALRKRREMLERESTKPPAMRFG
                     TNTPPRGAGRHGRSAALPSTACERHASHSAPPPPPPSSGVHRELNWGRSENEKAAERA
                     PVCFSTLLRPSPTPAGLTRPRSATSFHTPPPPSPRPREVNTSDQVDTIITRLHKEPSL
                     PRTVSPRSPVSQRSRVEHDCASSKNAAAHLLAPDATRAGQATAAERTQTKASQTPTHG
                     ATPAHAAVERHTSTPKPLSQEALVDEQDETTGMAAFSNTFPVPRFTPISPVVASDAKR
                     AQQTSEGEHSTPARFAVGEFRTPRPLARPSNAATPVVGCPASVPGEGVAQQVPLALDD
                     EAETRPTPSPIPVPLPQARVSADACDVLQQGARPTLRDGETHTSTQHHDTKIAAPHDA
                     TCFSLTAGDASPHRQTSSPPHRNKASPVPTAQDLIHSVQVSAEKRPCGCERATPSPEN
                     WPSRRATATPSRTGSPPPMPVPTSDEPMTDFGAPTQKCCDRPTPASLSSQPAGGDVRH
                     IISGASSASPWPTTENIINSIMAGCGEGQRRRGEDRAAAAAAHELPREDDGGALERSS
                     CEEANVSHTNSHTVTVPEMLGTNADNGDEAYIRSDVLRATLEAHAPTHTPSPVPSDRQ
                     YGQSVVASAEKRRCGRPTPPERHVSVATPEDSNGHADRTTSASPQLCASHLLDSLEVS
                     VDKGGQRCKPAERPSEAEGSGTGDATAGEAAGRLAGLRTPSPTPTPEHVIASLQASAE
                     KRTRSGALDTTSGPGGSSAAAATSPSCSSYQSPTLTPQNVKDSMQKLMREQQQAARSD
                     APAPIRPWAETPKGIANTASGADLWNSSASPVVTAENVDITLDTLERDQRYHSRSSRA
                     PQVADISPEEPNATRLCDSVVSPMEVAEAAAPEDMSRIPAPSPEVAALASVVSPVPSE
                     FAVASAMFFDCVSVPPTPALENVEATTRDLGSPESTIRGRECAHVPPQFYDLQREVAA
                     ISEGRCRTRTPPPVQVCELRSPLPVSTTPLAEEDTPRAEASMEQAEVAVSAPLHHPPN
                     AISSCSAAADKDAEEEAMARRSSLILVHPTAAPQALLQHPHKPMPAAAPPSISPVQVP
                     RAPTPQPRRPLQQDLFLTGEHCESPLPRPVSLRSQVSLVKPVQLSHGHQHSRSPALAW
                     GASCTFPPQNGGMRAPLLQTGARPPAHYAAAVKRDKDPDQQAGLLDSQNDWMDLVEPL
                     RPHTITVSPQGGSVVYTEHSSIDLPRNREGPAGCVSPSSSRKRSRSAQTPLAASRQMA
                     ATTPASIALTMDDGVLSGSRSLHVVATPPSHVSQTPRSSTRGRKSQAEELLEMLPAEV
                     VAEVARIETAEEVAAAATAAAAASADSHGLRPSLGSSDGRLSGVSDGDSTLGLLSTIS
                     QRVSQRPRRVYHNDDYYIQYLEGIATSSASKARKAAGRRIHRAVMKDVASATVKTIVQ
                     RAGGDESPASARVSPAESPALRGSRRQSASPRGGGSAVARAKASPKHASEEVTLSPQT
                     PSPTRVGGRGQLKVSTRLSAELQKALFQQPSPAKPKRQRGPRGASPNASTKSTKAAKK
                     SPTPSPKSGPSPSSTTKGKTAKTPTQSTRGKKSVKKFVTAKSMRRPRRGAKHGKA"
     gene            <447949..>450003
                     /locus_tag="LMJF_32_1140"
                     /db_xref="GeneID:5656227"
     mRNA            <447949..>450003
                     /locus_tag="LMJF_32_1140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685378.1"
                     /db_xref="GeneID:5656227"
     CDS             447949..450003
                     /locus_tag="LMJF_32_1140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685430.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656227"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5G8"
                     /translation="MDFEAVARATHAAMARERGAGHLFQQREQELEKQAGTSAVPQQS
                     ALASGPALASSSERFCHALAPASHSAPSPQRSRDDASPAPPQQGQQQAQLPLRPFRRN
                     GAAARYSLQDMLKDCAADGQWARALHLFTSAVDQACRQVLVPGGMAPGVVTASGAPAA
                     AIASDPRSVSVNSTAESECFVAIRKMLAALPPRQPRDRATHFSRATNVKNMRGIMRWT
                     GQHYYLLWKCLLEAGHVEEVERVWSVMQHSGFVEYQMEERTVNAMMALLRRTSHPVER
                     VIATVAPPGRPLSETTSHQKGILRELVKELEKAAAARKFQLAGLNRRTAEGIRIAEAL
                     KRADQGYDGRHTTADAGATPDNGADAAVVTRLEEAAVVVGDFNGLLRRARSSEATERI
                     LRMMEHLNIEKEAVTYASLIAALHNPQYVLPGHTAKELEAHLPGGVSSQQHTNVGEGG
                     GTVTEGQASGPTSNSVDLSGTKTSYEAYRQERIEAGMAWFAACHSAHRTADVFNELLY
                     LLRAKSHWCQFNTVLVQLRGNAVVTETEWPERLSEAGEGVPPSASAAGGASPGSVTIL
                     APRWSTWPNGKTYELLIQRARYVHQWEVMWALYEEMIATGVHGTARVYEVLLLEARSH
                     PPQAVLAAERSGNSDGASSFLLRLYEELRRNGSDVHSFTGTVNVVNAWTRARSRSNRW
                     QS"
     gene            <451550..>452467
                     /locus_tag="LMJF_32_1150"
                     /db_xref="GeneID:5656228"
     mRNA            <451550..>452467
                     /locus_tag="LMJF_32_1150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685379.1"
                     /db_xref="GeneID:5656228"
     CDS             451550..452467
                     /locus_tag="LMJF_32_1150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685431.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656228"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5G7"
                     /translation="MAAPSHQHSLVLERSTCHHYYHCVLYDILFDLPVREIAAQVVPC
                     KDSNIVQRLTSADCRVVPHQLHVYKEPLEKKFGYVSFFVHRAPHSSTAADDVHRLVCE
                     WVAVDLASQLATVQCKVQLAQPPECHSSEPFLNAFRLKCPLLDPTLAADTKKLETFVL
                     TRVRFGQHCGNASVNQLNAVHCDDAKSAASAGSCGTETEMCTDDGLTATEGELDAGAR
                     SATRTLHEHVWKCVGTFLIASLSPKELVWLKKQLPSFPPLRIANGDMDTAYCDEAKLA
                     QFFETSLAPLFTVDEVVEAAALNTVNSEA"
     gene            <457284..>458429
                     /locus_tag="LMJF_32_1160"
                     /db_xref="GeneID:5656229"
     mRNA            <457284..>458429
                     /locus_tag="LMJF_32_1160"
                     /product="long chain polyunsaturated fatty acid elongation
                     enzyme-like protein"
                     /transcript_id="XM_001685380.1"
                     /db_xref="GeneID:5656229"
     CDS             457284..458429
                     /locus_tag="LMJF_32_1160"
                     /codon_start=1
                     /product="long chain polyunsaturated fatty acid elongation
                     enzyme-like protein"
                     /protein_id="XP_001685432.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656229"
                     /db_xref="GOA:Q4Q5G6"
                     /db_xref="InterPro:IPR002076"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5G6"
                     /translation="MVSLEQAEQIAAAIEVPDWVLTKSAALVYSCFGSAANAFESSIK
                     INFPAQHAFVEAWMRARSHPFAERLPYLNPWHVIASILAYLSLIVTLRLLHRVLGKFS
                     CRTLGLVHNLGLHLLSLYMSLGLMISARAAGYSLWNNAVGTSPAEWRIAKLIWLFYVS
                     KVVEWVDTVIMLLKQNYHQVTFLHVYHHTTVFVLWWLALLVAPGGESYYSAMVNSGVH
                     VFMYGYYFLTLLFPSGIVRDVLSKFKFAITKGQMWQFVFNCLQSAYDLVWVPREELKY
                     SAELLQILFWYMISLLALFGNFLVKNKKFSHRRCVDAATASGAKEDTAARSHGDRTHR
                     TRVKAGMTNMQLERLKNEKSTEMKLLMRKNGNGNGQKASLQAMAGSR"
     gene            <460111..>461355
                     /locus_tag="LMJF_32_1170"
                     /db_xref="GeneID:5656230"
     mRNA            <460111..>461355
                     /locus_tag="LMJF_32_1170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685381.1"
                     /db_xref="GeneID:5656230"
     CDS             460111..461355
                     /locus_tag="LMJF_32_1170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685433.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656230"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5G5"
                     /translation="MCNRAPSQQLSPLSLDHHCGHRSIPSFSISAEEQPRLALLWAVR
                     NIAFSSRPQMSSSSAVTEGHAEDSWNFRIEDAGVPPTMVATSSWVFLSFITAVLFLEV
                     RPAAIRRVRASAEHNACVIADDANSSAHTRRLWRLLVAVWTCALYDVVHRTCSYCVLS
                     AHMLVRRRLLPLGSDFLWDGLWTEWVNWVRFYVLCAPSATTSAAAQLTSCAGWKLPLA
                     GALAYDQYPEYAVLNVSSPATPSEVRLYRGVCLASLAITWVAVVALHGLYALLRRLFC
                     SAASSGTTRSSEVVADEPARAGEEQAMRTDDLTTALDAAEAPGDDSWVDSPEAIAEEA
                     RWRQQDEHLSRQRGSAHPVGMSAHAPASPTSYLVWRCWPSLATAVYATLYAFVGGLPL
                     LMILLFPAAIVIISVMVMLVTV"
     gene            <462142..>464124
                     /locus_tag="LMJF_32_1180"
                     /db_xref="GeneID:5656231"
     mRNA            <462142..>464124
                     /locus_tag="LMJF_32_1180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685382.1"
                     /db_xref="GeneID:5656231"
     CDS             462142..464124
                     /locus_tag="LMJF_32_1180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685434.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656231"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5G4"
                     /translation="MNSDGSSAFSYVLELLLSPLEEPFRRYLDICEDVHMRDASRNTM
                     LHWAATVGNVAAAYALLQHGVEVDARNVYGATPLHLAAAFAPNMGVMGPLLMQHGASL
                     TVPLSSRNETGVGSLLASRGLKAVWTWMVELSALLQQNGDSSPLLFRFGGSSSLPSAA
                     SIRAVTPLLCAPEELQQLGQGRGSSMQRPCAAVGMRAVPIPRAPARRLTPHGGGGHLL
                     SQKRSARLVSSHAAAAESASSATAASAASLRSATAEREAAVALFVSREEVGRIQLEKE
                     QVEARLEIHVELCDPLWSPYTCDEGDEVDVDSKMPASSAWWGTAGGVGNPEGDDTYAG
                     LVGLVVAVLGEKFDMKDGRQLFVQYKEPAGVDGAHVAEVWCPFSSVAHDPVVVAYIDR
                     YSRTYGLTNSVSVKAAATPSILNSNGGCGSPLDSMEREQLEEQLRMLPRRDLSSPESA
                     VSLNVSTKQFIPIAASELKSPEEFYSVRDELTPPVSRSPNPATLAGGLALRHPHPRRD
                     EKDGDGWHFAQAHMQEISPVQGVWPATGPAVSPEQTPTQTDAEAAQDTTASAVANHAP
                     TGVRSQPSRDDACVHLRQHSSPDVNRAVSGASSTVHTQPQVSSLRDGTSVILEKDERY
                     HLSETQKARYNSFLRDSALQRLHKRQGRLFAGASGG"
     gene            <465365..>467065
                     /locus_tag="LMJF_32_1190"
                     /db_xref="GeneID:5656232"
     mRNA            <465365..>467065
                     /locus_tag="LMJF_32_1190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685383.1"
                     /db_xref="GeneID:5656232"
     CDS             465365..467065
                     /locus_tag="LMJF_32_1190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685435.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656232"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5G3"
                     /translation="MHCSTGRAGSVGFAPRQQELQRVIEEKQIQLKQLYERQCRVRAA
                     MLRQQDFKGARVMRDQPQLRIRGSPAQARPPHRAASQTPSPSGIGPSESVAFTITSER
                     RRLRPRIAPQNPDSRTVFLGARSKLTRNRPSPSKEFAIRLSRLHKASASGAATVPEAV
                     AVSATKEPLSDSPDVSPIAAECPAGPADVSAGSYWSSISALFGDPVGMSCLGRGDVEG
                     ARHVRFSSRSPQVATFSVERSCVPLEEGFDAMVVAAAATPGTPASDGEKQTLGPELDL
                     IKAASAPLDTAAQRVSSLAMSPFASSRYSAVLSPRTTVSSYLTQIEELRHSLLEAPSD
                     TRYSGRGFDDDTRLPARRSQDLRMSGQPSVMEKQVEREGAATPAKQWTLVRTRDLGES
                     VGAAAVGINSTTMSGALGLAVPVPSSVPVAPVMWEASVCFTENSPIFLRRPERRVGLS
                     TQDSCESPLLTNITNQPPKSSAPPPPRLPMSREESAVTVHKLTKCVRFRESVERSDKG
                     TSGTACKRRRPGWRPAPSSASAPAVGGVPIVMPAELCCEQEGFGAGILLACGPTLYFD
                     "
     gene            <467803..>468627
                     /locus_tag="LMJF_32_1200"
                     /db_xref="GeneID:5656233"
     mRNA            <467803..>468627
                     /locus_tag="LMJF_32_1200"
                     /product="putative proteasome regulatory non-ATP-ase
                     subunit"
                     /transcript_id="XM_001685384.1"
                     /db_xref="GeneID:5656233"
     CDS             467803..468627
                     /locus_tag="LMJF_32_1200"
                     /codon_start=1
                     /product="putative proteasome regulatory non-ATP-ase
                     subunit"
                     /protein_id="XP_001685436.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656233"
                     /db_xref="GOA:Q4Q5G2"
                     /db_xref="InterPro:IPR006746"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5G2"
                     /translation="MSALGDLSITVRKIAEDVKSLKAAYEAKNDDQCSKLLADIKRRI
                     IVFPSFLNPGATSNTRSEELSLARDYLELGVLASAHQKDLASFEVYFNQLQLYYSDIG
                     ADELPESPQYLMLLGLNLIRLLVCSRIAEFHSEMEKIPFATHGSNLYIRFAVGLERYL
                     MEGSYNKLLTSRKKVPSNEYLPVVEMLEQTVRDEVANCIPESYRQLSIPAAQRILMVD
                     TEAKVREIGAKREWALSADGTHFVFTREDDTLQKEIPFKEMIEQHINFVADLQNIV"
     gene            <469705..>472110
                     /locus_tag="LMJF_32_1210"
                     /db_xref="GeneID:5656234"
     mRNA            <469705..>472110
                     /locus_tag="LMJF_32_1210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685385.1"
                     /db_xref="GeneID:5656234"
     CDS             469705..472110
                     /locus_tag="LMJF_32_1210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685437.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656234"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5G1"
                     /translation="MHLTKRPPAELIIRRRDGTEDRFVQPAAAVVEQASRTATNDDHE
                     ETYHIVMECAPYTASFNTLLAKDSVHEDSRQMVALVHHRMHSEGIPLNTQTYNLLMKR
                     VTRFTDGAIFTLYDELKSEGLKENSSVRPNMESYMLLFRACERSALYNRAFLLYQQLR
                     QQFQLVPETAVYNTLLGYCAAVRDVAQATFLIEEMKQLNVPRDVNTYNCLMSVMMESA
                     PYEETLKVFQELLYLNLKPTIRSYNTILKAACRHGDYDRSFQFVEEMKKKGLIPNVET
                     YNYLITVCEQRLDYVRGTGAYSAERRTREQILQGLQAIAELVMTLLREMRSIQVWPDT
                     YTYNKALSILQSCEDERVFVVYNDMVLHTSEIVDRPRGAGRELSLPSRKWGIAKSSDD
                     DMHRADAGILLEEALQAEDEEEVGNMRSNAVRPNLETWRQMMKACLFYQHYTLAKEVS
                     ADMRKSGMTLNASLGLLLLEVCCAAKDLNWAEDVVAELKERDVLIDTPLMNAFLRVLC
                     AVDAGAVIFSEYEQMRLGIHPTGAWADTDTCNIVLRYAHARPSKAAFAESLYTMMVQP
                     YSIAAANEETFCIRLDALTGKMDVPVDSVVAFVEDVTHNSIPLTVAFYHSVLRFFLVR
                     DDARIQAWFDRLSAEYGSTANGSAPAADVECYTILMQYYLAHAQYDMVEQLFQRIQCS
                     SELEASTESYYVLFEVAGRQGDVTAVRRVFHQACVNCIPLDVLCYNSILKTLVLHEEP
                     FVYDVLSDMKKHRVPPAESTMAVFLADAHGRRVLAEVVSRALFYTPPPPITLQKMKVR
                     GEG"
     gene            <473279..>475672
                     /locus_tag="LMJF_32_1220"
                     /db_xref="GeneID:5656235"
     mRNA            <473279..>475672
                     /locus_tag="LMJF_32_1220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685386.1"
                     /db_xref="GeneID:5656235"
     CDS             473279..475672
                     /locus_tag="LMJF_32_1220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685438.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656235"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5G0"
                     /translation="MTETTGARGRRTFMGRRRSQHEVQTEASFVPGCSSLEYAYDPLA
                     SEQYANLVELRQMIHSCLTLVAGDVYDVVSFKDILYHLESEMPSSLPVTDLLLLSSRL
                     FRRTAELGRLLSCFFGVVFADDRNDEHFRFAEVRLLQREIRELKRQLSASEEERRRLK
                     EMLDNVGQVAYDHGRAVELLETHNKVLKKQSTALEDQMALLFHQLNTGLEGHCKSAYQ
                     QVTGEMMVQESLNPARITFRQTMDSLSEQLRGSRGLITDVREVLLSCSQGRRTGEAYA
                     AVEPTVRFKLKMLEANFQQLMGRFTAVKDTVVETAQELMNALQERKKILCLSFQHIRL
                     YDLQNAKLRNARAILAQLQHNTSEVVRRIRVTFPSGNLTSVDRFGNIRTQRWHGGYTL
                     ATLRGYNLTEQQQQGEGEMSEVARSSTAVPSLTAGASRTLPGLTESQIMAAESEMAVI
                     DGGVHSVTPVGLALSPGFRSMRASHSGVSPPPLRTSVPPSRGGSKLASARGSSSTTGM
                     PAPVSAPTSVRSDDPDVLPFESVSTFVDLMHDIHDDMDELQSALVLDDEMAAFLKVLT
                     LSASTTPRADALEIAGDPTGRAALLERQEYNMETALQPTGGRPGGTRGAPSSASVVSG
                     NESITALEANSFSSLFSKMGTPSTSSEARGGARAENASSEAVMARQAVQLQRQQKQIA
                     KMQEDFTSKVGFLRQVYEARIGDLEVRETTVSKRLGLVGGSAFQRGAGDGGSGRSSPG
                     VRKGEDESPVSSSPGDKERLTKLRKEWRQSKRKLQPNRKLREATAEQLQLMQKDEKL"
     gene            <476952..>478160
                     /locus_tag="LMJF_32_1230"
                     /db_xref="GeneID:5656236"
     mRNA            <476952..>478160
                     /locus_tag="LMJF_32_1230"
                     /product="putative ADP-ribosylation factor GTPase
                     activating protein 1"
                     /transcript_id="XM_001685387.1"
                     /db_xref="GeneID:5656236"
     CDS             476952..478160
                     /locus_tag="LMJF_32_1230"
                     /codon_start=1
                     /product="putative ADP-ribosylation factor GTPase
                     activating protein 1"
                     /protein_id="XP_001685439.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656236"
                     /db_xref="GOA:Q4Q5F9"
                     /db_xref="InterPro:IPR001164"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5F9"
                     /translation="MAGRSYVSPKDERAFVAILAKDPECSQCFECGAPSPQWCDVMHG
                     TFICLNCSGQHRGLGVHLSFVRSSTMDGWVDWKPEKLRQMELGGNRRARLYFEEHKVP
                     NTPLKARYESLPALRYADMLESEALGKPFSEASWQPPAWYTRLQAAASLAGPFPTSSY
                     PQTDLNRFAGVGSNGQPHVMSDNSEGDREWYSALYSGWSAVSQKTAELAQHATKAVQG
                     ADVEGMRSSLAQTWAGVSATVSAYAADLQQRIAEGGGRDKDDGLDRMLQNAREAQTES
                     SVDNRAAGQTRYGHIEGSRGNGPGSRIAVQARPVGAASPESSTVYQGRVLRQSASESS
                     PTESVTASASSGWDSPSRASPSAALPQTQPTSSRPVNPLGGDAGGGGASPPASQSTKK
                     DEWSWDNENF"
     gene            <479373..>482156
                     /locus_tag="LMJF_32_1240"
                     /db_xref="GeneID:5656237"
     mRNA            <479373..>482156
                     /locus_tag="LMJF_32_1240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685388.1"
                     /db_xref="GeneID:5656237"
     CDS             479373..482156
                     /locus_tag="LMJF_32_1240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685440.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656237"
                     /db_xref="GOA:Q4Q5F8"
                     /db_xref="InterPro:IPR026511"
                     /db_xref="InterPro:IPR028073"
                     /db_xref="InterPro:IPR028074"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5F8"
                     /translation="MGSLFQLRDFWYTSFPGEEFSPSAMVLADPDVSNLFDKIVLGSY
                     QGMLRILNPSATQGPMLPGDVLLEKKYDKPILQLDCGPFRPFKSGVPPNILAVLFPRT
                     LMFLEIAAHGSDNANAMNAPNPTSSDAAGNELAAEVTSSSTADAQLPHRSPHGSSSNV
                     PDAFSSLKELGAFYTLTVQREAHLQSTAYNFACGCFGNSDYKMVCVQSMDGLLTILDY
                     GGVLYRTFLPQNQFLIPGPMQYSMHRDALLTCNMSMFLLSYSFSSLVLNSTAEDVAAA
                     AATTAGAVAASRSSSLCPLWTFNLGEDAVDIAVCRLTRGLTREEADVVVLCTSVLYVL
                     SESGEPRMLRRLDVEASTLCVYSLPGIPYDNLLVGTFNGLVQVYSDAELQWSAAVASG
                     AAPLQLTVATLCGVEGMIVNLASDSSLSINYLGTDPVDHLPESLETKSIPYTEIVNDL
                     KQYEQLIRECSGNAASATEDGDEDDPLAIPAMSLSSTGGKRTKKRGAGKAEEGAASSG
                     IQTAAPPSPSNAAVATSLSITSAFSSLSTTDNSAELTVTLQTFHNHVEAVSLVLQAVP
                     PLLVTPSQCVIEQITPESSVQRTFTARALQNRDLIIPSSLDVVVVAVYRGQRREYETV
                     QHVALAPLPLVARPVAPIKNTAFSMQLNTDQTQPPSLIDVFADMAPLGHVTVNVLSLH
                     YLNGADATVLVSKNAARFKLQGSTMEGLWLLAAELTRRVRLCCGGAAALKLEVPDDLP
                     VPDFLAVVDTHWAIRREMVAASAALDDAAALFRAVEKRLLARFRDRSPADATALGVLL
                     QEGYKLLRERADAVTRAKTRLRQASAMLNCCAQLFWFCLEIKSPPLAPQDAETLSTLF
                     RCSVADENDGGWEEVTEAVLAKVLNVKAKKVPSNTLELSTSTANLKKHIGTLIRMVQS
                     GQKLGSAAQGGGA"
     gene            <483835..>485064
                     /locus_tag="LMJF_32_1250"
                     /db_xref="GeneID:5656238"
     mRNA            <483835..>485064
                     /locus_tag="LMJF_32_1250"
                     /product="putative ubiquitin hydrolase"
                     /transcript_id="XM_001685389.1"
                     /db_xref="GeneID:5656238"
     CDS             483835..485064
                     /locus_tag="LMJF_32_1250"
                     /EC_number="3.1.2.15"
                     /codon_start=1
                     /product="putative ubiquitin hydrolase"
                     /protein_id="XP_001685441.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656238"
                     /db_xref="GOA:Q4Q5F7"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5F7"
                     /translation="MNNSNFCFMNSMLQALMFIPSFAQLTVSVSCDAQARQLCPTLVT
                     LGKWTLQYWKPGFTRLAMIAPTLMPRVPAGANNSNSGAPRSAVVPASQRILDGSVQED
                     AQEFLQKLLERVHEELVGLEEAFQQADASEAATESEMGSIGPAATASTASGGGRTDAP
                     DDATTSTFPKKGWTFVKGKEKLAVREHEDTRGQSKLLSSIFGGTLESHLQGKQRQRNR
                     VSVLIERYYCLPVDVGFAPECTVEQALERTFMTERIYDSEHEKNLKKTLRLGHLPSIL
                     FLQLRRWAVTREGELVKLDNVVRVTRTLLIPRTICADDTLGNTERMYRLLSVVCHRGD
                     AVSRGHYVTYLMHHAATPAALKVQASEPGNKDTAILRSPPGAATVILCNDANISVCPA
                     KNMEKETVYFLVYQKTS"
     gene            <486098..>487534
                     /locus_tag="LMJF_32_1260"
                     /db_xref="GeneID:5656239"
     mRNA            <486098..>487534
                     /locus_tag="LMJF_32_1260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685390.1"
                     /db_xref="GeneID:5656239"
     CDS             486098..487534
                     /locus_tag="LMJF_32_1260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685442.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656239"
                     /db_xref="GOA:Q4Q5F6"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5F6"
                     /translation="MSTFALEPLPLFQPITAASEQRITQVLDTLRAQHKSAFPLLFQR
                     ALDRGTADLPTPQNDLRLLAYAFLVARHWNVEKAVKMAKDACLFFEKFRIGNDWILPS
                     AFSIRGYDQANVAAWTKQPFGTTNTPLYRCMQTMTPLVHGGFHYWDRRGLPVVYWLVG
                     RMETRSVLRKLKPHVPVGTTIEEFFQLFGGGIIETGWTLCRYQDAVLTAHPQPEIDMG
                     APRRNFCTVVVDCKGLSYKIIDRQLLEKTKATLQQMHCVFADCIHRIIVVNCPPMVKF
                     AYRLLKSAIGEGVQQKITFVSPENTTAALDSVIGLERVPAFLGGHCQCEGGCIASYNP
                     NAVFTTEEVDDEDDVTTENISVGPGKKHERVFELQQGEEVIWEFSTTKGTDVRFSVLF
                     YPKQQGVTAQSKGGKVRVRIDTSVKRTTTENPVVKQEKLKDGADSYMAPEDGILQLVW
                     DNSKSIVSDKGIQMRVYKSEAMMESPVE"
     gene            <493292..>495595
                     /locus_tag="LMJF_32_1270"
                     /db_xref="GeneID:5656240"
     mRNA            <493292..>495595
                     /locus_tag="LMJF_32_1270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685391.1"
                     /db_xref="GeneID:5656240"
     CDS             493292..495595
                     /locus_tag="LMJF_32_1270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685443.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656240"
                     /db_xref="GOA:Q4Q5F5"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5F5"
                     /translation="MNGTQSPAVERFHTSYKDSDLLSSATDSIDLNHEDEHQVTDAIK
                     TLQQLLKRSTVNDNTPTTPTDAAADSAAAMEYLADFSYGLTPGEARYIVYRFLKATGM
                     NIRRALEQMMRSAERRRKHNLNNMALFPCIIPMRGFNQRTVCYELRLPFISNISSGKS
                     CLDPEGRLRLEHEQLDYGNAHYEDPYTSLMTTGAAADSRPLSPDGSDCLSSQPAMSAP
                     QVASSSPTLPIGPANGKATLEGDGTAERERDAALQRSSLSPKEHRRKSDENKRDGSRW
                     RSFMSLIPFLRHQGTGSPSNASGSHLRNMSTVTSETRRHRGLHSILSTCSGSDCGNSG
                     AREQNYETPAMKEEEKPLNAAGVAGPLTATPSTFYADCLNVHRLLGPIVAVITKHAPF
                     AFHYWDLEGHPVMYCRLGRMHSKKLMQELFALTPIDAEPCALALLFSTYALLVLEQLI
                     RYCNRRNREGDEVRDERLPQPQRGSRQRQQGESCPASSTGAMLRRRPLVGSCIVVIDC
                     AGLKVRRYLYRPLLLMVRSIVRMNMCDFPELLHHVYVTNCTNVVSLSYLMLRGILSRA
                     AREKVTFCSKSNTAATLCECIRSDLVPQELGGQCQCPGGCISPMDATPDDARSTTLSH
                     SCIDAPSSVTTQCGDTCTEQVTQQLGEEELFFHPFHYTAERLVLKARESRKLSFAMDA
                     GSEIIWEFAVKHEQDVFFSAVFVSAGNDGAMLSLVPRRRVQNEAGHYISPSIGTVIFE
                     WCNKHHFFTRCRLSLKVYRGERSVAST"
     gene            <499776..>500375
                     /locus_tag="LMJF_32_1280"
                     /db_xref="GeneID:5656241"
     mRNA            <499776..>500375
                     /locus_tag="LMJF_32_1280"
                     /product="putative RNA polymerase-like protein"
                     /transcript_id="XM_001685392.1"
                     /db_xref="GeneID:5656241"
     CDS             499776..500375
                     /locus_tag="LMJF_32_1280"
                     /codon_start=1
                     /product="putative RNA polymerase-like protein"
                     /protein_id="XP_001685444.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656241"
                     /db_xref="GOA:Q4Q5F4"
                     /db_xref="InterPro:IPR005576"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5F4"
                     /translation="MFYKIVLQRTVNVKPADLCNTLNRSLLTFLREAVEGKPLPSPDS
                     IASIALDYVTASKSSAVVIAVLDILNAETLQGKVLDDGSVSFRLTYEAMVLKLHRGEV
                     LDLLVSDVDETGFWASVYGVNKLFVNRNQMGEDMKTGKSEWSFEAETAAWVSNDDRRS
                     IKKDTMVRLRVIAETPQSERGMAVGTIGAPFLGPRVGSY"
     gene            <503643..>505340
                     /locus_tag="LMJF_32_1290"
                     /db_xref="GeneID:5656242"
     mRNA            <503643..>505340
                     /locus_tag="LMJF_32_1290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685393.1"
                     /db_xref="GeneID:5656242"
     CDS             503643..505340
                     /locus_tag="LMJF_32_1290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685445.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656242"
                     /db_xref="GOA:Q4Q5F3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5F3"
                     /translation="MSSGDFVLDLRYADCEDHLKMNGYYVHSPVSHECINNKDRSRSF
                     GTDCNDSDVVETRATIGGDGAAQQRYSHPDALLPPFHKPLVEDDVEDDDRSSDDSDDR
                     VATAALEHFLMGSASGLMDYAALETNGAANNCSLNSSPPSSTTTTDDSEGSFPCVDEE
                     VLGDLGDVIGYGGDRGSFVCCVPLPPLSRMWTQPPSFAREPTFPEGLRCSEVKKAYKK
                     YPTHISKDELSFVSTAYRCTRHRERCQSSSSPFLTPEEVRYAALHLVLPDAVVLARGE
                     QVGLLMPLYNCSLKEYLQSLANPTSSPAAASTMPTSLTVSHNANLHAEDADSSTGLCN
                     PHSSTFRFTATYRPIQSIPVISAIVFQMLEAVAFLNHRLPHGDGSTGYTHNDLHLDNI
                     LLSYDGDVALCDFELVASTPTPSRSMDVRRLPPSSRQSPHGLFSETADTWAFGLMVVS
                     LLTGVDPLFTSDIVNDFSDGPLLFRWDRGTRVLDWEANIKAHVELLLRRQDSTGKRLE
                     EARHLLQLCGKCLVNREGAEPLCAVSLLEEAMFLPYRRDFSLATRTVKEWISGTCRV"
     gene            <508039..>508854
                     /locus_tag="LMJF_32_1300"
                     /db_xref="GeneID:5656243"
     mRNA            <508039..>508854
                     /locus_tag="LMJF_32_1300"
                     /product="putative polypeptide deformylase-like protein"
                     /transcript_id="XM_001685394.1"
                     /db_xref="GeneID:5656243"
     CDS             508039..508854
                     /locus_tag="LMJF_32_1300"
                     /EC_number="3.5.1.88"
                     /codon_start=1
                     /product="putative polypeptide deformylase-like protein"
                     /protein_id="XP_001685446.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656243"
                     /db_xref="GOA:Q4Q5F2"
                     /db_xref="InterPro:IPR000181"
                     /db_xref="InterPro:IPR023635"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5F2"
                     /translation="MRRCVPWRRLVCGGTSLLRGGVDAGGAPLSSSPSFKETVEGKLE
                     KEAEALRRVACYPHRSMTRPVMPVPTSQILSPVFMSSLMDLNQLATGLHCLSFSAPKA
                     HWDAAVILIKSNPDETEYEVWVNPSVPGYDDRNAVAPMYGMWENCISCGTATAWVVRP
                     QRITCSGYDEHGNHKVQVLDGMRARCLMHELDHLMGKTIFHQAVGPEFVVSSVAMAQR
                     YLWPANFPSAEAYVTTPGQFFDYVQNETVIPPGMEWWYAQNVREEFSNEQIGQ"
     gene            <509733..>510881
                     /locus_tag="LMJF_32_1310"
                     /db_xref="GeneID:5656244"
     mRNA            <509733..>510881
                     /locus_tag="LMJF_32_1310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685395.1"
                     /db_xref="GeneID:5656244"
     CDS             509733..510881
                     /locus_tag="LMJF_32_1310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685447.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656244"
                     /db_xref="InterPro:IPR013536"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5F1"
                     /translation="MEHVLHRARVLLPRRGWRIGLIKEFYPRGATLLGLNVNAGSEVC
                     IRFRVPGKKNEFLPFHEVLCTALHEFTHCVHSRHDRAFWNLYYDLVKECEALEITMIQ
                     QGMRLYPAISSTPMSCTGTASQQSRSGREGRTAATASSARGGGRRLGNGGARGGGRGA
                     GGGMSTGSRHVAQTVIKAGRAVSSSSSSPPSSAAFPGEGRRLGGGGFRQYDAPIGFTP
                     TRDALRRILAGAAERRLARTPPLAATVTLGSHPLALSLHNTTFPQRDEGQSEVDDDDA
                     PDCVPHSLSGHEDGGGWNCPRCGFRNDDNVVGSCAFCADCDDEDEGEATWRKRPRLDS
                     DHSPLETPTIVVSLATASKTAPTQQLQQQQLECTAEEHYIVVSDEDDS"
     gene            <511520..>513151
                     /locus_tag="LMJF_32_1320"
                     /db_xref="GeneID:5656245"
     mRNA            <511520..>513151
                     /locus_tag="LMJF_32_1320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685396.1"
                     /db_xref="GeneID:5656245"
     CDS             511520..513151
                     /locus_tag="LMJF_32_1320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685448.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656245"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5F0"
                     /translation="MNRDGVEDGIYVNFFGFDGKAAMLACDMYGILPENLLYLPKKMF
                     LQTGDESEQVLLVRYTMCERSRQGTFRTLLGAKSKLIAEGKVEALWEERRRVCQGAAP
                     CPRFTEKQLEEAAAALDTDSESDEERQVDERGMRKPPPPLPPAPPFAPDGPRGEAAAE
                     AAATENDESPTPVTDTPFSRAPDSEPLPPPPTQASSDAGGETRRGSGTTATNDNAALA
                     VDAKRTTQQLPNDWTQYDVVNSLELPRAHKLCSQPPSIPQAYFPRLLETLSMEEKELA
                     AAQKELSRYSKKSARRLRARQQERSNEPSAPGRSTSLPPLSSSPAHKPATTHLHQSVE
                     LRNRRELAAVHRVAQAHLRFLSERYEQGRSIDEKMEGVATLGTLEHMLKYQKSIGVAP
                     EFEDRLQSKMVREESRAALQQQLRESEWERAYAIEEKAQHAQEVLERERERTKGIVAE
                     ALRTQRLITDWKQVAAHRQQETHLNGVLHRSAVRHAKADAYIETKRAATGMSRYYHDQ
                     QEVHRRQLRDTIRDMMISKKFSADGVADEDNDVVA"
     gene            <514411..>516300
                     /locus_tag="LMJF_32_1330"
                     /db_xref="GeneID:5656246"
     mRNA            <514411..>516300
                     /locus_tag="LMJF_32_1330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685397.1"
                     /db_xref="GeneID:5656246"
     CDS             514411..516300
                     /locus_tag="LMJF_32_1330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685449.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656246"
                     /db_xref="InterPro:IPR008580"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5E9"
                     /translation="MTHTTEVASPKSDPALYEKMQHADPLPPSESVLLPSKTVPTPLR
                     KSDESRLHLSVDKGASKEKVVEEEMGPPLRFTTTEVPLRTGVMTPRSSRHLSVSCVPV
                     EATTCANRPLATVPRKPCLRRAAALRPPNDASVPGAAVRDGQSFLLDRCKPTARDMVV
                     ELHVYDLSHGHLKRYAQELVGLEIPGVYHSGIVCYGVEVYFEGGIGIAAAGRTRFGNK
                     YRTHYLGVTKKPVSEFFRWIGVRAIHVNQIHDYHPVRHNCHHFSHEAARFLLGESASI
                     PMYLFSTVDNLVKTEVGASVAEVMTLTTHGMQSSVARQMRSRTLERQCSIDMQLSAST
                     ACGVMTLPPTAAVLFRPSDLHLAKRLVLDLSPYVKGLIKRKHMKPAALTVLEGMACAL
                     MEGTDSLPPNLLLNYVEIVTESLLRSPLATWGPIFNGLRVAVLHKLCLINCVFHTKLM
                     SMLVLAARDFPRLLPDGRVAFLRLACNFACGAYGVIVYSEARYRDAWVSIVGLGLMDS
                     SSTVVYTAACLALNLALGIVATSNLPLRRDMTQQADEHYALRLATLLLYNLRHRSALQ
                     LPEPSFNMILMALYRLSSSNTTALEYVVSHPFKPQYAELLDRCGSNESRALVCLLKTL
                     EDLFG"
     gene            <517840..>522465
                     /locus_tag="LMJF_32_1340"
                     /db_xref="GeneID:5656247"
     mRNA            <517840..>522465
                     /locus_tag="LMJF_32_1340"
                     /product="cleavage and polyadenylation specificity
                     factor-like protein"
                     /transcript_id="XM_001685398.1"
                     /db_xref="GeneID:5656247"
     CDS             517840..522465
                     /locus_tag="LMJF_32_1340"
                     /codon_start=1
                     /product="cleavage and polyadenylation specificity
                     factor-like protein"
                     /protein_id="XP_001685450.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656247"
                     /db_xref="GOA:Q4Q5E8"
                     /db_xref="InterPro:IPR004871"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5E8"
                     /translation="MLHTAVAPLLPASVVTHTVSGYFLPDSFAAQKEKEVVAIRQNHL
                     TLYRVKRTPHACTAAGLPPEEQLGQVAEVSLHAPPLGSAVCRPLRTTSDVLVLLFGDF
                     HVSFLQYNPVTVQFDTVALVQLDDRQLCLDRCPLSAMLRVDETGMYVAVLAKRSDLFF
                     FPVVEMIDQQAMAQVQEENAAANAWNSDMHSAAFAGNEEAAVTKTSGAVTAAAPKPTV
                     ALNAWGDEDDDDDDEAPNARNQLEAAKSEQSVSETTMTEDNSAVAFGAASAAPGTASS
                     QKVTQGGGTSLLLRVGTVTHWRLQDVKSALRNIRDVQFVQSAGEPLLAFLFEKQPTWA
                     GRVKLLEWRSKTVESHMLTCSIEWMKVTLANSATPHMLSLSEVDGLPYDVTSMTPLPA
                     FQDLPSAVFCVSRNMMVHVSTKSGYGVYVNATGEEQARSLKSSAVSLEAVQWRSASQA
                     LSTDLVKVNLNFANATSVLVSQPATTQRAPVVAAGAAATGDGHSQRLLVVTEEEGTVV
                     DVHLQSHGYTVGSISAEIVMTGCFGSSYASIDATRFFLGALNGDSRFIASTPHDPCKV
                     VQKFLGIGPVRDVDIVDTTTTSAGTQEDTLDASIEASPYADLFRSVELEALPTMTAAQ
                     RKAVMDIALCSGSGLAGSLSILRRSIRSRVVRQEELNAISVFFLEPTNADARKRPRDR
                     GNEGGRGDAPPASTVGAGAAPHPHLLISGSNFSILFAVRSDSVQQVRGAALSMAARTV
                     YAVHLDWMPGLLQVTETELRLLSADGKRRLSSTEFLTLPAIQRASSQGAAANVALSAL
                     LVAEMRCALVRFTDGQLLSFRLVDAKTMSTATLLLERVTAVAWWGSAARHPQQCQHTL
                     VVVQNMDLVLYTLPSPQAVQQASIFPNFALMPPFAMEGVETPVVKLRERLNAEPLPSV
                     THLAVFDQHEDPAVSAAPTEATLVMILSSGELVTYRVVPADANGPRRCVKVIYHILDV
                     APEVDVMESIKARKKRLQEERAHLASVTQQMRHCSERLVPFRGLQDRYKGIYVCGQTP
                     VFLVYHAATNQLVCTRHHATNAVRGFAPFHSRHVHGGFVYCGEGFVHFATMQPFGELL
                     GCSGWWLERVRLGCTPHQVIYSPAAHGCFVVASRPQPFSPKRAPFDVQLRMVEDEEGN
                     RVPHVIEPVSLPPLSATSGSPVPTNERYEVQFFSTLNWQCMGRLVLDGNEKVLSATLM
                     QVTRDTTMDAANRSTTAPVCALATAYPLGEDVTTRGRILLLTTSQQSGQGMQQLRTLH
                     EEPMEGPVTAITRVGEDCVAVAVGGTVRVYRYDANKSTMETMAILYAGAYVTCLQAFR
                     EYLVIGDLFNSVLFARYSEEIHTITILGRDTSAISVVSNDMLYHDTRFGLLVTDDARN
                     LMCMSYKPRVLEEHGKPPKVLESLLTVTGEYRLAGGVLLKMMRLRAASARSSSVAIYV
                     TNMGEIGYLVPLGDQTSRTGQWVVRRLQSEVAHAGGLPPRMFLGFPQDDPLRSLKGEE
                     WMLHFPLLEQLYRQDLRTRKLVASAAQTQLERVMNVGATVSAELGHI"
     gene            <523408..>524757
                     /locus_tag="LMJF_32_1350"
                     /db_xref="GeneID:5656248"
     mRNA            <523408..>524757
                     /locus_tag="LMJF_32_1350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685399.1"
                     /db_xref="GeneID:5656248"
     CDS             523408..524757
                     /locus_tag="LMJF_32_1350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685451.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656248"
                     /db_xref="InterPro:IPR007074"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5E7"
                     /translation="MTSSCTIVPGHRVASSASGSQTPQASTRQDASWLHGNAPSSVFE
                     LRRDALLEWLHRFSERERNVGVSGVETPLSEEKPEELDSSVDLDTAYRAFLRCEDATA
                     QEALFTRLVDWVDAQCAQPVVSSGASPTSAFAAPATSAAAAAEDRQWGGIRIPQCLAV
                     PCMAAAMTSKERKATAAHVGEKADGVRAANAFEANVRRRFPDNAAVVTKQLAFQEALL
                     AVQEVLTAQKIRFFLACGTALGARRDGCFIPYDEDIDLGILYADIAVPVTEGDDWPVP
                     DLSFPSTAPAGLSYVQMRVYRLLHALASTRAFVVFDICGAVEKGLELRALHLATSARI
                     DINLYYPPLCTTACGGDGDASDDALVRETGPFVWAASFYEAAGARKHRMYRYRHKPFA
                     TELEELPFCAKTASVGRGFLVPPERYLVENYGEDWRTPKQYSYTEGLAGEFKNILKE"
     gene            <528817..>530895
                     /locus_tag="LMJF_32_1360"
                     /db_xref="GeneID:5656249"
     mRNA            <528817..>530895
                     /locus_tag="LMJF_32_1360"
                     /product="putative RNA guanylyltransferase"
                     /transcript_id="XM_001685400.1"
                     /db_xref="GeneID:5656249"
     CDS             528817..530895
                     /locus_tag="LMJF_32_1360"
                     /codon_start=1
                     /product="putative RNA guanylyltransferase"
                     /protein_id="XP_001685452.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656249"
                     /db_xref="GOA:Q4Q5E6"
                     /db_xref="InterPro:IPR001339"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5E6"
                     /translation="MARAIRVGAAGGSAAYSAAVTATTASPYPGPTRGMLPPNHIGAV
                     SHLPRAPPTAAANQGATPIPSAGSSSGSPAPLTAPQPHVSPAPQPASTAKPLSGPAPS
                     TLTTTTPAPRPAPATSVAALSGWRPPQFGRKAAPTNSNPLIVMIFGCRGSGKTTQAEN
                     IAERYHLLHLSSGDMYKEGKQPFAEVEQAVKDNFGPDAKDRSYNGLVLDRFVATGEMD
                     AYYLQAALNVCQLPVPLVFWLQVDPKEGLRRAQSRGDQKAGADHWRYVEQRAQAEIAD
                     RVYKKIGVLHVIDCNALEARRVGDRIYSIIDGLFPKRSRNIRLPPATPVAGYDKFHLL
                     DDHSDFQQLTKEVHTAIGNTSGRTDSAPLSSIGGYVDAGSFANRQECKRMSSMYVTLK
                     VDGQRYLVVKHSHFGVLGFPFAFTACYDFNVLFDPLMFSNAFEMVGDRQEEANGIEWM
                     LDAEMSTTAGESNQPQPLLHIIDYVYFGGKQAKRTPFFERYELLREWFRLMVQNSGEA
                     GAYAAVVLKHYVPINELPKLLPCFEDPPFAVDGIVFQGNTIYKFGLDKFLLKWKPLQL
                     CTADFRLMNGEKTEDGVTVFDLFTTENEQEVPFPGAVGVFTEMQMRAYQLRNSVVVEL
                     ELADVVERAGPNGQPATQWVFHRLRVDKPRPNKTSVVESIVKLKHLTYQELLDHCRVL
                     RFSGPNASSP"
     gene            <534245..>536617
                     /locus_tag="LMJF_32_1370"
                     /db_xref="GeneID:5656250"
     mRNA            <534245..>536617
                     /locus_tag="LMJF_32_1370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685401.1"
                     /db_xref="GeneID:5656250"
     CDS             534245..536617
                     /locus_tag="LMJF_32_1370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685453.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656250"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5E5"
                     /translation="MSNLNPNAPSFPVSNYQPNTTHNKQGYNNGGGPSGGGGTMQNER
                     YGGGMIYDNSNYHQGGGGGYGPGGGNPGGGYGQGGGYMSNGPQQGYPSGPRMGRNHRQ
                     PNMPHSQYQNLNGMVGGSGGGGGGGGSMLGNYCGMPAPYQQVGGMDMNGGYDQQPQQP
                     PQQQMPMQPRMHNMPPNAMSMSNNMMGGGGRMPYNSNQRNPMPNMHPNMNPQATMGLG
                     SVSAQPPPTMAAPAPVPRPLSVPPAAAAPSYITKNTPRAVMVVGYKKTGKTSVAQAIA
                     KREGFEYVCLKSSLQQSAAQAPGGEEAEEAEEEDISPLERLAPLRAALEKKSAMKGMV
                     IDDAFSTNKFQAHYVVHYLVKAGLQLDAVVALVPELASLVERGVSFAKSNAKTMHPEA
                     FEFASSLDPDRVIVVDEDLKLEVLAEKAAAEVSALLKNNDAAIKLEQEYFIPSCPMVT
                     DAELVEQILEAERSVVKRPLPYTFTYSEPNYVLDYVQFVQSAAKLQHYLVTPWIWGDK
                     LSLIGYETSVYVHLTSYNLLFKLNDVPAVMQELLKKLKSEAEASGAEDPASQVLFCVE
                     ASMLDDVIYISDMMIIGKQHGSEMLLHDRVKLLSDSFGKLPSNSSVRLLEHYPVCDIK
                     TCLEAYKDVSRGAIFVNPDGIEYGRYDVRNFVYPSEIKKTVRLRIWAGSMTDGMWSFD
                     GYVREYEDEVLATSRTTGASNLPVMISDANVDTHMINDGNIVECVMEKTATKGKSREK
                     SAVLTFCRRCKWEMTPITQFYMWAFADPPQWSTESFLDACSTIASVRPTV"
     gene            complement(<540808..>541866)
                     /locus_tag="LMJF_32_1380"
                     /db_xref="GeneID:5656251"
     mRNA            complement(<540808..>541866)
                     /locus_tag="LMJF_32_1380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685402.1"
                     /db_xref="GeneID:5656251"
     CDS             complement(540808..541866)
                     /locus_tag="LMJF_32_1380"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685454.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656251"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5E4"
                     /translation="MDTSARRCFVEVYTDGCDEPRLLQLEPTVKFHNVLRRFDKDGDL
                     YWGDHRIDPQTTPVAVGMDCGVDKANTLWFIPALPRAKPCGVSRVDSTAPLGSPPPVD
                     ATEGPALRPARGTSLPAYFDDRAAPWHSSGDHAARGSLIRAWMASASAATTPSWYSRP
                     RLLSPVPLSLPRSAVRVPHTQVQPPSGMPTDPIMHAAGGSRHTGAPVAALEAHGGEKI
                     APVRRLCAAPAPRAPSPPHSTVPVRRNAPVCIDPHVLVDDTSDAVEALQTELRHLSSE
                     MRAMRLRNPLDYNSVTPMRQVVVRPAGMDAAPAIASPICLSMAEPSVEELATELHDKQ
                     MHRLYKQRHLYLTHDFHV"
     gene            complement(<543617..>545875)
                     /locus_tag="LMJF_32_1390"
                     /db_xref="GeneID:5656252"
     mRNA            complement(<543617..>545875)
                     /locus_tag="LMJF_32_1390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685403.1"
                     /db_xref="GeneID:5656252"
     CDS             complement(543617..545875)
                     /locus_tag="LMJF_32_1390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685455.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656252"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5E3"
                     /translation="MIIGAPAKRWATESVPELLASPQTDLAAVLLSDAVADYLHSIDS
                     VGAARVNRRGGDGSEKDEDGSSDGIPSAVHVVLQYIVRHADTLFSLLHGKVQIENGPA
                     GSKHQPQGSFPTVCTTPGEAKASTGVVEIQHPCKGNHANGAPTSAAAVIGDADEEQER
                     RCLANLTELLSFCITHSQERSEINAVVAACIEALSVAKTLESQRTFAVQRLLLEAFDN
                     DFEATTQAIADTLTHSTIKGVVENLASNSIVAETLIALFGSALSAVWMVKSTTKTALF
                     TSQWIRLDFPTTLCAYLPIAIRDPGMYHYFYFFKELLKRGYSHSAGPIVDVLLSEPLV
                     SDYVEHILSCCEQDVGRSALLTPEGAAATPVSLAADGMELLVSIIGLVRKSLVLPETS
                     YMYETAIRYITPVAVLQAQAPRMTALLAPTAQEEAELDVHAPSADASPRFLSAVAPAG
                     MYGLGPLRLAVCELFVEFSLFQLASTDNTLITSGFFPALIGCCELFPQHDALARALHR
                     CMLSIFQRATLVGESLSAAAERDCLWRYLVKADTVVLRCGAVESVLGALTRFAQNPNT
                     SLSSLCIDLLTNLSSLPLFQSAAGGPFEKHLDAFKACEAIQERVRHMDAPITGERFKE
                     RGSTGLPQLVHRDTINLAGDRFHGPKAGGLSRGSRLSGFSSKLAKGSYIVLRRSADDD
                     RPQRPAPNVVVDIEALKEEVHTLQQGGSPALQSYPNFSDVNFNFFSSSAEGDTDEDQN
                     DAATPSSEEHRN"
     gene            complement(<547432..>552507)
                     /locus_tag="LMJF_32_1400"
                     /db_xref="GeneID:5656253"
     mRNA            complement(<547432..>552507)
                     /locus_tag="LMJF_32_1400"
                     /product="putative DEAD/DEAH box helicase-like protein"
                     /transcript_id="XM_001685404.1"
                     /db_xref="GeneID:5656253"
     CDS             complement(547432..552507)
                     /locus_tag="LMJF_32_1400"
                     /codon_start=1
                     /product="putative DEAD/DEAH box helicase-like protein"
                     /protein_id="XP_001685456.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656253"
                     /db_xref="GOA:Q4Q5E2"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR004179"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5E2"
                     /translation="MSTPAATCLGELLHFLPHRCFTKVQEAVIPALFTNDRNCLVAAP
                     TGSGKTVLLEVAMLRLFRNVLAPRDDAGAIATEDGEARGSSGPLQQGKRKAVYICPIK
                     ALANEKYEHWRAQFPTLTVVIETGDQQQQQVDQQERSCATASATGDVRGRDGVESMVD
                     VSQADILVTTPERWDSITRRWKEKEVMAIVNSVGLLLLDEVHTVQEERGAAMEAIVSR
                     VKVIQASSRAMHQHSATETAPTRIIAISGTLPNSRDLAEWLEVSPEMTFAFAPSDRPV
                     PLTIRVIGYAHDSPNPFAFHRFLSFKIFGFMQQYSQGRPTLVFCASRKDTTISAQRIV
                     EDIRDAAARRGQLAQLEPSAEAQQLMQQASDKQLRSCLMIGVGFHHAAMTKEDRQLVE
                     RMFREQYIAVVCATTTLALGVNLPAHLVLIKGTTFFSSGRSHDMPVSEVMQMCGRAGR
                     PGFDTHGMALVLTMQRSVHLYETLTSGAVTLTCVESHLHCHMIEHVNAEVALRTIHSF
                     PSAMEWLKTTFFWIRLRKCPPHYGLQFANRAEELEFNAEAFVEALMERALRVLMEEGC
                     VRLSHLDTLALSAARGPAAPVATGDMEDIKHPSAVFETTRLGRAMSRMYILFDTVCTL
                     NARLKDRGAASANSDAPDDGSGADACASAMDVGVKATTRTGCMSVVEVPECSYARIDT
                     SLAGTQPHRTAADATACSSRRRMMPFNLREVLQLLCHCQELVEVRLRQGDRGPLNELN
                     KTVKYPLHSGRRGGREVREDWQKAYVLIQVHIGLLPLTEVSLRNDSLRLWTVVPRMSR
                     FLEEYAWAATTSYSLATHANLLARCIDRRVWPDGLVLRQLKHVSDSVAKALLRGGYST
                     FESLGGVDARQLEVLCSRLPPFGSQILSEVRRLPRISLDISFTASPAESDGRDNQHCV
                     PSGVVQLTLSQGTEAVSDEGVPSAAWRQRSETASSKAAGGQPQLLSDMVALDSTRVLL
                     LVGMPSEDRVLLKRFVPLSAFGSPSAPRSTAGTASRSTADGLCARTLCFPFVSPPLSR
                     DTSGGGGGRGRRIEARCLVLRVVGMDTVTARDEEFSTARGDAASDSIHRSAQKSVADA
                     CVRFPTPKDVALLPQMKAPQTALSVQVASEARAAFSELLEDIQYVASAGDPTQSHRTA
                     PRQPSISRKRTRIDQGACRAAEDGQGTQKNETRPKNDNTAAMSPLSATANVISLLPVP
                     GAPDLRDADGSGSAGAATSEVSQERAAAGGSSLDSAGSSPEHRADKEARLEEPLRDQN
                     TLQHLSEFPSKLVHESPSLRQARLCPSPETGAADALAASTPSAAHKRMARVRLRPCTS
                     PPASRPPDVADASPRACLPALQRERPFSTPQAASSRPVHPHDYGDTPPDATASVDQRR
                     TYPLRRMTPWGGQWHPSMVAPTLPPSSRFVVRVPPPHASSLHLGRDRMHGSARQRSDF
                     VEPQEAFYYPLDPQQAPPDMRYVVSGVQGEWWRPSYMQDPGWMHGTVVSPHPYPYRTP
                     SMVTRSANYGPMLARPSSVGYLPTHWEHVAAVPPSRFAGQRPPSFFASRPPLEFAEEH
                     QQIWQTGSRLSSYPPSPVPSVSLPHQASSPTPYTVLQTQPWPRPPPPPVYDPRDWRPS
                     ASMQREPVPPPLWGPVTREHQKQRFAVTEGDPSARTAPSDMSVSRADASVATPASMPT
                     SDGGNFPSRVRRRSPMVTQSWWQ"
     gene            complement(<553238..>554470)
                     /locus_tag="LMJF_32_1410"
                     /db_xref="GeneID:5656254"
     mRNA            complement(<553238..>554470)
                     /locus_tag="LMJF_32_1410"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685405.1"
                     /db_xref="GeneID:5656254"
     CDS             complement(553238..554470)
                     /locus_tag="LMJF_32_1410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685457.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656254"
                     /db_xref="GOA:Q4Q5E1"
                     /db_xref="InterPro:IPR007325"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5E1"
                     /translation="MTAEFTELDEANRKVREWKREAKQSAPVSLAGGIDLTMCLDEMR
                     IVVPPLSPFQVLRTSDILTQLVHIPSITTTAAASAAFGALVTLLLATKSSFTPVAQQG
                     FLRRWTHRLLRIMVTAVASVVFARFLRQRYPTVQRVSQYENLSTSPDAPCFVANRILT
                     MTSSQAGTHADGPHHFCRSLSHRNYDDAHYSGDAVVLDIATELREHHQSLDPDASLAI
                     TVEVLEKARVKLPAAFRDGSRPVWRLLLVTRHSTATSPTSASATEALTGPPRVFFPLD
                     VASPTQVATVGVKGGTAATLAEPSSNAYAFLYPEAVDYLHRVFPRLVLLGIDSPSVDL
                     PQAMPPGQHSHGALLRCGIAILENLRYTRLSPLLESPAGNNQRGWISGSMLTVFNATQ
                     NYDDARGCSVIFFPEEAL"
     gene            complement(<555199..>557271)
                     /locus_tag="LMJF_32_1420"
                     /db_xref="GeneID:5656255"
     mRNA            complement(<555199..>557271)
                     /locus_tag="LMJF_32_1420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685406.1"
                     /db_xref="GeneID:5656255"
     CDS             complement(555199..557271)
                     /locus_tag="LMJF_32_1420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685458.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656255"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5E0"
                     /translation="MPFFGVDDILFLLASTTALLWAKRADVVESSVYTTVSILTDDPH
                     EAARRAAAAGAAQGSTPTLLLKGFDLQAEEANLLYFQKSAKQVETRHRPELSALISAP
                     DTADRSDASASAPLFVKESVHTQFHQIPVVYQVPQVPHRHYNLHKRRPHVSSLATASE
                     EDVKERIASYSVAEVQALFGKMEREGLWEAVIHVSYGIDQANQRLRYLNQHNVECAIR
                     TLLNTSHADVALIYYFRFGEDMLVSDEILVALFHTCRNDEQLSLELCHVLQPFKSQWT
                     PTVYACCLTTAARFDYQEAIRLYHAYIETQRSQQVASQGMLRRVLAASALLCETGVVA
                     APAPLPLDYLYHVMIPLVIAHDPASADTYVADMLVKDAESAPDVLLKCLGFTKGQELA
                     WRYLEDAASGAIDSTATDAVKRWVLAQKRAQRTGSAPLDVAGMAIHLYRLRPSAMNMN
                     TLLKLCTECVDVREGEAVKMASTSVTQHEWSTTGSPKNAASLSATLKRLASGRVAVLT
                     HLLLRMPLRSELDATVLARTITEQHASWGLATQFLSVMLRRKCFNVVPSIAAHVALQG
                     QWATAAKSMAIYFSNQRAAMTAKEAKLCIDSCVHAGQWASALFWVERAHAKGLALGSS
                     TYDLVLGVSRHCSFDAAERVVTTMHDVGASCSEQAILDFIETAAHRGKVANALSVLRH
                     HRNIEWTP"
     gene            complement(<559150..>562551)
                     /locus_tag="LMJF_32_1430"
                     /db_xref="GeneID:5656256"
     mRNA            complement(<559150..>562551)
                     /locus_tag="LMJF_32_1430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685407.1"
                     /db_xref="GeneID:5656256"
     CDS             complement(559150..562551)
                     /locus_tag="LMJF_32_1430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685459.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656256"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5D9"
                     /translation="MKIMGQPPPGAKIIVGPPPPGAKAMLGAPPPGFKIMHSSPPPGT
                     MHVASPPLSSTPPSLSHDNTPPLPPGMAAKTPMKMLPPGAKLISGQPPLGSRPVSPEE
                     ARHSATSPSLIPSRSVSPTNATVFRILPNGVKVLVSPPTVGGPVHPVSKALPGHLSPP
                     LPAKSPPNTLIKSMRDSNLGGAPTAPASRTTAPLIPPQNVNVSVGPKLFPGPQQQLPK
                     PTPVRPGGSIVKAVEAPHRTPPGRKQQTSAAKEHQSDVQVKMHKSESDEFTFQEEDNL
                     DNSTDIQFEEAPSVMPSDSPRAGAAVAELRRISSSGSSSSSLSLRKDPDEATALPTVM
                     KPHSSTAPTVIASPSSPLSAVGTVAPVEYEKSLHRHRSQDGASKGARKKKRKGRHASP
                     RDDRLDDGKSSRKQRRNHHYHRSHSSDVGNISRSSASLQSYSAPGAPVSASPAAVDDK
                     QRRTPPQRAAASGKDDVVDTPGELGGEQLRELAFTPEALTSASRDRIAEDFLSILCPQ
                     QYYGKVQKISRIRAFKADRSAATGLRSSTSIYVATKGVMPNPYFYPQLRLRNSDGEKL
                     GSLARADEVAEGVVNTPIILYEATPGNMLFAGTELEARRLLESNRNFNSCFMLSNSAI
                     LFRAPEQYVVPIASLNVQWVPYTSPQSEPQCPVHRRELQLFDPCSKELVCALCASRNC
                     IPMSNFVVIPDVLGNLDSRRTVEEKVSVQLDEAQQSAKRWVEQHQRVRELCESKKDAI
                     RNQFNLLINALEAKKKEYIEACEAEFAYAQTDVAREILITDEKVQLLRAATDHLRTDP
                     SKPLFSMQIATIAEGLSASTDLPSRFTRASLRLPPMSAGLMPNLEGVMSQVLELSPQL
                     SPSGARGGEYCTEDLSLSNAPYKRPNWKLSNDGRSVEEAVNIVHRDRWRLSGTRAAAA
                     AASPAKSPRPASRNADASPLLNNGRSACSSSPARPALSGPVATREYVRSMSGSSQKRS
                     LAGSASSVQFAADAVSVPNSTGTSLFDFALHHLLSTLSASNVKRWSPRYVQWAIRIDD
                     PGDWVGLGVGVGNTIEAWEQGSTNDLSHLWIVPASMTGQVLYLRVAVSSSSGHAKLTV
                     HDVRGKQVDGGEVPQWNAARPSYPQATFGGGIGSVRMIEIPHVVH"
     gene            complement(<564364..>564807)
                     /locus_tag="LMJF_32_1440"
                     /db_xref="GeneID:5656257"
     mRNA            complement(<564364..>564807)
                     /locus_tag="LMJF_32_1440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685408.1"
                     /db_xref="GeneID:5656257"
     CDS             complement(564364..564807)
                     /locus_tag="LMJF_32_1440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685460.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656257"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5D8"
                     /translation="MNDIYARRLAQTSMFHQLMRSHGTLWAATQVTKEKLNLAFVKEE
                     MMRVNGRRAMPLLIGAAANENLNDTHFTHLTEHCAWTESARAFAVQRQTPLTQHIASM
                     GRMAETITQAKTASTSQLLFNEHLARIDGISEFEEEPFVDDEDDS"
     gene            complement(<565674..>566159)
                     /locus_tag="LMJF_32_1450"
                     /db_xref="GeneID:5656258"
     mRNA            complement(<565674..>566159)
                     /locus_tag="LMJF_32_1450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685409.1"
                     /db_xref="GeneID:5656258"
     CDS             complement(565674..566159)
                     /locus_tag="LMJF_32_1450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685461.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656258"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5D7"
                     /translation="MKWLGRLMRRKKRTPLPPKPYVDTASTGRHMLDARLYGSADLAQ
                     IDPEKPHWQDMRFESRERVPFFDVFGYNRDWSWSLFKVSSLFFAVILYWEMRSLAYMK
                     NDPMKITSTTTVSPVPDYARDEKATEEELREAGFAYVGLEKLDNLGISAASSREAGHK
                     A"
     gene            complement(<567006..>576629)
                     /locus_tag="LMJF_32_1460"
                     /db_xref="GeneID:5656259"
     mRNA            complement(<567006..>576629)
                     /locus_tag="LMJF_32_1460"
                     /product="putative phosphatidylinositol 3-related kinase"
                     /transcript_id="XM_001685410.1"
                     /db_xref="GeneID:5656259"
     CDS             complement(567006..576629)
                     /locus_tag="LMJF_32_1460"
                     /EC_number="2.7.1.137"
                     /codon_start=1
                     /product="putative phosphatidylinositol 3-related kinase"
                     /protein_id="XP_001685462.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656259"
                     /db_xref="GOA:Q4Q5D6"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR003151"
                     /db_xref="InterPro:IPR003152"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR014009"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5D6"
                     /translation="MEAVTDDEGLVPAAVRQRTEKGVLSSCNTSRHDSAGIRDELAGI
                     GEQIKALQLQLSSNLAPETKVSEVVTQTLWDLLWRLRTFLFLASPSAAHQWKIGGALF
                     DVYYRRHYGRDAAHVAIALRLYLVLLRFTVVCPAAALHGCLTLFGVLAVLNDPRLRSW
                     KDTSERLLDGFLFVSRAQHRSENDVFAQLMNIVFELLSEVTAHFNGSAAETESALFLQ
                     LSVEPSAALLSQTEASLPSFASPNSASDAEGRARRLQEMFSTCTCVETLYEARCIQAC
                     LLRLVVRLSEERLLLSLSPDRVGLLCDVACHIVSSAIPGAEGGVVNRVQHDAAWHTLR
                     YFAVVDRRLLPHLQGPLILSVLAAQWSRRGAQTCSSIFNITVAEKALFDWCRHLSTAE
                     LDSLVVAAYHRGGAGPGGQDVMTECLVQMWEVGVQWCAELYTSPSTAVDGIVANTASS
                     TPSSLSAMFTLQQWVCLCERVFRSTVVQRSAFAGLTQMGEPKLLAAYDHQLQLLVSEL
                     PLSSLTASLLCTQLPSFAVESELAFLPSRILSFFNGQALTACIAEVVDRAKNCIDVSA
                     YRLLEANALAVQSRLKVSSWMVQCDAAAFQSALAETLQVMQHHEAPSHSLLVQAIIVL
                     VHAFPVDSENGEVRKSDTVARVIEALDNSISSRHDGSYAALEVAAPLWHMLDRETATT
                     LFRAGSGLGWTRRLLALPPHTATSAKTAELFLCRAAGLAEALQHALAETMVREGASTS
                     RSTSHAPAPKVLPGAAAARGQMPARLQRAYESIASHFPVVVQLLQTLSTLITTLQRDV
                     QWWRCMRNGKGGTYADANGAIVALGTLFSHATGILVLLLDAKYRFAAIAGSEAGKGRN
                     SALAGAAPICEQGSTTKQPLAQAATVVDVDDDDNADGVSEEKEEAKQPYRHRKTTARG
                     ATLSSKAGKASAKAGVGGALQASNVSQQSIAKTKQLEKIVQLNRSKLLPALLAFTRHL
                     VYEARGRGASPDADEVQNEDGRSSQRAAGGMQSHASALECVVLSLAYTSLALSPPFSL
                     TDENALFSLASVGAYNVTDSILYCALRELVLWSPELAWREREAGNSAIPTLLLVQLSG
                     TERLLSTVLTARRDGNTTYIAECGAQILQLLWYGRRFFQRSGDARATAVDKPEREQRL
                     SLTDASAAVQEDCMAASERVTQEGHAWLCLCFDLYAVYHSVRPAHNDTALAVMGLCLE
                     TARGVMALFSWSATDLLRFRERPFVFSSFFKAIVDKEDRDMKVILTSSLDVLGRYVIS
                     AGVGQAGGGTVAATATMSTVVPGDSVTRAKLKHLMDQEKIADWRAAAGALAYALYECG
                     SKPVAKQMLSLAEAASYAKRSIKDVPAMVRSTIHFVAFHIVSLEADAQMLAHDRRCHS
                     GRDRRRFLGGAVALHAPLAVVGGSAHSLFLCDRSEGGDGAEAADVEDASASPPQRTTT
                     GELHPAEGDGDDASASKEVLDGIAFSVFERALVQLVTLGEAAETAAGVENSLRKPVVR
                     AVAAEELRKNMFAVLDAVYKAIRIEPAVAYRSEGAGAADEEEASAAPPGSLRTRRRWL
                     LGLASFIRFMGPQTTPIALMLPTLLGHCARFPSLLPSVCIVWRELICACTDEYLAESA
                     AAIVLSLVSLEQHAALESESKGLLLCTLRHLYTRTEAAEFWDSYQVVLGTFSELVRAT
                     LHSRHSGCGEAAERSEESRRDSAHVLLLGFASVMRSGSLQSSTVFVRALYQYLCAADE
                     ATRRQLSHAAADHPEVLQTLLRCTEADSDSALYAMRCISILGAVAAPNAAVSTGAPRA
                     TKTADDERRSSLTPSSASALDGWNRMTWTQSFYLDAETVLNWRKFSFTLLRDYFPRVF
                     ASTADPVLHNCIAFAVQELIRASTRQERLQHKGVELRREDVVHLDELDRYIWWMRLTP
                     HVKQLLGGFTTTRYSLTVNWQTRLRTPEYMPSLGHRRWLFAFFNHLVMSCKGWFAEMV
                     QPLRNVAKKNASLVLYLLPYLVVHILESGKVEDVQYIEHEVKAVLEAAAGGPNVAVLS
                     LRSQSIYEASPETVSQEEPREHAHTVLSLLEDVEQLRWTLLRNRGRVACVFEPQEQTE
                     SLCIRLAEMYGDFLRGISWPLRCRAALRIGSHIRALRSVESQRRIPGLASVIAAVPLQ
                     RIFAALNDRESSRSIHRASPGLSLEDTAFSFENNGDWLSALGSSELVLQHRPHSGQHQ
                     LTALHCMNELGELYMTSRYAASLLASASVSDGDVRGFEATEYLSGAALKGRSTFSQMV
                     SEAPGEAAAVSDFAQLRHHVQAYANEAAWRLGQWDMLLPSGAATAPVSSRMPTVGSDG
                     GRSVSLAMPAAYLQRALSGNGSLAFVRCVTDNERAKVVPVVRTPCQEDLTAQGYTVTL
                     LLHALGDVDAVSELCARAFITNGSGHRCGGDGSDASQSSAPTMKLAAPLLPSSVKEEI
                     ASLLSQRESYVEDTIAAREPLLALHRLIYRELDMPQKVAETWLKQSELLRNGGLGEAA
                     LTAARQAAFECREHVTATSYYVLVANLLHDTQSPTPAMEFARECVADVRIPATTRAQL
                     QILLTNWLIETGSERPEHIFAEYEKARELDRKSELVHHQMALFYDHLHTLASNASEGA
                     AAQLTAAATSPTSSSTANVSAAVMYNAALQHQKEMVDSIQRCATRAIVHFGEALLRGV
                     EKASVSLPRMLTLWLDSAVFLGGLLGTTVGKLDGTTSAVLGEMNNRIREFVLSTVQPV
                     IPPAVVMTALPQLLSRLGHPVTAVRNVLTDIVLHLMDHFPQQCLWLVLPMALSKEGPK
                     EVVETQIIKPFADNPRNERVLRHAKILCDTLLTICNCSASLFPKEKGLTQLSPVQKIT
                     PMLAAAKFIVPVLSNLTPDIRASSSEDVFPTAPCFDHFDDRVVVMRSLQKPKRIWVHT
                     NDGREMSFLCKAKDEPRKDIRMMEVAALMNSFFLSDPEAKRKRFSLRRYSITALSDDC
                     AVIEWLNDTTPLAKVAMECYALDRSGVHISSVKKWMTLVDEKKMSKMELFTKYILPEA
                     PPVMHQWLDRTFASNQSWYEARTLFTQSTALWSIAGHIVGLGDRHAENLMIDMERGEL
                     MHVDFACMFDKGEKLEVPEQVRFRLTQNLTDVMGVLGAHGPFQATCEVALRCEMKNKS
                     AVMSIIETLLHEPLIEWRRQSSRSHSSNGPKQLMERVARRLDGFLDLYSVPAKRDTLS
                     LNVESQVAKLIHHSSDLNNLSQMYIWWMAWI"
     gene            complement(<578615..>579454)
                     /locus_tag="LMJF_32_1470"
                     /db_xref="GeneID:5656260"
     mRNA            complement(<578615..>579454)
                     /locus_tag="LMJF_32_1470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685411.1"
                     /db_xref="GeneID:5656260"
     CDS             complement(578615..579454)
                     /locus_tag="LMJF_32_1470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685463.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656260"
                     /db_xref="GOA:Q4Q5D5"
                     /db_xref="InterPro:IPR018799"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5D5"
                     /translation="MSGEVDFWSATIAAYQPLQLTSPELTPKLLKRPPFRFIHDIVCS
                     IDARFAAYDHIIPAELRDSAQVDTKEKKIEYLTTLIQYINRIMKVEIDVNPKKIVSGN
                     EPEKTNIFLQYLAAGVGYAQQDKAAQATPAPQQKSAASLASPASPAAASFSTNPAQDN
                     LSLSLASGLCRKKSSSRDPAERRRSHVSVFDEAAKFNRKLSGYSLNLNLDEQRDVRSE
                     GQSIVRMWNELANPQTETKPSHMPQEALETAIKRQIETVKMVQELLSENDRVIDKLEA
                     LVI"
     gene            complement(<580638..>582056)
                     /locus_tag="LMJF_32_1480"
                     /db_xref="GeneID:5656261"
     mRNA            complement(<580638..>582056)
                     /locus_tag="LMJF_32_1480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685412.1"
                     /db_xref="GeneID:5656261"
     CDS             complement(580638..582056)
                     /locus_tag="LMJF_32_1480"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685464.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656261"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5D4"
                     /translation="MTAQTEAPKTIKTAARPQDGPMVPDYGPLRATGLWSVEEVLDES
                     KKTVDFRRIDDVESEIIEDHTNAEEALVPYAEEEAWKHKLMFEYKFKKTPKHLTWKEM
                     GEEIECMDCVIELDEHRPEELFTIFFYFTDKKTGTRDLVWSARNDVSYSEGFTDLLAA
                     IGACLGRSDVHRTIRFDDGVGCTRDLTFRKRSRYTSDVYVAFRPPEKYDKFQRKEEKD
                     EYEASMEREGMSTWGYHPSLMDPEFSELDFKDPEGTYEVAISAHGFSFVVLRAIGRLL
                     ARPMKDFYRPSQLMRTAKVRTEDEIGFTHALKGWLGVDEQLYPHYTPIEALQDHWLGK
                     DAPFSLCAIVNKLREMNYLKKENPEFQSWLSVRSHDTHLAIRNMGVKLLGVGASTLFV
                     PVSHNATVNRLLPKPQQRRLESRFSLNAVLGLPDETRKLKDFKQITGHDRITDVPTSS
                     TRETATIASPAQDEASVKNSPT"
     gene            complement(<586417..>586989)
                     /locus_tag="LMJF_32_1490"
                     /db_xref="GeneID:5656262"
     mRNA            complement(<586417..>586989)
                     /locus_tag="LMJF_32_1490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685413.1"
                     /db_xref="GeneID:5656262"
     CDS             complement(586417..586989)
                     /locus_tag="LMJF_32_1490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685465.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656262"
                     /db_xref="GOA:Q4Q5D3"
                     /db_xref="InterPro:IPR009149"
                     /db_xref="InterPro:IPR013730"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5D3"
                     /translation="MSEGGRRRKVYGFKAERQAFFSKHVRQTFLEEGRKKKDEERARM
                     EAYRKLCEEEGIVSKRLEDYDRTRKAAKEHLSSTLEQIDYDQSLTNNEKKKRKYNLKR
                     KFAATTVNDLIDKQQKHYSAVSGMEEVQRRQQQEREEKQKARQEREREKQSRVQARKS
                     RNALFAKRTKKGQPAMSSRVESLLQKISWQ"
     gene            complement(<587832..>588959)
                     /locus_tag="LMJF_32_1495"
                     /db_xref="GeneID:5656263"
     mRNA            complement(<587832..>588959)
                     /locus_tag="LMJF_32_1495"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685414.1"
                     /db_xref="GeneID:5656263"
     CDS             complement(587832..588959)
                     /locus_tag="LMJF_32_1495"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685466.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1495"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1495"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656263"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5D2"
                     /translation="MDISAPRFSDDLVTLPATELRESLENILTAIGASAYSCSEESRA
                     LEMQRQRVLALLSKLDIGNAPCDLPRTTAPGRGTLLSPVTSEAPDKHTGPLHMSSSSG
                     EVADIRSNAAGDDMLATFAEAGDARTAFVPHPDHRCLLANLFSKPRRHDVTAPLNSAL
                     PCILSPPSRPTLGKGGLDGQDENDSVPYATAALPQEMGQLCCSPAVLLSLSQDGRELV
                     CEGHDLPSSVPQRCRVEEDTPQSQQSQCCALSAQVNAHRRLRWYSDATDPRSFWINVW
                     PCYGGSAASRCRHPTRVLVRGRYRYFEDVLEAAANLTDCKPASQAFYTPDGCPIRHIE
                     DLIAEHHYLLFPFCGFYRKQSVPTALLWLLYTDARHLVHCS"
     gene            complement(<590607..>592763)
                     /locus_tag="LMJF_32_1500"
                     /db_xref="GeneID:5656264"
     mRNA            complement(<590607..>592763)
                     /locus_tag="LMJF_32_1500"
                     /product="putative ATP-dependent zinc metallopeptidase"
                     /transcript_id="XM_001685415.1"
                     /db_xref="GeneID:5656264"
     CDS             complement(590607..592763)
                     /locus_tag="LMJF_32_1500"
                     /EC_number="3.4.24.-"
                     /codon_start=1
                     /product="putative ATP-dependent zinc metallopeptidase"
                     /protein_id="XP_001685467.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656264"
                     /db_xref="GOA:Q4Q5D1"
                     /db_xref="InterPro:IPR000642"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5D1"
                     /translation="MNQNDPSPGGSLFQQMYSAQQQQQQMPPPQAYGGQLSLQPPPTP
                     QPQKSSQGDGYAQNPYTVPREGIGAPPSIYTGYNYQPQQMIPQQYSYAAQQQQQPARM
                     PPVYQPPVQDDDYYKGFHDGVVRPSGPVWGSAVSWVVPLVVNVAFFVGPIWYFRRKYM
                     HAMASATGSAAASGGKGGAGGSSNMMSGLMEMMNPMKPKNFRTEVKGTTFKDVIGIPE
                     AKEELKQYVDFLKEPSKFTRLGARLPKGCLLTGQPGTGKTLLARAVAGEASTPFFSCS
                     GADFIEIFGGSGPKRVRELFEEAKKAAPCVVFIDEIDAIGSRNQGGRSMGGGGSSEEN
                     RTINQLLAELDGLTSKEAIVVIAATNYPEAIDKALLREGRFDRKVTIPMPDHKARCEL
                     FEFYLNRIITGDPNCKPKVQVFKTRNEAEAGGSGAAQASPSSTLASSEKAATETKALV
                     TEDAKPESIKVIPGVSNKEYAVVLSDRTPGVSPAQISTIVNEGALNAAANGKEVVPLE
                     VLQDSIDDVLIGKKHRQRMSNASLHRTAYHEVGHCIMAWTNPLQKDVIKLSIIPRGRA
                     GGYTQQVQDEAMEPQTDEFLFSQLCVLMGGRAAERIFEKDISIGAMDDLQRATRLAME
                     KLLKYGMSKTIGQLAFKPNDKNDGRAWMTWSENLHAKVEAEARALVESAYVHTEKTLL
                     AHKDKHQKLAELLLGKKELDKADIAGILGARPVLKA"
     gene            complement(595571..596644)
                     /locus_tag="LMJF_32_ncRNA1"
                     /db_xref="GeneID:12982165"
     ncRNA           complement(595571..596644)
                     /ncRNA_class="other"
                     /locus_tag="LMJF_32_ncRNA1"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460992.1"
                     /db_xref="GeneID:12982165"
     gene            complement(<597465..>600122)
                     /locus_tag="LMJF_32_1510"
                     /db_xref="GeneID:5656265"
     mRNA            complement(<597465..>600122)
                     /locus_tag="LMJF_32_1510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685416.1"
                     /db_xref="GeneID:5656265"
     CDS             complement(597465..600122)
                     /locus_tag="LMJF_32_1510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685468.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656265"
                     /db_xref="GOA:Q4Q5D0"
                     /db_xref="InterPro:IPR011335"
                     /db_xref="InterPro:IPR011604"
                     /db_xref="InterPro:IPR019080"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5D0"
                     /translation="MAQHPDKLKWKDAHPHGLSASQFGMALGFCGRVSDYVHYLRDIV
                     GTEHEFKGNAFTAHGTRTEPKARALYELLTGCRVHDGGFFVTNDHILGCSPDGQIYHH
                     VDEPPIEQQGGLSVSGLASPFQSCSGGCGASNGAGMIEPQRRSSRCSVHVPFKSKRRP
                     RSPLSAISGRSSHSFRTLACDDDESTSCTSGSTRCCTDGRSGIALAESHASIDGTHST
                     PLRSPSHHKVRLLEIKSPFRALYASTKPGYQPFGIPMHYMCQIQGQLAIADCEECDFF
                     VYLDHPVCQVEGWRVRRSRAFWAWAEPNLRCVSIWVKDGPPDWLNRSFAFTDFDFRTI
                     DVVPLVFPFDITAHAALTDPRSFAFFAQFANPFESLDRHREASGNDGAQLQAQDLCFA
                     YAGSTWADITEYERVAVAAQAPAVRRLFAPAQADADDTEALETKVELWSRLSSWRRAL
                     EVEGVFEESATAVFWKEWTRTATAGRDPIVKVTLSIPYDWDTGRVGARCSLPSLPRTQ
                     GDALDSRYDTALIHFHQRLFFASLLSDDVADPCERATSVTSSGAAKSPPHAALLNLVP
                     VFSESVASSSKKAESERPASGSAAMCVHVSTTASSLVDTVTPSRREASSGGTASSSVV
                     CLSPRESSPSQQCVVAAPSAHLCHSLSPLQCRLRKDAEEPNPAELSALASDAVAATRH
                     AAALQRASVPLPQLAAPPAFLPSRRPCFLCEISVQELLDVIRFAHDCEGVVLVSDSQA
                     PLRYYEKLRDWRSPSMSGAADGTWSPPGSTLLVGESAVMQQLLHRSAKASFGRPSALS
                     PLQFVWDQVGARTRPPASLVPCFVVSIAGSSSHLCNTMEHLGGTPCFLVRAAADAASV
                     LRQTKDLVREWGTGACRRRRVDDGKSRPL"
     gene            complement(<601524..>603098)
                     /locus_tag="LMJF_32_1520"
                     /db_xref="GeneID:5656266"
     mRNA            complement(<601524..>603098)
                     /locus_tag="LMJF_32_1520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685417.1"
                     /db_xref="GeneID:5656266"
     CDS             complement(601524..603098)
                     /locus_tag="LMJF_32_1520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685469.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656266"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5C9"
                     /translation="MDALHMFRYRRPPKKEIYAKLLALCAFGVFCAVVGFNVAHLPLP
                     SAKRGVLDVSIPAADHDSFKVPTLSSADRVRLEKLSTQITVPYLTPWGEGERPAICFM
                     WYLLYRSLKPDLDKLTANLLNTSTINATASEIGSAATHNQRKVVIDVVESHEGYITTS
                     LAHFLPTTYVFSVVASAPAEQQYGWRPLDPRYRRGAKDAYDFGSEDLAAKRQAYAERV
                     ATKVVRVLANPVAEGAAEASQQPGVNGGQPAMETGVQTATAEKSSAGGDTFQGISRQA
                     EAEAVTQVTPPPHVYLCVPRYSLNSSYYASMAAQELRVSYQILLFPHVALRGVRTSAE
                     FDVALRTLLAQANVASFIALPWLSESGNVGTGSATNGEPAHHRRLLLERELIDYERWY
                     EDYRWTPSQVLQRALSSPDMEAQYHVSILPLGSKWWFGALRQLFRVELQRKHDRSAAN
                     VAVRFTTITVDTASARADGALAAIDGSGTNTPAASPLPSLVANMFGCAARQVLLGCVE
                     REHHSSCEQFSEVHVL"
     gene            complement(<604016..>604663)
                     /locus_tag="LMJF_32_1530"
                     /db_xref="GeneID:5656267"
     mRNA            complement(<604016..>604663)
                     /locus_tag="LMJF_32_1530"
                     /product="putative NUDIX hydrolase dihydroneopterin
                     triphosphate pyrophosphohydrolase/hydrolase"
                     /transcript_id="XM_001685418.1"
                     /db_xref="GeneID:5656267"
     CDS             complement(604016..604663)
                     /locus_tag="LMJF_32_1530"
                     /EC_number="3.6.1.-"
                     /codon_start=1
                     /product="putative NUDIX hydrolase dihydroneopterin
                     triphosphate pyrophosphohydrolase/hydrolase"
                     /protein_id="XP_001685470.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656267"
                     /db_xref="GOA:Q4Q5C8"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="InterPro:IPR020084"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5C8"
                     /translation="MVIVRGQDGCAYRRSVQVFFVNERAQFLLCQPAGTSNVKFRQTV
                     QGGSEGDESPQKTAQRETWEEIGVDLDKDATFLCEVHPSAAVSGEHGQAEDVRNEKNE
                     IVSERRKEFRYKSKTWRKLGISGQELYPLLYLLKSEKLRHVDTLGSKRGVRTEFWSVA
                     WGSLADLAEKAPPRKRAVMRSVCNAVAAAAMPLLELRGYPTSGSTNLISRAQTAV"
     gene            complement(<606083..>606817)
                     /locus_tag="LMJF_32_1540"
                     /db_xref="GeneID:5656268"
     mRNA            complement(<606083..>606817)
                     /locus_tag="LMJF_32_1540"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685419.1"
                     /db_xref="GeneID:5656268"
     CDS             complement(606083..606817)
                     /locus_tag="LMJF_32_1540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685471.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656268"
                     /db_xref="GOA:Q4Q5C7"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5C7"
                     /translation="MFAPVPLQDSKARRTRGNADESTETNIIIRAADSLAYRRSVQLF
                     FVNEDGQFLIGCPVGESNKCYRQTVQGGSLEGETPMQTAANEAWEEIGLDLAKDATFL
                     LEVLPPPTSLSGSCDSAGILAAPQDNNGVLNSSGEVVSEYRAPFRYRTKQWRHKGIHG
                     QEMYPFLFFLPRDHISQLDVQARKRGVRQELKLLYWGPLCALEDQAPPVKKQAMSVIC
                     PAVAAAALPLLQCWRYPLDGIAAYVS"
     gene            complement(<610896..>612101)
                     /locus_tag="LMJF_32_1550"
                     /db_xref="GeneID:5656269"
     mRNA            complement(<610896..>612101)
                     /locus_tag="LMJF_32_1550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685420.1"
                     /db_xref="GeneID:5656269"
     CDS             complement(610896..612101)
                     /locus_tag="LMJF_32_1550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685472.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656269"
                     /db_xref="InterPro:IPR007557"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5C6"
                     /translation="MGPLEVLSEMRAVNGYLQLLAEQLYVWAETSPSAATCTSRSPTV
                     TSAGESGARGYPATPGATDAALSWRRASERDAFYLLQTVMENTRRLVIESQNVVWALL
                     SRDTATSGATSGQASCGISYSESPFDAPKRSVDACVYPLDTEEPRVSLMRVMQGSPSR
                     VALPPSLARSDVRDTSRTPASASATQPRLSDDVAEHPRRRLWPAAQFCYMTHVEFKRG
                     RLRRFLSPVTVKAGAYVIVPGDRGYDCGLVVQCALWNPHKQAYDADTIQSLDPRVLPP
                     GNAGPIMEVIRVATDEEVHRLHREHVSMERLALTTCRDIADRLHLSMEVLDCEYQYDG
                     TKISFFFDSAEVIDFRELNKELFRVFNARIWMQNTNTAVRNEAPRNVRPSRRAHRLRF
                     GFQGTSSAH"
     gene            complement(<613205..>615961)
                     /locus_tag="LMJF_32_1560"
                     /db_xref="GeneID:5656270"
     mRNA            complement(<613205..>615961)
                     /locus_tag="LMJF_32_1560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685421.1"
                     /db_xref="GeneID:5656270"
     CDS             complement(613205..615961)
                     /locus_tag="LMJF_32_1560"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685473.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656270"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5C5"
                     /translation="MGSERNGEKSAANGSSASPAKQPRPPRWTGDAAPLSSPAPRRRP
                     TLQRARALPPNTMASVATSTSLQPSALPNGLPRRRHSPVFWGALKEALLYAGPLGEAV
                     GTVPVGSVLLEGSRYRDVFGGWWISTRCDDGTLGWIAYSDSIEATTTEDAGAAPFWLR
                     VYDTRATPAAASDSVEAPSPRAALPSTQVCWHSVLPSVSCADFSRTAAAHFLFRDAEL
                     YAYYWDTIHPGERVARDWNFEYQRAVELRWLGADFFPPAAPTSSILSSAPPEAARHAQ
                     LDALIAAFRSEVERIVVQIWKEATMPPPSRQVAAHPQFPDQVYFDGGILLRRCVDTAD
                     GVLGGDEMAMKCGHAIYRHQEMLAVVAPRHVLHVPLHACCTFGGFSFLCSTIPPYGSA
                     NLVAGDSNMFAAAGDDDTLSACTPTPPLPRSALVSELLRSLGDALGFEGGDVPREWRV
                     YAGRDRRLYLSQTHRLLPPVLPLHRADLSLAVLSPLSKTSDELVGPSRASSLYASLLC
                     YRVRPEVFVRWQTRWHPNECVCTSQESATRASTAHACRSAALASQSYAAGTWIRSEGI
                     TRVAGTLGFQLPVAAPLLPVEPCNSCHGEIDANELRFVVCTNPLQCCRVCMHCYTRLV
                     LGHASGEDAPVDLLGQACPTAVRCAAGYRKAGSFLMVPTLSELMHANGLNLRYLAYVL
                     HRLPQTTRAAVEHWCQVEMVARTAKHLLQHDLRSATTPLEARATCEALLTSLLQPTGA
                     ASERFWRTRLGPALQSRFLGMCEPFHLSVHALRLVAERVAALAGVTLSESCLSSLASL
                     SAPTNPKTVRRRTDSETGTDSGEAGSLSTAAATETGGAFVEIQHIAPLIRVFPAPPME
                     PLMPSPPASEDVGVENSPQGRSLVKRRAERLLLFWIGHTPEGADDAQQPFYLGESVLH
                     MALQ"
     gene            complement(<616983..>619178)
                     /locus_tag="LMJF_32_1570"
                     /db_xref="GeneID:5656271"
     mRNA            complement(<616983..>619178)
                     /locus_tag="LMJF_32_1570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685422.1"
                     /db_xref="GeneID:5656271"
     CDS             complement(616983..619178)
                     /locus_tag="LMJF_32_1570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685474.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656271"
                     /db_xref="GOA:Q4Q5C4"
                     /db_xref="InterPro:IPR001164"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5C4"
                     /translation="MASVQRQTKEVQEERQRQLVELLKHPANAECMDCSARHPTWASV
                     NLGVFICIRCSGLHRQLGVHISKVKSCTMDLWEPEQIAFMSKMGNERAKRAYEATIPA
                     SYVKPGERDASAKVMKWIQLKYVQRRYYRPLPPPAADSDSEAAVDEESDVKRANAPRA
                     GEDFQRGQPATPTQSVRDTRPLISNPVAATRTAAQASLAALGTNTSPRAALDASYLSK
                     QKKEAILDWLRTATPCVVLEEPLNTSAPPVQPTSVAKTPLSNIVSSPTIVVREVPSPS
                     TSVTVIIATEAGGPEAAAPALANTPGVAEESGVNSTRRRTAKRANRKTTTAPPVLLDE
                     MLNDGAAPVDVPLFAYEDRDRVRTATPPLQRDPSDDAKQATAVVSVTETGPHEESEAS
                     ARPRRRWRKRAPLTEVLESNLAPPELSFPVFSISRGSSSPALRLTPSPTLRTVLVEPR
                     CSSPRAVDSVARVSYRDRKQRGQDPEMLPESPARPATQQLPPRLAQGPACAAPQAALP
                     ETPPLLSEEPMPRTTSSATALAAPTSVEQRAQFVPRVVDATLGQSAATMNSSSALCRS
                     SLTGEATPTPVRAPFMRPTATAAVRSRHVAGQTHRPMQVLGKPSSLCSSRRALLWPPA
                     RDEDKYVPQQDIRSSGASFCDELQPRPPTFMRWTASPSSSSFTRLRSSLLSPITEEDS
                     VAQRTPSTQFYPLSTHKTGTLNNVLQMQRRLEEQLRVLKERFRQKSHPN"
     gene            complement(<621899..>623164)
                     /gene="PMI"
                     /locus_tag="LMJF_32_1580"
                     /db_xref="GeneID:5656272"
     mRNA            complement(<621899..>623164)
                     /gene="PMI"
                     /locus_tag="LMJF_32_1580"
                     /product="phosphomannose isomerase"
                     /transcript_id="XM_001685423.1"
                     /db_xref="GeneID:5656272"
     CDS             complement(621899..623164)
                     /gene="PMI"
                     /locus_tag="LMJF_32_1580"
                     /EC_number="5.3.1.8"
                     /codon_start=1
                     /product="phosphomannose isomerase"
                     /protein_id="XP_001685475.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656272"
                     /db_xref="GOA:Q4Q5C3"
                     /db_xref="InterPro:IPR001250"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR016305"
                     /db_xref="InterPro:IPR018050"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5C3"
                     /translation="MSELVKLEAGHQDYAWGKDAASSFVAKMKGLTNDKSGKMFAELW
                     VGTHPNCPSKIADGNAQLLEDFLKQPENKKTYFSEAHQATIFRDTVPYLLKILSIRTA
                     LSIQAHPCKKLAEELHAARPDKYKDPNHKPELICALTSFEALCCFRPLGAIIAYLKRI
                     PELAELVGADAVLGQYMMAPESALPAADSDEEKQSLKAMMTNVYAASDDIVAKTLRLH
                     LQRIEETGAQCAEDELFARIYRQYPDDVGCWMVYFLNYVQMVPGEALFLSDSEPHAYI
                     SGDGVEIMACSDNVVRAGLTPKWKDVPTLISMLKYDTTGLASASHERKSNEDAAQWQV
                     QYYRPPAQFPDFSLYRLQYEHASGNGTTSVTLPTIGLGFCLEGSAKVNGTTVNAGDCF
                     AVPYGKLTCQAEGAKALVFVASTNDLSDR"
     gene            complement(624375..627188)
                     /locus_tag="LMJF_32_1590"
                     /pseudo
                     /db_xref="GeneID:12982185"
     misc_feature    complement(624375..627188)
                     /locus_tag="LMJF_32_1590"
                     /pseudo
                     /db_xref="GeneID:12982185"
     gene            complement(<628199..>630202)
                     /locus_tag="LMJF_32_1600"
                     /db_xref="GeneID:5656274"
     mRNA            complement(<628199..>630202)
                     /locus_tag="LMJF_32_1600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685425.1"
                     /db_xref="GeneID:5656274"
     CDS             complement(628199..630202)
                     /locus_tag="LMJF_32_1600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685477.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656274"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5C1"
                     /translation="MSDAFEARMSAMRARLSSLCHTVEEQEVEQQQQRRSFEHRYFVE
                     ARAAGSAATPAATKPITSTATPPSSAPISRPVTSKSQVPRTDGISERDVNQVHSASRK
                     DAAFGHHFGTSSPSASITRARAAKPGSGVNAMLQLARYHASGSWSEAVVTKDIVRFTG
                     GRSSPVPKAPATIPPEAFAVNTGQDTTDSSPVPLMPCGVAGLHSYGFRERLPSPRRPT
                     ASLAANTVDLASRNGEGRTSQNTPREESCITAADTTIVDTMHADEATSFDAFRVVQER
                     LRQKMMQLTTTSPHSVVPLSTRGAPAEFAVSDDATAPREELPHRGLTASRAVSDVDGS
                     SPSPRPPPGTRAETATPTRSPDKDESSSHETAPLPQTTPRYQHGQGDTWTDVEVLPAT
                     TEPDTENATEARLFTHGSLHDSVVGSGDETTAVSREWQWSRCGVPSTKARTANVPRGV
                     FDPTVRHVRVSRMPSSDAQLNPAAGEQRADSREYRRSPEAATAGRAHSDRGRSGRTTA
                     SIQHGVSSAPRRSGSRHAPSSTSAARWSATREGSVSTAARSRKSAPKPAARPKPISLN
                     VEATILCPVTGAELFALLRMRGLIDSEGDTAEYRLPPVRCHRLYVTAEEHRQLKLLRQ
                     SLHSLVAEEQHQDIPSYQRFTVSARSRNAEFAPPPPVLRYMDV"
     gene            complement(<634191..>635066)
                     /locus_tag="LMJF_32_1610"
                     /db_xref="GeneID:5656275"
     mRNA            complement(<634191..>635066)
                     /locus_tag="LMJF_32_1610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685426.1"
                     /db_xref="GeneID:5656275"
     CDS             complement(634191..635066)
                     /locus_tag="LMJF_32_1610"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685478.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656275"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5C0"
                     /translation="MFKEISFDDVDVSCASHEDDRVAAENVADAVEGGKAFVRFHRSG
                     EEGFSIVAGACDDKDARHNAHFMSGDAWMSKDCHCIQCETLRVLSRYSEMRAQPNIFP
                     VIVLVDLDNFGFNQFKSIPPYADVELLDHVLVWSFFGSCFTRHHRAWPSEQTVCEPLP
                     NRAVSVNAAGTTKRSIWEILVKKQQVFFTPCGGQPQAADNVMHRVLQALQGMETVLLT
                     GDVQLIDEIYRSRRLLGMKSRRHNEDEMSDKLTVINVDDMDKRFVPVWRSLCNRLRGT
                     LHDVRATGGCNDSDG"
     gene            complement(<636479..>638782)
                     /locus_tag="LMJF_32_1620"
                     /db_xref="GeneID:5656276"
     mRNA            complement(<636479..>638782)
                     /locus_tag="LMJF_32_1620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685427.2"
                     /db_xref="GeneID:5656276"
     CDS             complement(636479..638782)
                     /locus_tag="LMJF_32_1620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685479.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656276"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5B9"
                     /translation="MAALQHVNSATEITPLLACGGDYVKNGTQTLSIPSVYATLDALE
                     SLWQAQREKQHLSVRGRAQGLRHYHAVYEASARCVPLSLTRWEQWLAGLSEQGARSTV
                     GACPDELSSSSSPHVQRVQKELVDSYWHLYRRLCWGSSGAAKAGLAAVLEHTDSAASG
                     LPSVMATGAASLLAKQEAALAKPLQAFARLSAESAHLFADYPLIGRVERLWLSETVLP
                     ALGEPAEPLVEMLVRRTFKRDLRVPSVALPELLREYEESEIDEHKVEDIVAVGQATLS
                     SSWMSAASALHVHMTRLTDTTKPTDVGGTLEASSASRDARLKELEEQLLSVLMKVPRG
                     QGFLPALGLLMQRLMEDHGEASASTGPWRGLNGSQTQFYLYLLHQWFATYIGSHHRWS
                     VTDMFAAPDDADLWMFLLDRHAVCLTWALVTEQPALQDPAVCTHAEAQLGYLNVLATS
                     VDKLRAVFYSVVHCVQLYHASTTAFTKTERRESRRGTAAAATHSWMKEIGAETFCRAL
                     LNDLFDATALWEEAHADYDVCVQQRALLVEAELKLILYDTMMMLQCPDRSTERIERLV
                     EAALAMCDAWDTSEREPSGRTRQEHKDLVLPIIGIVGRCLHRISASLRCEVASVSAVS
                     EAQASLYRRAVQWVKRCIVAAAAIGGDPSSLWDEWTGLVSITVFSAEQHSSGEASRLF
                     YPLAFLGYAVPATGRGRASRQTAATGGLDDVCWERRAVAKAVRQEVKTGVDGGGSGDD
                     RVSSCIDTAGSGEEESMQPPLKKTRSN"
     gene            complement(<640690..>641442)
                     /locus_tag="LMJF_32_1635"
                     /db_xref="GeneID:5656278"
     mRNA            complement(<640690..>641442)
                     /locus_tag="LMJF_32_1635"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685429.1"
                     /db_xref="GeneID:5656278"
     CDS             complement(640690..641442)
                     /locus_tag="LMJF_32_1635"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685481.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1635"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1635"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656278"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5B7"
                     /translation="MALLLDDEEVFVGTANAPPQPAQPGARIVLDSASETTDFTPLCA
                     AAPSSKTATSAPSTAAATRHRERSPVSAGALVTLPLRGGDGMEKMEALLCGKTKVALV
                     RNGSVVGLKRSADEAVGAAVFRTPVAQRTSLARLCDGRIDASSTQPKIVSAARSLSSP
                     SPQQELPSTMSLETVLTTPHERSSQAVVSTSPEHPCGSPFASPPARPTPTLSASAREE
                     TVVQTPPSSVATQPAKMQMKLSDFFSKMACKR"
     gene            complement(<642477..>643145)
                     /gene="CPC2"
                     /locus_tag="LMJF_32_1640"
                     /db_xref="GeneID:5656279"
     mRNA            complement(<642477..>643145)
                     /gene="CPC2"
                     /locus_tag="LMJF_32_1640"
                     /product="putative chromosomal passenger protein"
                     /transcript_id="XM_001685430.1"
                     /db_xref="GeneID:5656279"
     CDS             complement(642477..643145)
                     /gene="CPC2"
                     /locus_tag="LMJF_32_1640"
                     /codon_start=1
                     /product="putative chromosomal passenger protein"
                     /protein_id="XP_001685482.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656279"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5B6"
                     /translation="MSSYRSDVDPFKEIRVLPREAAQLRHHLSRINHALQTKYFVAAE
                     LSELALQPDRSDEFLALYKAEIYRVVAKLNMNAKKQYTVTVDPLRLTTGFEFKRGADR
                     KDNLGTAVTAATVEGLTSPDVHAKWTASLVETSRLLAQQHAINPNCQALSSALQSTPS
                     SQQTQGLNGGGGAAAVGSDVIGDASTCAIDSDVRKANKESFLFSTPPEFAGFAPSGAS
                     PGAP"
     gene            complement(<645086..>647857)
                     /locus_tag="LMJF_32_1650"
                     /db_xref="GeneID:5656280"
     mRNA            complement(<645086..>647857)
                     /locus_tag="LMJF_32_1650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685431.1"
                     /db_xref="GeneID:5656280"
     CDS             complement(645086..647857)
                     /locus_tag="LMJF_32_1650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685483.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656280"
                     /db_xref="GOA:Q4Q5B5"
                     /db_xref="InterPro:IPR000009"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5B5"
                     /translation="MLTKMEPRKAVEKVHPKLSPSPEMPTGEQAQLRSLRSSRASSEA
                     RSEQGPASPFSGPLQDAQMAACRSSRAGSEVPQRESVTASPSSATRRDAGASYRSSRA
                     GSEVPDRGPANDPNEDRSARSSRAESEVPERGGYNEPVIPSPKRTPGKTKQNLMMMAA
                     SGGSRSALRSIRAGGPISGAGKSGHRAGVHGVGRAPQSVREHIHNVEQRLYGTVHRAT
                     TTFQFYQKLHYPLEYPNAGDEADVAEGATVAEGQAHSEPMTLPVDPKEPSPQPRFGSH
                     NAVKSTEVMRGTSSPAVCEDGDNVTTAPGAAGVSASDPRSSTSHSSAVTGASAAALMG
                     NVSSGYGGSSNSPSPCFDEAAFNASFDNAGFLNESGDMLSESFRVPLQTDGEYSALQS
                     VSVVAMATLLDPMSGAPVLGLCLGDYSGHIEYFEVSTADTYNSSIRRSKSLMQQHEVR
                     TLPAGLIYGGCSKTRGSLQYSSEDGTGTSATPNNCGSLDSAATENITHDMRGREVLRR
                     HSHKAFVKSINALTSVAVEPYVKCLSFVRQRCSPSMISYLTANERVIKLFHVRREGFS
                     PFNAFAGMEEVIGKTFAGSRYFARLPPQPAILPIKEFGPVANSIQALSVSADGETFMS
                     VEDLQVFWWSFEATDTTKATCIADLRPPSGALDEVEELVTASSFHPTHSSLFLLTRSS
                     GILNIGDLRDPPSRESRKYAISSQLTTQQNPFSCQAYDEILCSISGASFLGPDHVVTR
                     DYLSLKLWDLRKPDQPCAMMPVMNYVSKYLDSLYENDSIFDRFPVAVDDISGTVVTGL
                     YDSAVAVWQPLHSSLTLANSLVHYRADPFVEPRDAVAGGVVRVQELEKSLADAWSQTL
                     AAPHRSRPSSQTIEEKDCGMGIPEEAIPEPFTNKVLTVAIAPGGERFCYTYKNGRLVY
                     VFERKSDPQ"
     gene            complement(<649738..>653235)
                     /locus_tag="LMJF_32_1660"
                     /db_xref="GeneID:5656281"
     mRNA            complement(<649738..>653235)
                     /locus_tag="LMJF_32_1660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685432.1"
                     /db_xref="GeneID:5656281"
     CDS             complement(649738..653235)
                     /locus_tag="LMJF_32_1660"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685484.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656281"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5B4"
                     /translation="MLKCESNPIVATSPPRSHWLTSSSASATPRASPVLPQEEENSQL
                     NATREKLTTQHRKPPTDPHARRHHSRESSSAESRDYVDELASSAFQDCRTAALVLTAY
                     SAQQLASYTDAISSTARDTSAGSPGMPRIHTFHRVDSDDDGGSEDRSFHEAETADDPS
                     DAASGAVAEQDATIEAIVPVVDDGPAVFPYEADGEAQEVVRARQGTDAVSEDTSSNTP
                     VGVWAARHKKERQSAGRPSIASSDLSIGDAKSAVAPSAACSSAVLRHAHSSEWAATRK
                     TALERLRANFDHPSRTVASLAPERRSSSLFAQREPGKAHVLHSPSDAVISRDRALQPS
                     DSFEDLSKAPLSGERAKQSETRDPSRAESKTAASILGALLGDSWIGDAAAVGQLSRSQ
                     KEPAAYGSLSEGESHASLSEKVATPVKQTAGSAATPMAIQSLSGSRFIVRPALSTDVS
                     GISPIKKDVPSILADLYGTPDARPPAMAMLQTPPASLATTTPPPHARGRWSLQGALEA
                     MHEPSADVATVGFHTAQTAPSAASASAEETDLCDRVTIDATATTEMSASACQHPPQSL
                     CANRVDRAPLFGQWLVRSGVVLHPDDGGGAGSGLQADAKVPLSTESVPRSWDSSRVNR
                     WRCSERQPLAHAEHSVTEASVATPAHENTALTRPAEWRQQRLKKELRAKEMAECTFQP
                     LLSPGTRAMVRLAQERELERTLQEEEDGAEAQAAGTRPRSARTDSQQASLDPSTLKAT
                     LQSVYKRLYPAELSAAASRRQLLDQEMEYRRLTREELILLRHRCGVARRVPRSARSGG
                     AARSRETFSSFMSTILQTDWEEATAAIAMPRLVAASSSPTQSRMTGSAVAPVAVLQTS
                     YMSPMAVALLEEKKAKRKYHSRRQAEMHGQHAEAGDAEVGGGADRRGTARSPADSTEA
                     TRAEESFRVALFDEFLLRQNAYYFNRSRTVRELKQQMTPVFTPRTTNASARLVQNMVS
                     RSLLNESLGPETSSIVAQRERQRVPFASLFVKQHASPYVDPCTFKPNISPSARALREE
                     DRRRKGANKQAPAVQQQSFFERLYADEQRRAKQREEAKARAEAKEVEGLTFQPTLNVK
                     YNARVHSTLNPRNYQPYQAYLLEKRQLLEAKRKEQAEEAQQAEEDVCTFRPQTTKKPA
                     YIAKMAKCFGVLRQQDAEF"
     gene            complement(<654236..>655117)
                     /locus_tag="LMJF_32_1670"
                     /db_xref="GeneID:5656282"
     mRNA            complement(<654236..>655117)
                     /locus_tag="LMJF_32_1670"
                     /product="putative NAD+ synthase"
                     /transcript_id="XM_001685433.1"
                     /db_xref="GeneID:5656282"
     CDS             complement(654236..655117)
                     /locus_tag="LMJF_32_1670"
                     /EC_number="6.3.5.1"
                     /codon_start=1
                     /product="putative NAD+ synthase"
                     /protein_id="XP_001685485.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656282"
                     /db_xref="GOA:Q4Q5B3"
                     /db_xref="InterPro:IPR003694"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR022310"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5B3"
                     /translation="MPVAPLHPELQRVLKENRRTRAFDPAAWIEMKCAKLNDYMQRCG
                     LKACVTSVSGGIDSAVVLAMCAHAMRAHNSPIQKNVGLCQPIHSSDWALRRGKENIAA
                     CGATEVVVDQTALHTELATLVERAAGIEGGAFARGQLRSYMRTPPGFYVAQLLTQEGT
                     PAVVMGTGNKDEDFYLGYFCKAGDGVVDVQIISDLHKSEVLLVAEVLGVPENTRHAAP
                     SADLWEGQTDEDELGFPYDFVELFTEWYLKQRETTKIKFLNSLCDEARNQFERYVAAC
                     ELVHRRNAHKLQGQVNL"
     gene            complement(<656698..>657108)
                     /locus_tag="LMJF_32_1680"
                     /db_xref="GeneID:5656283"
     mRNA            complement(<656698..>657108)
                     /locus_tag="LMJF_32_1680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685434.1"
                     /db_xref="GeneID:5656283"
     CDS             complement(656698..657108)
                     /locus_tag="LMJF_32_1680"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685486.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656283"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5B2"
                     /translation="MEAPTDNDSMQAGPVVVGHADGVLTMPSEDFASLHLQPIQDDTW
                     IRNAEIVHMENFVETEDGKRIKREILKEYVEEKERQGTFHPDPILEGMIYQEKFMEAY
                     RTNGRSVDADKAHSYRLKLLETHRRARAIENADT"
     gene            complement(<660278..>661969)
                     /locus_tag="LMJF_32_1690"
                     /db_xref="GeneID:5656284"
     mRNA            complement(<660278..>661969)
                     /locus_tag="LMJF_32_1690"
                     /product="putative protein phosphatase 2C"
                     /transcript_id="XM_001685435.1"
                     /db_xref="GeneID:5656284"
     CDS             complement(660278..661969)
                     /locus_tag="LMJF_32_1690"
                     /EC_number="3.1.3.16"
                     /codon_start=1
                     /product="putative protein phosphatase 2C"
                     /protein_id="XP_001685487.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656284"
                     /db_xref="GOA:Q4Q5B1"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5B1"
                     /translation="MIPLKRAPPRRPPAKHPMFSAKQMQYLSPQQVEMTRMLQQQARD
                     RRTYIVRSILLFITLTAITGYGYYSYGIIVGLTVLIGGWLMGWLELLQIVLAWVIRNA
                     GQPNFDELLRRADIMSEPMKEKESVSGENEFLEYGSSSMQGWRRSMEDAHTLLLLEKG
                     GFFGVYDGHSGAATAKYCGEYMFQFVHQTKAFMKGEISKALYDGFIAIDKYLHSLPSF
                     ERGGCAAVVLYLDGDDVYCANAGDSRCVMCRNGSVDALSTDHKPFLPSEQMRIERAGC
                     YVLNRRVNGMLALSRAIGDFMFKNNTQVSWEMQAVTSAPEVRVTKLNRDKDEFAVLAC
                     DGIWDIMSSKQVVDFVRPRIQERVPLGKICEELMDACLSPQPFRLGCDNMSVVIVKFK
                     RGPQGGAQTAQATTTGSPHMVSPRLPAASATVADDDGTVSSMDDNRSQAAVLEVSNGV
                     PLTPGTAGKASTAAADKTAASDHRKEGVGYVEPKKSPLVSPQVSSAKMTSAPSRSALT
                     KPLRSSSSHQSAEDARSSRDCEDTPNGSSAAMSFHPKVLSPTRSTPGFSVRGKGV"
     gene            complement(<664890..>666446)
                     /locus_tag="LMJF_32_1700"
                     /db_xref="GeneID:5656285"
     mRNA            complement(<664890..>666446)
                     /locus_tag="LMJF_32_1700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685436.1"
                     /db_xref="GeneID:5656285"
     CDS             complement(664890..666446)
                     /locus_tag="LMJF_32_1700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685488.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656285"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5B0"
                     /translation="MQDAMKAAASATPDRWLAAAMMSPIMPTGENVSDTMPIHSADLG
                     WTPLIDSAASTGGAVHAEKRACEHTQPPVGDKAESVVIPRYFLQQLERQLRLLVDDVA
                     QEEWNERAWMCLYTYLSELPLSVRASLTSRDRCGAAIVVQLVNGMRASALTEGNLVEE
                     AVAMASKAAEQDPVPSLPQEVLHLLQHSTAIDPEFHFEWRGSTVAYVEGPLGSAAGKA
                     RRSAVASNGEVGDFAHVLPPSSSLSSTSLALTDDEEERSLIDEEEAVCTSRLLSFIVA
                     HIKKYSDRRLRGVATQFPEPGTGELRTPPGATEVAQAGVYALSTPPTNRRSDASASLQ
                     QQFRDQQDQLTSLLASFVRLRHTPLFQALRHTSEHALFACDFIELASAAERLLERAPP
                     ASAATRLLEISMTQKRVITEATDARDTSVGTNTSVGSGSSPTTGPSVRHSVRVRTPMK
                     PSIRHPIQRILSNLPSPSGLSSGRGTQMPDMYKQLYSPPVHVDEEERGRAVSAATLRD
                     GRLAAETWAA"
     gene            complement(<668739..>670754)
                     /locus_tag="LMJF_32_1710"
                     /db_xref="GeneID:5656286"
     mRNA            complement(<668739..>670754)
                     /locus_tag="LMJF_32_1710"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685437.1"
                     /db_xref="GeneID:5656286"
     CDS             complement(668739..670754)
                     /locus_tag="LMJF_32_1710"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685489.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656286"
                     /db_xref="InterPro:IPR029026"
                     /db_xref="InterPro:IPR029028"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5A9"
                     /translation="MRRSLQLQKQTLHPPRNPITLASNPLTRWSRRLPKWADLGGALT
                     RVQVGLEGCHSAFNATNSVRTCLYFQTASPPTFLTAASWKAIEHVQVREAAHRESSAH
                     KMHEDVFPNSRAVGHAEMEPGPSGCGGSGVACGSPFDGIALFGEEDYFSPRSHPPCDD
                     GEAAAAAPNACPLVALENFADGAQSIMRTRLPTAATQKGGCIRLVVGHENWGVRRSLL
                     RAKDGTTLAPLCDRTRTAALVGIPRSTPAPMADMVVYVPQYGTTSSLNVATSLGIALF
                     YCYMDAACPEAREIYLAGSFSCPGEGGSPDDGASSHDALEELRRRLHEYQAVFSKALP
                     APATCGNGSASTSTDATSSGPTRSVGDAHVNTTPRVDQRPLHPAFYLRNSEEIQDQLR
                     AYRQALLRYSGRPQAVDSSRQPNADASASSPSPASYFGLSVLYENEYDQRNFGGLIRS
                     ANAFLVDYIFYVGRRKINVVGAVGSYHYTPPVHLGALPDSPSIASTSDAMSDSASRDW
                     ATEMRARVKEAYGLNAPRNWWLLDCGHDFLYEATFDGQGEFQGCEVDAAASSPASLQA
                     FRRLKANGQARSLCDSESSLREASDGGLVLLVPQEGRLPHPGLMGLCTGVLTVLPEGA
                     HFCEHRGDAGDGRIRGGNGHRGLPSQVASGVALQRLSAVMHPRLAAL"
     gene            complement(<672322..>674502)
                     /locus_tag="LMJF_32_1720"
                     /db_xref="GeneID:5656287"
     mRNA            complement(<672322..>674502)
                     /locus_tag="LMJF_32_1720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685438.1"
                     /db_xref="GeneID:5656287"
     CDS             complement(672322..674502)
                     /locus_tag="LMJF_32_1720"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685490.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656287"
                     /db_xref="GOA:Q4Q5A8"
                     /db_xref="InterPro:IPR007185"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5A8"
                     /translation="MQVEGNWKAAANLNLLLGLEHPPARLEKPLLMPQQRSAGSSGLV
                     TVEARNTANFRSSSYCGLQDKSAPTIRRHVIDYYKQMLHRVPLWRGLAKTQQEGSCRG
                     TVVKTELEDDVDADGMVPLPGGAPVVSDGLLFRAVGILTQLQDVSAVSAATQQAPWEF
                     YLVRDMDDDECYVRALQALGQADRTADASFALLQDASHAGFCARTSGRLASSTARSST
                     AVAATSAIDEAGEETLGRAAEADEEAAARDGTRLSLYTRQASWFTGLHPGMAVGIIGD
                     PFQRSARGVLTGVLVREFVLPSRPTLPWRVDRPLLSAAVTSTSGAGAVADGSDGGVRI
                     HFCSGPFPRRDVSGLLRAVTSQALHRGADVLIIGGPFILPFASDFERELLPSLGATFN
                     EVMESFVDTLEETLKNYYSTRPLLPHMKVLLVSHRGDVTQIPVLPTTMYAIADTDDIL
                     IRSNPCRLSVNGVHISVCNEDVVGDMRDRMVERWPTADGSLRRVVEALVNGRLYVPLY
                     SLPVATADLKHLPHLRMDYVPSQNELLEIKPAAAALASSTATKGDRRGNADGSDATTS
                     TSGASSSRGWETVFSVAEQPSTDMAAWLQHKVKRAKLEDAAGDNEEGDAASAPGGPVT
                     PSTPTASSKTEYLPHIMFLPSTRPQFATVTHQSEEVDGADIDSAESASGVLVVNQEVW
                     STRSSPKFELRVAEVTIPNTDLVLRRGATSTNGVTCGVLHIYSA"
     gene            complement(<675924..>676895)
                     /locus_tag="LMJF_32_1730"
                     /db_xref="GeneID:5656288"
     mRNA            complement(<675924..>676895)
                     /locus_tag="LMJF_32_1730"
                     /product="putative coatomer epsilon subunit"
                     /transcript_id="XM_001685439.1"
                     /db_xref="GeneID:5656288"
     CDS             complement(675924..676895)
                     /locus_tag="LMJF_32_1730"
                     /codon_start=1
                     /product="putative coatomer epsilon subunit"
                     /protein_id="XP_001685491.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656288"
                     /db_xref="GOA:Q4Q5A7"
                     /db_xref="InterPro:IPR006822"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5A7"
                     /translation="MTDVLFDVRNALVVGNYHQAIADGSTARALSSRPADVAAFNVEK
                     SAVVALGQIGLGQVDAVISQLRSESNPLLVTIRTWAELICAMRDYDALSDPVTNVTQR
                     LQSDAEKVAADAVYKAVFAATSLLYQQDVIGALTLAKKWLGELPNPEGVLARRYTVEL
                     HGVATEALLRLNRPDEAAKEVKRMEQVDSEAIVTILYSGIVSLHQAASDVHMANYNAA
                     VSAFKEVQLRCGQSIMVSNLMALAHMGLKDYDAAERSLLDALAVRSNDEATLVNLAAV
                     SAHKAKPLDDAERYIQQAVSMHGPWGEAYHAKERDLDEDMSAFLLEG"
     gene            complement(<680705..>681094)
                     /locus_tag="LMJF_32_1740"
                     /db_xref="GeneID:5656289"
     mRNA            complement(<680705..>681094)
                     /locus_tag="LMJF_32_1740"
                     /product="putative zinc finger protein 2"
                     /transcript_id="XM_001685440.1"
                     /db_xref="GeneID:5656289"
     CDS             complement(680705..681094)
                     /locus_tag="LMJF_32_1740"
                     /codon_start=1
                     /product="putative zinc finger protein 2"
                     /protein_id="XP_001685492.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656289"
                     /db_xref="GOA:Q4Q5A6"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5A6"
                     /translation="MQMNSYAGGYTTHNRSYAAMVPPPMPMPPGWEMAYTPNGEIYYI
                     DHNTRTTHWQLPAEYTMQQPVCSYRGPQRQRRGIDRSKAKTKMCMNIENGGTCSYGAN
                     CAFAHSSEELSTHPHFNSAPDAGYSAK"
     gene            complement(<682907..>685249)
                     /gene="PUF7"
                     /locus_tag="LMJF_32_1750"
                     /db_xref="GeneID:5656290"
     mRNA            complement(<682907..>685249)
                     /gene="PUF7"
                     /locus_tag="LMJF_32_1750"
                     /product="putative pumilio/PUF RNA binding protein 7"
                     /transcript_id="XM_001685441.1"
                     /db_xref="GeneID:5656290"
     CDS             complement(682907..685249)
                     /gene="PUF7"
                     /locus_tag="LMJF_32_1750"
                     /codon_start=1
                     /product="putative pumilio/PUF RNA binding protein 7"
                     /protein_id="XP_001685493.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656290"
                     /db_xref="GOA:Q4Q5A5"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5A5"
                     /translation="MPGMKLDFLKNTAQRVAMGKSLPLKQVEAIVLYGKPAQRAKVVQ
                     KLLPAVYGLSLNKTTHHILLTLLDHCENMDRVQMLYHVRRKLLDLAQSPVGNSVLQRM
                     LEKVPVRQKKEIAEAFVLNVDEDEFRRLCEHPFGNHVAQKLMEVPACVEVVLPHFLPH
                     LTSLSLHPYGMRVVAKYVESVADGCSKTIEALFPSCAEVDPEGDEAAVAASDALDKSV
                     LALFRSAEESLVLTALLRHIRTPVEVKDAIAAHVSEFAADYLLPATAPLEGLTKKRRG
                     DEDEYGLPDFGTGSISAKSVAATDIPANVHVYSAVLEHGDDLQRAEVWSALSANADIL
                     HAITHTKGAVLVGVAAVRFVEAARKRLFDALLLSTPAGAQFNGSDAGSSTAGAADTTA
                     TSRPDKKGPKKKKARKSDEAEPSSNKDAARSSIVDVATDPVRSVLLRVFVEVARDTIP
                     EKDTQLLVHDAVTLAQNSVSSPVLQKLVETDLTGGFASAILAVLLNSTEFTSLVTHPA
                     ASFLLQSILQFAPEDVRAPLVVALSSYYAAHLHDSLSYAQGSRVMQKLLAYAPDATVV
                     QTVNQLISEATKEEGEMEEAKGVDGSCADAVDEEGAADTEEKTEVKKVSRKEQRERNR
                     AKHYEVLSHALVSYALHAHACYVVQALLREVRTRQLDRERKLLMNELKPHVFELAVSP
                     WAGRVVLDTMMSVGSAQLADAMKNIAFIRAEEWLSDVSEEKKRRGNGVDPTVRSILKR
                     QREEMDKGVEFKKDAEGPSSAERKGAPAHKKKKLFRSVKK"
     gene            complement(<687207..>688703)
                     /locus_tag="LMJF_32_1760"
                     /db_xref="GeneID:5656291"
     mRNA            complement(<687207..>688703)
                     /locus_tag="LMJF_32_1760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685442.1"
                     /db_xref="GeneID:5656291"
     CDS             complement(687207..688703)
                     /locus_tag="LMJF_32_1760"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685494.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656291"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5A4"
                     /translation="MRVGAAAISAIAASPFPVDGATKAAKSSPAFPMRALVVAGTHDS
                     DAVEGNNDDEAIFELFFREAQLHYHISAEENMRNHLLAGEEVAFTNLMIEALQARAEL
                     LAGDEAAELVIRDAQKRAQERQAMMKEIEKTVALRLHDERMAQLLAMEFEALLPAHGA
                     GCERILREEAADLGEVFRWHKENRPLGAGCFIEAPVEDSRLTDARRGTGAAKFLESRL
                     ALAKGSRRASCARSSRVYLAQLLQKGTSSRCSAAALGPLAVAAGEAPASLLDGTLPVM
                     DEALFQEEGRARLQAAKDQRYLALRGLRAVSDIRQAAAAAREKVLAEEAMCWMQIARL
                     EVDGIYAAQEATRERKKREASADAATTHRAAQKKEVKERLLRQRGRPVPEPDNSAGGD
                     ARVQPRISGKSTEEGAQPPKDQAAITEAGALEQPSPRSSSSTVPDNSPLCGALAEGAS
                     TTAEANVDAVDELAYLRFVTGEITDPDACKQLSALVSSEVDEEVEKAV"
     gene            complement(<690043..>691584)
                     /locus_tag="LMJF_32_1770"
                     /db_xref="GeneID:5656292"
     mRNA            complement(<690043..>691584)
                     /locus_tag="LMJF_32_1770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685443.1"
                     /db_xref="GeneID:5656292"
     CDS             complement(690043..691584)
                     /locus_tag="LMJF_32_1770"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685495.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656292"
                     /db_xref="InterPro:IPR008914"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5A3"
                     /translation="MRRFLPSSVAAWGAGRVLQCAAEWYHMPGWKTQSSTKDARSREQ
                     RERDRKARQIEKLPRPEALHDFQYPYEKTILSDSMFEYPVYETELDTPQLFNLTPPPD
                     FFIYWNATDFDRTAYPPVPEDDHRVLVPSSQSPRWIEHRARLLQYLRKHEIMPHYVPH
                     IHANVNLSVVFPGQYNTRARLTDENGDKIPPPPAQTKMTPRNFWFTAHCGNYMELTDV
                     QQPPSVFFFEEAPAAASAASDAGEAGDAANKQSSHAAVNYYTFVMLSPDYPYRVPLLQ
                     DRHKADRGFFLNYMVANLRAPQAVSTVDGAVVDTEGLQSKGDVVVPYVAPLPTEDAGT
                     TRHLCLLFKQTGHVPSVKPMTATEEQRDFPLAQRSNYRLHSALTKQTGLKMPPSASTA
                     CLASLRSVERAIPADPCAVSFFTTKWDIQVQEYYEKVGLPEPAAPVDEEIEALLEFHA
                     MRPEKLRVRARHRPDGSVNMGDDPNFWAQALPTRAMDGSMQRGLGWSRRTTMGANGVP
                     VVYPH"
     gene            complement(<692416..>692985)
                     /locus_tag="LMJF_32_1780"
                     /db_xref="GeneID:5656293"
     mRNA            complement(<692416..>692985)
                     /locus_tag="LMJF_32_1780"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685444.1"
                     /db_xref="GeneID:5656293"
     CDS             complement(692416..692985)
                     /locus_tag="LMJF_32_1780"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685496.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656293"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5A2"
                     /translation="MLAQSNSGAAMRNLVEEAEAGYEQLGKERRDVAVLKLPPSDFDF
                     LTSQEISVIPVHVIEARREEQRRHGTVNRDTSLFDFIKAIGLEEADTEDPVNGYSVLH
                     IKESTRAYFGEQEEEVYRVFRNNMIRCTEDSDWLKHMSFLSGQTADECKRQRILDRGA
                     QAASDAELMMPVTNYKQAFFAKKSKKANE"
     gene            complement(<693736..>695700)
                     /locus_tag="LMJF_32_1790"
                     /db_xref="GeneID:5656294"
     mRNA            complement(<693736..>695700)
                     /locus_tag="LMJF_32_1790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685445.1"
                     /db_xref="GeneID:5656294"
     CDS             complement(693736..695700)
                     /locus_tag="LMJF_32_1790"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685497.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656294"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5A1"
                     /translation="MGTIEGHNNYITVENLLYFSGLRFLAVRVPSPFAMAEPSTPAPP
                     TETHCGLLVFALRDVLSQLPLPAPFDASAVSAKWRCVLAPTAEAGAGESPESLLLSEE
                     ELMPYLEAGVPVRASRMRAAAAHTACGPDSLSWLTDPRWTAFPKPQIALRRGWGAPGV
                     DMHVSSFHKLISSFDEVFNHTRGVEVPLSRQELEAVGAATALVPRDVLEAEEVLDLQL
                     FHRSDGCPPIPILGERLLWPSFITDGAVCDQATWVSQRGMVRHWHLNDCGEFAMQAAL
                     PLPVDHSDDGDAKVSLSDPKLRSPPSASPSSGGGSTTAMRIRSLLYPESTAAEAAVSP
                     AVRSAHVPAMLVIFAPKGGYDWVLHDDEANMCGKTVALDLFQTPDEALPCDAALLPLL
                     TVAVLESGGAPLIVPPNLAQTSIALRDCVVVEQYRISNLWLDDVSYFLHRCARWQASP
                     IIYAYLQQDLQDDSFVGGQLVPYLIRVFEEHAEATSYHAAIRRRVVLSLHALAINQGH
                     YGLPDSSRASLDRLLHGGNPEMHAVLQSAPYCASSSAEAPATMEEWLAVYWGMSWCWP
                     KAGCVLRVPSIVHPLSARLTPLQQKAQYLPVVYPPMTCSPVYGSEKDSVEATVQQYFE
                     MKELESKPKELTAYLRTRKMAKDDLLDDLF"
     gene            complement(<696784..>697515)
                     /locus_tag="LMJF_32_1800"
                     /db_xref="GeneID:5656295"
     mRNA            complement(<696784..>697515)
                     /locus_tag="LMJF_32_1800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685446.2"
                     /db_xref="GeneID:5656295"
     CDS             complement(696784..697515)
                     /locus_tag="LMJF_32_1800"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685498.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656295"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5A0"
                     /translation="MRGNLYSRGFDPMKSRSERRKEKQAKLSKTKRVIRLKRRLGRIA
                     ARKFAGQEDSHMTALMESYILRRKAERAAEKAKEAPKDAAGAPGEDGLAGEGSGAEES
                     EMDEDEGSDCSLDSRADSAFEVDDANDGEEEQEDIASSRRRAVQRRQAGYARGCGGAC
                     RGTAPRRGGASWAANTDTTPPGGKHGRGGGAGRGGQGIRGGHSAQRSGRGSARGGGSS
                     HNRQNTSRNASFHQRFRKVPTRSLY"
     gene            complement(<698322..>698783)
                     /locus_tag="LMJF_32_1802"
                     /db_xref="GeneID:5656296"
     mRNA            complement(<698322..>698783)
                     /locus_tag="LMJF_32_1802"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685447.1"
                     /db_xref="GeneID:5656296"
     CDS             complement(698322..698783)
                     /locus_tag="LMJF_32_1802"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685499.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1802"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1802"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656296"
                     /db_xref="UniProtKB/TrEMBL:Q4Q599"
                     /translation="MSTARRSRGRNGKLATCETYSRADEALWDDAYLLKLFNEQLDNA
                     SAVKDAREETQGDDESVLSTETERSDGETERVAASATSSSTAVSGGEVRVQRRSMSAK
                     SEVISRSFPLLNGLPEDIQALVQSFYNAGFEAGRFVGRSSASKKCCRKRHR"
     gene            complement(<703347..>705314)
                     /locus_tag="LMJF_32_1810"
                     /db_xref="GeneID:5656297"
     mRNA            complement(<703347..>705314)
                     /locus_tag="LMJF_32_1810"
                     /product="putative protein kinase"
                     /transcript_id="XM_001685448.1"
                     /db_xref="GeneID:5656297"
     CDS             complement(703347..705314)
                     /locus_tag="LMJF_32_1810"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001685500.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656297"
                     /db_xref="GOA:Q4Q598"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001245"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:Q4Q598"
                     /translation="MGGGLSKSQLNVHYQGATEAESTYIVTKTDPDGNGVSAASATKP
                     LSVVDAQCAGKATEPSRDGVAVSAAAAAAAPRKEEARGLGTAPARAGSAFDGVGDNHG
                     TNSATSAVDDNGSPIPIRSGGGHVGYICLSDIIGDKDSRSKYIKISSIGRGAYGEAYM
                     VKRNPDYDAAARPMVEAQIQSNALANPTQPNGLYVAKVMDLRAMMSQDRQYAQTEIMC
                     LAHTHHFAIIRYYEHYVLDSDDETVVIVTELADHGDLRRNLYSGSVVRPFLEAGSQAT
                     TGGNAGTTNSGMLLTEREAGTYFVQLLLALHHISARRMIHRDIKSANVLLTSRGFLKL
                     GDFGFSQKYESTVSSETIAGTFLGTPYYLSPEMWKGKRYGKKADVWAAGVVLYEMLMG
                     GRRPFEAAGLPELRMCVLQEEFTPPTGPPTSGTADVNSQEGGQAKFSNDMRELLVAIF
                     QKAPEKRPSAEELLHKPVMQHYLYVFEKYVHSLISYDAAALAANPAMDRQGLYFTDPA
                     DQAMVLQGIAEGKAAIQKVAKRTIAESASTCFEGVVYKNNHNGVWKERYLLLDGTTLT
                     ISLSKGKEAVGGGERSKRVLLSSIKSVSPCEVEDVHVRVVNAESPSDGYKPPYAFAIA
                     MLSSNSIIFGVASAEELDHWMQALMRALQID"
     gene            complement(<711758..>712345)
                     /gene="SODB1"
                     /locus_tag="LMJF_32_1820"
                     /db_xref="GeneID:5656298"
     mRNA            complement(<711758..>712345)
                     /gene="SODB1"
                     /locus_tag="LMJF_32_1820"
                     /product="putative iron superoxide dismutase"
                     /transcript_id="XM_001685449.1"
                     /db_xref="GeneID:5656298"
     CDS             complement(711758..712345)
                     /gene="SODB1"
                     /locus_tag="LMJF_32_1820"
                     /EC_number="1.15.1.1"
                     /codon_start=1
                     /product="putative iron superoxide dismutase"
                     /protein_id="XP_001685501.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656298"
                     /db_xref="GOA:Q4Q597"
                     /db_xref="InterPro:IPR001189"
                     /db_xref="InterPro:IPR019831"
                     /db_xref="InterPro:IPR019832"
                     /db_xref="InterPro:IPR019833"
                     /db_xref="UniProtKB/TrEMBL:Q4Q597"
                     /translation="MPFAVQPLPYPHDALASKGMSKEQVTFHHEKHHKGYAVKLTAAA
                     ESNSALASKSLVDIIKSEKGPAFNCAAQIYNHDFFWRCLSPCGGGEPSGNLASAIIDS
                     FGSFSNFKEEFTAAANGHFGSGWAWLVKDKSSGKLKVFQTHDAGCPLTEPDLVPILTC
                     DVWEHAYYIDYKNDRASYVSAFWNMVDWNFASSQL"
     gene            complement(<714298..>714924)
                     /gene="SODB2"
                     /locus_tag="LMJF_32_1830"
                     /db_xref="GeneID:5656299"
     mRNA            complement(<714298..>714924)
                     /gene="SODB2"
                     /locus_tag="LMJF_32_1830"
                     /product="putative iron superoxide dismutase"
                     /transcript_id="XM_001685450.1"
                     /db_xref="GeneID:5656299"
     CDS             complement(714298..714924)
                     /gene="SODB2"
                     /locus_tag="LMJF_32_1830"
                     /EC_number="1.15.1.1"
                     /codon_start=1
                     /product="putative iron superoxide dismutase"
                     /protein_id="XP_001685502.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656299"
                     /db_xref="GOA:Q4Q596"
                     /db_xref="InterPro:IPR001189"
                     /db_xref="InterPro:IPR019831"
                     /db_xref="InterPro:IPR019832"
                     /db_xref="InterPro:IPR019833"
                     /db_xref="UniProtKB/TrEMBL:Q4Q596"
                     /translation="MPFAAQPLPYPHDALASKGMSKEQVTFHHEKHHKGYAVKLTAAA
                     ESNSALASKSLVDIIKSEKGPAFNCAAQIYNHDFFWRCLSPRGGSKPHGEIASAIIDS
                     FGSFSNFKKEFTAAANGHFGSGWAWLVKDKSSGKLKVFQTHDAGCPLTEPDLVPILAC
                     DVWEHAYYIDYRNDRASYVSAFWNMVNWSHANHCYRAAGGAHYVNSDL"
     gene            complement(<717341..>718015)
                     /locus_tag="LMJF_32_1840"
                     /db_xref="GeneID:5656300"
     mRNA            complement(<717341..>718015)
                     /locus_tag="LMJF_32_1840"
                     /product="putative rab11B GTPase"
                     /transcript_id="XM_001685451.1"
                     /db_xref="GeneID:5656300"
     CDS             complement(717341..718015)
                     /locus_tag="LMJF_32_1840"
                     /codon_start=1
                     /product="putative rab11B GTPase"
                     /protein_id="XP_001685503.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656300"
                     /db_xref="GOA:Q4Q595"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q595"
                     /translation="MQTAHAHTMTAQMKVLKPKTVFDNRPDEARKPIKLILLGDSAVG
                     KSKLVERFLMQRYIPVQMSTYALTLYRYDFVTEDGEEVDVDIWDTAGQERFATVHPSY
                     YHDAHACILVFDSTRKATYKNLEKWLSEMRVYREHIPCLVACNKIDTDPSVTTKSFAF
                     AEKHNFPLYYVSAADGSNVVQLFESAISTAAAYKKNPAKDDFMTQVIGILKEDKTAAG
                     ASAVSS"
     gene            complement(<719119..>720903)
                     /locus_tag="LMJF_32_1850"
                     /db_xref="GeneID:5656301"
     mRNA            complement(<719119..>720903)
                     /locus_tag="LMJF_32_1850"
                     /product="putative chaperonin HSP60, mitochondrial
                     precursor"
                     /transcript_id="XM_001685452.1"
                     /db_xref="GeneID:5656301"
     CDS             complement(719119..720903)
                     /locus_tag="LMJF_32_1850"
                     /codon_start=1
                     /product="putative chaperonin HSP60, mitochondrial
                     precursor"
                     /protein_id="XP_001685504.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656301"
                     /db_xref="GOA:Q4Q594"
                     /db_xref="InterPro:IPR001844"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:Q4Q594"
                     /translation="MLSRTVPRCVKYGSTPKDIRYGMEARNALLAGVENLVKAVGVTL
                     GPKGRNVILEMPYACPKITKDGVTVAKSIEFEDSFENLGANLVRQVAGLTNDNAGDGT
                     TTATVLSGAIFKEGFRSVASGTNPMDLKRGIDLACREVLISLAEQSRPVTSKSEITQV
                     AMISANMDQEIGSLIGDAMQQVGKDGVITTQEGRSLNTELELVEGMSFERGYTSPYFV
                     TNTKAQRCELENALVYVANRKLTSVAHILPALNYAIQQKRPLLVIAEDVEGEAMHTFL
                     YNKIQGRISGCAVKAPGFGDMRINQLQDIAVFTGSQMISEDLGLSLDQNDFSERFLGT
                     CRKVTVSRDECILMEGGGSAIAVEERVQMIKDMISAEDHEYNRERLVERLAKLSGGVA
                     VIKVGGASEVEINEKKDRIIDALNATRAAVSEGILAGGGTGLLMASLRLESISKDRRL
                     PPDIRTGVNIVKKAIGLPARYIANNAGVEGSVVAGKVLARKDPSFGYNAQTGEYVNMF
                     EAGIIDPMKVVKSAVVNACSVAGMMITTEAAVVEKDLLGREKRIEDEGMEDKEKKRSV
                     DKLRKQVNERDAPMPKMAPPMKFDMKGL"
     gene            complement(<721679..>722923)
                     /locus_tag="LMJF_32_1860"
                     /db_xref="GeneID:5656302"
     mRNA            complement(<721679..>722923)
                     /locus_tag="LMJF_32_1860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685453.1"
                     /db_xref="GeneID:5656302"
     CDS             complement(721679..722923)
                     /locus_tag="LMJF_32_1860"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685505.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656302"
                     /db_xref="UniProtKB/TrEMBL:Q4Q593"
                     /translation="MSESCSGDYYHFVTQRSQAAEITLPIPSFCKPLAASVQPFGEGK
                     AGLLASFFDPEQHAWVVRQLPVQESWSHQPPPSLTVRVATLVDPANLYELRVSLSSVL
                     DGVDNDDLCALQRRSQIYGLVVEEHLADKSGAALRSAGAEGRLPQLREAVTLAAPVDV
                     MNGFVLTGGGFLSDFPVLRDGPALPRSMNTVYDDILAGEDFCGPPMPAGGARFAGTDS
                     AAHTSGGRGSDSPVNSNEPREYTAWSVTAAANAGLACISMGLRRRSPIEWPQLQSESQ
                     HTHSASPRERTGPGTSLAISPGPLRAKPPPSVVSDTGALAVYQCTGVPVSGLRPNEHG
                     DGGNGAHGVVSAYSSAAVSTMAARPLLETLTLRGEVDVKLSRRDGEEWGISLPPPHGS
                     LKFSMGPNRELVAAARRYFYCE"
     gene            complement(<724928..>726805)
                     /locus_tag="LMJF_32_1870"
                     /db_xref="GeneID:5656303"
     mRNA            complement(<724928..>726805)
                     /locus_tag="LMJF_32_1870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685454.1"
                     /db_xref="GeneID:5656303"
     CDS             complement(724928..726805)
                     /locus_tag="LMJF_32_1870"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685506.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656303"
                     /db_xref="GOA:Q4Q592"
                     /db_xref="InterPro:IPR002524"
                     /db_xref="InterPro:IPR027469"
                     /db_xref="UniProtKB/TrEMBL:Q4Q592"
                     /translation="MLQELCTLLFTPSRDKGVRRWQQAAIAFSGLWGISIFFTISTSF
                     LIASMQALVLLNTAASLTAAIVAQSLCSRAGTQQNYPFGFGLYRLSVVVRLGSTVFLV
                     FGCVATMLESLHRGTHGHHSNPFFLLALGGMQLLSQLVFLRDVCLTDRVTGHRGMAGA
                     HSEDLLHLLCVSACRDRRGMGGGGFFEEFHSPSSAWAQSQPPGESPVAHGPSCGAQRT
                     MRRSGTQNAVYLLCPITCVVASLLMVVTDSSLPDVAGALWLAVYYAYVGYRNGRDMLD
                     LLMNKCVTNPRRLRNLERCLRNIKMLDGVLQVQSTVWWNVNVSESMLLIRLRLISGSD
                     ACSVSQAARKQLAELATYVYVECFPANGVNDLGHSTQLSWGASLMGTHGHTNGVHGHS
                     HRGVQGHEHGHTHGNGHDDDNGHHNHGCDHSHSHLFAGKGEVSLAARRCSNEFGNING
                     DPRTDSVGADLPYGEQGFPAAVPSTAYAGGTPTALAFPTPPAATSGGFDSSAKRHSPA
                     SGAPPIGRPSSGQALSMAYDAANSSATLAMPSPFTGFPHGTSRSCGRGCTNAGSRFAQ
                     HAPGDTAAEAADSLRNPAAPSSRLPAIPPPVFTPFRDGGVRIGSDVRRGAPHSGTYDH
                     V"
     gene            complement(<729089..>729565)
                     /locus_tag="LMJF_32_1875"
                     /db_xref="GeneID:5656304"
     mRNA            complement(<729089..>729565)
                     /locus_tag="LMJF_32_1875"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685455.1"
                     /db_xref="GeneID:5656304"
     CDS             complement(729089..729565)
                     /locus_tag="LMJF_32_1875"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685507.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1875"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1875"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656304"
                     /db_xref="GOA:Q4Q591"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:Q4Q591"
                     /translation="MNAEELQASQRLSDGSGEATFSQTHEYESIARKGSSGTAAAVDV
                     VHASDSGHPRIANSKSGGAGASVKVRSLAAGQVNRVVHGALPEGMSVSRDARVALQKS
                     ATISVLYLACLGDASRKATGSTRTTLNVQDIRGAMEAAGMAHLLPLMSTAAKRRRD"
     gene            complement(<732998..>735259)
                     /locus_tag="LMJF_32_1880"
                     /db_xref="GeneID:5656305"
     mRNA            complement(<732998..>735259)
                     /locus_tag="LMJF_32_1880"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685456.1"
                     /db_xref="GeneID:5656305"
     CDS             complement(732998..735259)
                     /locus_tag="LMJF_32_1880"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685508.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656305"
                     /db_xref="GOA:Q4Q590"
                     /db_xref="InterPro:IPR002562"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:Q4Q590"
                     /translation="MMPPAIEVGKSASSVEGVGAKDMDEVNTHTSVSLCSSSSSTDAY
                     GQTTTAAVVLTLRARAPSPIVKRGSGSISSGSNECVSCDLRMPTPPTPCEFLEDLSLA
                     STAAVGALGVGVKVVSDSAALALTPISPLRTTSAKRRLTPPHPIDFSETTSAVAATAA
                     AGGPVDALAPALEFAPSLRLSSSRPADASAPSAVAATPPAFSVASSGNSSRPPLPPAG
                     LHSEAGPLHPEKSTIIDNAAISSLFSTPQQTYTSPCDYVPAEHRPSLATSSLRYCECC
                     SAVKSGLLLQPHIGNSPASLRSAQHPPSTSHPQYAEVGSQARGNAFDAHWQAASSPPR
                     CHGHISSSTCSPAGMGTLSGWKVSGLVSGGYSYGTCVEDRSIDGVAGANGTSAVASSG
                     AEQSGLSAGMADGCGSKLHSVACNSRSPLTPPRGLYPLAPSVFSAAHASAPQQVIAPP
                     PHLDLMGMGGGGYEYSTGKSLGYNTGPEYGDGRGIRFRGCVPQNVACIEHLNHLDHVC
                     REILLESEMRRVRREQRRRERVYSVDDKNAEEARYSDTLTIALDLEGRSLGRMGSICI
                     ITLATYSTVYIIDVVMLGAEALYAGSPLKRVLESRDIMKLMFDCRADCDALFFLYGVR
                     LQNVCDLQISSCFALFPTSPHLPGMKSVFLVLGLFTDEDAGIKNAGRHLFNPRCGGSF
                     DWWEERPLTDVLVQYCAVDVKYFFAAQLILQDHVEQGCRLGEARLASVCNGNFRGSSR
                     SNSFRDFDVRSEL"
     gene            complement(<738178..>741846)
                     /locus_tag="LMJF_32_1890"
                     /db_xref="GeneID:5656306"
     mRNA            complement(<738178..>741846)
                     /locus_tag="LMJF_32_1890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685457.1"
                     /db_xref="GeneID:5656306"
     CDS             complement(738178..741846)
                     /locus_tag="LMJF_32_1890"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685509.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656306"
                     /db_xref="UniProtKB/TrEMBL:Q4Q589"
                     /translation="MDRLASAVLTLAPSRFTDLAHDLVRVHISVKSLSGSVRPQTPSS
                     HGAAEVLTALLSDSRLGHYMKDPSLAPARFSTEETLPGATLVTLHALAIMASAFEASL
                     LAFRRIAAALAQESKTAPPGQTERSVCGQKEGDQETPQAASAWRCESVGEYSCLLTKL
                     LRMFAEELAVVSQPSFPVSHASGARLDLLFLAVLSLMKSADECAHIAGKPSPGDGAAT
                     ASVGGFRAECVSDQLQHLCLQVSILCSRWSSTAARTLATPGLQLEHFCSTSSLSLVAR
                     QAKKLQMRMRVRSPASWLEGYLPALQSMVLVYYVSILRRMIAMESAAVNAACRDAPPS
                     VNAEGVGAQLEGDATASLYLTGDERVQLAKDVEMLWGEIKPKRVLSSAEVSHLQHRTV
                     HTALNVSLATWWKAAAGIAASASSSTPYWNQTPQHITALLCSYNSLLTECRSALSVFV
                     ARSASETTALPSASATVSSMSPDLSWFVPFHSRLLRVGLDLQLEATLFAALHLGIEPR
                     APPTPATPIAKWIESRHIQRLRRRGASGGATTKLKSSETATADASWARVYRLCGGLRV
                     AATELLYCAITDVCSQVAEKPQSRADNGSLSPPNGPSWSQRGSLSPATSANTRDSGSA
                     SPLAAALVNAVSRTFFAVPRMQYLFAHYTDATYTGRASEEECRRVYAACLGVLLWLRE
                     LAPPFGVRFGESQVAPSVPHSSDLLHGAAPPRKSCREEWQVCGTTSAIAMDGAFFLAY
                     YLYHWPGETGRHAAVSSDRGTEAERTALDVALASDGVVSGMSCPSVAHLLTGATAVEY
                     TKEMLFQLQHDTARQLQHLRATNRLHHFSGELQDKTKLLEDSNLRQRHVTSTLSVVQA
                     HRKQPTLLWMPLTQVQEMVFLFDQYPQLFRCIDSAPRCGTRGDAEENRGGEVAPSDGI
                     REYPKVHVGDITCTFSRVHGYLVKRLHVLSGILREYRSILLESAPHDAIDSHAISNDS
                     SASVTTPTKSSFRGWLLDNARCSPQLAVHRRNNYEWAHVWAMQLHEELPRLPAQMEGA
                     PRWASGVVRTLDRMERTMIDTHQKGLFINVVKSQRQYRELQRARSGAPSPTSAKAAIP
                     ADATEEKCVVEPQLHDLVVRRDSERIPLGLVLDGAARILRVQMKVARPAVVADGSDEA
                     EGDLLESPFACALAQQQQEGQHPLGLSNRAGAFVDVVGWRVLRVDGNAVRTGRDVAAQ
                     VRDKIEFTVTLQPCSRSE"
     gene            complement(<743538..>745355)
                     /locus_tag="LMJF_32_1900"
                     /db_xref="GeneID:5656307"
     mRNA            complement(<743538..>745355)
                     /locus_tag="LMJF_32_1900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685458.1"
                     /db_xref="GeneID:5656307"
     CDS             complement(743538..745355)
                     /locus_tag="LMJF_32_1900"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685510.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656307"
                     /db_xref="UniProtKB/TrEMBL:Q4Q588"
                     /translation="MHDYQYNLEVVSVVPAEVLTDTRDERRHKLILHCTRRDAIIDCT
                     TAPSTFEVRNAPSFELVSISLVAVDCAGGSEHVEASSSDPLLVGGPHRTVGAVWVPLR
                     SVSAVDSASEASAPVSRVFVAWSVTRMDGDSVRKGDLELSPGKTPVLTPDPTVSPLIA
                     SPFALSATEDSLPPNHFSSTHQGVASELESAEADTPKAATAATVTTATTTDTFPVTSD
                     AGAGSSLSCAVVGLCVPPLHGVICSEEVLWPLNAFEAGSARGSRLTESTNGPFADKGS
                     VLSLLLSRLVVGSSVTNPEISAGGQAARVSVVLDEGQETGQQRIENDRCGASRAPSTH
                     AGGVAAPGQDPLHRASAVDVERHGGAPSTSALCEPAEQQVCGCQDIVLEQFPFCSVSL
                     TSKGTIATSSPHSPACTPASESSANAAHAENGAEHTGASAGHVGSLQLDPALAAADAR
                     TTTWVDYYASSTQAIGVVPLQTRLQNLYTVPSPQLLDRLKDQLGPPSLSAASPTAEPA
                     PVTYHGLWYGRDRQINFSRCLGSSGSAQEEIRREQEVKRSGAALLAGMQIDGGDSSVS
                     PSASPMARVKGHYVEVRTESALALLRRQALGGLQRRRIM"
     gene            complement(<747045..>748397)
                     /locus_tag="LMJF_32_1910"
                     /db_xref="GeneID:5656308"
     mRNA            complement(<747045..>748397)
                     /locus_tag="LMJF_32_1910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685459.1"
                     /db_xref="GeneID:5656308"
     CDS             complement(747045..748397)
                     /locus_tag="LMJF_32_1910"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685511.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656308"
                     /db_xref="UniProtKB/TrEMBL:Q4Q587"
                     /translation="MALISQSFAERYAELVARVPTHTELLLDVQRREVGERKALEEMC
                     QVAFQDVLHVAGVMIADKKALGRGALAHRNRFEVALYKKQTAVWFQAAPPRKVALPTT
                     RPLHGFPHAAFAELCQEERELRQWHYGVERRLREHIEEACGRAWFFLNVINETARSES
                     LSRQRLQHEEDEDFTAIKQSFFRAVPADYYRNVVIARYGQTISAIEQAKDLTFEELEE
                     KVRAALMEEEEASWRSAYQYLQDMYDAQLFALNHREVLGRYELEEEERNTLFPLILQC
                     CREDFGIVFYHIPALALHFNSSQPCLRALCVAQLQEAPRRMAATRSRFSWIPAFDLAG
                     MASELGLEEDGDEIEDSAEGETQEAEGSTDGGDDSHNALPPPVDDMPPINTASTMVFE
                     PEVGSSEVPEPETKREEAEVDTSQSAVVALAQRTHEESVLATEMEEHVPVSCAGEENE
                     "
     gene            complement(<751077..>752483)
                     /locus_tag="LMJF_32_1920"
                     /db_xref="GeneID:5656309"
     mRNA            complement(<751077..>752483)
                     /locus_tag="LMJF_32_1920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685460.1"
                     /db_xref="GeneID:5656309"
     CDS             complement(751077..752483)
                     /locus_tag="LMJF_32_1920"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685512.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656309"
                     /db_xref="InterPro:IPR006968"
                     /db_xref="UniProtKB/TrEMBL:Q4Q586"
                     /translation="MTDYRWCVIPGTDKVCAPSVQRRETVSNRIRLFGMPKGFPDTTA
                     AGFQRFFYLSLTSSFVSNFASSIGYQSLLSGFFLGSSPQLWMLKDLVPALFAAYMANK
                     VVSYESRPKFWFVVSVFVNNLTVISDMLIPSVLPNHLLAAAIITSTVKQSSALMYFVT
                     RASALQHYAINNNLAELTKKFNSFGMVSYTVATALGILYCTYIASFTVQLITVAACCV
                     TNMFLSSMSMMPITFRLLNVDTMKLLLGAFILEERRVMTPQEISTLLGVRMLPTQALK
                     KAGIAMDVATRLVCVSPPVNKLLIRSDTLEEDVLYVNNDHMFMLAMWKPSPLPLTLRE
                     CWQRYEFPPLPRLFRKASWRRRSQEDIDMEKKFNGRRLVLLVHQKCTAKQLIAAYLIM
                     YTAVLQHAGTEEELRRFVRTCHGEQELWYLRGEEFGKMLLAADWDVHLPLLDHHNFRM
                     SELILPPSFRRVAKGCAA"
     gene            complement(<757047..>759392)
                     /locus_tag="LMJF_32_1930"
                     /db_xref="GeneID:5656310"
     mRNA            complement(<757047..>759392)
                     /locus_tag="LMJF_32_1930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685461.1"
                     /db_xref="GeneID:5656310"
     CDS             complement(757047..759392)
                     /locus_tag="LMJF_32_1930"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685513.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656310"
                     /db_xref="UniProtKB/TrEMBL:Q4Q585"
                     /translation="MTTAVEAIDVDDDERYSDDSFQDDFESDSSSTSHRSAHMKEASS
                     HDERAASEDSAVIGEGTPSNATASTSSSGNSPSPDSSHNSSVLHSLGRPPVHLEGAAK
                     GASTAASSDSSLSSLPLPRRSSDSASAHSANYASTSEEARLAEKSTAYDDDSSLLPAD
                     RVYEGQQRLADGRMSESCSRSGRVSIDQRSTGGACARDAGYPVGSQPDYVSTNASVTG
                     RCRLQRPGVPGTAEELVTMQEENASMREELFQRSREHYHASFSQSSKSGGTFNGNRTI
                     GGPGASHKSTLTSTIDNTFRRHRESTARFVQVSLTAHRTLQVLRLEQRELLRRRDQLK
                     ELVSRYKKATKYKDYIEIAKQDIAVLTEDHRDAHLEVRCNEKLLLMNDAMFGSGLGDR
                     RLLEEVRSQNALTQRRREHALRDADSAQRVRDAAAKRVEELKWELKKRHQWMAEENHA
                     DVNRLRLFNQAKKDRIHELRRQLRQLRQEGRETRGGSGSCPRKSHGPPQVCQRHQCYT
                     RPDDAEREYLERRIAEIHRRLEAIAGAPSQVAASRRTSIGDAASPARDTGSAAASPKP
                     EASQNELPAAAQQEGTSAATVVQEPVRACSVDVESAEAGSNNAYGEVDVTAWLNAHSA
                     TVSAHNEATYSQRSSHNAATAGNDCSEETGAPAVPQAEVWHQERTGATATADAEPPLW
                     LDAGEDGGDLDIAPTQADLAPLPSYEHDAADSVEEDIAEDELGSDAEQAAPAAAASAH
                     GDVELDDLLFGAGGHAPAYAAASPSAPAADNNDDGPDWLNF"
     gene            complement(<760805..>761776)
                     /locus_tag="LMJF_32_1940"
                     /db_xref="GeneID:5656311"
     mRNA            complement(<760805..>761776)
                     /locus_tag="LMJF_32_1940"
                     /product="putative heat shock protein-like protein"
                     /transcript_id="XM_001685462.1"
                     /db_xref="GeneID:5656311"
     CDS             complement(760805..761776)
                     /locus_tag="LMJF_32_1940"
                     /codon_start=1
                     /product="putative heat shock protein-like protein"
                     /protein_id="XP_001685514.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656311"
                     /db_xref="GOA:Q4Q584"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="UniProtKB/TrEMBL:Q4Q584"
                     /translation="MIDYYQFLGLNRESGDDDVAKAYRRYALAYNPQCHPDSTDPETL
                     QRNFMMAAQAYTVLSDPKKRAIYDIYGEEGVRHGGTGQQGVPGGIDLDFIDPNAVFTR
                     FFGVDNPFQVIGNVDAVKNNQHNFFSVIAGMPPNPPKCPAIEVKLPVTLEDVFYGAVR
                     RATWNATHTGVPTLDAAVTTTEESYEVRVEKGARTGDHFTVEGRGNTYPGYARGDVVV
                     VVDVMPHTRFRREGDDLVTKADISLRDALCGTTVTVSTMEDRELSILIDKIVDPAYRT
                     RITGEGLPSRGVGDATRGDLIIEFTTKFPSFLTAEQKTEIGRILDAN"
     gene            complement(<764959..>766233)
                     /locus_tag="LMJF_32_1950"
                     /db_xref="GeneID:5656312"
     mRNA            complement(<764959..>766233)
                     /locus_tag="LMJF_32_1950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685463.1"
                     /db_xref="GeneID:5656312"
     CDS             complement(764959..766233)
                     /locus_tag="LMJF_32_1950"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685515.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656312"
                     /db_xref="UniProtKB/TrEMBL:Q4Q583"
                     /translation="MQQHHPQGCIVPVESQADVSECAHLNKGEVKQELGYATRRHEPQ
                     SLYGEVNDVSSSECSEADAAGQPQPAYAGCGGDAEESHDLERKGGDAPYVDPDRLSML
                     WTMDEETVLMHSSQVSLQRIRTRLEMLLLGVSEAICLRKACDALQHRASSRPVMDYQE
                     KVLAADHALRRIIGEAFVSFAERDAVQMVHLCSLADKGVTDCDELVRNAVVVLQALLH
                     DGEAVQGLEPFRQFVSTHRAEIRSQQWQHDFITALRSLAVGFLRHPEAVMAAYGHSVN
                     QIVQREAFYVALLRFCGGRPVGYTSAPANAADKAKLAVAKTQSPHAVATSRLRASRVS
                     TPLQRKRETKSIHATKHEGGAARMQRPSVSHQGSVMPPDLPQCVSLCASSTPSRRRNF
                     TSKCRPNSTTLSRSSVGADQKASTLAPRRNDR"
     gene            complement(<768805..>769719)
                     /locus_tag="LMJF_32_1960"
                     /db_xref="GeneID:5656313"
     mRNA            complement(<768805..>769719)
                     /locus_tag="LMJF_32_1960"
                     /product="putative
                     1-acyl-sn-glycerol-3-phosphateacyltransferase"
                     /transcript_id="XM_001685464.1"
                     /db_xref="GeneID:5656313"
     CDS             complement(768805..769719)
                     /locus_tag="LMJF_32_1960"
                     /EC_number="2.3.1.51"
                     /codon_start=1
                     /product="putative
                     1-acyl-sn-glycerol-3-phosphateacyltransferase"
                     /protein_id="XP_001685516.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656313"
                     /db_xref="GOA:Q4Q582"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="UniProtKB/TrEMBL:Q4Q582"
                     /translation="MAERRHTNQLLRLLCTLYLILSLVLQWVIIWVSQVTFIVASFPF
                     TTSEFRQDICGHILRTVSFVGMDLLNPFWSIHVLNKFPEVKNKKVIVMLNHLSGADPF
                     VTIRSLLPRDGTWIAKGGLFRVPFGGWALYNAGDLPVHFRDKRKSFATVKGTVGPMME
                     NARRCLRRGRMLCVFPEGIRSMNPDGPLNPFRLGFFSLAVDEGATIVPLAVSGTEKLW
                     PRGSALMDAADAYFSFGDPIDARNFKSAEELSQHVWNVITELREKHPDRIELHARQAQ
                     PQAEPLSAPVSLDGKAPWVHVNEPTDRQ"
     gene            complement(<771294..>772658)
                     /locus_tag="LMJF_32_1965"
                     /db_xref="GeneID:5656314"
     mRNA            complement(<771294..>772658)
                     /locus_tag="LMJF_32_1965"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685465.1"
                     /db_xref="GeneID:5656314"
     CDS             complement(771294..772658)
                     /locus_tag="LMJF_32_1965"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685517.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1965"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1965"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656314"
                     /db_xref="UniProtKB/TrEMBL:Q4Q581"
                     /translation="MECQRNPDTQGDTNSTPACYESSRLLRDQLNTDTCPASNLASCL
                     RRESTMAGTRSYTQRENASVIATPSSFTKDSVSLFPALSWRTKVTGTAAAHHNDHDST
                     RMSPVLDYPLLSEAFRSGAPGVPPMLPLEEECKNAVTQAAVLPQPSSTPILPPPIETS
                     HPTLQKVCVVSSPANTWQGVAVKDMLSFSSSSLMSAAPSQLNPLHGAGLIRCHSAPAL
                     HKVANRTKVLVHRSLPEEEVSRPRSAVVQIAAIAVTSPRAHHGDESFSAQPPHGATIT
                     SRSGPRASCLRASTSVSGPVLEEVAAVALTGVGSREFSFRSPSSSIVTFIDHELDIST
                     TDSGVLHAGDGLHDASEAESLLESEGGRRCSGTKLYLLTDTRSSLVSGAHVRPFMSRS
                     TVRHRRLPAAVTSVPQPAHLTSEYAAAVQAAAKHGRSLRQILARCGDADDALRDSGEA
                     QSEL"
     gene            complement(<776842..>777735)
                     /locus_tag="LMJF_32_1970"
                     /db_xref="GeneID:5656315"
     mRNA            complement(<776842..>777735)
                     /locus_tag="LMJF_32_1970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685466.1"
                     /db_xref="GeneID:5656315"
     CDS             complement(776842..777735)
                     /locus_tag="LMJF_32_1970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685518.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656315"
                     /db_xref="GOA:Q4Q580"
                     /db_xref="InterPro:IPR007177"
                     /db_xref="InterPro:IPR007209"
                     /db_xref="InterPro:IPR022968"
                     /db_xref="UniProtKB/TrEMBL:Q4Q580"
                     /translation="MGKGDARTRSGRGRGRGRGGGSGGVCSTSGFHNNEPPAHPCSVP
                     LAMWDFEQCDPNACSGKKLYRLNALRLLRLSEPFHGVVLTPSATEIVSPADRGIVLQN
                     GAAVVDCSWKELDAVPWRKMRMSAPRLLPLLLAANPVNYGRPSKLNCAEALAATLAIV
                     GLTDDARSIMAYFSWGASFFDVNRELLAGYQKCTNSAEIAAFQDKYVEAELQESEARR
                     GLDLDSIDLSDARPLNERRGRLKNRREWQQPSCSEDEEENDKAGEDDNSDEGADARVS
                     EEDEDRRESECAAADSTEETA"
     gene            complement(<778520..>778972)
                     /locus_tag="LMJF_32_1975"
                     /db_xref="GeneID:5656316"
     mRNA            complement(<778520..>778972)
                     /locus_tag="LMJF_32_1975"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685467.1"
                     /db_xref="GeneID:5656316"
     CDS             complement(778520..778972)
                     /locus_tag="LMJF_32_1975"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685519.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1975"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1975"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656316"
                     /db_xref="UniProtKB/TrEMBL:Q4Q579"
                     /translation="MPKKHRVKRQNYVAHLRNLEKERETYLQKRRTHKRSRETGNEEV
                     VGEARDRMESGAPKKRRTEAGPSTAASARNEEGAAPHTHLTPTTAATATSAAAAETVS
                     AKRYSFSTKSFAELVKASAATAPTTDAAPRDTSAIITTAKKTLKRRTY"
     gene            complement(<780235..>782469)
                     /locus_tag="LMJF_32_1980"
                     /db_xref="GeneID:5656317"
     mRNA            complement(<780235..>782469)
                     /locus_tag="LMJF_32_1980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685468.1"
                     /db_xref="GeneID:5656317"
     CDS             complement(780235..782469)
                     /locus_tag="LMJF_32_1980"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685520.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656317"
                     /db_xref="InterPro:IPR025252"
                     /db_xref="UniProtKB/TrEMBL:Q4Q578"
                     /translation="MDLHAQANPFNDPPDGGVYAESSHISKELLREVRRADAAMADDL
                     VVLAPRYGRVFRPGASKTSAADGVGASGAISRATASSAACGGSAGYAVDVHDTLMTSE
                     FVQQKREVGLVRMSLTTKKAEIRKLEEKIHRAEKRLHQQQEQLSNTREKFNSFLKFSN
                     LEQDAAVRRADDETRSKHAKTIEIKKLSALISHAEAEMRKTRVQIENCVAYKDFLEIL
                     AKPQWFYDTLSNLRIEDATEKILLDAEEAYQARSASLTAQEAARLEAAQQAALAKERD
                     EASSGKRKRPCISTAAQRKGRYQANATPVVEAEEPKVVPLEEQLEHLYASVEEEARAA
                     IAAATASIRAEVGAMTLVDVKDDLHHNYEEKRLPLCFTSVDDLLEVFINVEEGNLFLI
                     QNCHELEEELEGVEMGYMQEREEMSAMVDQRTAQLEALTSSVAEAQKKLQALDERMMA
                     LEPHGNVQATAPAGATATTSKRARAGASSVGGAWDAAGVASATKMPPEELKKKVEESI
                     EHIFHLLRTGDQQLKLTAQNPNLRKSVDGAKVAGNASHGRSRAASLHRGPKALQSSTM
                     QTGKMKAATGGSSYDSQRPSSGAHRSGKSTVGATTAAGAADAASQQQHHDASMGPVEM
                     LTIIENKLEEYHRYLSDPANHVELALMKAVMKQSDKQRRRQARIIHLANQEDEQEERI
                     RRALERSQAPIIHKIGKPFRPRSFVSKPIDEKSRRKAERAAAALNGSLDNIDSDEDGA
                     EFFM"
     gene            complement(<784195..>784530)
                     /locus_tag="LMJF_32_1990"
                     /db_xref="GeneID:5656318"
     mRNA            complement(<784195..>784530)
                     /locus_tag="LMJF_32_1990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685469.1"
                     /db_xref="GeneID:5656318"
     CDS             complement(784195..784530)
                     /locus_tag="LMJF_32_1990"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685521.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.1990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.1990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656318"
                     /db_xref="UniProtKB/TrEMBL:Q4Q577"
                     /translation="MADQAPPGVNMPKKRDPRLRQMQAPQQQKFFDSADYEVRKQQQQ
                     QQPSHPSQQQQQQPSHGQMALNGIPRRGPADGLHPCTADGGAPRGKNPPPPPLPDGYA
                     VPSVRRAPC"
     gene            complement(<785828..>786937)
                     /locus_tag="LMJF_32_2000"
                     /db_xref="GeneID:5656319"
     mRNA            complement(<785828..>786937)
                     /locus_tag="LMJF_32_2000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685470.1"
                     /db_xref="GeneID:5656319"
     CDS             complement(785828..786937)
                     /locus_tag="LMJF_32_2000"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685522.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656319"
                     /db_xref="InterPro:IPR021852"
                     /db_xref="UniProtKB/TrEMBL:Q4Q576"
                     /translation="MRIHSTFLLAPPQRHQRCCLLASVALLASLLLALPAVLAVTPPQ
                     GKPIRPLHGAGYEHLDCSACITVARTLFERLNQTLAENPSTYLISHRLGKKNQLRRRQ
                     YRNSELLVTEVMENVCTSYKNDARLLRLHPKSKVRLYHQQVFGDTRLGVRHALREDEV
                     YPADADPAAWAEKLDGQLYPIARLYSRRDADALQGLQSLSATPTMCALLVEEFEDEIE
                     SLVKSVRSLEETEHSLCGMTLPVNKPRTVLDGETEGDEVSSVPLITNVCADAEVLRAA
                     ARRDQQRWEQYERREAERKAKLAQRRKLETAAAAATSESADEAPANAEAAAALASSAP
                     GASGEPIDSPAEEAPYSPVGGVLKEAAEDRTDGDL"
     gene            complement(<788076..>788960)
                     /locus_tag="LMJF_32_2010"
                     /db_xref="GeneID:5656320"
     mRNA            complement(<788076..>788960)
                     /locus_tag="LMJF_32_2010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685471.1"
                     /db_xref="GeneID:5656320"
     CDS             complement(788076..788960)
                     /locus_tag="LMJF_32_2010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685523.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656320"
                     /db_xref="UniProtKB/TrEMBL:Q4Q575"
                     /translation="MPRRALLGNWFEEEAYERDRRRLMQGRSGGIVEASAELAHMMAK
                     IRHHNAPHAIAPVAEDGYLHFYVPLMLQNAHTCGFLSVDLDERKATSTGWQVECTTAP
                     AEEATSRCTVVLTPAAMPQTDSFPIPEDEADVVHYGQPFYLMTVRELCDDPLFLMSEF
                     ITPGCASRVTQKLQHTYFSPDGGSAAAMWCAEDANPAYQEDMRDHPVKADDVIRIRHN
                     MTAAPLASLHEVFNDFGAQFEVGCGRLTALATKRRGGPPAPANLWMFIHNGQGLQQES
                     DEGAVCGEADTQEASAGP"
     gene            complement(<790576..>791058)
                     /locus_tag="LMJF_32_2020"
                     /db_xref="GeneID:5656321"
     mRNA            complement(<790576..>791058)
                     /locus_tag="LMJF_32_2020"
                     /product="putative ER--golgi transport protein p24"
                     /transcript_id="XM_001685472.1"
                     /db_xref="GeneID:5656321"
     CDS             complement(790576..791058)
                     /locus_tag="LMJF_32_2020"
                     /codon_start=1
                     /product="putative ER--golgi transport protein p24"
                     /protein_id="XP_001685524.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656321"
                     /db_xref="GOA:Q4Q574"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR015720"
                     /db_xref="UniProtKB/TrEMBL:Q4Q574"
                     /translation="MFLHYMVTMGGSMDIDCKILAPDKSVIWNAERDTENRVLFKSRI
                     PGSYAFCFSNRMSTLTSKVVSFSVIVGNGNAADVMRPKGAESDSLHRSIMRLQQGLRE
                     IEELQQALRTREQNHRATTEVANTRVVVFCILESLFIIGMGVGSVLYLRQMFVTKRMV
                     "
     gene            complement(<794030..>794665)
                     /locus_tag="LMJF_32_2030"
                     /db_xref="GeneID:5656322"
     mRNA            complement(<794030..>794665)
                     /locus_tag="LMJF_32_2030"
                     /product="putative ras-related protein rab-2a"
                     /transcript_id="XM_001685473.1"
                     /db_xref="GeneID:5656322"
     CDS             complement(794030..794665)
                     /locus_tag="LMJF_32_2030"
                     /codon_start=1
                     /product="putative ras-related protein rab-2a"
                     /protein_id="XP_001685525.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656322"
                     /db_xref="GOA:Q4Q573"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q573"
                     /translation="MSQSNYVFKYIIIGDSGVGKSCLLLQFTDKRFEPLHDLTIGVEF
                     GARLISIQGKSVKLQIWDTAGQESFRSITRSYYRGASGALLVYDVTRRDTFTHLQSWL
                     EDAKANANTALVIMLIGNKCDLESKRQVSREEGEAFARCNGLMFMETSAKTSQNVDDA
                     FLQTAALIYDNVQLGMIDASVVSGRPGTQANNSRLQNAHANNNNRSSGCTC"
     gene            complement(<796298..>798841)
                     /locus_tag="LMJF_32_2040"
                     /db_xref="GeneID:5656323"
     mRNA            complement(<796298..>798841)
                     /locus_tag="LMJF_32_2040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685474.1"
                     /db_xref="GeneID:5656323"
     CDS             complement(796298..798841)
                     /locus_tag="LMJF_32_2040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685526.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656323"
                     /db_xref="UniProtKB/TrEMBL:Q4Q572"
                     /translation="MPSPSTASPAPPAYTGAALLAGYTSRRKIVQKAAALSARMRRQV
                     QDVVQMEEEQRLLSQAYRGRQKLLERQPQLLQQAQANPRSVAGFEGAKAAGEKMASKA
                     RVGTAGDTPATPGSPSNPASPVEAAAASPDKNNPTPFPDVDIGLALEGALDIKQHLKQ
                     QVQEKSDTLTKMRGIQQAILELSEEATADVERRLAQRSYSTSVEEADGPSKALAAADF
                     GGLATDDNADRHPASSTEKRKVEMIQELRSTLKEMLDAHRALSVAQYSTVGRSVRRGA
                     AATELPGSTWLEQDAAYRPPAPLQMFSTSAFAVTLEYLSNSLACIAHIADEVCVATTF
                     RSRADPVVLLPHLESLQKWVAQAERCLDTAQRHLRHFQSGEAALLDGGAYEVNSLREQ
                     ALLLRESLTAHEQKVKTVEEAKVSVLHRLREVSRRCYLWEAHLLHRRDSVYGDGASRV
                     SCSLEGIGSGAALGCFSTPNAKVSEPMLMHAGPNVDAGGTMVPNGSLGISFPHTTAPP
                     ACVESRLIAATTEEASSLEATKAITLRPLSTLRNSHRGGKRSFRVRSDAASRPLTTSS
                     LRTPSLSLVSISARAHQPPTPLSLRLIEQRVARSWCNPYVRKKCLCQRAEQVIMQHQP
                     QQRQLQGRSAEQRRSFSRVGASVSEDLGSGCHNLAKEAARAPTSQPASFISFDSVHRC
                     PSLYTITDATAAADGATGRVLLPRLGSHTDASRNSTAAESRRRASRVADSLAASVAGS
                     TAALGESLEDLADARTVQLLQSLLRSIPSKNCASVHDHAKSTEGKRDTGGGSGDVTAN
                     PSLVQSLCIDVTQDEAKCAAMRYSIQRLSRYLATCTTRPESSRQSIFQK"
     gene            complement(<800521..>800796)
                     /locus_tag="LMJF_32_2050"
                     /db_xref="GeneID:5656324"
     mRNA            complement(<800521..>800796)
                     /locus_tag="LMJF_32_2050"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685475.1"
                     /db_xref="GeneID:5656324"
     CDS             complement(800521..800796)
                     /locus_tag="LMJF_32_2050"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685527.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656324"
                     /db_xref="UniProtKB/TrEMBL:Q4Q571"
                     /translation="MRLTAGKIYFWGSVVIVFLTAWNRRSTAQLRTVVDNLKEERMRE
                     AERLRQHQLGGQGGVSGAPMMTSVSSMPKHFNPYHKQQEMENASTDK"
     gene            complement(<801492..>803684)
                     /locus_tag="LMJF_32_2060"
                     /db_xref="GeneID:5656325"
     mRNA            complement(<801492..>803684)
                     /locus_tag="LMJF_32_2060"
                     /product="ABC transporter-like protein"
                     /transcript_id="XM_001685476.1"
                     /db_xref="GeneID:5656325"
     CDS             complement(801492..803684)
                     /locus_tag="LMJF_32_2060"
                     /codon_start=1
                     /product="ABC transporter-like protein"
                     /protein_id="XP_001685528.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656325"
                     /db_xref="GOA:Q4Q570"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q570"
                     /translation="MSSAKHPESGSPPAAVLSSPRTAPEGEAVGTLQLLRFAYSYMTC
                     QQRVILVSGLFMACATLLSISIPALAEEIVSYGMRTITKTIDGVSHTAESSSATSLEA
                     ATAAPGLGVPADGAGAGADRLFFLGLGPLSERIFKPLLPMLFAFLRGAVVGDGTESVA
                     SLSPYVEGVLCRCLLMAVAILCYHFTSLVAHLAAYYAGSGAQNALTKDSVQRILHTPR
                     PERVAVVNAVKLAQLITASGRALSDTTGELLTNVLSQVMYIVGFFAVMLFLSYQLTLT
                     ILVGVVGIQCLFVLQGISLHRQGSRVTAEEASVQAYIANILQRSQTVLVFGCSEFVLD
                     RMADRSAQLWRLTNGLNRSIHGYAAVSSGLTRLILVVALGLSNYYQQKGQLGMRHTIL
                     YFACFQSLVNTLASLSSAVSQLRATLGRLKTLEAMLRWYSEPLADTAGEGCTAASELA
                     VVDVQESATADVALDHVSFSYPAVPAFFSEVGGAAGAGDAVASWEQQLGTDMGSQHSN
                     GVSEVSLTALIGGITVLYGPSGCGKSTCLRLLCGLVRPHTGTVRTQRRALLLEQQHAI
                     FIGTVAENILLTNLSSFGSSTAEASALKPTRPSSGALQLPTAAATFAEMQRRVTDAAV
                     KSGCANFLSNPFSTFIESVDHPQFSGGQLQRIVLARMLARTDNHSLVLLDEPTTGLDR
                     SAVEVLLEAIKELRDTHHKTILISTHDHRVAEVADKVIDLSASAAEAQ"
     gene            complement(<807104..>808108)
                     /locus_tag="LMJF_32_2070"
                     /db_xref="GeneID:5656326"
     mRNA            complement(<807104..>808108)
                     /locus_tag="LMJF_32_2070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685477.1"
                     /db_xref="GeneID:5656326"
     CDS             complement(807104..808108)
                     /locus_tag="LMJF_32_2070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685529.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656326"
                     /db_xref="GOA:Q4Q569"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:Q4Q569"
                     /translation="MMPLVLLSTSRGKEANAKSLVAYMTRSLLTPIATKAAAAAGSVS
                     AASEPIKYRCSSTELQCGYSGGVDVYLAIDNQHRSTFLEHSVYLYSAALEVCPQLSIS
                     IIPVIGTAEAATRDKASKEETHAPAASSSPSASSKQQQQQLDGVQRGGSDVIELYDDA
                     AAVLREWKLVDKAFMRDAEGFQPHYKYVAVGGTFDHFHSGHKVLLSTASLHAMEKLRV
                     GVTDASLLTRKKFAESLQSIELRMRNVAQFLQKMRPDLELELEPISEISGGTKSIPDV
                     EALVVSPETAKSLGIINEMRAANGGLAPMVGISIPLVESPTGALISSTSLRERQTQAD
                     "
     gene            complement(<810057..>811685)
                     /locus_tag="LMJF_32_2080"
                     /db_xref="GeneID:5656327"
     mRNA            complement(<810057..>811685)
                     /locus_tag="LMJF_32_2080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685478.1"
                     /db_xref="GeneID:5656327"
     CDS             complement(810057..811685)
                     /locus_tag="LMJF_32_2080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685530.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656327"
                     /db_xref="GOA:Q4Q568"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="UniProtKB/TrEMBL:Q4Q568"
                     /translation="MQEIAAAEPPFACTPALVLIISEPKHAQTLLRAANLHLPLDQTE
                     GGHLKRLRPRRCVTRVPLTEPQSLPPATPPSSLELLLALQPLERCGAAHTASVFTSAA
                     SSSCDAIGGTGANSGAAGSGHAALEHRLLWPLTRAEASLCAEQVLTLLSSDLASASRV
                     VPFRAFVEAASAVTAENSAACGTRQQAIGICVRNDDTEGYTSTSSSPRVGDDTAAASD
                     AAAAPCGSLAFQIMSVPATAPRSDPAEWASANRVWPLAVPRPHAPTLPSAAWTAEVCG
                     NMVKHVFPLCRGLHRVCKARDQHVRASRLSLERGVEEFSKAASSPQISGAEEEAVVGA
                     KEPSGLLDIVAVVIDPSTGRVVATSSGCTSMRVDNPVATAPYCGIVAETPCSERTVSW
                     KRQRAVAPQQPRLILEHPVMYALKQLAAVQQQQEHHRQTMQPSPGTAGAFTAPGSLEP
                     GPSSAVTAEDARHANSTRPYLANGLDLYVTHEPCVMCAMALVHSRIQRVFFLFRNAVH
                     GGLGGRYHLHSMASLNHHFSAYECTEAAELYTTL"
     gene            complement(<812272..>813285)
                     /locus_tag="LMJF_32_2090"
                     /db_xref="GeneID:5656328"
     mRNA            complement(<812272..>813285)
                     /locus_tag="LMJF_32_2090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685479.1"
                     /db_xref="GeneID:5656328"
     CDS             complement(812272..813285)
                     /locus_tag="LMJF_32_2090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685531.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656328"
                     /db_xref="GOA:Q4Q567"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4Q567"
                     /translation="MSSITGAAYSSPEYTHCIRDSRFRHNVYEPEADTFLFLDALDKD
                     AELLRSIRPDRCVEVGCGSGAVITHLRCLLMPSVAAAATQELEAETPELCCGASGIRS
                     AVGGPMFCAVDVNPLALEATAITWTETLLKYFRETVLAAFYERIFQSAVPTSLAAPVV
                     LSAEGVSPPLTRVDADDPTSSALSASTFCLHRFHGDLLNALPRGNSAPALFDVVLFNP
                     PYVPTSLKELQDAITQRDVITTAWCGGPRGRVVLDRFLRQLPSVLSRRGVCYVVLIKE
                     NNATDVVAFAQAAFREHLRCSGTETVKDEDDVLEASEVAARYTGEHLSVYRLRYVPRF
                     QTP"
     gene            complement(<814581..>817544)
                     /locus_tag="LMJF_32_2100"
                     /db_xref="GeneID:5656329"
     mRNA            complement(<814581..>817544)
                     /locus_tag="LMJF_32_2100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685480.1"
                     /db_xref="GeneID:5656329"
     CDS             complement(814581..817544)
                     /locus_tag="LMJF_32_2100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685532.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656329"
                     /db_xref="UniProtKB/TrEMBL:Q4Q566"
                     /translation="MPAPTYTHVRIRTQRHINTRRKGGRMSTRTYCVIPYEARQDTSF
                     FQGVFEDGVRVLYRGRLQSLVFSHVLSPAHDYVKHVNGPLLATLREGGNATLVLATPN
                     SEDVALPPKPMASGVNVTASQVQADARTPVTRVPSSSTSSQRPNAGLAEATAVAMELY
                     GHLFPLLFRNLEGCSAARLSAVTVSASERVLLDGLREDRRIRTLEEAHKATVTRSTSA
                     TEWGTILQLLEDRHVALEGSPTSLEGQTACVVTVELQGYGRLVVVDVASAQELLQQLT
                     LILHMRADGSARTYPPCTPLRDLLERSVAPQATVQVLCVPAPQYTVRQTMRVLHFAAT
                     VEVAQGSGAAAAAATDASVSTASYSKPPRRRAASLSSAPSKLFSRPAAAPTPSAMEAS
                     PTHDSVADSSPRRVGAPAAVRPDVEEICRSGSSCSTTSGFRERTPAELPVPSVQLDRD
                     RQRAREQHLLKRLVFIEEQLRSSEEQCRRAQAARDQALQERNDLERELRGKTGLWTDL
                     QRAHQATKKENADYAQLVERLVGQVRTLEREATRQKRQDAAVVKRLRQAETEKEELTK
                     QLTQLRREVMLFRKDTTRRAREATLSRILPSETSVPVPRAAAQRQPSQSRHARQPAPP
                     SVSFTSTSDVGRHSPRARRIYDCITDMEGSLGSKNGDAPSLAQEQQARLAAITVDELR
                     WRNRQLMQEVDRLQERLLAALTATAKRGTTESAATGSVADHRRDGGCPMCDAMQERVE
                     QFQAELAHVREENDALLRFMAKSPPGHRPRDTKPAIAANLPRSCGSTPRSHSGSSEMR
                     CGGSEDDGDAAGIRSASQLAKASPTDCTQRVAASLLAGCASLDAQLACAQMALLRRLR
                     GGASASAPASNELRDPLSQLSPLILQEHKAAVTALADSLRHIAEKPASRVAATPSAAF
                     PGSSRDASELTRSLLPPVPRCATAADADTLTNYLSFEVERCQHLRAFIPTFAQLAVAT
                     EHLAMRLEATDANSS"
     gene            complement(<822459..>825074)
                     /locus_tag="LMJF_32_2110"
                     /db_xref="GeneID:5656330"
     mRNA            complement(<822459..>825074)
                     /locus_tag="LMJF_32_2110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685481.1"
                     /db_xref="GeneID:5656330"
     CDS             complement(822459..825074)
                     /locus_tag="LMJF_32_2110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685533.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656330"
                     /db_xref="UniProtKB/TrEMBL:Q4Q565"
                     /translation="MSTVQLHPHFVAACNYADVISIVGLLKEPIDSGDFKTNDGAPYL
                     PSAYTSTIHLGDALSGLPYSTRPPSPRKRTSILTTSAQTVHTPFATHAPVASKWPPLS
                     LIEANAGLEDEKVTPFLIPPPKTSPTPTSSRLRLSHCQSLKGVKPRRPKVLCIWDVDD
                     TLVASGASGVRQNAVFRDSELVELFRSAGDTARHLLLSQGSIDDVLERPGGRLWCVRP
                     FLERTTGSTGDDRATDGYTDCSSSAPASSRGGAKKRKSFFANFLRCGGGSRTKVQPAS
                     ASSVTSHTGAWNGYRAGRDDLSDRDLRHFASGTVVVRLATVRERSEQEEDSAFLDDPR
                     ASPTCNRTFDGQLDDKAEQQGRWLILRPEVWGITLASMSTFFPPSRNTAFVNGKIYRK
                     MDVVWSLAMSSEWDSVFFIDNNLSELGVVRYGLQISDMLDLRRQHKVYRFFQADYLLL
                     ATSAKLRDLGLRYGRDITRVPDTAELALSLEDQQNRSSCDQQAQKAASVTATSPSSSA
                     TAPKGSKTEEASELKWCKSAPVSSSGSADTTGSRTSGVTSSDAGHYASWKGCSSVWGP
                     GANGLADDVKIVKSNEGDRTPPHRDATSPLMVQRRHRSSHGYRSVDAECLPLKFPLFP
                     CHPLHEGGDGDLGASVTTATSIVRSPTLSYKDVNLIVVNLHMPSEAYRRVLTTARTSS
                     SGQRSMQRVNSHFSRYVGQPVFANDRSCTDEQYKDVLKYFQEAESTLFQVAEEDMRAN
                     GFVDVNRVSRWVPCTRMVCAPIRMRPTFVPHMLDFYKLFFKEVEERLVATLQRTGGVS
                     ASCVLHAEAQRQYYILQRVLPFIDPYLTGDLGRILFDIYTTDGSIPRSMAEQLKKTID
                     RTRDRIQPLQKKRRQ"
     gene            complement(<826238..>827743)
                     /locus_tag="LMJF_32_2120"
                     /db_xref="GeneID:5656331"
     mRNA            complement(<826238..>827743)
                     /locus_tag="LMJF_32_2120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685482.1"
                     /db_xref="GeneID:5656331"
     CDS             complement(826238..827743)
                     /locus_tag="LMJF_32_2120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685534.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656331"
                     /db_xref="UniProtKB/TrEMBL:Q4Q564"
                     /translation="MQTGSDVFMNIILATLKASNELVDGETFELVSGNPALLKVFLDS
                     GRVDIDEPRVQSVVQAKLDEVLAGDPYDGDVVSGDLLNYVRALCSIRTSRITFQQMVL
                     LRYSGFDYVELLIDYPYLLENLEKPSFCIFFVFDVLHYISIAISWIGVLVTLTFTAMV
                     LWSVVFWFQQPEHRNNGYWIIITYVGGYVVSLVATMRAEEGKIKRYENQVWHYPDNIF
                     RIVPIIPVYEIMLSYVSLRYEISANAKSFFIIRYDLRNGTLVQHITNGCFYALPQMIL
                     QTFLFISDIHRSNHYLHVACYWLLLGCSLTLITMSIFAYHRIAFFTHSCNGCGFAVLS
                     SQSTSTKDHTRVLARRVRPSDIVTKVLIFFTIYFFVAQTVTLVVLMLDLRSCARTAII
                     FPAIYMSVLGLSIIVIVVVYFNLPFSRGMGAIGIPVMLMQIAFLVYANVGATSRECVV
                     FKPSFSKWMIPSLAIFGLMCLSIVAWLTMLLFELFRGVRITQRAVDHYILA"
     gene            complement(<829592..>830806)
                     /locus_tag="LMJF_32_2130"
                     /db_xref="GeneID:5656332"
     mRNA            complement(<829592..>830806)
                     /locus_tag="LMJF_32_2130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685483.1"
                     /db_xref="GeneID:5656332"
     CDS             complement(829592..830806)
                     /locus_tag="LMJF_32_2130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685535.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656332"
                     /db_xref="GOA:Q4Q563"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4Q563"
                     /translation="MEDRNSVASSVFFTGVSLVIEKEKLRQHFESVGHVVSFTIFGPA
                     PGKDFRYGIVGYMDEKTAEEAIRRLDGTTFGERAMRVTAARSTTLHGPLRAGPGGGGS
                     GPADHSTFRKRPREPYPSLNSSRPPYGPGMGRGGGMRAPIARVSFSAQQQQKQEQSQQ
                     PTTDKAGRETMQFPRFYTDPILGRDGSLVLDALRGMATEEAYSAVEQLRVLALERPNE
                     AKRLLHNNPALKSAVIMTLQHAGRIPLGSLPRDAYQSRRAAEAEAELAQPLPPQQPTP
                     SQQSALPTPQQTPPQPPAESLKPAKKEARSAAKSGEARGARKRDTATGSASASAAVPS
                     ESQTSLVRPSTPMTEAERDEVLELIQSMSEEDVERVLTMSARDFAQVPDPAQRKQLEV
                     LQKRLLVMSRDL"
     gene            complement(<831712..>832113)
                     /locus_tag="LMJF_32_2140"
                     /db_xref="GeneID:5656333"
     mRNA            complement(<831712..>832113)
                     /locus_tag="LMJF_32_2140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685484.1"
                     /db_xref="GeneID:5656333"
     CDS             complement(831712..832113)
                     /locus_tag="LMJF_32_2140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685536.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656333"
                     /db_xref="UniProtKB/TrEMBL:Q4Q562"
                     /translation="MGNSSSREWFDPYAVNTPLAGVCAVSCLFNSVPNGVLRISNVYT
                     NVTLLVLLGCSTGLSTSLHMPLLGAQAGLTASLLFTLGAPMKILFTSRLFPRSVHYGI
                     GAFYTTYHAMQLQKELNYFEDAHEDGEDEVF"
     gene            complement(<833765..>837013)
                     /locus_tag="LMJF_32_2150"
                     /db_xref="GeneID:5656334"
     mRNA            complement(<833765..>837013)
                     /locus_tag="LMJF_32_2150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685485.1"
                     /db_xref="GeneID:5656334"
     CDS             complement(833765..837013)
                     /locus_tag="LMJF_32_2150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685537.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656334"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="UniProtKB/TrEMBL:Q4Q561"
                     /translation="MDSSHLIALLNGLRSADNQERKSAEEHYNGMVASSPVWMMCALA
                     ETSATSQDTSVRTMSLVLLRKLFNATPSTYAASDAVARAAVKAHMLAVINSASQGGLR
                     SPAAACVSALAVQVFQEKEDWNELWTSVMTILGDVKGDTALRTMCCEIVQATSMAMAA
                     YFQSHADTLATGLEMCFMQGTDGADLKKAAFEATIRLSNLGMADRLRPLVPKMLSVIE
                     AYLNQGEWESVESILEATVEGMSSSISLFQHDAEHLLGLMMQVAAAPQVDAGARHMAV
                     ELMLTYCEEVPKTVRKVPQFASSFFELLFQYTLNPDYGADWDVTGRDKDEDNLEENSD
                     LVIGSSGLDRISNALGGRKLQKTAQTLFAQNINSPQWQHRNAAVLLICYAGEGMRAVF
                     SSQLPSLVQMVVPHVKDESKYVRANTLDCLAQLSQDFAPELQMKVHGAILPAVVAALR
                     DDVPRVATCAANCLDSFIDSVTGDEEEDDDEDGLDEFRAILHPYIEVMCGDCLAMIRG
                     TQHFFVREAALGVLSSVSSTCKGMLLPYVEALVPVYQEVLSFPDTPEAMKTKCKAIEC
                     VTLLACGVGRDAFAKYAHDVCNYLKQLCDGGLTNDDPRTRFVMRGWTCMVECLKDQAQ
                     PYLSTVIPILLNMMSMECDMEIANVGVGEDDDDDDLPDGVEKMRFVIPGVGERVVTIH
                     TSLIEDKELASNVVFAMLKDLGIGLAPYFCDIANAAMGQLSFVAGEAVRESGASMLEE
                     VLKCYEEMKDPAAQQLAEAALPKLMEALGEESENSVMEVMLRCIGRCVSVHPAIMSPT
                     NTALVCDKVMAALEVVVKRRNECLQKKATENDEDELDALEVEDEEVQLTISSMCDLIG
                     TLLAASKEVFAAPFLEKAFPVLGEWLQASTDDFYMTRAAGILSDFVTHAPQSIVPSLP
                     QICASSLTIASSSSDDGLLQSDFYLMNVIVQLLGSHATTNMGVDGGEYAVHVQQVAEK
                     YFSSNLVNQEEYTHCTCNVISLYVSLLNFYGTTVLQQAATSMLTVVGKALPAKDDEIE
                     ARRIHDVVLGWVTNNHPVLQALPGSTAGFLTCVKAASPNCLSEQAKQYLASM"
     gene            complement(<838200..>841304)
                     /locus_tag="LMJF_32_2155"
                     /db_xref="GeneID:5656335"
     mRNA            complement(<838200..>841304)
                     /locus_tag="LMJF_32_2155"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685486.1"
                     /db_xref="GeneID:5656335"
     CDS             complement(838200..841304)
                     /locus_tag="LMJF_32_2155"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685538.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2155"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2155"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656335"
                     /db_xref="UniProtKB/TrEMBL:Q4Q560"
                     /translation="MKVNIEAISDALDSILAAETTFSSENAHTASIHSQPLPLSQSSV
                     NPSQRKCSKPRPPEASGASLSSGESGAAADAAFVIESSVGAKKTTQQLQVSPSDGHEK
                     ALFARKAERKGRSPKITTSHDQENSPQLSGTVKNTDTPAADFFECIKSVELVAFKVVE
                     ATGVGIISALLTPQSVGRWFSSSQLPSKSWVTSTSLSPEACAVFELENRLDMRRRREL
                     PSDTPSSRSSPSVGGSTGTYVQDFVAVLLVEDVAERQLLHLHSSAFLNRERDLFSVVI
                     ETSSSRRGGFVTAASTSAAPSSVTTLKIPGTRLNAFVRITISPPASEPSTKLIRVRAV
                     CFFRSDSWSTQKAAPVQRGRSSLKGEVKATSQESAKAAPQDAQSVREQPQERGVTEAG
                     KTQAPSLSLTKHEQERKGEGIAHFALSDRNMDADVAGFVKAVALARSRQDNATPKQPS
                     LRGGCNVEYDWLLDTLVDVSTTKDNTCRKASLPDAGDEAPVLEYIRTLQAWNSAPALS
                     VNAAVTYCLSETTSFSASTIFATGLFSHEAQNHLSQPFKLHFFVVSPSDVDQSSEQAY
                     SSCACLPPVHFLAAIANQAALLGCTTELLFTCPESSGFGCALRTHNCTSGTQDAHYKL
                     IFVVPVQRSRDMNEGGTTSVMKYLLRTALGIFRGLSDRRGISLSQECPFSSYSTLQCA
                     KPCGALRLLIDGTRCFDDLIPVLAEWAEVSGSLRYYGSAAQRTLQLLFFPSWLASSDG
                     ESGRFGVLSEPRHEAQWSGLDLRLSGLWRKCTNGVDSVADDTVALEAEYHCPATYVWQ
                     SRRGALRLVLTNAHFMESFARMDGLVAPSPLVSLAMSYCRKEVGGATHTLPLTTLSES
                     PWMSLLQAAERLRESTTASVVTSRNDAAADFFALRRRVTVSFAFHILSTAFKREWARV
                     SASIPLCNGHIRDATLELPNVHVSCVGERVNGGNGMSSAVGLLDEDAFIDTLLQWQYP
                     FPNVVVLHCTDVLSVAGPSPSLTSTTALCRPSSRVQEGVLSLFSEEVLHSFASVSGVD
                     EALS"
     gene            complement(<842738..>846655)
                     /locus_tag="LMJF_32_2160"
                     /db_xref="GeneID:5656336"
     mRNA            complement(<842738..>846655)
                     /locus_tag="LMJF_32_2160"
                     /product="putative R-SNARE protein"
                     /transcript_id="XM_001685487.1"
                     /db_xref="GeneID:5656336"
     CDS             complement(842738..846655)
                     /locus_tag="LMJF_32_2160"
                     /codon_start=1
                     /product="putative R-SNARE protein"
                     /protein_id="XP_001685539.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656336"
                     /db_xref="GOA:Q4Q559"
                     /db_xref="InterPro:IPR001388"
                     /db_xref="UniProtKB/TrEMBL:Q4Q559"
                     /translation="MFSRTQDAGGADSGVILPFRMGGKSTVVMSDYHICKYDAILGVL
                     VCIGDDASVLVLGKEMCRELLPLPGREHWLDAFVYAGTTSFLVLASETLLCLDYSAGV
                     NGNGDSMLRCTGPGAQFTCLHVAQGLTCGAVGRKDGLVSYFRLDPVSNNPEERPQLRW
                     TATETNVLGLCKPFCKGVAGPVIDTSAASRDKFFATGSLLSMDSYPNNPNALIGVVGG
                     VPGVCKWYIDEARVSCFFDASSIAGQSDSLLATCRVTPGGVYVAAVTMHCTKVLLWNE
                     SKKRRDKVAELYWVIDLSQHISQSMPSAPSAGLVDAFAYNEYRVGLSMARTALEDRFH
                     TTNDKHSHMYMLLHGQRDILEIVIRLDDKQVVRQDAIIAHLNAYTAQRGVEAARTKKA
                     AAGSRGNGTDVDANAVDNYFNVFHVEPCVLSNYWTSGLTDVDLEALFVTSEDGLRPIL
                     AKRNRQTGGIESIRELRELSAQAPWYPRALLLRLPENQIRSLAEEIQRTAVPSTWEKL
                     LRGGDALLRHALPDVEAKEAANSDAAYLWRQSVMVTVTDAAQAVCLSPQSNEAFSVSS
                     KALANCVPWSTLAIGQDADGLVLETVLPSLHTVFLPTEIILRVFSTESIVTVMKHDIR
                     RNTGSLVLDLDRAALQLDGNGEPGKRMVEQAVLVNARLEPSTVTSNVSVYKDGKCVLL
                     LLENSSVALVDLSGKGDDGRPFMLQVPPGLLPVGSTIASLDAFWMASRTATSTNRTGL
                     LCLACLFKDRKGLLLWNLSEMRLITYAQPEYATSATRLMVTAAAQPPLPNLSGDVKVF
                     EVALSISSPVHTAGEYGTLTCCDALGAALLSMSLAFGVADGAPQAWCYRQSAEANWVA
                     LPQTTSATKLLPVRFEVLGSSVEWTITVGGAAVATGSSPLQGSIVHVKTTWVPGKANL
                     TYDTDAGEMRDYEISRDTSANDRIDPAIAFVGAHEIAVVQVSALFPATGSPASMKASV
                     TAADAVPAATCRLDSARRLEHFSVYHGRGALIVVTRDANGWRWVSILDSRTAKSMMQS
                     YATLDFVGEENVQVLLVEIENVLHLYFLGSNNGVVGHFFVEANLGASKESGVRKHPCF
                     RGPHYHFTPCTFRGYGRYLPPAPTLKQETGFFKRLMTLPWEDIAMKLESETLRATKAA
                     GAAQMPAGTTPITAAPTSKPYASPAPLPSSTSPVAKPDPKGEQQELLGAINRGSSAAA
                     PAQAPAPARQPGAPAPTATATAATPNESPGGRYAQLKAIAERENVSLTEARRMMSENV
                     RKLQQRGERLSEMRDKSAELAQTALTFQDLARQLKEKQRSSWL"
     gene            complement(<847551..>849383)
                     /locus_tag="LMJF_32_2170"
                     /db_xref="GeneID:5656337"
     mRNA            complement(<847551..>849383)
                     /locus_tag="LMJF_32_2170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685488.1"
                     /db_xref="GeneID:5656337"
     CDS             complement(847551..849383)
                     /locus_tag="LMJF_32_2170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685540.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656337"
                     /db_xref="UniProtKB/TrEMBL:Q4Q558"
                     /translation="MNPTVPRGTEWGLVHCDFFHHARANTSRLLVSHRTTDTVGQMLM
                     SLKDGLLTSAPSKKPHVNGGTAYTAPSATAEKASRGTERRHQAAPVTDYSCVDMEGMQ
                     KNDSKFVPSVPRSAQAQEASVPTPPSPPASASQAETSAAKDAEGFLSHNAPPPSSSAL
                     FVVDKHSSASTVRPSLPTRVPQNEPPVPVSPLQTATASARHWQWTPPRHTVDNAFVRR
                     QLALLAHRRVLALLDPHALACGSYISMFSSGAEYSRLTRCFRAVAVAKKDVVSSWVSL
                     AHCAALCILLPRTMDEKVQLAMTSKGNVALRDVPTETGSRGHIRSRCHNRKEFSGRTE
                     PDVPARVSEAMCGVYVHRVADNAFELGVVMHGGHQDSRLLCLLRCLSHWCQVVIDHRS
                     VVLPICASLRAVSLRLWWVPQHGRVTPGSLLPPLKAFVEEGRRSFFAATRSGIAECDD
                     VPGGVCQVQSSTRLEEDAFPLFPSYDDVVLFLVRPVASQLRGTNVLRLPHAFGEYVMD
                     QQWGATNEAVEYRVAVPDDASEAGNDNGCAHRLFLRTSGVRELVRLSNGAVQATLVFA
                     DARVTTVGEHLLAVEMRPKAAYRPFVPTLCAKVAPFLVVGPEEA"
     gene            complement(<850912..>851613)
                     /locus_tag="LMJF_32_2180"
                     /db_xref="GeneID:5656338"
     mRNA            complement(<850912..>851613)
                     /locus_tag="LMJF_32_2180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685489.1"
                     /db_xref="GeneID:5656338"
     CDS             complement(850912..851613)
                     /locus_tag="LMJF_32_2180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685541.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656338"
                     /db_xref="GOA:Q4Q557"
                     /db_xref="InterPro:IPR009374"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016020"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q557"
                     /translation="MTRDDGTQVAQLLSEGKYNLPMFLRYLKASSMEGDQPDKSLLLG
                     ILLQSLARFQTSDFTACMCLVPSHVQDSPSVEKELNYIYGLENLLSCGLFARFWTQWS
                     SVKEHLPESFHFEARVRTSILETICITMESIPTEKLATYLAVSPDQVQKVVHNAMKDS
                     EDRDMKVMAYDSGSVVFHRNRFNYPQAGAAQDAIRFTDVSSVIHNDVPRRGAAVAADE
                     TRDVRARTWARMADE"
     gene            complement(<852947..>854848)
                     /locus_tag="LMJF_32_2190"
                     /db_xref="GeneID:5656339"
     mRNA            complement(<852947..>854848)
                     /locus_tag="LMJF_32_2190"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685490.1"
                     /db_xref="GeneID:5656339"
     CDS             complement(852947..854848)
                     /locus_tag="LMJF_32_2190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685542.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656339"
                     /db_xref="UniProtKB/TrEMBL:Q4Q556"
                     /translation="MGCVNCKKAKRRKDHPTLEEAAARETERERWAAAEQGFAAQNLY
                     TSVHAANSLPLTEREGATPLPATPGRLENVPQISAAAAAPGETENGRGWNSKKKSNSQ
                     ATGKADNDSTAAALARVTRTAAPSESSRETPKGRRNKHQYRCHPGVSSWSDGSLPLSV
                     DSVGSAKCPHSSSSSSSSSAQTYKSKKGAEDAKKHGSPGSITAAEIWPQENSDDSVAQ
                     GHLNSASHSQTATAWLHINGLTAAGTTSSTNARQTRQPKMYHRSSNVSSDSRSNATPP
                     GMETKVYPSADALDDGPSDWGSTSHDVPAAIPAPNTSVESGGAAAEASSLPNRAPFEP
                     YSDLGSRDVTDYLPPYEWAPRTLPVPSPLRACGPVDMAQWEDGENQFCGLAAAGTTAR
                     FQDPVVNVSAEGATTSNSAVAEGNYGASHPFALHTFYPRLPPAQWSSSSSDDTINGPE
                     ASAAAFDYPHLPVNAFIQKAHPHQQQPTYRAMYEGDASVRYSPAGYASHEATPRRAVP
                     PSLVDVHVSEAVGYASPPLVNNAHSFYPSRALLPMHHSHAVPDSGSGKPMAYSHALPA
                     MTTSAPQIYHDGNRNRSGNISIVSIGGGVHPHKPVSYLFDSSMDDWLQSRHAQPPQRQ
                     LYGESVDMW"
     gene            complement(<856038..>859085)
                     /locus_tag="LMJF_32_2200"
                     /db_xref="GeneID:5656340"
     mRNA            complement(<856038..>859085)
                     /locus_tag="LMJF_32_2200"
                     /product="small nuclear ribonucleoprotein component-like
                     protein"
                     /transcript_id="XM_001685491.1"
                     /db_xref="GeneID:5656340"
     CDS             complement(856038..859085)
                     /locus_tag="LMJF_32_2200"
                     /codon_start=1
                     /product="small nuclear ribonucleoprotein component-like
                     protein"
                     /protein_id="XP_001685543.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656340"
                     /db_xref="GOA:Q4Q555"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR005517"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q555"
                     /translation="MDFGYDEYGNRTSASNGDGRGGEEGRSEWRSVQESRGSSKSRSR
                     SAEEDAHGRPLDRSDSGSHSDFSDDVELVIGEEGTQALHEPLVDQSELQSHGRRAVGW
                     SNEAQFLLENRYAGREGTASSQLVLLDGDRHHQRPHSASASQNYLDVLSTLPDRMRNV
                     VVAGSLHHGKTSLVELLLHERSYHKRQDEVDREMTLKSHVLTIITGGAELQPTSRQIT
                     VIDTPGHPDLIGETASGMRLADAVLFCVDAAESLSDHSERLLRHAIVNEQLPIVLVIT
                     KVDRLMIDIKLPPLDAYRKLRMVVDAVNNVIASCGTTYDAFLVSPERGTVCFSSVKLG
                     LCFSLETFAMKYAAAYPRINAAALATKLWGQTTYEKKEFKKIVNFRQRPSFVQFVLEP
                     LYKIVAHSVTGEAAQTLSPDLAKLPRSPLSALQEAMRYFCGAPTGETLDAILSVLPAP
                     PARSRWLSEKYGTSALCSMRDAAAAAAEGKEGGAATARADDLVIAVASLQRVFEAKDT
                     LAAVVRVTYGTLRVNSRSKSKGAWVSSSCNGGQSRLRLIAFDEFSSDADPYYEVEVQG
                     LYLRTVEDGFVPVQRATAGQTVYATGLPARSGSHIVLVGGAAAAAVLAEDEGAPAPPE
                     ACGITSEWVVPIKVRSLGFPQPLLHVSMEVRDPAKASSVQDGLGVLLRTSPGLDVHKE
                     ETGEYTISGFGELQLDTALHELRHGLCPSVPVGISQPFVTFAETVQDAEGLLAMTGTR
                     NNSVGFVSGALPRTFTQAIEYEQLRLFSTELDEDRQPRKLWTILRRDYGFDALDAQHV
                     LAAGPDGTKGPSILIDDTLAEEAHHPLKAAHQRAVVSAFRSTMAAGPLVGEMVRGVAA
                     KLIFADIDASTRDAVVLSNARTALRHSLFGARPRLMEPVMAVEILCAPECVVQLGDIL
                     QQRRGAMLGEEPIAATTLIRAHALVPAMDSFGLETQIRMLTHGQAFPLFRFHQWDVVP
                     GDPFDASIHVGPLEPARGHQLARDFVLKTRFRKGLPQNMLTDL"
     gene            complement(<859830..>860450)
                     /locus_tag="LMJF_32_2210"
                     /db_xref="GeneID:5656341"
     mRNA            complement(<859830..>860450)
                     /locus_tag="LMJF_32_2210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685492.1"
                     /db_xref="GeneID:5656341"
     CDS             complement(859830..860450)
                     /locus_tag="LMJF_32_2210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685544.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656341"
                     /db_xref="InterPro:IPR008011"
                     /db_xref="UniProtKB/TrEMBL:Q4Q554"
                     /translation="MSALIPSDAVALLYRRYLKATHRIPNVTIRMLLLQQVRSGFHRN
                     RNITSVSAQRELINQAHKDLAVLEDDRLSRTLYINRLGLVSCLDWEVRRTEYNFRPET
                     QSYLAVLLICGFSLLLVAFLHTERLETRRPDIAQMVNCMAMRLEAESPEELKEVRERQ
                     VRNSLEQRQHQMSLEQCVLATFYNAPNTPAPSLRNPEGSLRYERHS"
     gene            complement(<861990..>866159)
                     /locus_tag="LMJF_32_2220"
                     /db_xref="GeneID:5656342"
     mRNA            complement(<861990..>866159)
                     /locus_tag="LMJF_32_2220"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685493.1"
                     /db_xref="GeneID:5656342"
     CDS             complement(861990..866159)
                     /locus_tag="LMJF_32_2220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685545.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656342"
                     /db_xref="UniProtKB/TrEMBL:Q4Q553"
                     /translation="MSSSFLASPTAETAQQLKEAQLTIGMALKNAQYALTTHAHRSLT
                     TALHENVNALTALSTYLSLSGSPVKAAAIAGQMAKILRSVSAYVAAKERSGGGWQRAE
                     GSHHSSSPNTSPSSSVMLHELGCMPDSRGESAGLVADLQRAVEELKEQRDMMAEEKRA
                     LLAALEESRQHPAATTPCAVVEVHSSEVADQDAGAAIRKLRAELDSLKHELREEHMRA
                     AALQDQLREAEEQVQDQQDQVQTLRLQLRLSQEEKLSQDAAFAKKEEEIKAFQAALLH
                     NSNSTSSPSSALAAAKDASEAARPPRGYVDKDDFDALRLQNQLLQQALREQETQARPT
                     DSQAVLTQQTLEEIEADHQQQLQAMKLTIHNQYNRETELLGQQHAMQDSIDDLKRQLQ
                     LSSNRQWVQQERENHLNEMDAAKQRIEQLKDTIKKQEGHIEEQKSQLDNCAQNERKHA
                     DTIMSLKLHHEEHVTTLDRQLCDLRAELNETRLRLQDLRNELEAQHTQAAATIAAAEQ
                     QCNHQKQDISNLTLTMTAEREQHESRVAELQQQLETERDRAAASQSAVEERESALQQR
                     LAELRTSMTAEREQHESRVAELQQQLETERDRAAASQSAVEERESALQQRLAELRTSM
                     TAEREQHESRVAELQQQLETERDRAAASQSAVEERESALQQRLAELRTSMTAEREQHE
                     SRVAELQQQLETERDRAAASQSTVEERESALQQRLAELRTSMTAEREQHESRVAEFER
                     RVAQVEATQKAENEIHSVAVADLRVQLDAEHMRADKAEADAREKVRIAWEDSKIVAEA
                     HAVELQKLKDEHTADLKQVQEGHVLDLKRVHCESATKFAVASYPVDWLKEENEALKVQ
                     VKEWEERHKEEAKEKMAALAKVRQTEQILFSRKGELQRLKDECASMQKSMAKSMEERD
                     AAVKKLKDGFQLAEEAQANVVRLETLRKELDEVQKRLDTADKDKALLASRYKRASTEK
                     EECADAARKLLTQYKEMAATHEKLVTQLAAAEALAAEKSRAVEELTRAAAVDADLTSN
                     GLQDDAVIAGAQKVLQNTVSEKQERIEGLVAEVDRMARENKRLRSELDNAQVRQVSTY
                     RLSLMAEPTSMQAAFARDMLSSLAEIRVILSAMHAQLLPILEQRCVQERSRAAAAASP
                     SAPTSAVEALEELHMAMESAHAATQATLEHFDAMARQLCVSADLQGVVYGKLLATLQQ
                     PQGKNAASALTPALVDVSLVRACAALFSEACSCPAPGWEENLHHGAKKVPSPANQSYR
                     SDNACSAVRGCAVAAEKDERVTVSTAADRKPLSMWSHCRAFSSAPTEFVSPAVAGNRD
                     TSAYTLSSARRRTDDCEFGMLSDAGYGRVAARAGPQRRSSFGNFAVAQATISLAEERA
                     GLSTAPTPPWK"
     gene            complement(<867527..>869848)
                     /locus_tag="LMJF_32_2230"
                     /db_xref="GeneID:5656343"
     mRNA            complement(<867527..>869848)
                     /locus_tag="LMJF_32_2230"
                     /product="putative ATP-dependent RNA helicase"
                     /transcript_id="XM_001685494.1"
                     /db_xref="GeneID:5656343"
     CDS             complement(867527..869848)
                     /locus_tag="LMJF_32_2230"
                     /codon_start=1
                     /product="putative ATP-dependent RNA helicase"
                     /protein_id="XP_001685546.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656343"
                     /db_xref="GOA:Q4Q552"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR025313"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q552"
                     /translation="MGIKGRRKKLRQREELARQQQAQGCGSVDDDEAEGVGDGLASRV
                     VAMGDGPFRLPVDAMGQLKMKKSDFFRMQDMEVLEQMQEEHQCRRKQSQFGALVAGGG
                     SASRKRRRGAAEDSVVDVAEEVEKSYLGHQYAHEDLFEDPKGATSGHQSTTLSSATAG
                     APGDRGSAQTRKGRDASSKAEVLDNQEEEQVDLIQQRRKAAHGAAFCHPLIGLDPVVV
                     DALQKNGFHRMTRIQERSIPYALEGYDLLGQARTGSGKTLAFCVPLLHLAKNTANKYP
                     HATVGLLLAPTKELCVQTHSVLSTLCKHIAAVPVTAGGAQFHVQLITGGTKVSEERRR
                     LMSGMASIVVGTPGRIHDHVLHCKGWDLSRLRLLVLDEADRMLADGFQRDLDAVITRI
                     PKGRQTFLFSATNSKSVHELARLSLSRLPLFVGTAGDAPSVVDMGDAETAEASASMAP
                     YRVYHDPDEDGEEVEDKEHGRKDEGDTDPCSEDAAGEADAIPSTLRQFGYIVPSQDRL
                     RALYTFVKQVARRAKAMVFCSTVASAIFHCQMMGSVGFHDDTVMLHGHMKHRQRVQTF
                     QMFTEWKTGVLFCTDVAARGLDIPHVSWILQYDPPLDPTEYIHRIGRTARAGTVGSSL
                     LFLTPEEAPFVRYLANYGIHMEKYPMPEKLPRIQEKLEHVLQLDEVVAKSAVTAFRAH
                     VGAYQSHILKETFDVHRLDLEALSKAFALTAVPHVTLPRNTEEEKRKEYIKGRLKSLN
                     RRRLDALRHYEANKTRPQWENGTFVGVSRPFMN"
     gene            complement(<870833..>873736)
                     /locus_tag="LMJF_32_2240"
                     /db_xref="GeneID:5656344"
     mRNA            complement(<870833..>873736)
                     /locus_tag="LMJF_32_2240"
                     /product="putative methionyl-tRNA formyltransferase"
                     /transcript_id="XM_001685495.1"
                     /db_xref="GeneID:5656344"
     CDS             complement(870833..873736)
                     /locus_tag="LMJF_32_2240"
                     /EC_number="2.1.2.9"
                     /codon_start=1
                     /product="putative methionyl-tRNA formyltransferase"
                     /protein_id="XP_001685547.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656344"
                     /db_xref="GOA:Q4Q551"
                     /db_xref="InterPro:IPR002376"
                     /db_xref="InterPro:IPR015518"
                     /db_xref="UniProtKB/TrEMBL:Q4Q551"
                     /translation="MRCIVANALRCSKAGSSRGDTGDVQWPSLAAASSSQGRRAAKDE
                     EAMAEVDAFVRDHITVVCPALPRGMTPEEAAKKFTRQYPVVRYCVEHGLPIIPVDDPK
                     SLSLSALLKEMLASRKDVTTSTTGSHAHHLYRSPPMPSHRASHALPSSPRCGAGALLP
                     PANGKPNTKGSSPSSASSATPHTWVAQGRSLADYDLTVVVSFRYFLPKRLLRVLPPVI
                     NMHPSLLPRYRGASPIFTALCRNETLGGVSITQMKPEQTAMDSGNVLWQCEVPIPLDM
                     DIRLYFPLVTQIGAAGLCDLIFGEAPPAWRPSATTGVVSVLAPPSLSARPSASWSHGC
                     SRSQSQTHQDGVDCRSTKAKSTNGATSPSWFALRQRSLTPLVHRPGGRGAAPGSATSH
                     GTHMLTNTLFSATKLPFLSSLPASSENCSAVRVRQMVHTLDDTTLRHGLGNSEESPST
                     NGADVCHPRCCQPWMTLCRAPTLITPEAVHAASRTLRSLFFQNVGSPPNAAAAAPAIP
                     ACSAAAPAECKGAPVSKKTVSLSAAAEMGVTTTMKCAEVFPASVLSPYCDWPDSFTYS
                     WKFAQVQAYPTYADFSEDPYHAPLLPKDAAVIRFSSMDAAEAFGVWRAFVGGDYFQPS
                     VNATLDKGSTPVRNQLVHRALRRILLKRAKSQGTLQQYSECAEARHEKMSAATVTLAS
                     EDSDVPVGVVAGKHVDLDIFSPAGLQLLTEAENTLRIPCTFTQVVNPVLAPACVCEEL
                     AEVERSGHPQRGASTCMRQHQSQQPHRCVRFYRAPAAIFRSLLSSRTSDSAAQETTRR
                     ARYRSVLAVNERGTAGTDGTHLPLRQQPYEAAGEGTVPHSTTTSPRAASLTAAEKGQR
                     QPGHGHSRAGGVATAVQTEEPGEDEEAPEDYVPEVIHAAPPTQHHVHIPPGTGYFLQC
                     DESYGAIKCKEGWFLWKEAHMKWANKAQPAVLIRKGLAMKTGVLYVGLFSEYS"
     gene            complement(<880854..>881897)
                     /locus_tag="LMJF_32_2250"
                     /db_xref="GeneID:5656345"
     mRNA            complement(<880854..>881897)
                     /locus_tag="LMJF_32_2250"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685496.1"
                     /db_xref="GeneID:5656345"
     CDS             complement(880854..881897)
                     /locus_tag="LMJF_32_2250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685548.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656345"
                     /db_xref="UniProtKB/TrEMBL:Q4Q550"
                     /translation="MMSGESENASCTTHITLPHELDTAPQMISTSEISEDTSSSNASA
                     VSPGSTAIPECVSTLSNTPDATATAAALPPFSCALSLHPYGANVPLLYKLSAEDTALR
                     TDIAVNAKLLFYTLTGYEADDIIDLLYVNEMWFSTEVLIYALCLVNRLTSRYPSWRAE
                     HAEADRVDVSAVDSPVHCSYTSGVQTLPPTLTHVCSSTSSDTSNVGNEDEITMNDRVS
                     ELKERIHSSSTNNLSDVFNRHNTRRRVVALLLIAGKFHGDVVYKTSSLANALNKFREE
                     KRSLQEQCAAAAPTAPTATTPATLMPSRPPPRIAPAHLGQCEKRLFQELGCTVFVHRK
                     EYQHCEGIVFRGI"
     gene            complement(<890297..>890860)
                     /locus_tag="LMJF_32_2260"
                     /db_xref="GeneID:5656346"
     mRNA            complement(<890297..>890860)
                     /locus_tag="LMJF_32_2260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685497.1"
                     /db_xref="GeneID:5656346"
     CDS             complement(890297..890860)
                     /locus_tag="LMJF_32_2260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685549.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656346"
                     /db_xref="InterPro:IPR007052"
                     /db_xref="InterPro:IPR008978"
                     /db_xref="UniProtKB/TrEMBL:Q4Q549"
                     /translation="MSTEEQQVTQGTAHAPAPTTVKNKANSYYYWHQHEKDRAKVGDV
                     APMPTPYLVSKDDARAMAAPAVPTVSVSKYSWCDGDKFVSVYIDTVVPEGGTLDESSI
                     EATFTGNSFKVTFATADEAGRTRAKSLSIRLSKRIDKDRSSTKVKPKTQQILVRLAKK
                     VESVWLDLEGEASDQDSAADSEAADAE"
     gene            complement(<892111..>894774)
                     /locus_tag="LMJF_32_2270"
                     /db_xref="GeneID:5656347"
     mRNA            complement(<892111..>894774)
                     /locus_tag="LMJF_32_2270"
                     /product="membrane associated protein-like protein"
                     /transcript_id="XM_001685498.1"
                     /db_xref="GeneID:5656347"
     CDS             complement(892111..894774)
                     /locus_tag="LMJF_32_2270"
                     /codon_start=1
                     /product="membrane associated protein-like protein"
                     /protein_id="XP_001685550.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656347"
                     /db_xref="UniProtKB/TrEMBL:Q4Q548"
                     /translation="MWSFLNDVRESVRQVVAPPPSRSSIASTTTTATSTTANTREMGF
                     EEAVDQLTTGLLYLWRKADQAASKVLRQAFDGAVSLREEATPRLFTVTAEARASLSEG
                     ELLELLIDAVSQATDRTHQALDEANFLLSLGIEEQIAHTKDYAGCYQWWDRTVNRRLI
                     VCQELLQARFADASSTPQHLATVMALRTQIDVIRRASTQPLAAVAARGRLLEDERYDL
                     LKSLPAMLPVEGGDQPAHASSTATDDAASTAHQPTAAHPSEASYTPSTEGVVASVPRD
                     SYIPQFRPFTISSPIAAAAPLTDSATATLQEFDSTHCHAQPATAHAFPSQTPPSSQEQ
                     ARLAREAEEQARLAREAEEQARLVREAEEQARLVREAEEQARLAREAEEQARLVREAE
                     EQAHLVREAEEQARLVREAEEQARLAREAEEQARLVREAEEQARLAREAEEQARLARE
                     AEEQARLAREAEEQARLAREAEEQARLAREAEEQARLAREAEEQARLAREAEEQARLA
                     REAEEQARLAREAEEQARLAREAEEQARLAREAEEQARLAREAEEQARLVREAEEQAR
                     LAREAEEQARLVREAEEQARLAREAEEQARLAREAEEQARLAREAEEQARLVREAEEQ
                     ARLAREAEEQARLAREAEEQARLAREVEESVARSKVSRESEEVSVALYGEVILGTEAM
                     PKEMHTPPSSHNVMPPPVGTVMDDEGWGEEDGFEEVNMAQFTKYLGSPQRRTSWGGAD
                     PSFSSSPLPAYAQAHTPASARWGASMSCQKLSPPITPVSGVQEVGLTAVVTAAVGRRT
                     GGMSLRKKSPPVRVARDGATPVSAFQPRSSMGSSSSMSSPYGGAANAASGATGWRPAP
                     QQSVFSSPSAVSKQSKRQVQLEDDDKWDEDW"
     gene            complement(<896549..>897403)
                     /locus_tag="LMJF_32_2280"
                     /db_xref="GeneID:5656348"
     mRNA            complement(<896549..>897403)
                     /locus_tag="LMJF_32_2280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685499.1"
                     /db_xref="GeneID:5656348"
     CDS             complement(896549..897403)
                     /locus_tag="LMJF_32_2280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685551.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656348"
                     /db_xref="UniProtKB/TrEMBL:Q4Q547"
                     /translation="MLRTTHVSWASTAKGYMNRVMVYAHRRRKARYLAPKNAHVRSPL
                     AHKMPEEYGNTWDPRSGVEWHNRMRNRNHYRHWPWARWTDDPVRFHQDSVCHRTVSAL
                     STVANNGAPEWDYYAEVGQAYETPSHFPLSYTAPFIYQYTAQCWSREDLQSYLERIEQ
                     SSGLRTIADAASRREALYTWWHNAGMNVIPLGVLQHLELVSRDIVAQNARKSYRIEQH
                     ERGILRTPEMERYYALPHLRGPSMPVQLAQPSGKYPSGKFTQMMEDVAIHPLQKPDAR
                     YKHNMYPA"
     gene            complement(<900069..>901988)
                     /locus_tag="LMJF_32_2290"
                     /db_xref="GeneID:5656349"
     mRNA            complement(<900069..>901988)
                     /locus_tag="LMJF_32_2290"
                     /product="putative sphingosine-1-phosphate phosphatase"
                     /transcript_id="XM_001685500.1"
                     /db_xref="GeneID:5656349"
     CDS             complement(900069..901988)
                     /locus_tag="LMJF_32_2290"
                     /EC_number="3.1.3.-"
                     /codon_start=1
                     /product="putative sphingosine-1-phosphate phosphatase"
                     /protein_id="XP_001685552.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656349"
                     /db_xref="GOA:Q4Q546"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="UniProtKB/TrEMBL:Q4Q546"
                     /translation="MFVVTSKPASHFVGPSSAQDFTPVPSPPLTTLASTRRDAVREGV
                     AVSATCTDDTTNGIGNGGIAGVAPCNGNNSGWPYPRGGGNPAANGTASGKSKPISLGI
                     VLKGPNREGESNPSDFAENSDSLGTDAPQVGDTVESAIKVPMTVVTPAAVSSDVVASP
                     LTVHENLVQWRPPQRAVVFREWYISCFCNEQQVWWIKKAQRIGGPLQPLLVPYFQLWS
                     FTGEAEFYILFIPTTAWLGAPLSSVQMASMLWVGQYVTSTMKDAFCCPRPPCPPLQLH
                     GKRDAHDNEYGFPSTHSCQSGVFSFLLYCQLVHAFPDHAFLCWLAAVCYFAHVSFSRI
                     YLGMHWVGDLIGGGVVAFLTVLSHVAFLDGWEASILQRADTPWWAYLLLYVTVHLLSM
                     AHATPHDPCPCYIDSLRFTGAVMGSAIGLWRFYAIYGTLAARPQSDHMLDVVFSFSFL
                     MQWVVCMAVVFASRELSLLIAAVVLKAVFKFLSGECAPRLPKSLRQPYLAMAKVVGLT
                     TLGNERGSRSCIPVTANGSLPMQSDRFNGGFGQDEKAAAAAADGKNALNSRSNTETVE
                     ELDGYLNSQQVWSLRTHRHWWLWDVHGRTVSYAVMGFVATFVCQVLLRETFGVGQELT
                     ALAAHRPWSPPPSPE"
     gene            complement(<904803..>906164)
                     /locus_tag="LMJF_32_2300"
                     /db_xref="GeneID:5656350"
     mRNA            complement(<904803..>906164)
                     /locus_tag="LMJF_32_2300"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685501.1"
                     /db_xref="GeneID:5656350"
     CDS             complement(904803..906164)
                     /locus_tag="LMJF_32_2300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685553.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656350"
                     /db_xref="UniProtKB/TrEMBL:Q4Q545"
                     /translation="MPGRPGSAEELYGLVCALQKQQQLTQVDLRAVQRRTEALRQELH
                     CQEALIAEEQAKREELAAKHTPGDAELRLAEAHARGAARASADAAQELRGARRAFLQK
                     CHAQVLSVGKGPTDPRRSGAPVAPSNCTPLSSAADESSSGSLSAVGLGPRREATLMPA
                     AAVRQLLLLLREKLMRCIEVGSTAVPAPFVVASVVAPATEGGSSEQPRDCRPSDEQGA
                     AAKVATSVMSPLTAAKSPHGPPSKSVTDACVRGAADDQSPPREKKRIGFAPECCFERV
                     TAVPAANVNRGTRETWLTEGAPGACGSTAVVPPAANVTLDGDNHPSNACLRNDSRPRT
                     QRFDGHFTVRVASRSATLVAEAAAMGAKRQRASEAAIAAQSSPPKAARADGDKGVSAS
                     RAPQGAGVAAAFPPAYTSNRDRLVAPVDLLSPRSAEARRNGSSGSGRRTVWTWTRGTS
                     REP"
     gene            complement(<907131..>910820)
                     /locus_tag="LMJF_32_2310"
                     /db_xref="GeneID:5656351"
     mRNA            complement(<907131..>910820)
                     /locus_tag="LMJF_32_2310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685502.1"
                     /db_xref="GeneID:5656351"
     CDS             complement(907131..910820)
                     /locus_tag="LMJF_32_2310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685554.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656351"
                     /db_xref="UniProtKB/TrEMBL:Q4Q544"
                     /translation="MSWVRVECSGGYCYAAPSHGRCVPKLDGMARLFQVPFCLRQLHT
                     FTTLSDNAPAISGCNNSDSCGVLGTNESVNVCIIVDQRNLGGHLGLTTVAVGDEEDAG
                     LSDSPPLRLLLNRVFAVLCSTSERGVQVLLDALCTRAPPPLTAVASAEAAIVHEDDGG
                     PRVPPALWLARSQETGSTPQNTPRSVGTSSNRRFLSKLMQGYSAAEDVTGAAEKLSLQ
                     PLSSDMVATTKPNHAARTLPQVASGTANTLPAHPSTAFSEFPGSTSLVIRPPLSYAAA
                     LRRRSLLFFLPQGVVPLSVLAIHLQLSSRPVKCQQKEAASAPCGGGVVDAQRIALTSI
                     GSASTGTGGFTRSLHAVLLEELEHVRVGAVRAGEGHGRNCASCASEQGCYCAVRVHCV
                     SHLRRRSDKLLRQSSSWAAVARTAEESGRVLVWAIARLLAGSERPMRTSQATDLGRLL
                     LHDLWAGEHCTGGDGGRETAAKDRAASTAQAGVTPLVAVYSPSGLLFASAKFSMLLSH
                     EEQVLLSAAAIDRLARYAAPLSLCRPHASAAAADALSWTSWPMRMGEAAGKPSAAVVM
                     DVLLITVGDALAFCLAFPRAPSSASVPPLSSLRSVQLLLESTVSKACSRVEVPSTRTN
                     APLASALVFACTHSTAPYTPTFHDALFAVTALEDALDAAKETSSAVSANSAAGEQVGV
                     AQYVHQVLWQEMFHTQTPNEQGTGTTAGAAPAPTSGATSTPRQANVSAAVAASIFRNS
                     TGGDGRHPHSVSSALQKVFSCLPLRHNDPSNGVASRQLYITAAQQQSSTYVKQSNTGA
                     HLSSPVPLLNAYWTRCSNPYTAFLLAMPLEEMLCYVAALVTRNELGTLRPSYELGLHS
                     FFFLQRPVAAAEAKHRHAAPAKASGSRTCKNASVDAQLPAPPTRFGVSFARFRLQQSP
                     CSHAVIPEEWADADGAPDGSGGRLAFFEDPSLLLRLHTHGVSLEGSTVDGKHGEGKGS
                     ERACRDTSQRLKESSSMDVALETQVSVVPVWTLLQAAPDESLATRERSGSGTETSDSD
                     SFAAADDFRGVHRSVPSSAGEDVQLVTSLHYACPQRLRRREPAPSPVNATLSTPPPAS
                     TQHTSSPILPHPQPLDHLLQANATNTADVRPKKGSVALAWCQVEAVVSICGDITGTGQ
                     SMMAKALQRHALSRSAEAELMGTGHKHGSGGASALSAAAPPDSLPEEWEYAAGAPQKL
                     VDLCREVVWCQEAALALLEGASCFT"
     gene            complement(<912289..>913602)
                     /locus_tag="LMJF_32_2320"
                     /db_xref="GeneID:5656352"
     mRNA            complement(<912289..>913602)
                     /locus_tag="LMJF_32_2320"
                     /product="putative C-14 sterol reductase"
                     /transcript_id="XM_001685503.1"
                     /db_xref="GeneID:5656352"
     CDS             complement(912289..913602)
                     /locus_tag="LMJF_32_2320"
                     /EC_number="1.3.1.70"
                     /codon_start=1
                     /product="putative C-14 sterol reductase"
                     /protein_id="XP_001685555.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656352"
                     /db_xref="GOA:Q4Q543"
                     /db_xref="InterPro:IPR001171"
                     /db_xref="InterPro:IPR018083"
                     /db_xref="UniProtKB/TrEMBL:Q4Q543"
                     /translation="MAKGRGGASKAEANLLQPCTKTYEWGGPVGALFMVAFLPTLVVA
                     LNSLCAGERCSLMQAVRLPALMKEVVQGAWPMLRTAIGIELVWIAAHAVFSILPIGKL
                     VHGGELRSGERLAYRMNAIHAFVVAHLVLFGLHFASILNMAAVADLYHPLMIGAILIS
                     FAMSVVLYAASYRSRNVLTALGGNSGCVLYDFWVGRELNPRTGPLDWKLMCELRPGLI
                     GWSILNWAFVCKSVELGTVTPSIVLTALFESFYVLDGLLLEAGNLSMMDIVTDGFGFM
                     LCFGDLAWVPFTYTLQTKYLVHHPVHLSLVHLCLCASLSATGYLIFRNANTEKDRFRK
                     NPQDPRVQHLRVMRTSNGKSLIISGYWGVCRHPNYVGDWLMALGWAAFSGTAEWLPYF
                     HPLYFGFLLMHRQLRDEQQMREKYGKEDWSAFCRVVKYRLFPYIY"
     gene            complement(<914591..>915010)
                     /locus_tag="LMJF_32_2330"
                     /db_xref="GeneID:5656353"
     mRNA            complement(<914591..>915010)
                     /locus_tag="LMJF_32_2330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685504.1"
                     /db_xref="GeneID:5656353"
     CDS             complement(914591..915010)
                     /locus_tag="LMJF_32_2330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685556.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656353"
                     /db_xref="UniProtKB/TrEMBL:Q4Q542"
                     /translation="MFLVNASVAGACGALSGVVGKLAVESSRVPSLVRSGGLYLQLDL
                     ATMEMVQAVVPWLLRIVFFLMNAILTGSMWRFYLKALSQGPTPVCQILNTGTNFVVSA
                     LAGLVFFEEEVTPMWGAGALLIVLGLALVVSDPQVSV"
     gene            complement(<918919..>919935)
                     /locus_tag="LMJF_32_2340"
                     /db_xref="GeneID:5656354"
     mRNA            complement(<918919..>919935)
                     /locus_tag="LMJF_32_2340"
                     /product="putative cytochrome-b5 reductase"
                     /transcript_id="XM_001685505.1"
                     /db_xref="GeneID:5656354"
     CDS             complement(918919..919935)
                     /locus_tag="LMJF_32_2340"
                     /EC_number="1.6.2.2"
                     /codon_start=1
                     /product="putative cytochrome-b5 reductase"
                     /protein_id="XP_001685557.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656354"
                     /db_xref="GOA:Q4Q541"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001834"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="UniProtKB/TrEMBL:Q4Q541"
                     /translation="MAKFMTFGAATALGAAFHTYTSSQRMAAECAAKKEAFTTKFKPF
                     VLGEVLNLAEDVAIFRFLLNDPSDVFDLVPCSTLQAHFKEGANMVDQPMRFYTPITPN
                     GTKGYFDLLVKKQRPGRFTEHLFSMDVGESLLFRAIQYKLTYKKNRWTDVGMICGGTG
                     LCPILQFMNASLETEGDSTRLNMLFANRSEKKILLKGLLDEKAREHKDRLQIFYTVDN
                     FDDPDIIANPVYKKGAPLTVDVASQPSTSPDGRKYFHGFKGYIDVPMLQATMPRPSPS
                     TLLLVCGPDPMMVKVVGAAPMVLRAMSGGLAYQPSGAVLNNAADVSGFLGTLGYQKEM
                     VYRF"
     gene            complement(<921064..>922998)
                     /locus_tag="LMJF_32_2350"
                     /db_xref="GeneID:5656355"
     mRNA            complement(<921064..>922998)
                     /locus_tag="LMJF_32_2350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685506.1"
                     /db_xref="GeneID:5656355"
     CDS             complement(921064..922998)
                     /locus_tag="LMJF_32_2350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685558.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656355"
                     /db_xref="GOA:Q4Q540"
                     /db_xref="InterPro:IPR007758"
                     /db_xref="InterPro:IPR026010"
                     /db_xref="UniProtKB/TrEMBL:Q4Q540"
                     /translation="MAFNAFASSTAPGFGAASTPAGVCGFGHAGGVAPTAPTGAGGFN
                     AAPASAPTSGFNFGSGTSAPAAATPTASTVGFGGFSAGHAASTSVPAASGFSTAPQPP
                     ASTPTPFGGSGFGPGAAASATAAPAASTPFAAASIPAAPVSGGGGVGGTTGSAAATPF
                     NGFGTNAGATLAAPVGAAPATAPASVSPALGAFNFATASVASASAATAPANFGPFGGA
                     AAAAAPAPVALTASAEGAKAPSNAGFGPNSGSSAPSAGLPVAGAGTSGLAAAAAGCGD
                     KSAAPVPAGGGFNFAGAATTAPVTAGGFNLGSAASALAAPAANKTPVPAAAVPGGFSF
                     GGAASSPAAAPAAASAAGGFGVTSATPAPAAAPAAAPSISGGFTFGSTGAAAASSDAA
                     TAAGATAPSAVTGSPPAAATGVSATSATAGVASSAKRAENAPPSSAAAATAASPSQEF
                     DGKSLAAVLRKLDVDISFDQRHFADLARHVVARDRQIMTRGRELAEVQSVMKDALTAA
                     KSAEATLAECKQRQTALSEYLQSLEDKIQPYYAQWEQRQQQQQQQQSHSVDPCGADQQ
                     RAVTYDNAMALLEEVQGVEEKVGRAVRQHNHSRDELLGLSEIEGTMRLIDGQLCALQC
                     CSALASALEMELDRLLGKAA"
     gene            complement(<923822..>926263)
                     /locus_tag="LMJF_32_2360"
                     /db_xref="GeneID:5656356"
     mRNA            complement(<923822..>926263)
                     /locus_tag="LMJF_32_2360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685507.1"
                     /db_xref="GeneID:5656356"
     CDS             complement(923822..926263)
                     /locus_tag="LMJF_32_2360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685559.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656356"
                     /db_xref="UniProtKB/TrEMBL:Q4Q539"
                     /translation="MSSAQGLARYFQGLAAGDEMAGLIRGLRTSMWQCYQNCLHCPAA
                     VQVPTSPALASGGESSVEASADGSAALSSRIDDASLRGSSFADAGTRPTSRGNHGVGM
                     GAAPLAAVPAAPAPIPLGKLKAAERRQYWSATKAAMLFAVESPSVAEEATALHCSTIT
                     RSLLYNYYYPSEGGGAASSTPRVSTTLETAPAMSNLHRGEVRWVLSDTRVAELAREAL
                     KMDRCDSGACGWQRALALLRQVDPTPLTSAVELELYRRTDGRHWAEALGCLWRIGPAH
                     WTEMDVAAAVRCLYSAGRRHHQENRVTLSADEVARAATEGGEGGLHVSSSLFQARLKA
                     QALRIHHAVETAGVLRWSTSSTFNDTLGLVALDTAGWLDACALLDKLLAGAAAAACSR
                     DAGVRGGATRGAVGVVRREKAVHTVQRITGDEAVADSELFPASTFYDSEMVSHSSGTL
                     VAPHSPQRARSPESLYHLVRANAVTVHQTCRALRSRWDVGLRYVQLLQDAFVDTLDLP
                     SDTAATEDVLRLCITGHQWEAALRLVRAHQAAMADGAEGDRRPAAAEVAASKRAQLPQ
                     HRKHYRPDVFVQLVRLFGSVQASRSAAYDLIHRYAAPSAAFSTARVNVNSNSPTVVGL
                     ELSKHYNTNTLSRAYNFLVQSADTLDAAEQLLEQLRHSRSPPLQGCSTAAQDAKSHAG
                     GDAGQPRRYIDAGLAGLETESVAHIAYLSAVAGDWRRALHHVNALLHEPRYRTTFFPT
                     ARLHDAVQYALEQAPSPGPSWQVSLQLFTDMMERNVPSSEVSFQSAVKRCFAGGVPDQ
                     AQRLFHFVLRNGVRP"
     gene            complement(<928291..>929127)
                     /locus_tag="LMJF_32_2370"
                     /db_xref="GeneID:5656357"
     mRNA            complement(<928291..>929127)
                     /locus_tag="LMJF_32_2370"
                     /product="aquaporin-like protein"
                     /transcript_id="XM_001685508.1"
                     /db_xref="GeneID:5656357"
     CDS             complement(928291..929127)
                     /locus_tag="LMJF_32_2370"
                     /codon_start=1
                     /product="aquaporin-like protein"
                     /protein_id="XP_001685560.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656357"
                     /db_xref="GOA:Q4Q538"
                     /db_xref="InterPro:IPR000425"
                     /db_xref="InterPro:IPR022357"
                     /db_xref="InterPro:IPR023271"
                     /db_xref="UniProtKB/TrEMBL:Q4Q538"
                     /translation="MCALQLDAAMGAEKKPYLARQIPLIQLSRYQAKFVCEGIGTFIF
                     LMTTSLAEMNCGHLAVDGKTRTRNLAPIAEGFMLCVLIFMFGYISGGHFNPAVTFGVV
                     MIRGMRVEEAISYWVAQVVGALVGAGLSILVHGSTQHLPAPQVVQNTAECIFSAFVAE
                     AVFTMLLVTVVLHAAYSQQRNNDFYGLAVGMCLLASQYAVGGVSGGAFNPAVATGLQV
                     TKFIAAGYFTQLLYLWLYWAAPACGAIAAAFLFMLTHPVPKDEDGELQQQRVARHLYS
                     SF"
     gene            complement(<930235..>932016)
                     /locus_tag="LMJF_32_2380"
                     /db_xref="GeneID:5656358"
     mRNA            complement(<930235..>932016)
                     /locus_tag="LMJF_32_2380"
                     /product="aquaporin-like protein"
                     /transcript_id="XM_001685509.1"
                     /db_xref="GeneID:5656358"
     CDS             complement(930235..932016)
                     /locus_tag="LMJF_32_2380"
                     /codon_start=1
                     /product="aquaporin-like protein"
                     /protein_id="XP_001685561.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656358"
                     /db_xref="GOA:Q4Q537"
                     /db_xref="InterPro:IPR000425"
                     /db_xref="InterPro:IPR022357"
                     /db_xref="InterPro:IPR023271"
                     /db_xref="UniProtKB/TrEMBL:Q4Q537"
                     /translation="MEGYALGNGIQGADPPGGAGVWSSGAPTPLSFTPPLVSAVHLPC
                     APPAAVSSPTSNNGFGAAVADGPHMIHVLGSATENVSAAHQASLTPLVSASASAAHRP
                     TSQGPFPAASTLTSPSLAMTGWGGGGTGDSTDDPNTSFSGATTTSATDTGEDRGFEFD
                     RAGRRHIARVVDPTEVPALKYTIAVSVTRDGKVVEEQLDPFELGRLYGQRQAALRKLR
                     SRYDFLAVPEWVRLHPLLGTYFAELVGTFGWVLTLALVSVRNESIFNISDATSMTPLP
                     IGFMFTSMIFTFGYISSSHFNPAVSIAVFLVRHMKVAQCCAYILCQLAGSLAAGVVAM
                     IIQGNKDIFVPSVSTNYVSSGIFLELIFTFAMCLVVLNIAYSRQSGNFFYGFAVGMTI
                     SAGSASAGRISGGAFNPAAASGLQVAMCLAGRCDDLKSIWVYWLAPVVGAILAAILFS
                     QMAQPAETQVLEDRKVFQNVNELHRQRMAAQAFAIRATAGTAAAKRCAGSADERKPAS
                     SSTSSERQPSSFSSDPRGAREMTEVPHTRTPRTCEGRDAEHVHASTQDGAEELDSGHT
                     RLPLQALSRGEVKVATTSWEGPTFNRR"
     gene            complement(<933090..>934661)
                     /locus_tag="LMJF_32_2390"
                     /db_xref="GeneID:5656359"
     mRNA            complement(<933090..>934661)
                     /locus_tag="LMJF_32_2390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685510.1"
                     /db_xref="GeneID:5656359"
     CDS             complement(933090..934661)
                     /locus_tag="LMJF_32_2390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685562.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656359"
                     /db_xref="UniProtKB/TrEMBL:Q4Q536"
                     /translation="MIPRYDGLVPAIRGPASACAVASVNATPSSTTKRTAAATTVARY
                     VICPVETTGTENAHVNATAERERRLFAFLPSVDCAAPPRELRVSSHYFEDALVASVAS
                     SDAESGEDLDEGEESHTSTARRGNTREDGAHGSNSGSRKRRRARRREPMRLEYDGFLA
                     PATEATKRVRLVSTPASEYSHLTCVLLQLPTAWREQDMDEGEGHGRTACVSSSSTSKP
                     LITSMPLRRPILQLWGERNTAAAGPNDGSLCTGSSAASISAAWGSDTRLQISKKDWKT
                     MDAAEEDLHKPTNWSDDDGGDASDEGRGKSASGADDAISARARKREREEATSIAVRSF
                     LAGTKEALRQQGAVGAADGFAQPQPAVRSDNAAPVSARVETSAPVKAAAKRATVTVPL
                     SSGSSGSRVRSSVATPAVPPTHALTTNSAAPLPSSGVAPPDGSASLDSLACTVVTGML
                     SSEARRAATLMELQKRILKQLPEFATMSQKMKSTATKQEAVAWFQTSQQALRAWLVEH
                     GHTIDSDGTVTFGDA"
     gene            complement(<936380..>937414)
                     /locus_tag="LMJF_32_2400"
                     /db_xref="GeneID:5656360"
     mRNA            complement(<936380..>937414)
                     /locus_tag="LMJF_32_2400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685511.1"
                     /db_xref="GeneID:5656360"
     CDS             complement(936380..937414)
                     /locus_tag="LMJF_32_2400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685563.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656360"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q4Q535"
                     /translation="MMRRVPITVSFDALDTLIQITRGLGYQYRSSYASFLLAHGIDLD
                     ATCPNATCEAVQELALKAIRDQVRAERAAWTRSANPKEMPIGGDTDEELRSFWARVLR
                     QTYTCATLYDGAAADVVQRIEELWGDHHNEVRCFEDYVLFDQFSSTKAHSWCPEGLRT
                     LQCLRKWNQVQMSCDESAVRPGLADTKPASDLDVFSPSSAAASPVLFLAAPPFVVSNM
                     DPRIRGVFMQLGAFEAGESGEPPLLSRIISARDTGYAKPSPAGILTGVRDIAASYRAA
                     CQSCGACDAGVDVHRHVHVGDADADRVACERAGCHFVQCDPATGVTWGLLQAKLQELE
                     ALYGSAPLPH"
     gene            complement(938243..940231)
                     /locus_tag="LMJF_32_ncRNA2:ncRNA"
                     /db_xref="GeneID:12982166"
     ncRNA           complement(938243..940231)
                     /ncRNA_class="other"
                     /locus_tag="LMJF_32_ncRNA2:ncRNA"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460993.1"
                     /db_xref="GeneID:12982166"
     gene            complement(<942366..>948443)
                     /locus_tag="LMJF_32_2410"
                     /db_xref="GeneID:5656361"
     mRNA            complement(<942366..>948443)
                     /locus_tag="LMJF_32_2410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685512.1"
                     /db_xref="GeneID:5656361"
     CDS             complement(942366..948443)
                     /locus_tag="LMJF_32_2410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685564.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656361"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q4Q534"
                     /translation="MSAHQQLPHSPLARASEGIAHAPSTGHSSRVSQDVRQARAQQAF
                     DAQASELEQQLDGQLGLVFTLMRQVMVLDAHVAAGSTADTSNTLLSSGAATEDHRELL
                     VGQLEEVEDAAVSTALHFVELANRHALEWMNQGHYSAALQLLQRADRLLRQNAGRVFR
                     YLPDPVELEAPSINGAVGGRNGPRDGCDTTPLQRPAAASAQARSHDRKSPAIFTSSDS
                     GASINHISSYNVCSISVPFFSPSQEPRRLKAVAAVAHNLGVYHFKLGEYTLASPLFAR
                     SAALEEELQAPGIGITYFNMAQTQHGLRQLTEALRYAEMAEEAVERQVFQAKDKATQM
                     RRRLTQERAFQVRDFPDGAHAARRGGEDNRDGVAAAANTSADGHRCSDAAATTEGEEE
                     KALMRMWIQWRESVCFLSYVKQTHAGWLDEMGLYKEAYQHYQQAHRWLLAIPRLATEE
                     QQRAQLLKQYMATMKARWRREEVEVELYHHPLRTSSAARSGAVPAASYPSHSTRAPSK
                     HRVRTHQRPQRSPAVLSAAVPIAKYFTSPLQSTVVTSVLPRNVEVVGRRPRGPSRAFH
                     REIFPTPHEAPFLWPAASAFAPRNSMGAQPRRRPSSANVALHSAYAPRRPSASSLRHR
                     PTATDHATASAEQDHKPLSHPSPETREQQQQQQQQHGGKRASWDPSMRVPIPPPGRRT
                     GYRTSTGRAGSAASGPLLHRGSASLLRSNAGEPEMFTTARLPPRASSTPYDAHTRFAP
                     QYHPSPPREPSPVSSTLAESCVERGLLFEAEPETPKSQPHHRHSEPVIPDALIVESVQ
                     KVAADPPGQRSEAAATPQKGSAGAGVSDLTASAPSAARQLPGLTPSPRIPGDLTWCVT
                     VLQAFLRPRCRHRTLLDTEGERDRGKPADRGSLGGEYGGHVAVDAIMKRRKSVISYES
                     DDGDASGGSAARAPTGTRSPDRFHSEGFHGAGDSADAAALTATCEYVATCDSGAVIAV
                     ALTPFPISHEKNEGEIYYLHEPSVDDDEVMLKAEPLDSGRRGRMPVSADALLGRKGDP
                     CCGNASANTSKTNTHDTSGKGEGDAMAMLAEEREDAPGNALVLETRASVPEEAKADSL
                     STLPRLNAGDRKDSVVASLAMHAHKDDQHQVCGAEGRGAAAQRTASPFRASADEVLRA
                     EQAELACAAVAVAGSLSARQSTTLNKVASSVATVAEAFASAAGDYSDVPKPSSLSPTS
                     WAACRGTRTPFQLPQNPEAREGELKTLPAPAGLLHSSHSPVPQAPQETNRRVDQVDGS
                     CSAGLGAAGEAEASNIFCAAAHATLSDRSREDDVSDRTAARKAALWDSPTPPSAFSAC
                     AENVCASSVEDTALPGGSSMRASISATSARFTAYAHEAPQKIGSSASACTGDPEVEGD
                     NGPASEALQQEMEEGGVSVWHKGSSAAPEASAASAGRAASSGRETAGCGEAVPWTEKV
                     SDATDALAVTVALPSAEAEEQLTTPDNDGHTHKQSRAATVLSPPSRIRESCRGEFPTT
                     TSAARPPHTKGADLQWPEDLASAKATTEERRAEVSAAIKEGPSPEEAMAAPQPLATLP
                     PRRGRVFVFAPHQLAASASMELTSSDLSFRSGDAGERIRSPTRTLKQPAATLGTETVE
                     DGAAKPVLLRVAGGGRTSGSSDGVLCSKEGHCCAAAMMACATAEDETVGRRTASIGST
                     TTRITQLRGSSSRSIHDGNDLRLGDGESPVKLEAVKLAESTASGSTMAPSPAIMQDRL
                     PPPSTSVDVAVPNETPVTVNEDVAQAKEKDVTQLQRSRQDFLSARETDIIANMDTPPL
                     CTSSAPNAPELLDSSKPPCSSAVFAPISASVAVAPVEASRGSGRAAALETKPLAAVPP
                     PVSPRPGSLATLPEAGEGAAVLLSPRNGALGREGDLLGRVHGGDAHEATPPGKGDVLA
                     TTEGETALEVGTNHPVSEAKDGVAGAHEKARLRSEGAHGAAVASCEVSAGHRSPPHLP
                     APFHEPRPQQQQRLGTNESTWSDVETDEAQRRYIRDQIVQEEAAGVIQQAWRDYVAAR
                     LRRQLHLLW"
     gene            complement(<950900..>953557)
                     /locus_tag="LMJF_32_2420"
                     /db_xref="GeneID:5656362"
     mRNA            complement(<950900..>953557)
                     /locus_tag="LMJF_32_2420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685513.1"
                     /db_xref="GeneID:5656362"
     CDS             complement(950900..953557)
                     /locus_tag="LMJF_32_2420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685565.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656362"
                     /db_xref="UniProtKB/TrEMBL:Q4Q533"
                     /translation="MPPDAGASASTVPYAFPVGRALRYVQLGRCHHEQTEGQTTLHEW
                     LAETPFSPSAEAVGQLLGNGGANVEGCATSKTDAHGPELVAEVSSFAKYHAHHVLIEF
                     KELRRRIAEADPCAQVARVGSQRPANSSPSNRHEHGADRNTQEPSASSSMSPSPTAPL
                     SPHPLPAHLTAALTQTLFSVTVLLHVSGLFSVAETHVERLLDVCFSASIFLAQDSAAA
                     AALTRRQRGNLSASSSASKSPRRHGATAAVVEAPSRSRHLHSLHWAIVHFSAGVQHWG
                     LLEHTSPLQDVGRTQRPYERLLQVHAALLCEQTRWCVDHVLWHELVLLKAGRRAEAAR
                     DAWFMGPDAAAYSVLFGAQSNSSTSCRNAAAAGSLARCVPPRLQQRRLQLLPLLWLSL
                     LCSQLQKRQTPTVQTPSTCAAPHSSPSPPDDAEVTWASARHAFAALLPLFSKDARLDV
                     TAWAALHLLFLPHRRAHLSNAKGAEAKMTQPCTISAPAPAANATLPELCALLARVERD
                     GALLELGPALPGPACVHAESSAHFHLASFLRRWLDASTAPPSVPSSRGTAHVGLAGSS
                     RRICRGDSALSTLQTPVHTAGQLYRALLNIPLSALFLPSPKYSFGDGLCSASAVAQYA
                     STEPSPRQRLSVTAEGVRLLNRLLLHVLLQWRSDRRVRRVPQSSGGVSARSMLEKLPS
                     AGGAAPIVPECSWSASTPCTESTSSGGRREATEAAQGDPPPGALPASRPGLSQKVTVS
                     AAESRRQWERELVCVLNTTLHLDALITAGADDGVSRDGSSDRGTGLIRAFVAPTAQAV
                     VRALAEQLGRSLLPWRLLLLHCEHVSLTAVELQLLGKLDATLRHVLLLYDPQRVCASD
                     AEAATPPTDVGSLPMMYRVSMNALMRTAA"
     gene            complement(<954521..>955765)
                     /locus_tag="LMJF_32_2430"
                     /db_xref="GeneID:5656363"
     mRNA            complement(<954521..>955765)
                     /locus_tag="LMJF_32_2430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685514.1"
                     /db_xref="GeneID:5656363"
     CDS             complement(954521..955765)
                     /locus_tag="LMJF_32_2430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685566.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656363"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR023267"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4Q532"
                     /translation="MPPLRGAGRGRNKTGTVPTARTNGGFKAKGSVKPRTFDEYYGEI
                     YGARWHTLRTAMMEAPRKVALWNRFSQVPFEEATRGLSRVEPNSLIQAFQPTQTANST
                     EAVSTADRGINDDDEAKLQGKALAAAADDLLHRNGVIDKPPIDAFGIKAYYLLDYASA
                     HVVEQLQVGAFDTVLDMCAAPGGKSIAVAQFLSPDGALTCNEARADRCARLRRNLQEH
                     VPVNYVPWRTTQRDAQTWYDPGAFSRVLVDAPCSSERHLLQQSGGSPLSLREWSEETT
                     VQLAALQRMLLQRAIETCRVGGRIVYSTCSISPLENDGVVGEVLQRTRCEVKVIKTSP
                     AAAAAAPVALPKTATDAGESDASGAEACAPHTPTVLGEATAYGRLLLPDTCHGWGPMF
                     LCVLEKTAEHKDVSSSSEDDDE"
     gene            complement(<956704..>957954)
                     /locus_tag="LMJF_32_2440"
                     /db_xref="GeneID:5656364"
     mRNA            complement(<956704..>957954)
                     /locus_tag="LMJF_32_2440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685515.1"
                     /db_xref="GeneID:5656364"
     CDS             complement(956704..957954)
                     /locus_tag="LMJF_32_2440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685567.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656364"
                     /db_xref="GOA:Q4Q531"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="UniProtKB/TrEMBL:Q4Q531"
                     /translation="MVSCRWQSTGDGYGYMTDDSSGLQSELSHALEGEGNLSVDAMLS
                     QSLVKADLQTPSARILLKKIERPPGRFDLLTNSLVYSWQTTAAQARKVTGPMREWASE
                     LKYRTGVHLEVEPTNPTRLGVPEEEGGYAAADDVELTVYLFGSERGIFNCRQLMETAL
                     DQNPAYVRLAVFRRRPGKGVSTSTAAVPRPQEDVEWLLLRRINRDLRPPDIPPISLKT
                     PGKWTLLYEQYKEAAIRTLWEETGITVEAGNVYPTAVLCQDNPIYYWRVPVHYFLAEV
                     PYDVQVLGPQVGLNTYMHHWDSSLLRQSPDPIDRAWAQLADPETGCAWMKQPMIDELQ
                     RPLRGENYMATRYTPPPYSQLNHALGLAVPAEAAGEASAADSALSAATTAEGGEAQDD
                     VKEDDAAAPSADADASSSNDKPSS"
     gene            complement(<959534..>960604)
                     /locus_tag="LMJF_32_2450"
                     /db_xref="GeneID:5656365"
     mRNA            complement(<959534..>960604)
                     /locus_tag="LMJF_32_2450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685516.1"
                     /db_xref="GeneID:5656365"
     CDS             complement(959534..960604)
                     /locus_tag="LMJF_32_2450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685568.1"
                     /db_xref="GeneID:5656365"
                     /db_xref="GOA:Q4Q530"
                     /db_xref="InterPro:IPR002058"
                     /db_xref="UniProtKB/TrEMBL:Q4Q530"
                     /translation="MKGKAGRSIAAISDVRAAVLRFCDEQLSRRLDTQPVAEVHQKVS
                     ACVQTVDPAMTPYIFGSTAVLGVHEQGSDVDFVCLSPTDVQDGKGADAVSEVAKGLQS
                     DFLFRLGEVVKREHYLWGIELVRRTRVPVLRVKGGLGVDGVSFDVTANRRNGVRNSAL
                     LRAYFTQCPEARWLSMLVKQWSKKTGLNASVEGGCITSYGWNIMIVYYLLRRRLVTLV
                     PVESCDVADIAPMPPHMPLESLQQGGQGLADMLMDFVSYYLDEFAPETEVMSLTRAAG
                     ETTTEMLSWTKQAEDMARIRGEKIHYRWCIEDPYEYDLNVGRNVTPFKLMLLRKHLER
                     ARETALLLLATPPPSATARSVK"
     gene            complement(<961756..>964695)
                     /locus_tag="LMJF_32_2460"
                     /db_xref="GeneID:5656366"
     mRNA            complement(<961756..>964695)
                     /locus_tag="LMJF_32_2460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685517.1"
                     /db_xref="GeneID:5656366"
     CDS             complement(961756..964695)
                     /locus_tag="LMJF_32_2460"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685569.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656366"
                     /db_xref="UniProtKB/TrEMBL:Q4Q529"
                     /translation="MLQSGVSQVQRPRHITASTHVLATRLKHNTAERVTVGNTPLHVL
                     HLCDVQCVAPLFASCVSLTTMTIHLKYVASSTALEALLCAAATSPTLTHISVIGGVTS
                     MESAAMASGLAAFTWHERMHAHRVLRADATSESPLPRTVRRVPSALEGYPVMSGRGGE
                     RGSARWRRCPSSDRSAALSPYARTPLLAHLRRQQCANSECGVPPPPSAASRPTQWRLR
                     RGGAMWPVPCTVSPRGMPVSHPASLASSPVFLRTPPHVRPLADHHLEGGVHLALELHR
                     LEEATAALLLDGLRRAHRIISAEVRLCVVTVEARRAGQRLAHEALKAAAHHRQRRSLR
                     LTQSAGSAAARPSRLPQARAKGQDGVARCRWPPHTSGLRVSPGPGLRTPVPPPPSPPQ
                     RPPASPRPVTAVEPDARGTDEGGCRPLLSVEVRGPRQQTAGRHAQQLAPRYPIASVTL
                     PWQSGGTSVRPPTSLTPSPFSVASGAATMRAHRPVLSDDERVGVQTSQADAFRRRGRH
                     ASPPPAGVGANALSRLVSPHQHLARAGRLYSPPRWVSGARPLATGAAPPPLPLSKVAF
                     CPTPQTSSAHSTLSPAGLRLGLCASLSTSSSSWSSRSSSPLPRPPQSTPRRAAEAFAN
                     FVAREQAVEVEKGEYATRPAQRTPPGSVSARLDRRGLRRLATFSARPPHSPPSYPGVL
                     CSPRYCLRRGSDSLGLRAEHCRTPRPQTPPCCSSSRCSCFVCRSRPPRSPVASARPAP
                     RTATPTNLENAILALAAATASAPQSRQPRKHDVTSARESRDAGDVTPTTHSAATSVNG
                     ITPTRRWSGGERDSDSAAAFHEEAAASSSRRASRSAHAAADSVHRSLNMDLGEGDHTS
                     ARHSSARARVEPAARRREGSHLQVSHTQMPSSAPLQSPEHQQRDEEVGYVVYQNSVAF
                     LRARVTEINRHVVWHQVQSAKAVEAHSKRLAELGVTFSDRVTEELTDILMVLTDMEHG
                     SRISSRR"
     gene            complement(<969424..>969699)
                     /locus_tag="LMJF_32_2470"
                     /db_xref="GeneID:5656367"
     mRNA            complement(<969424..>969699)
                     /locus_tag="LMJF_32_2470"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685518.1"
                     /db_xref="GeneID:5656367"
     CDS             complement(969424..969699)
                     /locus_tag="LMJF_32_2470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685570.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656367"
                     /db_xref="UniProtKB/TrEMBL:Q4Q528"
                     /translation="MALPDDRPALCVRTHKNKSKMARRARPVAEPSVLGPLRLIMVVD
                     PLRVHRSQQQLSAALVHFATHVSLALHELLPSRLWRSRQVPLQDSGL"
     gene            complement(<971586..>971990)
                     /locus_tag="LMJF_32_2480"
                     /db_xref="GeneID:5656368"
     mRNA            complement(<971586..>971990)
                     /locus_tag="LMJF_32_2480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685519.1"
                     /db_xref="GeneID:5656368"
     CDS             complement(971586..971990)
                     /locus_tag="LMJF_32_2480"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685571.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656368"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4Q527"
                     /translation="MSSGRNSPDSDSVEEWAAPPQAFLEGDASSGAAAPTAAAVGSRS
                     MEAMDAVERDLAGASVTVLFQLPDGEMYRAMFFMGQSVENMKALLEKEKDLPYEKTTL
                     YLGDRMLFDPLSLSDLPFDPKIENLVKVERTT"
     gene            complement(<972689..>976561)
                     /locus_tag="LMJF_32_2490"
                     /db_xref="GeneID:5656369"
     mRNA            complement(<972689..>976561)
                     /locus_tag="LMJF_32_2490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685520.1"
                     /db_xref="GeneID:5656369"
     CDS             complement(972689..976561)
                     /locus_tag="LMJF_32_2490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685572.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656369"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q4Q526"
                     /translation="MDERKDKYEQLLAKVDWHAPHPPKGYQYGAGRGAKGFITTAELT
                     TGVNTTAKMTRDENDFFAAMERLEERTRKPKRESDGAAGNQAAWRHSSGVSSSNADHG
                     APAKMKLSLDDLATLEVVPSPTAAKTITAADSPSACSGPAPSGSLTTVNSSLPAPALG
                     PSAPLVVRSARTEEGEAAEEHVFAEERVLTAYDVLKGKASAVQTGLHNVLAMGSTEEQ
                     TTWITHARAYREMGMTRRAYQTLVDGCAVTGRKGKRIWEERLRYLAKDNYAGRRRLLE
                     EATSACPTEEELWTQLLDCIPLLERVPCLQRAVLACPSSEQLWLRLVQCVPSLHDQRA
                     LLQKALQHTPTLPLLWARLARLETYQTGKEMFQAAAVRYPSLALIIEAAKYVEWHVLA
                     HYWACRFSPTNTPSQLAAHHGSQVLEAEKSGAGSAASMAAMHTAVQRADMEVRDLVRT
                     AQRNYLDLSEAGSRHAWLSLALSLLHKGDAKGHSGIEPSNRDGEATETFRAATPAPSV
                     YVCTAAHMFLCIVDPNDKKGAAHTIPATWLEDLVALLPADAASQHSVQCVLWYSWLRL
                     QQQQLESMNTSNEPSETLAVVGSSAAAAVARSTATMMPRDILPVLSSAVLSASSAVLH
                     DDLPALWCCGRGGSARTEDGAVVPSPARQPAVAHAALGARSEEQRVAEEDEEEELGKP
                     SVAPAAASTTPAPVKAKAADLESELPLPPPLVVALASLLGSITHVAAAAAGLLAGASL
                     GSQRPNAQLNAASSIPADARARSQLSLALELLLVEVPLAVSDALYRRCCFAAALSFID
                     RLLHTINSSATEQAAGALRLYVARSKMLAAVGDTTAADACLVSAIAAAKGAAATAQQQ
                     HREEEVWVKLAVLRRSQGHPIDALLVDALQRFPRSSRLWLMRLEEKRCAIQQRQDVLA
                     PTSTVVPVIDLLRHDESLASDVRELRVLCKKALAPDHCRAVAAVWVFVAARVEAELLQ
                     NVAAARALLTDALAACAADLQSTRSHGLARGVSAQELERQASAVARIGVTQAMLDVQY
                     GTPGQALEMVQEVLQRLPKTREGTFAMAQDDAVGELLGLFISLEPPASRGRAAAQVMR
                     QWKSREPLALCAVAQLYYAAGQYARALDQARKAVQLSKGRCGDAVGLLWRMAESPAMQ
                     PLVREIMAGKTGEDSDPSGEGEKHVDALSDAASVGQLTAEAIRQWVFSVMNSSADAGV
                     GSSSISGASCALATEDDAPAASTGSPATPLIVVPNSGPLWITVAKAEDPSNVTLLGYR
                     RPVAEMLRDVANRITLKGPESASAATRA"
     gene            complement(<977843..>978331)
                     /locus_tag="LMJF_32_2500"
                     /db_xref="GeneID:5656370"
     mRNA            complement(<977843..>978331)
                     /locus_tag="LMJF_32_2500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685521.1"
                     /db_xref="GeneID:5656370"
     CDS             complement(977843..978331)
                     /locus_tag="LMJF_32_2500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685573.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656370"
                     /db_xref="UniProtKB/TrEMBL:Q4Q525"
                     /translation="MAGAPPVSFVHAATRTLQHDIRTFTHWDPAANKLQCAIRDAAYL
                     VIDLPRFFMYSHSNYGAMRRYIRQSRINKGKVNPEDFKDVDTNVLRESLIKYAQAKGP
                     LQKIDFRWFYWMYAVMIIYVGWQGMYLQSLLDARVDRMGASLEQRRDMYDDDYLEEVR
                     PR"
     gene            complement(<981135..>983132)
                     /locus_tag="LMJF_32_2510"
                     /db_xref="GeneID:5656371"
     mRNA            complement(<981135..>983132)
                     /locus_tag="LMJF_32_2510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685522.1"
                     /db_xref="GeneID:5656371"
     CDS             complement(981135..983132)
                     /locus_tag="LMJF_32_2510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685574.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656371"
                     /db_xref="UniProtKB/TrEMBL:Q4Q524"
                     /translation="MASHGEPSLPAAGVQRRGTVGGAGVTTITTAVGRLLTDYAVQLR
                     EDLGFTDVTGGVSFKSGWEVEDGDVVKVEGEGSGSAGDSAVETRHKTSSRHATDVDDE
                     VAPLTEDDAAECRQRLQRLQRVKHLLVQFSGRADRRRVHTEAVKTSFLRSGSTAEDAD
                     EADGACCVSCETVRQNPVLMLALRRFDRIAQGFQGTAAPAAVAKVQGGGLREAGTAAS
                     ASETNKGNCIQPFLNPVPLAEGALSAFSRNVNIVFRRRPTAGGTPATGKRPRDEAGDS
                     AASSWASTAVAPDTHNYWGLLAAQQRRRRFALYTARAALLPRVNAMCAPLYVSPAVQE
                     LAQLNSEAERLMLKRAWCVHTKAHLLRELPWAARDVAAYRVALREALQSFTESQQDAF
                     LIDVVYAQFVCAEGGVVRVCVQHALFLDLTYDVRLRQWTLVALHWNIFTTSAGASLLT
                     SQSVLAVPHAQTPSTPPAAPATAARAPLIAHSSAHGTVDSASPLPEASTPASFVRVVP
                     QDREALHRFLRLAFEQEGLSGGLHAANRLVCAVVMDTFAIQLQSLQQSFFTGGGLGRL
                     VEMEVRPGTLISFHLSLPELFVPSAPVAHVKMTVAGGTVMLECVRGTDLSTRRVTLPL
                     GTSSLVASGAVGVNTATWKSSMTVVDMEALLWQCVCASAPS"
     gene            complement(<984371..>987151)
                     /locus_tag="LMJF_32_2520"
                     /db_xref="GeneID:5656372"
     mRNA            complement(<984371..>987151)
                     /locus_tag="LMJF_32_2520"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685523.1"
                     /db_xref="GeneID:5656372"
     CDS             complement(984371..987151)
                     /locus_tag="LMJF_32_2520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685575.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656372"
                     /db_xref="UniProtKB/TrEMBL:Q4Q523"
                     /translation="MLAWSRFPNSAAGSADPKQQQMMFANGAPCDSAVHLTPYGDVAN
                     RCFFLGAMNGMPVQPPSLAAASVTSPNTAAAGRPGVPHPGSYAVPRPAAGYYYPPYAA
                     VKQHAFQQPQAAGVMQGQVPPPPCQATTPSTTALALATQQRSAAASSPSCGPENAFAS
                     ASPHGKGRESPRNGRHRRGDGEAAATPASAAQPSSPGRHGGGRVYSGRRHHRDDPPPS
                     STSYTRAPSQVATATFGEVFPHSSNGPNSHIAPAAPAAAWGAAHDDDDGGDGGGRRRR
                     RRRHGDGGGERRRTASPSSPPEPRVDEEAKELHRRRHRHRGEVRGQHDNARSNTNEPK
                     PASAHLAGDLADTSRHHRSNHRSDQGWGSPPKSAAANVSTSTGAAAPSVGQTPVTTLV
                     ASVLQPVSVASTLMVAPPPPPAMVPAAPPAHRGVRSTLPLSAAAPSPPPAIPPTSTSK
                     GRRRHRSHRRTPSASSSSSGRSSDAALRQGSSSYSSSLSSHSETASRPASASSRDRRR
                     RRRRDRRGRRGRRGGRRLPRSASSSSRSRPAAGDPAGSAPSLPTNNNASVAEAPKKKG
                     DGGILSFFRRNKSTAAEADSATAGKAGAPGQETAMMMLLPMPQRALYDTSMWPCSAAV
                     APRDAVTGVQQREASSRTDAAGQRLRDRTPGRSQHPAPSSGTVNAHIPPQQGNGSHNP
                     SVDPSTAVAPSGKSKGLFGGLFRRKKDKADGGATAAADASANNASTVSGWPPSSSRPS
                     TSGTSVNLTTKVATTARLGTPSIPPKSAPPRGGYGAAPMSLSPAPDPALMSKRDVVGR
                     STKKSKAAAAHVRQEPLEPNMLRSPVQAQKQSQNQHSGGNRGRHRNESRGHPSPVGER
                     GGRTSGRRTLGNRDGSPRGRGRRRTPLKDSNSCSSDASSTSSSTKAAPKQHSGRGNTG
                     SKAARAQANNEI"
     gene            complement(<990584..>993460)
                     /locus_tag="LMJF_32_2530"
                     /db_xref="GeneID:5656373"
     mRNA            complement(<990584..>993460)
                     /locus_tag="LMJF_32_2530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685524.1"
                     /db_xref="GeneID:5656373"
     CDS             complement(990584..993460)
                     /locus_tag="LMJF_32_2530"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685576.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656373"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018488"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="UniProtKB/TrEMBL:Q4Q522"
                     /translation="MPVSSLIPKLPSGQQMLEGCLPTAVQEQLRAVALQVLQRLFVPI
                     LCRYRLRKARLALKHQLLLSHTSWEEVEEAAFSALQHTSYLGAVTRDLYTIADGGRSA
                     TRGGATEAQSAAVEVPPVDAATGAQIRDTVRDVLNSSYVQVAVHLQKEVLEWEWEPAS
                     EVLVLVGGSLERHGTAVAMAKATASTVGGSNVGAAASLAGSRRASAVAGYGFSRKSSV
                     VTGDAGRPGTARRASAAIFRSTSSHGGTAGSGIALPPTSGISCLLTDFVQERTASASG
                     MDGAAGAPAMSSSSVLQAHPSAPVPAEAETEFLTAPQVLGELACVGGFPYCAALSVSS
                     PMAVIVRIPKVVYCHMLSECATSVGQRRLLVEALQMRERLLPYFAPLTRARLRICPLL
                     TRLRTEQLDHIRDLIIPRVYAAGMECGEEEQPTHIFFIRRGVVQVQREATVPGNDGGT
                     HINNSEPASPHAAALTAAPQTNFSLELPRNRSLLVEGHTYGETSCIFGDSVGDRYTAV
                     THVDMYLLPFQVFIQLMKQEPDLHGPIYHSAQELSYMRDKEWTGALFGPRLVGANLPG
                     VHGVVPAEGMLALLAAGAHRGVGDGGTSVCRGKGPTEVSLSPFHPPSGSALRGGGGGH
                     YSPAVSRRVTIFEEASNPAGAGDRAGGGAGSAGVLPLTGGRVSSALLSAMEHLPLVSL
                     LSGATSDFHHACIQQWQCVRYNKGDVIVTSGEECNRLLLFFEGRAGIVMDAALLHEEM
                     RPGAALDSAGIASASPAAVCPIPSGHIVGYTCVRRHRWTRSIIALDDVVEVWELRRNA
                     FVQLLRTHGIVHDMQAATLQVLQPLAAQVRLKVLDYQPLLHPMPSSLWKEQAVPNVHP
                     VVVTNEETVLFPVWREGDFPLDRHQSVMEATARAGSAGGRRATLSSVNSVKAASVANE
                     LHRSATRLGDSAHLLSHRPSSVTGVLETGSISRDSLTAQCADAA"
     gene            complement(<994718..>996739)
                     /locus_tag="LMJF_32_2540"
                     /db_xref="GeneID:5656374"
     mRNA            complement(<994718..>996739)
                     /locus_tag="LMJF_32_2540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685525.1"
                     /db_xref="GeneID:5656374"
     CDS             complement(994718..996739)
                     /locus_tag="LMJF_32_2540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685577.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656374"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR006674"
                     /db_xref="UniProtKB/TrEMBL:Q4Q521"
                     /translation="MPPPLRSKAESVQREEVCQMVEPKRSMSVRDTLYGQLEFPPVIR
                     ILTNSPVVQRLRDLKQLGNSFYVYPGATHSRFEHSLGVCYLGMELYRSIVDGHREEHR
                     DFGVPEIANLTREAAQKDMHCIGIAGLCHDLGHGPLSHLFESFVRSSARPEEVQLRKW
                     SHEQASIMLLRKMWLENETELAELGFTESDLRYVELLINGLAPGKAWPDNVGRPKWAR
                     FTTEIIANKRSGLDVDKIDYIQRDSVACLGTPTFVSMSRLFQGARVVVGDNDETSIGY
                     PDKLDGVIEEIFLARSHLHRIVYQHRVTKVIDLMTLDALRAAGDVFEVSNGKDGVMPL
                     RSCVLHPDFYVHASDWIVLAILHGSNRTMAESWGSGASAEHRREKLAEACRILQRIHS
                     RHLYTTIGSYRHSEQTLINAGRLNSVEGSSQEVKREVMIHELLSDIEVTNLDLSVKLR
                     EWSRQHNGMTAMEILQAEITQTAGDMDKKHNPVSATYFFNPRQSTHCRVEPHFSCNVT
                     TTLFVKTGPVSSLVVVCRMPLTPQEKESLRVSFTSVADRLGKTDASSFSCTPMSQRGR
                     AAESSQQAASVARDESAATPNHSLAGGERLTSSVSGGYPAAKRLRLDLDTQRSRRDDF
                     DVDQSSEGVLQNDATTSSLELVTAAGYGQVGEKGQDDDDGEETDILSFS"
     gene            complement(<997934..>1002766)
                     /locus_tag="LMJF_32_2550"
                     /db_xref="GeneID:5656375"
     mRNA            complement(<997934..>1002766)
                     /locus_tag="LMJF_32_2550"
                     /product="adenosine monophosphate deaminase-like protein"
                     /transcript_id="XM_001685526.1"
                     /db_xref="GeneID:5656375"
     CDS             complement(997934..1002766)
                     /locus_tag="LMJF_32_2550"
                     /EC_number="3.5.4.6"
                     /codon_start=1
                     /product="adenosine monophosphate deaminase-like protein"
                     /protein_id="XP_001685578.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656375"
                     /db_xref="GOA:Q4Q520"
                     /db_xref="InterPro:IPR001365"
                     /db_xref="InterPro:IPR006329"
                     /db_xref="UniProtKB/TrEMBL:Q4Q520"
                     /translation="MESNTCMQSKVQGGATFVIERLLSHKHLQQPCSAVSASFESFRD
                     SGDGSGGMPGPADDDKAQRNFRGKGALEASDAAVAPTYHRIMIDGDEGDKDYFRCVGI
                     MAHIIQTRQTYKDTDQGQLEVPLTAEELERRYCGTAAPATSVLAGSPAASVSSPLSPP
                     AGKMAKGPLSQTGDSTAVASLMGLEFRHGVFGFEGMRTRIVPWEQYVRDIRAVYGAIE
                     NGPCLSTARMRLTSIAEKFRLYLLLNLEIEGSYDELYRDGGVYAPCTRVDNGVNMHTS
                     VVAPVLLEYVVTTALEQPRAPLYVDPHTQQVVTLAAYLEAGGIQDPRELTVEGLGLQP
                     TLYRNKYLPYDPFDAKLNPTGAFGATLLQALFSTDGPSHGNLCGVLLRAELEQREYQK
                     QQMTATEMTLEICGHHPEELTRLAMWVRRQGFNKFSRNRWVLAIQRERHSTKQLGPSQ
                     LPSLCTTVGDQLRHIFYPLFMATLCPQDPQWSDVAQLLCHTGALGIRTHAVVRSENFS
                     ATPVDPDALPCTSAPREDGQTTGHGSAMAHGGGCSDYYFFYYVWANLASLNALRTRLG
                     LHTLLFTPSVTEKAPAYDQLVSSFLLGDVVHDVSSLAQSWIMQFLYMYCRIGIVLSPL
                     RDNALSTAYFDSPFVKYFRQGMRVSISTSDPLYFHHHESQPLIEEYATLSKLCSLTPM
                     DTMELGRNSVLNSSFPPEVKQAWLGERFSALGAEGNDLRRCGVCDYRLQFRHETLAHE
                     EALLNQLLAKAGIKAPGGVGSGVDGGDSDGGALSLHLIPYAQSVLVSDLVQQSRHSRP
                     MNYTDQRIVYPRIDIYYGGHRSGFATDAVAALRQVVALRLKYVGNANRTAVAADANVH
                     VEDVFSTTRQFDEAQWEYNTYYGVCILSQQGKTPLWPTFLPTITEFIRDMSVIRQAAS
                     SVALQRLATHRLHLLEQKFLLHLSMNISNEAGKREEKEWNNRDFFTAYKVDTNVHTDA
                     GSNARTLLEFFVDKALHHSEDVVFERDHHPVTLKELLSEYEIDVHHITVDELNHHLNT
                     HPDLREIFLSPFNFMQGRYFAELTKRTLDIYEEDAFSYAENRLSITGASEQEWYDLAH
                     WFDCYGMASSRSRWMVCLKWHYRRLRRNGVLKNFGAFLDNVFHPLWEISMHPAKDTKF
                     HYLLAHLSGFDCIADESKIDLPLTDVSPHDWNSDLNPPYSYYMYYIWANIASLNEFRA
                     SRGLSTFTLRPQCGERGSMDHLVSGFCLANSINHGVTLARHPVLEYMWYIAQVGVAMS
                     PLSNTAGASAYLENPFPVFFHRGLNVSLATNQPLYFHFTREPLVEEYSIAAKLWKFEL
                     NDMSEIARNSVLQSGFSAAWKENALGPRYQLRSTLGNDVRRSRVSDIRVAYRYEVYHT
                     ELNFLDEQLAAASPGFAGNSSVAETAPPPAEADASRRHKNSLLTGVSLFSTDAGCEPA
                     AGAGRSPAPAASSQRMPRAMKLLEEELAICGDVWQGVASTPLLPTSVTNADGSLTFLH
                     TTNSRSVHLPRHSSSALLPLPLASRTAQLRGEIRRLDAELTRMRAVSLQVAGENNSIA
                     TQVNALRERLQTEGLTILGGLYGSANEEEAEASSNGNSAVTGAAAVEEVEGGDGRPSL
                     "
     gene            complement(<1003969..>1005225)
                     /gene="TTA1"
                     /locus_tag="LMJF_32_2560"
                     /db_xref="GeneID:5656376"
     mRNA            complement(<1003969..>1005225)
                     /gene="TTA1"
                     /locus_tag="LMJF_32_2560"
                     /product="putative GPI transamidase component Tta1"
                     /transcript_id="XM_001685527.1"
                     /db_xref="GeneID:5656376"
     CDS             complement(1003969..1005225)
                     /gene="TTA1"
                     /locus_tag="LMJF_32_2560"
                     /codon_start=1
                     /product="putative GPI transamidase component Tta1"
                     /protein_id="XP_001685579.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656376"
                     /db_xref="UniProtKB/TrEMBL:Q4Q519"
                     /translation="MPSSPRRPKSTAVAASSETWRRNSTKSFVALSAFIFLVVIGVHW
                     TTVSREHVELPMDRVLADLQASCLTLKDTPALTSASLPPAFYGLGVWVDSPVLLPSVH
                     AALALMKERLAEGLGTAAAGVPLQTHTLHTFVRLQSQMRDEAVAALVTDEPSGRFPSA
                     KRVMRTLERLANQQQLGLPTLKHAFLPEVGQEVELFGLSLFSVPASALPGDAASKVQC
                     FVADVRQAYCVLPLEEPDASDVASSGRTSFSAASLTPLSYRLRAASLEAEVRAALLSV
                     VAQQIGLASFKPADVAAWKRSREHQGCLHTIASVTSTLRSIAANTNMAVPQSTERMFA
                     VLERHVQSGSFLRAARAADDLQFHPLLTPQLYIPWDHSLVSQLILLLPMVSCTLLAAR
                     FLVEERWHDRARAKAAAEAQDAKKGQ"
     gene            complement(<1005844..>1008000)
                     /locus_tag="LMJF_32_2570"
                     /db_xref="GeneID:5656377"
     mRNA            complement(<1005844..>1008000)
                     /locus_tag="LMJF_32_2570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685528.1"
                     /db_xref="GeneID:5656377"
     CDS             complement(1005844..1008000)
                     /locus_tag="LMJF_32_2570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685580.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656377"
                     /db_xref="UniProtKB/TrEMBL:Q4Q518"
                     /translation="MREARSPARVSAPMDATVANSKETEASHTGEDAACERLYRNATK
                     QAEQRERGLQALREAQEVSFQANCTFHPSLAPVEEGHRKRKPTRRARSHSAGAGSMAG
                     ARGGRGTLPHRPMSSSAAQRTPSRSSRQLSVAQEDLRAAHPRRLAELRRRTEEEARSS
                     LCTGIPRSKASEPPRTYREQKKGCRGLIGAGSEHFAHYVNGRQTPLASTVGPQHCQGA
                     LAVSTPRLGGNSLLDRPPQLESEPSSAPSGTVGTPQQHAPARSGVHEKTTKTSDNGHA
                     AVAPPQVFGRLFRDSDERAAVRAFIELMRKKWMHTELYRSTTPSNGASAAARTHRDDQ
                     RRSSAKQRPPGAPCNKDAAAAIALAAGGAAARESPPRRTDTIRPFAVGHTVFDALYAE
                     REELQRRRENRHLQAGSDAETCTFHPFVDARSRVLAEECSRRLSEGNGLAAETVRERR
                     ARTAAGAEAKEAACRAQVHASDPAFSQPQTERNRERQEELLTALLHKCSGDVAERRLR
                     RARSQLTGSMTEGKRGHLQIIDNHKTAQQLIGARMTCPGTTSVTAAAAATTPLSPSVR
                     RTPRAGRMWVPSGATTRDAAPASVKDLAQSTIDRAEGYEALRSVSPLSPQRREGLCAC
                     FGLERAVRAVGSPVEQHCSQCSIPHSGACVYSPRDANGMPGAAARSGTAGMHRFKAAL
                     EDNTGTLHIAGAASSAYLRQLESELQTALEDWSQCV"
     gene            complement(<1009713..>1010888)
                     /locus_tag="LMJF_32_2580"
                     /db_xref="GeneID:5656378"
     mRNA            complement(<1009713..>1010888)
                     /locus_tag="LMJF_32_2580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685529.1"
                     /db_xref="GeneID:5656378"
     CDS             complement(1009713..1010888)
                     /locus_tag="LMJF_32_2580"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685581.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656378"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4Q517"
                     /translation="MLSVAARPPPPPPPPGTHAHTPTCSTMNLLHVVQTSYEPGTYIM
                     DGCLCNGSSSLALSLSTQAIRLYDTQAATFLGDIKEHTRPIQDLVATPAQPSMLYSCQ
                     RDCGVMITDLRQARAVHFLCDMCSSGAVCSSIGVTPSAPLLAIAADRDIHLVDTRTWC
                     SVKCLDQLHVDEVSRLRFLDDKILCSAGEDQMINFLSVEEGVIDDDVLLQAVNCGEVV
                     TKMNCFPELGVTAMVGSCENGYVFPHDLEQRETRHGRSSFEMYLVDWCMVSGQLHLVS
                     GVRDDSGDAGPLQVLNWATGQTQVLPKVHKELGRVAIGFGNRLITGGEDGMLAYWKHG
                     DLLPSEIATSVGYSAHRTGCGKVFASSRMHEEQDSGGGRGGGRGSGGPHRGGRGRPY"
     gene            complement(<1012213..>1012611)
                     /locus_tag="LMJF_32_2590"
                     /db_xref="GeneID:5656379"
     mRNA            complement(<1012213..>1012611)
                     /locus_tag="LMJF_32_2590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685530.1"
                     /db_xref="GeneID:5656379"
     CDS             complement(1012213..1012611)
                     /locus_tag="LMJF_32_2590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685582.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656379"
                     /db_xref="InterPro:IPR009069"
                     /db_xref="UniProtKB/TrEMBL:Q4Q516"
                     /translation="MTNDTEQEQSPSAELAAAAPEPQPSQPQEFYSLRGESHNAVDQE
                     KYGRARTHIAGLGHVSAKDVFKHYRRSWLTPFFGSNEPEPTLQQEGTQHPCQIFSREV
                     HQCLEDHHNSFAFCQTRVAAFQQCLREFSI"
     gene            complement(<1013736..>1015658)
                     /locus_tag="LMJF_32_2600"
                     /db_xref="GeneID:5656380"
     mRNA            complement(<1013736..>1015658)
                     /locus_tag="LMJF_32_2600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685531.1"
                     /db_xref="GeneID:5656380"
     CDS             complement(1013736..1015658)
                     /locus_tag="LMJF_32_2600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685583.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656380"
                     /db_xref="UniProtKB/TrEMBL:Q4Q515"
                     /translation="MVMAGKEDAAAAYCANLAAAYERLAHVLAVPLIDQELYSCLFLH
                     PLLHEHCAEARGFSVNVAAASAATFSPNALAVDHSGDALVALGGTELVVAALRAHEQQ
                     TLLVMHAIALRESVMTRIWACCRAYNDGQASLEEAQYTVLCLLEEHQVVTMLVVESVV
                     EWRQALSRPYPFLLKNGDNYLINIVHECAALGATAVVRSLSHVHLGRDPMCASVDLRR
                     LLHRLEIKHRTRLVNSGAMWKLGLHPLRAIASSRLPTGSAAGNACGSCVGAAPPSTCT
                     APKAHGSAPETQSYAGTSLDFLTEVMRLAEGLNKTGGRHCAPSPLPSASASTSSIAAG
                     VSSSSGTTAALRRLPLPSPRGDAAVQQEKQRRLLTATQVLEKEASVQRMLVKDLYDLA
                     HGQERFVPLLGVTGLFIPHDCGTSEKDIPADSWPLDKAAWPSLATMERRVDRLSCMST
                     AREALQAKHLLPAWERRMSNGMADLATSTGTRSSSRTTSLSFPAKGSRAPFQTMSTRA
                     APRGSVMTTTTRSSGCADSLESSDDTDSETFRMQREHTSPPREDAPSHATFSSTFHST
                     TPGFPSSSAVARAPTVAASLARHASSSSSSLYSPRATPSSSSSQTPSRKPSLKELRQQ
                     LLTERGLDSGFASMNC"
     gene            complement(<1018839..>1021850)
                     /locus_tag="LMJF_32_2610"
                     /db_xref="GeneID:5656381"
     mRNA            complement(<1018839..>1021850)
                     /locus_tag="LMJF_32_2610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685532.1"
                     /db_xref="GeneID:5656381"
     CDS             complement(1018839..1021850)
                     /locus_tag="LMJF_32_2610"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685584.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656381"
                     /db_xref="UniProtKB/TrEMBL:Q4Q514"
                     /translation="MSHYTVSSSESGSFCTNTAPHSHMRADTEHSESAVVSFSKRTHR
                     HASAVAAADGGFDEEAADSAYSESTPKKPLQAATTATATMAQESPSMTIRRMPVDYSK
                     RMEDQKARSSALERYKMLFRGNRQVESKQSSPNSVDAKEVGEFSKRRDDEQSEAFASP
                     AGCSAMDETVISDDSETEEKPALPVSKSLRSAGERVSSSSSQRMPQRTRSSSSPVLVS
                     VSVSRPIARPAEVTAGNPDGGLTGDSPAPAVLQLNLSKTHGPPSQPAAACATGDDGNG
                     GVSYVAPELTQPYCKPSQRRRDTLRPGFEPVTAHDCTSLHRTLSASFTQAGVSPSPSS
                     SQLQPRSHSHRDSSTKARLASTSAAAALPSPRSTSCRKKDAVKATPAMAATTSVSPQQ
                     DTSETAAEEAGATAATDLASTSPASRGVAMQLFHDDEKGDLLRQTDAEEDGVEGLGAS
                     DVNGTRKQEQEVILLSSSNKAFWLRPSTAMYEMTASIAAKRKDRHEGEEEVRRSPNRR
                     HQNQSRSCAATASTASSCGTPRGRLSTSAEAKPRFTTHMTAADRERCEEVPAAVASAP
                     AQTYGSIYSARQAAAQKSALSRPIQRMSTDASTVNRACDSPHRASQHQPQRRAALRAC
                     SLRSPLERRSSTLSHLSSDPPMTASSEERHRSVNSGRVSIRQQDSFSKHCARVAARNS
                     RPEESAGAAAEPAKRSRTKTVAASACETPAKGEAAVPSKPVAHKKLQFEPETESEPRT
                     NVPKATDRVLTSPVEPMPAPPSPETTLHGLHRSGEGSPSKSRRREHDLTASPARPDDH
                     TDAESGLDAQDAAMEREKEEARVQQVRTALESFRKARQTCTDDPKASHVKATSTNEVV
                     AAMLQGIVQQTRQTLPCYLCADQQNASAYHVHVDLCRPKTEALLCEYYTAMDDVKGIP
                     AALQERIQHGAAQEVPSSASSETERDAFAKKCYQCVKAMLVACRKCGVQVRVHDVREH
                     EMLCGRACYRNSRAAERVRATVERIEHGSQE"
     gene            complement(<1023700..>1024608)
                     /locus_tag="LMJF_32_2620"
                     /db_xref="GeneID:5656382"
     mRNA            complement(<1023700..>1024608)
                     /locus_tag="LMJF_32_2620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685533.1"
                     /db_xref="GeneID:5656382"
     CDS             complement(1023700..1024608)
                     /locus_tag="LMJF_32_2620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685585.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656382"
                     /db_xref="UniProtKB/TrEMBL:Q4Q513"
                     /translation="MMRRSSLLLSGGMVEYHEWHLHEPLLQNYEGWRILDNPKYEQKS
                     DAYIYDFMGSVRHLDPIIDDPRLTHKQRVCRLYRWSLKEIQMWMIQLNAHKFNLAHKV
                     IRRRFEKYRYVTDPATCDMMVRQTQKYLRDNANFHYMRRNNSSPWSTYTLANPMFHPD
                     NSLVYDHWTHPEVMWYDDAKLHRWTAHHPLYAGPGEASERFGDMDVAPHLRGLVWAMF
                     MILFAWCFYQLLGGPGMRDDKHFEEWMQQFDENLAGALYAEERNSRSRNSVLRGDWDR
                     IMGVSSTLDGFYRNNMSVVDKANYPA"
     gene            complement(<1026407..>1027219)
                     /locus_tag="LMJF_32_2630"
                     /db_xref="GeneID:5656383"
     mRNA            complement(<1026407..>1027219)
                     /locus_tag="LMJF_32_2630"
                     /product="putative superoxide dismutase"
                     /transcript_id="XM_001685534.1"
                     /db_xref="GeneID:5656383"
     CDS             complement(1026407..1027219)
                     /locus_tag="LMJF_32_2630"
                     /EC_number="1.15.1.1"
                     /codon_start=1
                     /product="putative superoxide dismutase"
                     /protein_id="XP_001685586.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656383"
                     /db_xref="GOA:Q4Q512"
                     /db_xref="InterPro:IPR001189"
                     /db_xref="InterPro:IPR019831"
                     /db_xref="InterPro:IPR019832"
                     /db_xref="InterPro:IPR019833"
                     /db_xref="UniProtKB/TrEMBL:Q4Q512"
                     /translation="MHTPKADIQMGRFNFMDQYNEFRNRSGRVPDYYVEKYRKTYWRV
                     DEYIRRSENYIQSQGFFYLPTLEFPWYKGCMPLMSSYQIRVHYGRHHRTYVEKLNQLI
                     EGTPLYGMQLDALIVKSAHDSQLKGVYNNAAQHYNHSFFWKCIQPYGSNIPPDLSAAV
                     SAQYGSVEKFEQQFITAAQNLFGSGWVYWVYDKKAGAFDIVSYGDAGCPLTNYEYTPL
                     LCVDVWEHAYYIDYENKRPEYLSKYFDVVDWHWAERHWKRATDQEYHEMKFW"
     gene            complement(<1034818..>1036017)
                     /gene="CD"
                     /locus_tag="LMJF_32_2640"
                     /db_xref="GeneID:5656384"
     mRNA            complement(<1034818..>1036017)
                     /gene="CD"
                     /locus_tag="LMJF_32_2640"
                     /product="cysteine desulfhydrase"
                     /transcript_id="XM_001685535.1"
                     /db_xref="GeneID:5656384"
     CDS             complement(1034818..1036017)
                     /gene="CD"
                     /locus_tag="LMJF_32_2640"
                     /EC_number="4.4.1.1"
                     /codon_start=1
                     /product="cysteine desulfhydrase"
                     /protein_id="XP_001685587.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656384"
                     /db_xref="GOA:Q4Q511"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR006233"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q4Q511"
                     /translation="MPNQSFEECSVETKLGHVGRNPDEQWGFINCPIYRGSTVLYKSI
                     NDALKLRSVYWYGTAGNPTVTNLQNAWTALTGGAGSVVVSSGMQAIAYALLATANSGD
                     NILVADAVYLPTRNLCDHFLVTKGITTTYYDPCITADELRELLHQKPNTTVIFMESPG
                     SQTFEIQDVPMICAVAREFNVTTIIDNTWATPIFFDALGIGCDISVEAGTKYVGGHSD
                     LLLGLISANEKWYPKLRGFMSLLQSVPSNEDCYLGLRGLRTMYIRLKEAEQRGLEMAR
                     FMESRKEVLKVLHPAFPSCRGHEIWRRDFTGSSGLFSIVLRPEYALQDVERMIDGYKL
                     FSIGFSWGGFESLVMCFDCTKFRTATTFAPGGILLRFQIGLEGLEDLKQDLCQGFDKL
                     HAESMGC"
     gene            complement(<1038357..>1044488)
                     /locus_tag="LMJF_32_2650"
                     /db_xref="GeneID:5656385"
     mRNA            complement(<1038357..>1044488)
                     /locus_tag="LMJF_32_2650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685536.1"
                     /db_xref="GeneID:5656385"
     CDS             complement(1038357..1044488)
                     /locus_tag="LMJF_32_2650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685588.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656385"
                     /db_xref="GOA:Q4Q510"
                     /db_xref="InterPro:IPR001537"
                     /db_xref="InterPro:IPR029026"
                     /db_xref="InterPro:IPR029028"
                     /db_xref="UniProtKB/TrEMBL:Q4Q510"
                     /translation="MSSRSLFVTLVDQLATRHDSGGSGSGTSHTQDVGKHVSRLFLLA
                     CDLTTAFQPVDLYQHLEGMMTREWAALLHGESLYTSSPASSGAPEPATLSHSSPPPEC
                     ASTLIAASGALLGYARTHVTEFETSGVRQACVDDICERWQSSVLQLLSAQPPFSAETR
                     TAACYTVAQLSLLPRNCCEQVLNAACEALETGREDGLNVSIATELIGQITSLMVLCKP
                     FQLHGLALEDPAAAAAAETSRKAAASKKGTASTAGAQTSKRAKLSTQRSAGEGADAGA
                     SAFSTAGIDSEAPTASCSAIPSCYPFPSLERLRELKVSLIQCCLVSLGSTVAEASTAS
                     STAVRATRAHHGQQQHRTGLVALICQRVLIPLLLLDGGQGLEQYEHLVHNLLRTLANR
                     PSTSTTAAVSPNFSQRTPGAAAEDAVLLLYGDNCDEVVLLIAALFDFLFRQSSLDPRT
                     DFRFSEFLWVVLSSALHRSLTATEVDAGHRANMQLRVEYLLKRIVHMTKQQQQQWQEQ
                     HARLRTDAPPAALPPVIEFHPLFRWCTTASGVGSTAGKHRNGAAGEHGDSLSATAWDN
                     FFLVLESLNEYGWHIIEPVMARLDTLIAQLDSRLESAAAPCDDTATSTVGVSAAALNP
                     RWIEMLLLKLILHPNLGVRKVGLRRIWALPKRVLRSLSPSFLFQYVFQSASDPRLCGD
                     IDRVPITASFLDTKAFEGTEVKAVPDVEPLAQEVERFYASLFAHRWTSSDADAVAGRI
                     DALHRMLDTVIEKPPRFTVCTLVRVLLAIAQVFLDHGLDAEPVLLDEGVLERLHRFVR
                     DSVQENVPFWLDVRVTVILFAALTTLAAATASPRRCRLHSAFWRLYCMCGPLGESGGH
                     SIASVDACGQYGLVGASVEERFLQHWLVQFSARQQPTRQVNFDKAAPSLVEALLDVEG
                     LACRVEAVLRAPAEPGLHEVVNIVAVKETFFLVGALTRTGSERHAELVRAIGDRIATT
                     IASLQTRAYCTAAHVLASAACLVEFQHSVGGAVCAQLWPVNTTLQSMASALHGHVMAA
                     LQASVRSICDAAEAPGQLRIVRSLFEGETHDEADTTWALMNITNFDVLAAAIASLNAI
                     ACDPTTRTPAAAAAAAEALNAPQYVHQLMCLLRECSAAYESASASGAGTAGGEEAGQK
                     RLAALLIVSRNAARLLQSELCGYLSAKHEESTAPQAPHDEGFDVVATGRLLFPAALPT
                     CREAPPLSAAASSRCPIAVVLPRDVLEVCVDQLMALPSQRVPSGAVPSALSNLPWSTL
                     LSQQSRYVCNALYVLLLSLTAAEQEGTDTAASNSTRTFPGLVRRVQDYALGQLGECWT
                     VNLASVYDVLLWVSSSNVPEVVDYVAIANGMWEHMREVGARQYTRLAALAFTVLHYVM
                     PHHPDYVKEVLLRVLKGEGKDAQTADRDVYFAAITASLQVLHDPANNWPVLRDVVLYA
                     AVLFNTNRDEEENESTVAVTEPLLWTWPEALRLCYPPTTCMAGVGRAMAVATLLWCCY
                     ENVAGRAVPLTLELLRMNTCHPVVTREPCMPNSRTHRTRMRLWQLLCALLPCLADQHS
                     VTPAQVEEVFRMLVFHCLTVNNMGSVRRLMELYAIRLVEQRPALYTVLSEALDSYSLR
                     PQVCGSYILIACHVLLRQEEAGGADESAAAAAGDEALASGIFTSLFPRILQQSTSNQH
                     LLRIISHIGLFNICRRRLARGRPIPPAVAAIYEYVLHAPEHVRFREKHESMLFFDTEA
                     ASSPRSLFCVQRKEANTVLAEVLPAAAFERLRFVETEMCCMIGALYPMELLRVHDWCA
                     SVRVQERVSVLKGFRGIPHTSTPSDYYVDYTREATELLTRDPMLEASAAAATARSAGV
                     GAGDEASGADAATANVQKKVSSWWTSEVYNELHPRSLRTQKQSIIVVGSLLENPVNIA
                     GLCRCGEIFAVESIVVPEKKVFEHPHFVAAARSAELWIPWEEVAPKDLPCYLEGLRRR
                     GYVVVGIEQTAASVPLEQFSFPERCAVVLGAEGQGVPAPLIPLLDVCVEIPQYGLIRS
                     LNVHVAGAITMYEYTRQHLMAQSHPSA"
     gene            complement(<1049741..>1051207)
                     /gene="AAT16"
                     /locus_tag="LMJF_32_2660"
                     /db_xref="GeneID:5656386"
     mRNA            complement(<1049741..>1051207)
                     /gene="AAT16"
                     /locus_tag="LMJF_32_2660"
                     /product="putative amino acid transporter"
                     /transcript_id="XM_001685537.1"
                     /db_xref="GeneID:5656386"
     CDS             complement(1049741..1051207)
                     /gene="AAT16"
                     /locus_tag="LMJF_32_2660"
                     /codon_start=1
                     /product="putative amino acid transporter"
                     /protein_id="XP_001685589.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656386"
                     /db_xref="GOA:Q4Q509"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:Q4Q509"
                     /translation="MSGANHHHHHHCSDSDGGSAPLPEELATNYPYTETGDNVLAAGS
                     AAATKMKGTADESYSVSSVDGPAVPQANSTGVRGVIERVYSIIPHGGVVANIYNLASA
                     TLGAGIVSVPSGFHQSGMVVSVVLLAVVCACTIYSIRLLGQAKLKTGLRSYEEMARGM
                     LGRGWDYFAAFLMLMFCWGTCVGYVISVGDLLSPMLDGPNTNAFLKTDSGHRILIGLI
                     WFVGMFTLSLPKEINSLRYASVVGVSFVIFFVICVIVHSARNGLKNGIRKDIVLVNNG
                     MPAVNGLTLFIFAFICQVNVFEIFDEMQKPTLGRMTRDATISMLVVAFLNFFSGFFGY
                     CDFGAEVDGSILLLYRPLEEPLFMISYIGICIKLCVGFAICIQPSRDAIYYCLGMGKT
                     SDVKDWLNWIVSGFLALAALICGLFIPSINIVFSLLGGICGGFLGFMFPAYFFIYSGD
                     FTLKKVGILNYLGCIVLIVGGVVAVVFGTAVAIFSEIP"
     gene            complement(<1052467..>1054839)
                     /locus_tag="LMJF_32_2670"
                     /db_xref="GeneID:5656387"
     mRNA            complement(<1052467..>1054839)
                     /locus_tag="LMJF_32_2670"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685538.1"
                     /db_xref="GeneID:5656387"
     CDS             complement(1052467..1054839)
                     /locus_tag="LMJF_32_2670"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685590.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656387"
                     /db_xref="UniProtKB/TrEMBL:Q4Q508"
                     /translation="MFAELGGPGRTEAASPHLPSSSRTAKSRKQRRNHHVQRVVGKDV
                     AERAKSMTDAEWESVPMADKHAFTKYMSELLREHPTEATEQQRRRYFETTMADPRDLD
                     PSRTVRDEFERLKMGLPVQLKDPQRSLGVSQAIFEAGDASLFDPDKVDALEDTMVQVK
                     QVFTDYVRQRREGVSTETARRKLANMLADLNVETQRHLSHMFKYAEERVRQEAREERK
                     RQLSELQRLRRLVSSSLRRRASPSSESSAATPSTGTSVPEGGACLSTSCSAVDAGLGA
                     VHDTFSPSPAALAKTKKRAVLKRSLGKALGLELSVVESLITELEAQEKFMQFCEVFAR
                     LTVSQGFRHGPEDERLDAYTESLRRLYSVDANKLSTLDVVQYLAAKEEAHPVDWAKRW
                     YERLVRLPLEHTTEYKRLEAIRDGDTAALELQARAACEADAPVSAGHEAAMQAERAAA
                     GGRTQQAVRLVEKMFMRPDDPRLKSLHERRLRYIAYLQMERQIAQARENAKIFEGVEA
                     TAEAAECRKLYAQLMERKQRLAALGDSVNSAAAPTTEAGGTESMDGSAAATSADVATA
                     VAATAGNANVFEQDAEAAALFEQIGRLTQSVIRTYSRETRRRSKAAAKAEVFTRVMQQ
                     VGLTDADGSPAGRAEELQRLLQAKKDKVAQRLLNVLEADVKSDLEWLDAMEEAERPPL
                     LPIPEGMSYVSAADVQAWKEVRDADKALSADPFRKNKKRFQPQLFGQQWQLPDKPLLF
                     WGTGTRAVQQALEHAADDAERRRRGEPLAPPYPCPENPWGWRLVKDVLDD"
     gene            complement(<1057565..>1058719)
                     /locus_tag="LMJF_32_2680"
                     /db_xref="GeneID:5656388"
     mRNA            complement(<1057565..>1058719)
                     /locus_tag="LMJF_32_2680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685539.1"
                     /db_xref="GeneID:5656388"
     CDS             complement(1057565..1058719)
                     /locus_tag="LMJF_32_2680"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685591.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656388"
                     /db_xref="UniProtKB/TrEMBL:Q4Q507"
                     /translation="MPEPLVPMSGTTADKFLSKQVYKNNRIAQNMFSSATRKDKKVML
                     PQTLLKGLTIQKLWDNVFQDNTNFFKKYHDKRNESKLEIGPWDYAVDHGSGSRTVSLV
                     AIVEVPRAGTPTPLNQVQRFAYVNTPEGKLMLVYQISSQTPEMPAGSSFRTEAYFEIT
                     ADSADSDCSIAIWGNCRKMSMSFSAIQYIATPRAIKEMTSAYRQMVNMISEEFCGGAV
                     APAENGDGDAEGGESNGNTGDGGGGGGNGGDLGSVFHGTLLVLAVLVTLLVFNSTRTM
                     SRTSHVAMTMLSQDRAMWEGSRAGGRGPAPANTGGWMCEEKALLTAAREAQIQTMRYR
                     WMEQQAEIEHLQRIVSLLKWMAYVQVAAVVVALSGFGYLLKRHLDLTSEA"
     gene            complement(<1060161..>1060565)
                     /locus_tag="LMJF_32_2690"
                     /db_xref="GeneID:5656389"
     mRNA            complement(<1060161..>1060565)
                     /locus_tag="LMJF_32_2690"
                     /product="putative ribosomal protein L27"
                     /transcript_id="XM_001685540.1"
                     /db_xref="GeneID:5656389"
     CDS             complement(1060161..1060565)
                     /locus_tag="LMJF_32_2690"
                     /codon_start=1
                     /product="putative ribosomal protein L27"
                     /protein_id="XP_001685592.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2690"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656389"
                     /db_xref="GOA:Q4Q504"
                     /db_xref="InterPro:IPR001141"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="UniProtKB/TrEMBL:Q4Q504"
                     /translation="MTKFLKPGKVVIVTAGRYAGHKAVIVQNSDVVTKERPYGRALLA
                     GIKKYPKKVVRGMSKQTIARRSQVGVFLRVVNHKHFLPTRYNVDMSKELRGKINVSDA
                     SKRSRSKRLVRHVFQARYNAGSSMWFFQRLRF"
     gene            complement(<1061525..>1064911)
                     /locus_tag="LMJF_32_2700"
                     /db_xref="GeneID:5656390"
     mRNA            complement(<1061525..>1064911)
                     /locus_tag="LMJF_32_2700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685541.1"
                     /db_xref="GeneID:5656390"
     CDS             complement(1061525..1064911)
                     /locus_tag="LMJF_32_2700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685593.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656390"
                     /db_xref="UniProtKB/TrEMBL:Q4Q505"
                     /translation="MQAQVQLRRLLRRACTPAVLSSNQVGMAVHALRQLDLLDVSSSS
                     PALNALPIVRQLCGGADARSQANMLHALAAAVSETCDFRTVLNEDLQSTVQCVQAELV
                     EVADTLTATETVLVMEALLKLRPYVGCDAGVPLVNSRLVEEVRERTMALASVVERPVD
                     LLGVTRVIVEASSSTSAAARDAPHGGRPSASSFEWASFSLEHVLRVVQARLSTFSKQE
                     LISLVDVLTVRRPSASSEDASSSSPSSSSAPAIPFHREKRRGAAVSMGKAAETAADTP
                     PEAADGVMLLDASRPLIPDLLACALTTVPSLSVSQLCAWLTRLTALRLTDNALVLAVV
                     QSMLNADVQHFTVPQLASGASALADLLSLTSVRGQPWVHAGLCLRLYARLLHRLSSAL
                     YDAGRNDPAVVHHAQTRLLPLLGTIPEAALDEYIDSDMPKGAGHVGGGSGDMSTPAAS
                     ATAVRPNVLNLCATLASAIEKSASVLLRFMGELSSREQANVATAVFYWRVYTPCATDV
                     PGALTAVAVSPPCIPCDADGQVTLKSRDVLQRCSPLTLADTARKHRALCGLIMTGSAG
                     FTARDCVHVLNELVVAHYIDEASQMRHQQEQQEQRRLCSSAADLSSAPETQPSLRESV
                     VRAVAEERRVLMKLLNEQLQGPLQSTLGEVHTSQLVRYLSSLSRMGVGAKAPYIRVMD
                     HLKGRSLSSFEQVSVMVVVARHHLKSRHVVHGVVRTLPELGTALSSAAKVTLLKSLGQ
                     VNGQRFVKAPCDGTLVPGKFFPTLEELTRLTLLQLVFCFNGLIELRQYENPAVQAVLA
                     EIGKRLCTPPLRPSDSFLSINSATSLAEFLASLCRFGGPADGVSTTLLLETMRVLEQR
                     LVTSRSLFVDLARLNWYWPCVKEYFHLSSVLWTDSASSMQDAQRGAVPPVAGQWAFTV
                     EEWPHLTRAFAQLIETAGARVAERLQDIARSPSLRPNTFLWGQMVCGLRFSGMPPRGS
                     VEEERLVANLEQTRMLPLLGNPQQLLDITVLALHFAVEGREAEAVPALRFVQKKMGAM
                     RVQDCLQVWWYTSQLLSAPTALAAATSLGKVTSPPRNGDRKVQVTGTKSSVETTPLSE
                     RARLVLQEVRDTAKDQVLHEEKATMQKLSTMEKRLLKSLQ"
     gene            complement(<1066538..>1066942)
                     /locus_tag="LMJF_32_2710"
                     /db_xref="GeneID:5656391"
     mRNA            complement(<1066538..>1066942)
                     /locus_tag="LMJF_32_2710"
                     /product="putative ribosomal protein L27"
                     /transcript_id="XM_001685542.1"
                     /db_xref="GeneID:5656391"
     CDS             complement(1066538..1066942)
                     /locus_tag="LMJF_32_2710"
                     /codon_start=1
                     /product="putative ribosomal protein L27"
                     /protein_id="XP_001685594.1"
                     /db_xref="GeneID:5656391"
                     /db_xref="GOA:Q4Q504"
                     /db_xref="InterPro:IPR001141"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="UniProtKB/TrEMBL:Q4Q504"
                     /translation="MTKFLKPGKVVIVTAGRYAGHKAVIVQNSDVVTKERPYGRALLA
                     GIKKYPKKVVRGMSKQTIARRSQVGVFLRVVNHKHFLPTRYNVDMSKELRGKINVSDA
                     SKRSRSKRLVRHVFQARYNAGSSMWFFQRLRF"
     gene            complement(<1067929..>1068378)
                     /locus_tag="LMJF_32_2720"
                     /db_xref="GeneID:5656392"
     mRNA            complement(<1067929..>1068378)
                     /locus_tag="LMJF_32_2720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685543.1"
                     /db_xref="GeneID:5656392"
     CDS             complement(1067929..1068378)
                     /locus_tag="LMJF_32_2720"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685595.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656392"
                     /db_xref="GOA:Q4Q503"
                     /db_xref="InterPro:IPR007233"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="UniProtKB/TrEMBL:Q4Q503"
                     /translation="MVVHLLWIINQSGQLITKTAFTSPDNIGELGANPDMQLTLSSVL
                     FSTCGMSQQLTPNADPLDSACMTLVECEEHNIHVYETPTSVKFVLFSDNRTMECTNLF
                     KELHALYAEFATKNPFHTVDDAGIGQPIRIPAFTEAIRRTVTKYQRM"
     gene            complement(<1069225..>1072344)
                     /locus_tag="LMJF_32_2730"
                     /db_xref="GeneID:5656393"
     mRNA            complement(<1069225..>1072344)
                     /locus_tag="LMJF_32_2730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685544.1"
                     /db_xref="GeneID:5656393"
     CDS             complement(1069225..1072344)
                     /locus_tag="LMJF_32_2730"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685596.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656393"
                     /db_xref="UniProtKB/TrEMBL:Q4Q502"
                     /translation="MSRADKQQHQEHVVGTSRDTSVRLFAFANTRPGYQVVFAPEKPL
                     IVLKSKNSATPLHPCLQWEPLSTLVFQARPNTTHAVYVADTTNLSSVATYDQEEHVNG
                     AAVGPLLKRLSNAITRLNPHNATMVAAGVSGHLAMKYVLVGEKTLGHRDRLVQRLVLL
                     CPTSLSALTAMTNAVVKRPAVGGYQLPEVVVLLKEQAEVPGWSAWLTALQDVHHRISS
                     FRVTTDLGPSLFAAIVREAGLAEADGTVVDVQQRYAAPRVYRLDFVLSKQTKSVEQLP
                     RLSPLDTLGYDDAAEDDGDEAHGRHHAHHHGHSHGHGAPHHHHRHDHAADEDDYEDAG
                     SSDEESEFEEGADDAAAGDSAGAIESCCGCGSEGCGGDRVHGAEAAVSDSAGSMLVSG
                     LHGLANWCDPVRVIVEGRVLDLGTGLVGTTDGCVEVTNLPAMIAADSTLTAWHARAAS
                     TGQRAKQRRPPAVAVAGVLSRDKEGRTTLRAEEARPLTKAEVLHSMTAGSSIEEIPVY
                     YNTSRIAHGYGALLIRGRKCALVRNVGDAMAAHMYIPFAPHSRTEESCVDCAVRALCD
                     ACEVSSDNFFLPSYLPPVVYYPTAATASADHVGPRCVTIYTALAISPPPRGAASDAVE
                     DAPEPEEPYDWVSFSRALALVETQAEREALQEAQRHLERAHKAGLYTPVKGCGLFGEG
                     VKPHSGAAVGAVLPKATLNGIPSRAGQRLKTLSGIEFYVIVCPGGAAAELTPPLTQAL
                     HTSCSLVCGEDTTTSSIEDIAAEAQWRGERHVLLLLGGNDDAAAFCEAHLVYLKEKRQ
                     ATAQVFTVLLPQTATSITELGGGVLASEVEARLDSLLSAVRVSDALITMVPPKELSRG
                     EQAVLQVCCKANPDLMLFYSWEARHPFTVCDQTPSESGSASEAGAAPVLKEMKVRTRA
                     GVPVAPAALAFLTHTGALDCFYAAGECRLLFAHGDVWVPTRGSTQGFVYLDVVSHCLA
                     VEPGKEWASESDTDRTSELTLFVWCANDAAAGTAAVHAATLEKQLQWSEARDGTDWLL
                     AYDPLPQWD"
     gene            complement(<1073453..>1074142)
                     /gene="ACR2"
                     /locus_tag="LMJF_32_2740"
                     /db_xref="GeneID:5656394"
     mRNA            complement(<1073453..>1074142)
                     /gene="ACR2"
                     /locus_tag="LMJF_32_2740"
                     /product="As/Sb Reductase"
                     /transcript_id="XM_001685545.1"
                     /db_xref="GeneID:5656394"
     CDS             complement(1073453..1074142)
                     /gene="ACR2"
                     /locus_tag="LMJF_32_2740"
                     /EC_number="1.20.4.1"
                     /codon_start=1
                     /product="As/Sb Reductase"
                     /protein_id="XP_001685597.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656394"
                     /db_xref="GOA:Q4Q501"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:Q4Q501"
                     /translation="MHRSPFSCEGIAILARVLLCHLTAFFFFVVLTVLLFEHSDGRRA
                     LYFALRRLSASLGGGHDVLLTREAVCTLWLRVVRECVPFTGAASYATLLLYPLLGCVA
                     MTNYTYIKPEELVELLDNPDSLVKAAVIDCRDSDRDCGFIVNSINMPTISCTEEMYEK
                     LAKTLFEEKKELAVFHCAQSLVRAPKGANRFALAQKKLGYVLPAVYVLRGGWEAFYHM
                     YGDVRPDLMYV"
     gene            complement(<1075377..>1079930)
                     /locus_tag="LMJF_32_2750"
                     /db_xref="GeneID:5656395"
     mRNA            complement(<1075377..>1079930)
                     /locus_tag="LMJF_32_2750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685546.1"
                     /db_xref="GeneID:5656395"
     CDS             complement(1075377..1079930)
                     /locus_tag="LMJF_32_2750"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685598.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656395"
                     /db_xref="GOA:Q4Q500"
                     /db_xref="InterPro:IPR000904"
                     /db_xref="InterPro:IPR023394"
                     /db_xref="UniProtKB/TrEMBL:Q4Q500"
                     /translation="MEPEPPPELVQRALAACRVVLHEVSRRVESTVPNAAAKAELLDG
                     VKAAESAVARSERLFAVPPHRKGGSSTKGASAGAPPLSNLETQDHAAAGVSSVSPAPH
                     HTKGARPTQLTQKSHDAADRRESMPGATVGASGGTSAAAPPLLAKEVIAKGQKTTVAL
                     PPTNAVGSTALQSSTDAEADAASRAGQHLSNTSLSGGATASAMRLVGTAVHTTDRLPF
                     CTELQSAVVWGYVLSAIFWKRRKLTEYTITALELLLRVMPVPSHIVTLIVDPAALSYE
                     GATGGDGAFKGRCAPRRSGRMLVSVSMGVYCALSECILHSFSEPAVQTRALRLITELI
                     TSSLVPPRRSAAGACCAGREREANTFIARRCNNGTVDVAACFHGHTAIGVIKSCLKVA
                     ALGMQETARREALLALRAAVKRVVHTFVTMRTYNEVVGGTDGRAQAHSAFSTDTILAD
                     YTTDVDNTEPYTWIHVMPSNKAEVSLPASRRTGFSPLEPAATAAAPRSGGEPGGDLAT
                     QPPQHTEGPSELVSAPVAATSPQIVKHALHRGDASSSASEQVSNAPAPSPKHPVLGAA
                     RWSSAQLEHEAPRRNEGGSHVAPTLPRSQPSATAAASAAAATPLRVNPSPSSLNLSFD
                     PHTFFRNSVDESLVLGALSTLNTSDGALPSPLKDLLIVLRRMCRYASRQCSGMPTHAN
                     SDVRKRDVGLWALECVLDGLPVANCEQEHRCATWLSLVLNACKYELLGCIAKNLAIAT
                     PFKLFERAVHLLGMMLRKLHYHMARELHTLLGAFLLPLMVSQYAGFRQKHAVLSMIRQ
                     LFTVPHLCVSFFVNYDCNPAFDSGAEYGGMLELLVEHVVEMTFLDHVDGNGDAYPWLS
                     SDQQQLLRSECVVVIHTMMTSLYRWIAEDPREYAANLQRDHRKGAQRRQQQEGGATIG
                     ANKLTELCLESWESDEVANPNPPLKARHSATAPASRKEDHKGSSNSGESEVHGCNVAL
                     SLDAVAGMPLPQWGKNGNINYHWKHIHYLLHNKRILQEAVQGINSGHWREAKAFLESR
                     GFMAAVVPSETERADPASVAPGTSSYALFARFLFEYPGISRGALSSIFEKVNREDGVS
                     RMLLQEYLHCFNYTDIPIDVAMRDTTCKFMSWDRPMFEAKVWETIQKCFGNEYARQNP
                     DSITARDADVMAGVLLFLHSNLHNSLVKGSRMQASQFVRDANACLEFPMMEEDLQAMF
                     NRVLNCKWELDMYGRTPQQAEKERTLVRLSTKIQMERAAQQRRQSVSNNNSFIVNSDK
                     MAGPAGLSASAAAAGSGAVATASAAETHATTCKEYLILDTDPAALEDALQSEDESDGI
                     SGHSPSRAPGTAAATATPKLETAQNPNASMDSSTLQVWMSDDMGLLDNMIPTYADSKD
                     TLKTKEEQHHAYREVSAMYLHKLESVHRLYCVEEEAYRPQPYIMPCYAEHVRQMLLLT
                     YPHVMSSVYMGFRVLEEAPIARKLLDTVQITYDIAAAFVLSLHDLRPVMEEALQRYLN
                     DERAYRLLPSSRSTFVSFLLNVM"
     gene            complement(<1081166..>1083757)
                     /locus_tag="LMJF_32_2760"
                     /db_xref="GeneID:5656396"
     mRNA            complement(<1081166..>1083757)
                     /locus_tag="LMJF_32_2760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685547.1"
                     /db_xref="GeneID:5656396"
     CDS             complement(1081166..1083757)
                     /locus_tag="LMJF_32_2760"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685599.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656396"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4Z9"
                     /translation="MSRPSALRKPLLYTPASSTGRPASSPRRRQRQPLQPRGSASTIA
                     DSPRRLISYYLSKAAYNTRAEENRGDGVASAIASDGDDVVDERTKRADYDQGAAEHDL
                     QTPPSYFSEPLRPLPFWSMQNNTGTSITASPPSPRRRPTATVVPSKAGSVSMATTTRQ
                     AERSNDLSERQALAELRTPLPSAAPAWLPATPTSPVSQPAVYTEEQRRVFEAQVMQQV
                     EALLQAQQSECRAELEAYRVTAAEAQATLQAVEAALGEQISAMQRGNSGKVEGTSTGV
                     NDRRDDCVSAGRPSPTPEALSPRSLALSVDALAFEMSRVAAAAATPATEKLLDGIMSI
                     QDGQHVPTVLQRVMEQLYHDLARALAPAVMDFVSQQQQQLLHEEWTAAAMKTRASAAH
                     ATHNDAPCDADELLRAQAEVAALQEEVHALRRTLCSRDSDFASEDASSTNGLAPSTPF
                     IMAPNAQKHPSQEDLVYALQNRLISECHAMLTRSRHEALLLRRSLEEEKRQHFLTRLR
                     LLKPTHPLAPHRASAAASTAAAASGHVRSHNAPASLRVDLGGSGGVDVSPGSHSGSGS
                     SPVMHGSSATRSPTSPTPDAGGSPHSQAHATARQSAGPLLSAAHTAAPHRWTPVRSPL
                     SLASHSGGAAEHGRDGDAGDNAPAEQPPAPRHMSSPSSQLLSTGPSRAAPRTAPSLQT
                     AMRVADEVLRTTAPATHTAREPVHPYYREEGGGVAGTWQHGCCSGDVSGVPQENGGGA
                     LFSRQRGEPLGQPPRAREHSVSSLDSSDSFKEVVRCTAPSLMSESLTGAASRGGPSRS
                     SSTHVVGRHESNTSTGMAPMPSSTLARSWDGLATAAEAAPAPPSAAYERRVWNKAVEL
                     LSRYSIA"
     gene            complement(1085487..1086585)
                     /locus_tag="LMJF_32_ncRNA3:ncRNA"
                     /db_xref="GeneID:12982167"
     ncRNA           complement(1085487..1086585)
                     /ncRNA_class="other"
                     /locus_tag="LMJF_32_ncRNA3:ncRNA"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460994.1"
                     /db_xref="GeneID:12982167"
     gene            complement(<1088066..>1090948)
                     /locus_tag="LMJF_32_2770"
                     /db_xref="GeneID:5656397"
     mRNA            complement(<1088066..>1090948)
                     /locus_tag="LMJF_32_2770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685548.1"
                     /db_xref="GeneID:5656397"
     CDS             complement(1088066..1090948)
                     /locus_tag="LMJF_32_2770"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685600.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656397"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4Z8"
                     /translation="MKNPSHVAAAPTSPSPHPSAVSGGAPIPWLPLPPSSSSAGASAT
                     IASAPSERWAAALQKVPYLHSILEGPTCTVYRPPTVIQLSEATGCSVSKLAGAYSDLP
                     VITLNKIRATSDQEAAAAAAAGLNSDGFEYLQLSPTDDSLEMAAKALVARRPAPDAEE
                     IFWEAEYWEVLRRAKRQAQEEKERLREKKLGQRERRAVMGASNSSVGVPSPKLGGATT
                     LSSMNSPSFATPHSRQGSLGGPPGDCGDGSPAYLHAQTAAQRTAKGLLRRARYNETHN
                     PAQRVLVRTASLLSQNSATQSVIRCRTRPRHDSITSQQTLSGARGFQYPLSSLASEDG
                     RSATSDSFRTPPPPIAYSHQSRELLAASLELELSTSGGPAKTGTTTRSGTAPAEGAKG
                     EAMTARETARPHNEGGSPIATRDAARKRPSTAAAAVSPDSSSSLQISSNRCSTDLRRS
                     KVNSFPSVTASPRSSIVQRDSATSALLIIPAALPALEPSAQQRPPPPPLQGDSGNEQK
                     CRPLLPRSVGAIRKPVEKQPPVAEGGREGRGGGGSSPQPLPPQPQLLSLSAMPRTSVG
                     RPSGDTSSLTVDGQPRFRCTTARPSPDSNARANSSASSRPSGSAPGTSSQLASVPTVT
                     GELRKAKSALAALSPVVREVTATVPTSSPGAPFTAAEVKVRRDAGKRLVTRADLKPLP
                     LHPSSAQPPLGHRLDGASAPDKAFRLSSTPPCTAAVTAAASPAPPHSSFSSSTAQTTV
                     VPQSASMPVMRAPVPKPLPSAEPAVPPAITVISTAAPSPSSSVTTRTTATAAPSSCLQ
                     TREASPSPCLERAAVVVRAASSIAPKDGADATSSTTSRVTVAPPTATKPPSAVTKPLR
                     NGEAPLTSRQNTTVATNAKDAKGEEAQPPAQVPSTPSKAEVAPPQPSNRRADEDAAAR
                     PSCLSTLSFAADAERDAHNAPESGATAFSLPSRKVDKEASRCCVVL"
     gene            complement(<1093004..>1096288)
                     /locus_tag="LMJF_32_2780"
                     /db_xref="GeneID:5656398"
     mRNA            complement(<1093004..>1096288)
                     /locus_tag="LMJF_32_2780"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685549.1"
                     /db_xref="GeneID:5656398"
     CDS             complement(1093004..1096288)
                     /locus_tag="LMJF_32_2780"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685601.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656398"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4Z7"
                     /translation="MQRKRRLTVQPVDAARFCGDNNGAVVSFLNGMNHLVVANPAPMT
                     EGEQLPLPSRVLVHAYAGAQLADAVVRTREEFVEEAAVNSAAVVACRVTPLRASRAST
                     GTNYPVRTEGPTKIVFFSGCQRLAEVGIDDGVVTRSSPPMQLPWCPMQCFRVESEDPV
                     KGLVALDMAAFLKDPHTLCACTPQLGKLQTLRFEESTICCLGPGRAGHAEVTVILGNG
                     VAAMCGVQRAAPAPARFTAEAYAEVAAAPSASRAARQTFLAANEGSDMHVLHTLQLPF
                     HASPSAAPLRVAWTDATVLWVVYSDGSVVAVQCGERIGTGSGAEGNEELQQPSEALAG
                     PSSASQARGSTVTTQVLEAQLMATWAQNGDSNKVSMVQVQIHADPRAPVLHFAFTTAD
                     AGGSEQQQQQLLHYGTVRLHGASPAVQLHWRQHQICYAEQLYGVRYERGQFHILSQSA
                     CGAGPLYVATLLKDGPAASSAAAGAVSVAPSLAMTIMQCAESELSSHCRSCEARLKEL
                     RDSAQELTCEKDATLLLHQLMQAQHALYALLTRQQQSASVTDLAASESLPYRLLQRAA
                     QVSRQHVAYALFVHLGIMHTISKPLKDVLRLSEATATVEAAQAQWKSLLHDTFRRKSV
                     YQSSVAELAMWQSATPLCIEVLLDKLGLPAADASFTMASALASMDAVTPEMAVFILYY
                     SYVGLEHSADASGAQALPSMAEQQQQRQWRESFLLLFGMPVDLNTWAFTCYAVDHGVN
                     PAEAAEAEQKKSFLYAMGPAVQHLGAPPFVRLLAPVVNGLAHVAALDVLLRLIPTCIA
                     VYTSAGEDVPVMMAMRLLCVALRAGSSRMIEALYDVMRGSEELMHLVAQPLAYAALHA
                     GSVSAMRGWVGVGSPVADTIERTLQTAEGAHQREAVLIFFYILLQRYEDALQVCSSAT
                     PADATQAQRLQVVLSYLRSLLSASSKAWGEQKMVVVADVDPHLPVDEASALPLWRPET
                     LSAPLLQVSSGDLAEQLGRIVSSAGEHGGHSGAAVVALRGAASAGGATTAPASGALGE
                     AGAVYHCSHRATGEGLPTHARPPLFRPSTLLSSVERGSRAGSSAASSSSSPAAAGSAA
                     TTAGQC"
     gene            complement(<1096958..>1097524)
                     /locus_tag="LMJF_32_2790"
                     /db_xref="GeneID:5656399"
     mRNA            complement(<1096958..>1097524)
                     /locus_tag="LMJF_32_2790"
                     /product="exonuclease-like protein"
                     /transcript_id="XM_001685550.1"
                     /db_xref="GeneID:5656399"
     CDS             complement(1096958..1097524)
                     /locus_tag="LMJF_32_2790"
                     /codon_start=1
                     /product="exonuclease-like protein"
                     /protein_id="XP_001685602.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656399"
                     /db_xref="GOA:Q4Q4Z6"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4Z6"
                     /translation="MCGVIEGLWTRGGRVFHRYVRPSDPRRISAAAAAVHGITWETVQ
                     NCSPWPVVARELVAYMALVGADAPVSASAQLEAAQLGGQRAVHLPPLVAHNASFDARF
                     LEHHLRRCGYQIFWHPRYPLTCTRQWAQVAYPHLANNLDALCAFLSIDWAADRAANGH
                     DALTDATLTALLFLQMCRRWMERFGRGE"
     gene            complement(<1099731..>1103822)
                     /locus_tag="LMJF_32_2800"
                     /db_xref="GeneID:5656400"
     mRNA            complement(<1099731..>1103822)
                     /locus_tag="LMJF_32_2800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685551.1"
                     /db_xref="GeneID:5656400"
     CDS             complement(1099731..1103822)
                     /locus_tag="LMJF_32_2800"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685603.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656400"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4Z5"
                     /translation="MSHSTGPAVPIPSLGGTTAERPPQSRGSLPAVIYSTSPQAAATA
                     HLSYPPAPYSRQPQPGYPPSFPISTGDTNEGNLGNHAATAASSLTPSGSYVSAAMTSP
                     SPAYPEYGGYSQPQHVALTLPPPPPHQQRSPNAYIPREAAREEVVGEAIAATSQHWLQ
                     TQLKRETERRHEQLHGRVQESAHRVHEGQNDGGRYVRENAARHPSTAGGAAASGGTTS
                     FTLSHASQRQHVEFLIGSPCHVKRLVLLFFSTLFGVLPLMSTFAFTTLLCGVVLLYIS
                     DYLGYHRITVLVLLGTAGVFSATLLISNIRAAATSFGPMLMIADLGGVLMVVVAAAIQ
                     HFRWVQETFPNVLCALERFVFAVGPVLCLPPLLTTITGLAGSRRAPFLFFVALCTLHH
                     FFYCPLKSSFLVLVSPGSAAGAAAASVQPDQQQQQQQHLQSDAMRDAGAHARRRVAGD
                     GDGQAKDAHAGGDGAGGVDDAASVDSTSSTCGAPMQLNEQVEALVFSCLVLLLPVAVY
                     NAFQSNWADHAVANVLNSVGLVCGGIAYFCIWPLHSLWFLASPPEETYSLLQQLEYDP
                     LGLLDLVAAFRIPVLATVSIVGVHWGAYRLLNSRYSYLFSGVAFPFNAILLLIAFYIT
                     VYVGIEIKWLLDVDSRGGDVTKGKYLLRRMPVLLGSCVVSVILCVLTSAPGVLYFPSV
                     LSIIAFNVFLMDRTNGGPMFTFTVFTSLMLLWWMYRTYSFIVMDLRVFGETTVVPTPV
                     LGVSVLWCYVLGCMSFTLSFSPSKAPVTIALFLLALQLTFVEHVLYSQNEEGAYPAVL
                     VVLTSAVGVAVACRMYRNGALTVYSAVLISSCFVAKLFTFLVEVTSAYYAAELTVRDG
                     METARAYLLMAEITGGWWVALFAGYLVASFEIERRRRIKMEAAKRMLYTYATLALLLS
                     LLTIRNVQRAAYEFVTQNYVAESELLHIAAGTCCATYALLTMPVWWRLKSRYPAVFPL
                     RAVSRCTALLGVVLLALQPTRVVEAEVSDFDYDFEYADRGRCAAAVGLMMLLGARASF
                     LQCIPFAGRFVYWLATAASLSLGITGLVQAAPTFNFFIMMLCFVFLILLMIDVVHYRE
                     VSGTVLVGVYGLSILTIPLSFLQLNRSVAAQQEKLYYLPNRLTMLWDMYEQGSLRLLA
                     VIVVMYLGLSVMINCRLRGRPLLPKCREISHEASLPLGFIANFSTELSVALLCAINFF
                     GNDSEPTLYVLSSLLLLLFVDDEVIFFGLKEHHFRYFAPTACSLTLLWLCTMWNAWRM
                     AAPQGLLSQLRRETWSLVQASVTLPAQISLLVLLWKGRKMGSSPGFVVIGSVLLNLAC
                     LLLVSDKAVQWMAIVGIFGQCARIFETQLQPTTFTRRRHHSAY"
     gene            complement(<1105559..>1106902)
                     /locus_tag="LMJF_32_2810"
                     /db_xref="GeneID:5656401"
     mRNA            complement(<1105559..>1106902)
                     /locus_tag="LMJF_32_2810"
                     /product="putative RNA-binding protein"
                     /transcript_id="XM_001685552.1"
                     /db_xref="GeneID:5656401"
     CDS             complement(1105559..1106902)
                     /locus_tag="LMJF_32_2810"
                     /codon_start=1
                     /product="putative RNA-binding protein"
                     /protein_id="XP_001685604.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656401"
                     /db_xref="GOA:Q4Q4Z4"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4Z4"
                     /translation="MAKGTVKRKATPSSLRKKKAQQRIRKQIRTKLQKKKPSWKTALA
                     KVYTGGDTTLKDKKKDSRKRARSGEDDWDDEENTFNFKRDDVDEDGEVQSDVDEEKEE
                     RLNQRDPLETQLFLKNLPLDTSEEELMTYFKTHFSAVKRVLLVRNRASKTLSGTGFVH
                     CGSAELAGKIFDYAQQNARELSAVGREDMKAQTGSLSHHQAKRLMHKMRTHSFVARDP
                     FLTIRDTKFTVLRVLSRSDTQEAVSAQQKKKRTKVAADDPRNLYLLQEGLVLPGSAAA
                     KGLHPRYLQMIEDDYAARKQQLTNSNYFVSKTRLSVRNLPRTMSENDMRRLFAEQARA
                     YLKKHPEDTEKDKWGKYGPIRNVKLLKDTAGVSRGYGFIEFVNHNVAINTLRMLNNNP
                     TVFGDQRRLMVSFAIENMSAVQKLQHMKELKRARLARGSSDGRASTVSSKAKKSL"
     gene            complement(<1108441..>1109667)
                     /locus_tag="LMJF_32_2820"
                     /db_xref="GeneID:5656402"
     mRNA            complement(<1108441..>1109667)
                     /locus_tag="LMJF_32_2820"
                     /product="putative proteasome regulatory non-ATP-ase
                     subunit"
                     /transcript_id="XM_001685553.1"
                     /db_xref="GeneID:5656402"
     CDS             complement(1108441..1109667)
                     /locus_tag="LMJF_32_2820"
                     /codon_start=1
                     /product="putative proteasome regulatory non-ATP-ase
                     subunit"
                     /protein_id="XP_001685605.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656402"
                     /db_xref="GOA:Q4Q4Z3"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR019585"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4Z3"
                     /translation="MSSPPPPRNIEEDLHKNEEEDPAPEVDDADIPVDPLLTLLYIRH
                     TLTSPWSSSEERETAKAAMMEEMEKHNMAPYIRLVCEALGVPLDESKLAEMDAINAKK
                     VAAFDARLKDAVDNLGDTEVRDVLQAKCDHYARIGDLEMCMKTNEECAAKTLATGPKL
                     DLYFQRIRLGIAFSDNDIAAKGITDAHRLMKDGDWERRNRLRVYEGIYHVFIRDFQRG
                     STLLLDSITTFAAGELLTFQDFVFITVVASLPVLSRPELRKRIVYSPEVNRTGVDDVR
                     ELVNSIYDCQYNKVFPNLEVVCQHLRKVVYLSPHVSYFFREMRVLIFTQFLDSYSSVT
                     LESMGAAFGIPVPALDSMLCTLISNERIACKVDRVDGSVETYRGDTTNFDYHRIVKSG
                     DLLLNRIQKLSRLVDM"
     gene            complement(<1111348..>1114704)
                     /locus_tag="LMJF_32_2830"
                     /db_xref="GeneID:5656403"
     mRNA            complement(<1111348..>1114704)
                     /locus_tag="LMJF_32_2830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685554.1"
                     /db_xref="GeneID:5656403"
     CDS             complement(1111348..1114704)
                     /locus_tag="LMJF_32_2830"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685606.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656403"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4Z2"
                     /translation="MNVLALSGESDFHSRGAGGQSYAETVNANPTSSSSRSSPRMEVH
                     ETNNAGEFVVAPAAAAGESAVLTLEELLDGPASCRGSTTEAPAHLPVTKFLTTQHNDS
                     DDKQREAPAAGPAYAEKAAAAAASTEYSRETTATAALPAAANLAPLSSPSREALSSAR
                     ASSSPLRDSVAATSAHLSALLADAGSSGVSLSVLTTAPTDPLVAGAAESAASQWHEET
                     TPSHVKDSTAVGLQAAAAGSVAEKSPIAKRPATKAEESPRALTRAASLSAARVARQGV
                     GHGHNSSAATPSKRVSKGRSATPGCAAALLRGILGTATPADRAAADARKNRAVSTAPP
                     PISTLDLPVGLLLLYCAAEETCTALEGGATSSTASALAHSLLYILEQISDLRRRDHRQ
                     AALKQASELERAKCEELYEAAEKKRALAAAQRTAHAQAVEQEELGACTFRPAVSKMAR
                     RMEAKGVKNFMEKCMMWKAEADRRLRQRCDHLAEVEAEQRAAAAAQSGMLTPGKAVTK
                     GSRRLLAQPSVQERLKSRPRLWEVKRPSEGPQEGGVHVLVPAHVLADTATSSPRLVGA
                     PITSSTAEEQEAVLRELRRPGTEAGASDDLPLQLPQNTSTSRVSKNSEGTVKGFLSRV
                     EQDAERREQTVAKLQARYHNPDAELFEGGTGRPFFCPNAMPMVWKDGHRVSYDDLPKE
                     KQRDFRAELRRAGLDFVLAHYLRERQREKRQNVTGSGRGSSVAAQGDGADVGEGSTAP
                     RHSISSQSHGHALTVARQARFMASLEAALARKQKSWERLRAQATAEETFHPKITKRSE
                     RMALHKTGGTPIYERPTELRRGSSAEGARSEKSQGQPSSAVHKDRPLPEVAQVFLDRS
                     GKWMESRQRRLQHLAEMEEERRRAECTFTPNRYFGDACEKTEVSRGMEVSRTGASSDT
                     DALVGPDAAGGDAEGCRDTSQSRVLLQDLMASAADVRVINELELLRTGAAYRDARFVQ
                     AVCDQSGLTDARRAMANLSLQSAPRLTRSRKDAWEASRPPHQSSATLFQSPLSPIPQR
                     SNRPSASPYTLPRRDTTSFSSFHESAPKSVPTLSQGESAQTPMPRSVARDATAARSGV
                     RDFTLSVPPVEDPWAALDAQTDAILKRYGR"
     gene            complement(<1115758..>1117470)
                     /locus_tag="LMJF_32_2840"
                     /db_xref="GeneID:5656404"
     mRNA            complement(<1115758..>1117470)
                     /locus_tag="LMJF_32_2840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685555.1"
                     /db_xref="GeneID:5656404"
     CDS             complement(1115758..1117470)
                     /locus_tag="LMJF_32_2840"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685607.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656404"
                     /db_xref="GOA:Q4Q4Z1"
                     /db_xref="InterPro:IPR004127"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4Z1"
                     /translation="MHTEEYGEGEVLTGAELYLYLLRQNEAQLLQAQEKLREYATLKD
                     TLHVLTERSRRRVLAPVAGGLAYYAAELNATNTVLVLLGDGWFAERSAIQAAEIAGRR
                     VDFLRREAEVLQQEQNTLRAKQELFMSELPEAQEAVAELLAARETGVPGAQSPSQFSP
                     ASQIPQPPSQEAAPSSGSVALASAPDRSGTPDAVRPAASPRFASSGSCPALLPSSTPP
                     TSRTPPTSSGLPLDYSSIDVALTTFDEQDELTEDELIALEAELGDRVNDDDFVERVMT
                     ERMIAKKERRIRAELERRSGGAAALENRSKASEGALGPALRPTSASAAAPTATAAPRS
                     HGAASAAVASAADSNGSSVSRQEAVTYRTPGDIGGMAARSLAPPGAPADAPPAAQATA
                     SFSLNEFVSEPAPTSSLSTAALTSARPLTSAALAEVDVSSAASSSASRPKPSRRKEQH
                     VRFAADVKDTSSSSLVTAVAEARRPQVVNAPGQLGSCDQRISAEKAPGCTPSLLRSTC
                     IIGDIVEYNEGTANGGGSGAAAGAAVGCGVASVMPPPLLLSGQRQKPKRKSLFMRELE
                     GDGA"
     gene            complement(<1118750..>1120660)
                     /locus_tag="LMJF_32_2850"
                     /db_xref="GeneID:5656405"
     mRNA            complement(<1118750..>1120660)
                     /locus_tag="LMJF_32_2850"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685556.1"
                     /db_xref="GeneID:5656405"
     CDS             complement(1118750..1120660)
                     /locus_tag="LMJF_32_2850"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685608.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656405"
                     /db_xref="InterPro:IPR007052"
                     /db_xref="InterPro:IPR008978"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4Z0"
                     /translation="MPVKPQFTWEQTGEDVLLQITIKGCKKDTVDVLIADVFVKVNAP
                     PQYLLALDLLHAIDSSKSSQYFTNAQDGVILHVKLHKAEVGRVWDALSVRQSSVGKQA
                     LLQRRQESMQRAEQQYRAQLDARVTQRETEKRRMLEAQWEVEKAQRAQIEQRVKAEKD
                     AAETELYAWEDSYTTPAADTASASPLPLDNTKLASPLPHSADIAAVATAAAAASSPLP
                     ATPEAAPPVAPVSSSSVATPPAIRQADTVNVTIDFTPKTFAMPTRSHGDEEYYRQSRY
                     KPVSIEDTPMFWKERADKCYGTQQWKAAANAYSESIKRDGAFLTCVMNRSACYLQMAD
                     YKRAIEDCSLALTMLANTPASEVTQERYRGLMTKLHARRGAAYCWADDLKSGAADLRM
                     AAAYRDPTSDDDVAADLAMIEAQMKERGITEVDACVDPLSTRMQEAAAQYYQGSYEAA
                     EATYSAILKEQPFHMKAQGNLAATLLRAGKFTQALQVCDGIVQFCSEAAAALEQPGGL
                     AGDQLDSDDEEDEDEPDWAASSTESAPEEVEGASNKDTLVRQRRAAAKTLGEQSGHVY
                     MLLKAYVRSAAALCGMKEYHKAHGYLERALRITPYDNDLREDCNRLAEKIRMDTLITA
                     SAGSARTQKAAV"
     gene            complement(<1122351..>1124603)
                     /locus_tag="LMJF_32_2860"
                     /db_xref="GeneID:5656406"
     mRNA            complement(<1122351..>1124603)
                     /locus_tag="LMJF_32_2860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685557.1"
                     /db_xref="GeneID:5656406"
     CDS             complement(1122351..1124603)
                     /locus_tag="LMJF_32_2860"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685609.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656406"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4Y9"
                     /translation="MTLTSDGSPQHAVPHDAQELHDRTHVYLSSVAPTLDSIENLLAL
                     WNRFREVSSTAGKVPEGSSLRKVRIDPFTVLKSPPLISEAEIDRAVKRLTAKELKALH
                     DEFELTCVDDFVYVNSDEGDEADAATSAQAATRTVHFADEAEGDREEGDDHDNGSRGT
                     YGAGAVQWKRAGERTSCALGEASPPPAANVTTALADMSATSRAAALFEGNTVTVDALR
                     ATVGGGGCRSGASSAHFLASDADPLMPSDDAQTPPVISLEEMSPSSIAAIAAARGEAT
                     NDDASGPSSSRLAATFSAAANSASDLPAGCTVELEYRTDHWIPSSTRRALQGEAGANI
                     TLTTAATHTDTIHATTMKCSAAPAAESAAASTTESDEDEDEIRSFTTFSRMALADHAR
                     RLGSRQAEEGASLHPTALQRAWTVHESKRTGTEAYHDADTPRATNRPAASATPAPSTT
                     PLSSQPGGTAKADLTRERNAFVRMRVRDVLLANRVRAMDTSVLGAAFFAKMDTAWNAA
                     ADQTTPVLQRLDELLCESSALLHTLEVMDHQAYRERVMDPTQYLCVPRYSVSCAVADC
                     HTPFSATVTRVMCGRCGQLFCPKCCAERGVGPDVKCEGQRYSLGWEPLCRVCYQMCRD
                     SQQKVVEERNHVLMIANQPSNGGHAGEAADEERNARHAAAGELSLKQAVLFGAYCDEH
                     RCLSDGLPPFYVIQRSANETVSFWDILGYHFAKTQGTLRRGWQSAGNLATQAVNSAAQ
                     MMSRRKGTLR"
     gene            complement(<1128011..>1129477)
                     /locus_tag="LMJF_32_2870"
                     /db_xref="GeneID:5656407"
     mRNA            complement(<1128011..>1129477)
                     /locus_tag="LMJF_32_2870"
                     /product="phosphatidate cytidylyltransferase-like protein"
                     /transcript_id="XM_001685558.1"
                     /db_xref="GeneID:5656407"
     CDS             complement(1128011..1129477)
                     /locus_tag="LMJF_32_2870"
                     /EC_number="2.7.7.41"
                     /codon_start=1
                     /product="phosphatidate cytidylyltransferase-like protein"
                     /protein_id="XP_001685610.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656407"
                     /db_xref="GOA:Q4Q4Y8"
                     /db_xref="InterPro:IPR000374"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4Y8"
                     /translation="MDGYRTPAGPPLQVGPARNRIGLTNIQMRTVTVCIIGPAVLAWS
                     GYSERCATVLSFFATFMCGIEWSGVKRHLKVALLMSMDNTAMPKPQSPVPPLTMLVDL
                     VARPPPPSPCIEGVPLCPEEYELPVAPISLYNVLKHLGWALLPLAAYSGEQVFLVTLE
                     LYFVVFVVVTLTAHNRLELKVEHAMKRLSQQLSSDSQDSSRGAPTAAAACKTEPDLPR
                     TDDSVAKKERVAKAQRDYFLLMELHMIAERQPTEQFLDFCLDIFGIVWIAGISTPFFV
                     YHITDVGVPWLSSTLIGNFANDIAALVVGRSLAILRERYGEIYDVTGEEPPATGAANQ
                     PRKRPLKEASGLVRMLLRSPHHLNRAISPNKSVEGAVAGVIINAFSFAGLMFWFYRGL
                     FAAPAANVVDPAFQNVALWLLLGTIMGVLGVCGDLLQSLLKRAARVKDAGFIIPGHGG
                     ILDRVDGMLLVFPFMHCALRGIMSLSSDSGNRRSFFAA"
     gene            complement(<1131289..>1133070)
                     /locus_tag="LMJF_32_2880"
                     /db_xref="GeneID:5656408"
     mRNA            complement(<1131289..>1133070)
                     /locus_tag="LMJF_32_2880"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685559.1"
                     /db_xref="GeneID:5656408"
     CDS             complement(1131289..1133070)
                     /locus_tag="LMJF_32_2880"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685611.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656408"
                     /db_xref="InterPro:IPR008496"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4Y7"
                     /translation="MKPGPSPNSPHLELGSSETAPRFSSKPSFSEALLLSAKACAPSV
                     QPTSTPTRSPPGEVAAGTRAPAASAVSTDSVIPAQAHRSHDDSDDVTNGSGTSSPLAL
                     SPSLAATTTESLGGLPVLHTSGTPPSPLARRLRLPSRTVVELQHFGCCVFFFPAPFVS
                     WLFPLVGHVAISNAEGSQLYTFESSYYVREEKLISVLDRVLREEGQEQHAASLLREAP
                     HVGSRVDLSALPTTTSLHSSTGSQLPGMPMASDASASDTAVTSPSDASAGSRLRCRPT
                     SPVFPPHCSARPPRRAGRPRSAAGAPASGHAHTQCVRIWDLKPLLMESRGRRTRRTPC
                     GLTTQGGKQAAAVLWERLQELLQPTEVSTASVQGASPAGGAASKALSPTPPTLSVKRR
                     YASEYHSDDADGIRSAPGMSSSGEEEGEEYELLDAETARFYNRNLNATIRLFRGSADG
                     SINSPDVVLQHHSSFSFVGFVLEACGVGSQGKPSSAVSAPKSPAKEAANGGSAAASAS
                     PPAAANRPATASASDDAVPGESLNSEGEIHWGVMKLLFHVSVFGKWHRGERRLWRVVH
                     GGSITSASILWAAIIALAYHYFKILFF"
     gene            complement(<1137802..>1139136)
                     /locus_tag="LMJF_32_2885"
                     /db_xref="GeneID:5656409"
     mRNA            complement(<1137802..>1139136)
                     /locus_tag="LMJF_32_2885"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685560.1"
                     /db_xref="GeneID:5656409"
     CDS             complement(1137802..1139136)
                     /locus_tag="LMJF_32_2885"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685612.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2885"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2885"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656409"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4Y6"
                     /translation="MPSSYVCILHSSNGHYTDNLVGNALRCVHALQCSVRTGAPDFIP
                     SIAVFFADPHRGAKCVYSSAVPDRNHALDRLGATYPVLSDATGSVFSPEEDGGGGGTG
                     GGTAERTVAFAQLFRLRSPQILQQAILRAAQEHNSTVPTAGARVDASSVKEFRETSTA
                     PSASASPSPDAPNMWSSLAGALLASLCYLRAHSSSAFRAANRDEADAEAGEAPGEAAS
                     GDSSSSDAVNFAPPPRSAGSVLVFSDAKAAAVPPYSAECALAMAAVTASKMGVTVSCF
                     GEAVVHTDSTENRLVALACSLGGFCAGRFSLHDLGHLLDGASAAVSLIGSRARQRRDR
                     IASQYVVGPTMLPQAPLRKRRAVAAALAEDSTVDFKRATTEEVDTAVALDAKDDEHAS
                     YLGWLCPSCMAVIYRPSTEVAVTTTSDSRTEDGGGSGMGQAMGPRCPYCSKV"
     gene            complement(<1140005..>1140880)
                     /locus_tag="LMJF_32_2890"
                     /db_xref="GeneID:5656410"
     mRNA            complement(<1140005..>1140880)
                     /locus_tag="LMJF_32_2890"
                     /product="putative SNAP protein"
                     /transcript_id="XM_001685561.1"
                     /db_xref="GeneID:5656410"
     CDS             complement(1140005..1140880)
                     /locus_tag="LMJF_32_2890"
                     /codon_start=1
                     /product="putative SNAP protein"
                     /protein_id="XP_001685613.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656410"
                     /db_xref="GOA:Q4Q4Y5"
                     /db_xref="InterPro:IPR000744"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4Y5"
                     /translation="MEERGDALMAEAEKQLKKRSWFSSSDAKVDEAHDTFLQAATQYK
                     AAGNFAKVAQAYKRASEMSLKNKSESDQAVEMEEAAKAYVKAGDAKSAAALLRDVVDM
                     YDKAQKYTNAAKACAALGDITMGDEAMRWLQQAVRYFRNQGAKVTASEIVLKMADMKA
                     RSGDYAGAQQIYDQLAREALEDRVARGNARKLFFTTLLCQLALMTPESLMEDVDALEE
                     RFQEYQELDTQFNTNTREHMFMTDVIAAIQGEDTAMFDEAVHEYDSICPLDDLREKMI
                     LKGKQALRERISDLR"
     gene            complement(<1143210..>1145066)
                     /gene="DC2"
                     /locus_tag="LMJF_32_2900"
                     /db_xref="GeneID:5656411"
     mRNA            complement(<1143210..>1145066)
                     /gene="DC2"
                     /locus_tag="LMJF_32_2900"
                     /product="putative outer dynein arm docking complex"
                     /transcript_id="XM_001685562.1"
                     /db_xref="GeneID:5656411"
     CDS             complement(1143210..1145066)
                     /gene="DC2"
                     /locus_tag="LMJF_32_2900"
                     /codon_start=1
                     /product="putative outer dynein arm docking complex"
                     /protein_id="XP_001685614.1"
                     /db_xref="GeneID:5656411"
                     /db_xref="GOA:Q9U1E6"
                     /db_xref="InterPro:IPR029652"
                     /db_xref="UniProtKB/TrEMBL:Q9U1E6"
                     /translation="MSVVAAKKKGAVSDTLRRSQIADGILGAQDQGARQQEQILHITE
                     ENNQIKKEISAISGTHYDYVKADKLASLQSDVDGLERRYQFEKMRKNDLTKRYQLARI
                     DLLHSRKMKGGINVEKEQAVAVQRQVDILESRLDQTLGQFNDALSYNKELRDRIDVIR
                     EERRVFLRVHKRMEDDLKTKKRLMAEHIEKSNRDMDDRDAQLREVERLRAALAEQRQA
                     YTNQLRDLDTAMMDIKAMRDGQTEMQLELEAREYEFGERMGDTKAARAQEEADTSRRA
                     IGASVSGNGEDPASTTGEEDDEDDTHTLLCVERESATITSILAQIKDDLQTDDIDELR
                     TKYLHTGDLNFSMYKYVNELSAKKEALKDSIRDLQRLLSEEDDSERQHRILIKGLEEE
                     LAGTESKLDEMNCATVQLRDAVQRTAATAEDVYAHIGCPQMADGAVEGEERCTEANMK
                     QFLGTIEERATHILIAFQRHHQFSANSRTSVASSSRVTRDTQSPKEAVQNLEEEDNAL
                     TANTTDSPHGETLQMAEDWEVEESPIMPIAPQTAHSAVSARNLVRMMELPSASLAGGT
                     TDRDSSLYADQDDDHIISHEDIRKQMEARLATMREREERNQRKKKDAAQKAK"
     gene            complement(<1147605..>1151630)
                     /locus_tag="LMJF_32_2910"
                     /db_xref="GeneID:5656412"
     mRNA            complement(<1147605..>1151630)
                     /locus_tag="LMJF_32_2910"
                     /product="putative ubiquitin hydrolase"
                     /transcript_id="XM_001685563.1"
                     /db_xref="GeneID:5656412"
     CDS             complement(1147605..1151630)
                     /locus_tag="LMJF_32_2910"
                     /codon_start=1
                     /product="putative ubiquitin hydrolase"
                     /protein_id="XP_001685615.1"
                     /db_xref="GeneID:5656412"
                     /db_xref="GOA:Q9U1E5"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR006615"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:Q9U1E5"
                     /translation="MSSEGVLSSGDAMEEMELKERNHSIEGSSFTATTRDSFASAEED
                     STASQVNEEACMATGKPRTVAWNGTSTAAHDYIAASTAATDGEENAAVGAQPQPPLDR
                     LQAYIQALVGNILESLRGFDGSIAWLKRSHSAIAAHLDGINAGAVPAATEEFSVAWFG
                     IASAVLHDLIQESVADISALATPPLPFSENEESARGLCVTPRDLSVAFVSGLQSIVSE
                     VMNNGGCHRSGGSHHFSRYSLRSFAHVKEISEMSRRLMEEHLTQGAHVPHALRNKYSD
                     DTTSIDCKEDLCSILQRTADAWVCSFFPAYQQRSRNPTEVAPFLWGEEEDASRLNLEL
                     FFYCLYFACQQRSLMQNREALPRGVVVPTAWIEQLLRWSAQAKEQHCLASPGPHPPFP
                     GPIDTFALMTVSPHDPRRHWLSLDSERYQVIPQALYNSFFDFFGTGPKYVMYGAFSLR
                     ERCLLMWKPLPLTVFTTFEWWERNESDGALDKYSVEVPVEEALLHSDMREVCHLAWGM
                     MREEEGMMSEKVARVWFAAINGTDTVRICCKGLYMLSVKTGPFAITEKGDGMDLTVQE
                     ILQQLRRRIEQYMPESVEEWRLQTSGKVLLSLVLTLNNTNGDDRGGEITGTMEVAAHQ
                     CGVCGLTNVGNTCYMNSALQCLSNLTSFRTKLLTLPISHFSQAVITLLLIRLLTTMWS
                     GQHSFAETRELKEQIGMQVKRFSGYQQQDANEFIEVLLDHLSEECNLISERCYRQRED
                     SDKAIATQELSTIFWSNFLENNKSFIPPLFFHQSKTVFTCLTCGECSTVFDNNVTLSV
                     SIKDPPQRRAMSVDVMVELNKPDYAAELASHSGFMAPLFRPVKGGAARAHALVTLKVH
                     LLVQPDNTVREQEVEEALRQLLLSNASSSSEVLRFFLDGSADEMTAEEERQRARSVAA
                     RVQVDVRVMDIPDHGRVLAWARCYLASAELSVASAPPPTTVGAAGTPAARVWYFMKDA
                     PLPFTTAIMGTPVWVDEFPASYGAEHPQPVAADAADAEELVLASESRDCMTAYAEHIR
                     TRSLEVATALLQRVPEDETDEVALFNSTETLSGGVGYVMPPSHKDEAKETLASANDAG
                     AAAASIERDIKIVQRILRKSASATVTKTTSPGGDINADATGSEACEKALASAAVTTTI
                     VVCIQYDSAKYQLVTDGRRSDAFGLRGVGSDMTPEVKCSLHECLSHSMQPDLLRGEDA
                     WFCRRCKEFRETKVHRTLFRLPPCLIVSFKRFKMHTYSADKKNTTVQFPSELDFAPYL
                     DPEAAGLQTEGTKYRLRGVVYHTGSLSFGHYTAAAFNDSVKKWVYYNDTHATIDSCDA
                     PAPNGAYILCFERVEATASPA"
     gene            complement(<1153138..>1155321)
                     /locus_tag="LMJF_32_2920"
                     /db_xref="GeneID:5656413"
     mRNA            complement(<1153138..>1155321)
                     /locus_tag="LMJF_32_2920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685564.1"
                     /db_xref="GeneID:5656413"
     CDS             complement(1153138..1155321)
                     /locus_tag="LMJF_32_2920"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685616.1"
                     /db_xref="GeneID:5656413"
                     /db_xref="InterPro:IPR027295"
                     /db_xref="UniProtKB/TrEMBL:Q9U1E4"
                     /translation="MRIRDIVIIGVAFVCSIICWSQEGSLNFQRGFMIPILDNELTEV
                     IMPKPILVDPDGSGSRVLLSSTTVGYLSIYNTYYSRRRIDESFVRLNPSAELNVYTPI
                     VGIGAGYTELNSSIMLCAVVTEDYQLIAVSIHTPSPTVLWKTQLVGPRYWSELTHASI
                     SIVPERNWAEDVGMIAVAAKVVDTSGVEMMMYSAFDAKTGARRWAYFSDGGNEMNDVV
                     REANNNGTQTENGVTDLRLLDRDGAAKGGINQHDYLLGRKYEQPWTTFRESVMASMPH
                     RYAHVWDAQLYPHVFYRAKAHRKARSSRGKAERRATFRYNDRVVHMETDDGGNLGKKL
                     SALALSLRQSTQAYPAKNATRRHRRPSNVFVFHGEQGVEVVHMYTGSTVTSVMPLKAG
                     GACYDDINGDLVLESVSTQIGPRSVVYATRGIDLKYDCLGIIEAGAPSSADELFNATV
                     CNTQGLFGNLDLIHHFVDGDIRGEEAPRALNTLELLGSRNVVSSMTRATPPLILQVQQ
                     NMGAGLQQVERYAAFMIDTGLVTCIDPSRRRVLWRAQTGARFAPSPSDDMAEARKSRY
                     HVNRDVKPFPQMVPYSLMQKNRETDMTFVGGGKESFRRVDTYVLAVGDAEFSIIKTKN
                     GKVTRSVSLKEPPVAPVLVVDFNGDGTNDLIIVSKYHVFGFVGSSRASSETVAALMLL
                     LVGLLGILFAVREKKMAEGDHDNYTLPVHTGDKVQRKRTFKRSTD"
     gene            complement(<1155915..>1157402)
                     /locus_tag="LMJF_32_2930"
                     /db_xref="GeneID:5656414"
     mRNA            complement(<1155915..>1157402)
                     /locus_tag="LMJF_32_2930"
                     /product="tubulin-tyrosine ligase-like protein"
                     /transcript_id="XM_001685565.1"
                     /db_xref="GeneID:5656414"
     CDS             complement(1155915..1157402)
                     /locus_tag="LMJF_32_2930"
                     /EC_number="6.3.2.25"
                     /codon_start=1
                     /product="tubulin-tyrosine ligase-like protein"
                     /protein_id="XP_001685617.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656414"
                     /db_xref="GOA:Q4Q4Y1"
                     /db_xref="InterPro:IPR004344"
                     /db_xref="InterPro:IPR027746"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4Y1"
                     /translation="MRHCGSIYEEMAKQLLATGRWSHLSVRQCSVTKALVISETQKEL
                     CDTNMHLLLGEKLPCERVIATRRFMSKRYPSRLGERTNARRSAYDLRSHTSPGLRMPM
                     GSGDDGEVRVVDFVENTRSITLKSSMVTALLKHHNYNWNTLGDYLPMSFKLTPCQSSR
                     DERQQLLATLKGRMRPLHEGDEPCLWIAKSSAGCHGDNIEIFRGDYRGILKLLRFIDS
                     QHGSQPWIAQQYVDRPLLYHKRKFDIRCWALLLRDMYEIYVHEELVMRTSSVPYNRES
                     ATSKTPTGRLAHITNHCVQETSKMYSLYEESNELWREHLDGLIRYKGTVRAAKLKQEK
                     YTPLCSPRPQEPNRGDVPYPTRYSNDSRESLYPIREAYRGDSTTAPRFVSVRDEPTTI
                     TLDNHVMPQIHFIIRDSLLAARSHVPGEPAIPPTHTFQVFGYDFLIDENLKVWLLEIN
                     GAPGGPDRLKPALVKDTIELAVAPYFPGTMNLKAKRHNGYVRVYP"
     gene            complement(<1159138..>1160952)
                     /locus_tag="LMJF_32_2940"
                     /db_xref="GeneID:5656415"
     mRNA            complement(<1159138..>1160952)
                     /locus_tag="LMJF_32_2940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685566.1"
                     /db_xref="GeneID:5656415"
     CDS             complement(1159138..1160952)
                     /locus_tag="LMJF_32_2940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685618.1"
                     /db_xref="GeneID:5656415"
                     /db_xref="UniProtKB/TrEMBL:Q9U1E2"
                     /translation="MKAGQLLLVRAIPLIRPVKVDPATKKVPATLLKDVTMLSTVTND
                     AFSKRCQAVLRSVSKSKLYSSRFWVTQPQSRRSCNAVVLPGQKPAVIHLNVEKVIPLK
                     VVDKKDQKQVLDEHPPFFGSGVGILSERKKWKAVTADRLIRLLNAAEEERALFIDVNV
                     AKELELKYNKKDVIDIRSASSVPVFNSDQLDDPYKGEPQKGVALNAATGKRLGQPAHD
                     ILLGVGILRGYTSPMWIAEAQMKYLNLELKANAENQAVLAPNMTGMIVSLSVLPPKCK
                     RELLSELRRQRPDAFGHDVFFMYNVNGWEATRSRALVRNMAAVNDKEYPFHFVNLKDL
                     RLQKPQYSSVVTRLTGCKTPLCASALETAALAATKSKEENQKDDLVLQGKKFPFFFAE
                     DATRRRYYNAACVTKPYLMMPSVRPIAILKGRLLGPRDESILRTFALKNKLSSPVWVT
                     EPAAERMGVRIAAARKKHYVLIGATAADANPDEEAVDGFYNIDDFAKPEEILSLFPKA
                     SKKVHFMLDTKWRAVLGKQRQDYLSSLKRDVPLWVSVNECLMSGFEPRPGSTLLSFPT
                     SRKRDKTGTRLYNSQHTTDPVRVIGLSSVYTRPQGLTM"
     gene            complement(<1161893..>1162348)
                     /locus_tag="LMJF_32_2950"
                     /db_xref="GeneID:5656416"
     mRNA            complement(<1161893..>1162348)
                     /locus_tag="LMJF_32_2950"
                     /product="nucleoside diphosphate kinase b"
                     /transcript_id="XM_001685567.1"
                     /db_xref="GeneID:5656416"
     CDS             complement(1161893..1162348)
                     /locus_tag="LMJF_32_2950"
                     /EC_number="2.7.4.6"
                     /codon_start=1
                     /product="nucleoside diphosphate kinase b"
                     /protein_id="XP_001685619.1"
                     /db_xref="GeneID:5656416"
                     /db_xref="GOA:Q9U1E1"
                     /db_xref="InterPro:IPR001564"
                     /db_xref="InterPro:IPR023005"
                     /db_xref="PDB:3NGR"
                     /db_xref="PDB:3NGS"
                     /db_xref="PDB:3NGT"
                     /db_xref="PDB:3NGU"
                     /db_xref="UniProtKB/TrEMBL:Q9U1E1"
                     /translation="MSSERTFIAVKPDGVQRGLVGEIIARFERKGYKLVALKILQPTT
                     EQAQGHYKDLCSKPFFPALVKYFSSGPIVCMVWEGKNVVKSGRVLLGATNPADSQPGT
                     IRGDFAVDVGRNVCHGSDSVESAEREIAFWFKADEIASWTSHSVSQIYE"
     gene            complement(<1162731..>1164908)
                     /locus_tag="LMJF_32_2960"
                     /db_xref="GeneID:5656417"
     mRNA            complement(<1162731..>1164908)
                     /locus_tag="LMJF_32_2960"
                     /product="putative minichromosome maintenance (MCM)
                     complex subunit"
                     /transcript_id="XM_001685568.1"
                     /db_xref="GeneID:5656417"
     CDS             complement(1162731..1164908)
                     /locus_tag="LMJF_32_2960"
                     /codon_start=1
                     /product="putative minichromosome maintenance (MCM)
                     complex subunit"
                     /protein_id="XP_001685620.1"
                     /db_xref="GeneID:5656417"
                     /db_xref="GOA:Q9U1E0"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR008050"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="UniProtKB/TrEMBL:Q9U1E0"
                     /translation="MTTPDKRAYAAAASSKYPNYINDRDVCKRFLEEFRDSTGQAKYV
                     IQAHHIAQRQSIVFSIFLDDVAGFGQLHLAQRVQMNVVGYMEELYRVVDSIIPQTDRV
                     VDMVDQLIMEARMSGQELPALLTRRYELKIHPLSEDSVPIPLRELKGGKIGTLTVLRG
                     ICIAATAVRPKLSMLVSVCEVCAETTFQQVIGDRLTPLQVCQSQRCKLNNAVGRLLAQ
                     NKASKFMKYQELRVQELPEDVPRGAIPRTIRVVCEGEQTRIATPGQVVRITGVYCPDP
                     STGQGHEAFRASTMVKTLYKAIHIELEKRSYQEAAEDMRAQVEDIRDYPDREAVIEKL
                     TRSIAPEIWGMEDVKKALLCQLVGGSSIANGIRIRSDINILFMGDPGVAKSQLLKWIA
                     SVAPRSVFTTGKGSSGVGLTAAVTHDTHTGEVMLEGGALVLSDKGVCCIDEFDKMDDS
                     DRTALHEVMEQQMVSIAKAGIITSLNARTSILAAANPKFGRWKRNATPTENVNLPPAL
                     LSRFDLLWLLLDESSRERDAELSMHVTHVHLHGVAPGTVADDGVRGTTTEYFGRDFLR
                     AYVGEVKRIHPYVDPGAAKAISDIYCEMRAQSARHSNVVTARTLLSLIRLSQACARLR
                     FSERVLEEDVREAGRLLDCSKASLQDRPATDMHRVVTTSDASIFSVIRDIARGRSSVD
                     LSEIRPALMMKGIGESHLQRCLRTYCEVGVWSVSGTMLEFAED"
     gene            complement(<1165314..>1165691)
                     /locus_tag="LMJF_32_2970"
                     /db_xref="GeneID:5656418"
     mRNA            complement(<1165314..>1165691)
                     /locus_tag="LMJF_32_2970"
                     /product="tubulin binding cofactor A-like protein"
                     /transcript_id="XM_001685569.1"
                     /db_xref="GeneID:5656418"
     CDS             complement(1165314..1165691)
                     /locus_tag="LMJF_32_2970"
                     /codon_start=1
                     /product="tubulin binding cofactor A-like protein"
                     /protein_id="XP_001685621.1"
                     /db_xref="GeneID:5656418"
                     /db_xref="GOA:Q9U1D9"
                     /db_xref="InterPro:IPR004226"
                     /db_xref="UniProtKB/TrEMBL:Q9U1D9"
                     /translation="MSDSTESTNRFASNVRQAEAPNEKTLRIKVSALKRTIKDLEFAK
                     REVERELQRLDTLCQSDPDRVPQQTKVVDEAQMMVPHSVNRIMASVKDLSDYLEKEGS
                     TVSNEELLDLARATMADGQAAVS"
     gene            complement(<1165984..>1166553)
                     /locus_tag="LMJF_32_2980"
                     /db_xref="GeneID:5656419"
     mRNA            complement(<1165984..>1166553)
                     /locus_tag="LMJF_32_2980"
                     /product="ATP binding protein-like protein"
                     /transcript_id="XM_001685570.1"
                     /db_xref="GeneID:5656419"
     CDS             complement(1165984..1166553)
                     /locus_tag="LMJF_32_2980"
                     /codon_start=1
                     /product="ATP binding protein-like protein"
                     /protein_id="XP_001685622.1"
                     /db_xref="GeneID:5656419"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR024253"
                     /db_xref="UniProtKB/TrEMBL:Q9U1D8"
                     /translation="MSNSTEQALLQIAQQIERAVDDEIDRIDQMDDDEILAIRQKRLK
                     QLKEIQARRDEWLRKGHGQYLEIAEPKEFFDNVQSSERIVVHFMRRSTPRCEIIERHL
                     RTIAHEHFETRFCYVDVERIPSLPERFNVMMLPTLMLVEKGHTFHSIIGFDEFGGTDD
                     FTTDTVTQVLAHYGMVNEKGMFAADQNDE"
     gene            complement(<1166840..>1167436)
                     /locus_tag="LMJF_32_2985"
                     /db_xref="GeneID:5656420"
     mRNA            complement(<1166840..>1167436)
                     /locus_tag="LMJF_32_2985"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685571.1"
                     /db_xref="GeneID:5656420"
     CDS             complement(1166840..1167436)
                     /locus_tag="LMJF_32_2985"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685623.1"
                     /db_xref="GeneID:5656420"
                     /db_xref="UniProtKB/TrEMBL:Q9U1D7"
                     /translation="MNLFWTLVVTVCAIFVLINLPDEDSVEPVHDLMLNYQKEALKSR
                     YGDARSLNHTETRRIYNSVLSEAQKAIFNSHEDADRKAYTCSRIRSQARQYARSRDGT
                     YKGPLMEIALQLRDGYVHGVKYLHIALQKDVSSSLALQRPTLLHTAMVVRQTYCCLAP
                     ALSGGECPSYAFLRFIRDKSDTDILESCVRSNKGFNDV"
     gene            <1174504..>1176783
                     /locus_tag="LMJF_32_2990"
                     /db_xref="GeneID:5656421"
     mRNA            <1174504..>1176783
                     /locus_tag="LMJF_32_2990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685572.1"
                     /db_xref="GeneID:5656421"
     CDS             1174504..1176783
                     /locus_tag="LMJF_32_2990"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685624.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656421"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4X4"
                     /translation="MLFKASGKDYVSLREVCNIFDASTRTTESNTVDIHSLNNEAINK
                     VWTELLLFLNSCSGSVGRFVVHNIDTLCSMSDGSCEFLVSLLLAGVASILRYYSHIGD
                     REALLNSVSVEFTVLNTETGSRVADSLQFFVERGLRLTVSRSREDNFKAAYDELISSM
                     RCIEFSDADWIDAICGEIVDAHEMLCDRDIEAAGSGSFISPIVLLIAPPGPSLRVALE
                     KQILDSYSSEALRVQSDGEWINAQFDKKAPLVFICSSYWLVEQMSMPKGDGLLHRLNV
                     QIIVHGGFCEIGDSAEEEILRCVIALRSCGIQWEEMRVMQHKEPSYWRLEEPVSFRSN
                     NALAQECANVLLLLFRRFLTPYSPFSKQPHTSLPRDIFCSRRGWDFYHRLTQTLRLAG
                     VLAPEAAAPFETIELTVLGRFLSYRFRIGEGALIGDTLTVTDGKAILWAFLFRQPLSV
                     PLDVIKSCHAFDSWVDAAVANYCKVYRLEFEPEASTPRKALVAQLALFGIGDCAVRDR
                     VHYLLSSPNGVRLPLRQHLVTAAPTNCRGWYEQAPLNAGLALEKKEVNVFCLPPQSAY
                     CELEAVEKGASFHIQCPMELSYPLIVAHSVLHISLHNVCVFSETADPSVVTPLPAHLL
                     ESGVMSSLLCEVKRGNAGFWLDGVMNEIVLASSASSVLAPLTLQGRQYIPYCERELFT
                     RKRLRQEREAVKAAKSEEFRGTLPRTAAERSAVEELAELIRTIGREKAEKAVRGKKGF
                     SFLEPSHELYPFYLYNLKL"
     gene            <1178689..>1179012
                     /locus_tag="LMJF_32_2995"
                     /db_xref="GeneID:5656422"
     mRNA            <1178689..>1179012
                     /locus_tag="LMJF_32_2995"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685573.1"
                     /db_xref="GeneID:5656422"
     CDS             1178689..1179012
                     /locus_tag="LMJF_32_2995"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685625.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.2995"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.2995"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656422"
                     /db_xref="GOA:Q4Q4X3"
                     /db_xref="InterPro:IPR008504"
                     /db_xref="InterPro:IPR029008"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4X3"
                     /translation="MNTQDERFVGRVLEKNYESVFQVRTMGSLLAGIAAGVLGLTNFR
                     GLFFFIGCAVVTSFAIMAFGCGGNAHKCFPKGTSELFSVQQLLSGAMTYILVWTVAYD
                     AIYIF"
     gene            1179815..1180380
                     /locus_tag="LMJF_32_2998"
                     /pseudo
                     /db_xref="GeneID:12982168"
     misc_feature    1179815..1180380
                     /locus_tag="LMJF_32_2998"
                     /pseudo
                     /db_xref="GeneID:12982168"
     gene            <1181685..>1182896
                     /locus_tag="LMJF_32_3000"
                     /db_xref="GeneID:5656424"
     mRNA            <1181685..>1182896
                     /locus_tag="LMJF_32_3000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685574.1"
                     /db_xref="GeneID:5656424"
     CDS             1181685..1182896
                     /locus_tag="LMJF_32_3000"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685626.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656424"
                     /db_xref="InterPro:IPR002550"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4X2"
                     /translation="MANGYSILGVPVDVSIWTLMMIITALVVLAGLMAGLIISVFSLD
                     KDRLKVLAQRSETVEGRRARRLLLVLQNPHWVLVTLVVVDSAATEMLPLLFNVLLSPV
                     EAVIMSVILLVICGEIIPEAVFTHHALALSSALAYLVLALMVVTAPISWPVGKVLDWC
                     VGSRSGVAFKRGQLREVIRYRAAQLYDIHGDDDDETAPPRESSLDTREPRLMHQLETQ
                     IMLGVLSLSEYVGSSVLKKSIRATFTVHRDAVVSKRMVQSMVTHKLNHIPVYSDVGNP
                     SNVTQVLELRLLLFFAYCEEGASIRIRDLPLLPLPRYSADTPCNLLLDYLRASPLQVV
                     ALTSPDNAARVVGIISASDVVELVHRTSFDTAYVESHRPQQGSVVQSFRAHNASMTHE
                     TNQMLLNDMST"
     gene            <1183621..>1186248
                     /locus_tag="LMJF_32_3010"
                     /db_xref="GeneID:5656425"
     mRNA            <1183621..>1186248
                     /locus_tag="LMJF_32_3010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685575.1"
                     /db_xref="GeneID:5656425"
     CDS             1183621..1186248
                     /locus_tag="LMJF_32_3010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685627.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656425"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR025875"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4X1"
                     /translation="MSTRNGRRGMGPFGANKPSGVRMNRKNLRSVREMTLDHYDAEYM
                     YLRENELISFDCDVKMEQLLVLDLSINEITGAVDFLKRTPHLHHLYMTGNKIDTLAGI
                     SNFAAIETLCLSDNAISSFAGLENLPNLRVLSLNFNNITSFESYPTLPNLHTLNLVGN
                     PITDAPNYRSMAIAVNGLNLISVDGNPVQVEERAEADKYKGKVVHCVREGFTVEGENP
                     EKAAGAFMVKMQRNRQDAKYLQLCSINLAPVSEEVGDIMEGSPVALSLCMQDVRPYAQ
                     RTTEVFQSSYLYPVIFKVSGEASEVFVVGSMNNWTEPISLERCVEGDEVYFHTTLYLP
                     AGDYEYRYIVDGVEKVSEANSMPSKYKQGFCNIYKVAELEPQEEDQDTILYIRWMRSS
                     PSGSYEVIEDEHTLTYTPTAADINCCLRVEVLAYVNGEFSFLYFDISTPTKPAPPQCP
                     RLEVTGVAVEGGLLTAEADYFGGIEGNSSLVWYRISPSGDEVAVDVMDPWAGYELTRH
                     DIGCRIRAEFTPVRNDWAAGEPKSVTTNPVIACSPECRTIKIIGNLAQGSQLDVDVEY
                     KGGEEGKSFYQWLRKANSKSDYTPISGANGTKYVVKPEDVGQYLAVEYTPVNAEGVVG
                     ETCRCVLNNPIDAAVPSVSHLTIVGELMEQHTLTLKYDYTGGQSGTHMIQWYRRDKKR
                     SHMTKIGSPNSNFVTLTNKDVGCSIEVSLTPVRRDGVTGKVVTAKRAGTVEPCAPEVK
                     LLNIVGDPVVGKELQLQVEYCGGTEGESIVKWEVENPRTEEFNVVAANARAYTVKRAD
                     ANKMLKVTYTPVRSDGDQGAPKTRMVQVKGQRDTSAAVAPRAAALPTISMSLTSSTQM
                     SLTSSEESSTSISLHEVSP"
     gene            <1188708..>1191071
                     /locus_tag="LMJF_32_3020"
                     /db_xref="GeneID:5656426"
     mRNA            <1188708..>1191071
                     /locus_tag="LMJF_32_3020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685576.1"
                     /db_xref="GeneID:5656426"
     CDS             1188708..1191071
                     /locus_tag="LMJF_32_3020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685628.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656426"
                     /db_xref="GOA:Q4Q4X0"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4X0"
                     /translation="MSFATSITCVLFYMLQLSLLLRGALCISYRALKSAAAAPVAAAG
                     VSAASSRLGGAWEGSIERAEALENLSNEVFGRGNRHLKNVETLTALPEGLHSFPEVCF
                     IGKPGCGKSSLISCLLHNHRLGKAGATAGTTRLLQFFNVGDALLLVDTPGYGGWRGRE
                     VGQRLAEQANAFSILFRYLALRNGSNLKRVYWLMESSAPTPVSFQPRDEELLTFLSRE
                     RIPFSVVLTKIDRHWRHYAEQQRTADRVGNDGFVHPRHRRPETHDQGFFTRTSLPQDG
                     VARNMQEVYEFLGTDQVPILGVSANRLQPNRSRNLELLQHDIVHYCTQDLLHSEELSF
                     RNMHKLSYAPPTADRIHEIQLRYPVESFVVPENNNMSLARMVEHHEEMKARFCENNVC
                     ARRLSAKDVAACHLESVAKLKAACKHDTAERERAEKVRPTATYLFESTLAAAVTSLPL
                     PGDVAGLLRASEAQGTATASVSRVGGLPERWKECDDHNAEACAADVCASRRFRVRPLL
                     VGERQTSRDSLGDILERALDEEEPRQDFAGSIVDKGEKTANAASPPHCAHAETTSSSH
                     TLNPVPDEAPVPQPYRVDAVLLQEQPLEALPLPAMLDPDAHYVTAIDGTPIPRSMISV
                     SVEQLAVSKDDELAHFATKSGAGAYEELIVADQEKSNAGADLFMETSDVAHLPEEVQT
                     QLEEACARLTRSAARKQKERFLTKYVERKRKERSIYMQAEGYMCPWLGRSEGRSVVQG
                     FAGSCGTGKGGAVMRDLKQKGFGGKSYSARTMKNRGRATKKTGFWAA"
     gene            <1191762..>1192751
                     /locus_tag="LMJF_32_3030"
                     /db_xref="GeneID:5656427"
     mRNA            <1191762..>1192751
                     /locus_tag="LMJF_32_3030"
                     /product="putative chaperone protein DNAj"
                     /transcript_id="XM_001685577.1"
                     /db_xref="GeneID:5656427"
     CDS             1191762..1192751
                     /locus_tag="LMJF_32_3030"
                     /codon_start=1
                     /product="putative chaperone protein DNAj"
                     /protein_id="XP_001685629.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656427"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4W9"
                     /translation="MSDVSIYALRGTSALYEVLGVSRNATQREIRQGYYRLAVLYHPD
                     KNPEGSDIFKEVCFAHGILSDPEQRALYDSGTLRAELESRARACDPSMDPGVELSPED
                     LRVFVDRVRQTQEANRQVQSTFELRREEEMKRRAEFDAKNPSFKAEYEQARHLRQHGC
                     RGSTSAAHARASATADLSKTVPPKVRTSAEVLAELQREEEERLYGNPGIGSVDSSSSK
                     RAESDGLSTKHHMMSHYRATHREASGAESLSNSYSGGSTAATVRRRQLETTRLPFVRA
                     HCETPQYSETISATVQAYANYDYLTFVEGGSMDHGELEGAIMADALGNYDRHH"
     gene            <1195385..>1196311
                     /locus_tag="LMJF_32_3040"
                     /db_xref="GeneID:5656428"
     mRNA            <1195385..>1196311
                     /locus_tag="LMJF_32_3040"
                     /product="putative protein phosphatase 2A catalytic
                     subunit"
                     /transcript_id="XM_001685578.1"
                     /db_xref="GeneID:5656428"
     CDS             1195385..1196311
                     /locus_tag="LMJF_32_3040"
                     /EC_number="3.1.3.16"
                     /codon_start=1
                     /product="putative protein phosphatase 2A catalytic
                     subunit"
                     /protein_id="XP_001685630.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656428"
                     /db_xref="GOA:Q4Q4W8"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4W8"
                     /translation="MLTEILDIDEHLATLNRCENIGEADVKRLCLKAKEIFTSEENVH
                     KIPAPCTIVGDIHGQFYDLLELFRVGGEIPDTNYVFMGDFVDRGYHSVESFLLLLVLK
                     IKYSRRVALVRGNHESRQITQVYGFYDECLRKYGSINVWRYCTDVFDLLPLASVVEGK
                     IFCVHAGLSPSIQTVDQMRSIRRNCEVPHEGAMCDLLWSDPEDIDGWGLSPRGAGYLF
                     GGDVVCQFNETNKLDLICRSHQLVMEGYKAMFNDTLVTVWSAPNYCYRCGNVASILEL
                     DEHLNKNFKIFEAAPAEAREAGQRNEVPAYFL"
     gene            <1199440..>1201917
                     /locus_tag="LMJF_32_3050"
                     /db_xref="GeneID:5656429"
     mRNA            <1199440..>1201917
                     /locus_tag="LMJF_32_3050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685579.1"
                     /db_xref="GeneID:5656429"
     CDS             1199440..1201917
                     /locus_tag="LMJF_32_3050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685631.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656429"
                     /db_xref="GOA:Q4Q4W7"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR020859"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4W7"
                     /translation="MREQTKGRSLMARYVLQNAVCVVAHSSSSSVTAANADSLHPRGI
                     MKLVQGVPRLRFRNQQVHRRKIILLGYQEVGKTSLRKCFESEPFFFKSLPEVRTTSGV
                     EVQEKSMTIDGDSVHLILSDFAGQESYHSHTYFLTERSIFVLVWKLSAVEQDFQSSGI
                     NVREEERLQRWIAEVFAKYPHARIVLVATHLDELRVQGQRSVEMILNKVEGKLRSFID
                     DLIAASNMTAAPTTVGAPALASSSTAAGGAPSSSKGQISSHLAQPRYARRVIVGNFAV
                     SCKTRLIIAAGNALRHLSGEKISALLKYLGALVKEDCFADREYPAAVVPGRHTKLIES
                     LEDVKRRHPVKLLMRLSEFVQIAVNVGIESEEELLQVARLMHSWDIVYLFNQYSIEAN
                     PLIVLYPRWLNRMAASLFSYAHLLRTPLHMRSMIGGLEYLVSNAEMADMCLMRKGYLR
                     WPLARVLFHKPLYDFLRRSPDDADVAMCLELLEAMQLVYPVEVESDEFEVLAEEVPVD
                     PSVGRPVIKSQKITRYYVPSLAPLETPQSLKKLAPVLFHRGVRVRLEFNLLPDELWWR
                     FQCKLYRFIQPVTVYQPAVGGMDDEDLLLNGFRLREADEEHNRWRDSLWLMGRGCRVL
                     VYRDGANAVSVLSAENTSRGSEEVLQAVEDALVGLLQEYKGVQRRTFVACPNQDCGGW
                     LEADVVASSVSITCPTCKQTFESKQVVSSGVGPLGAPHFSQTLLVEAGELLAFCLSHR
                     SCLHMCRYLGIPYKGPSPAREESVEAEADSESDSHQTDALGTHVEYLHALDKVVQAVL
                     FRSWMQRTEEQERRRRMLEDEPTPAFF"
     gene            <1203747..>1207043
                     /locus_tag="LMJF_32_3060"
                     /db_xref="GeneID:5656430"
     mRNA            <1203747..>1207043
                     /locus_tag="LMJF_32_3060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685580.1"
                     /db_xref="GeneID:5656430"
     CDS             1203747..1207043
                     /locus_tag="LMJF_32_3060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685632.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656430"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4W6"
                     /translation="MRQRTVSRSRARNQIHISAAEEDDLRVALQRFLDKLRQHQPLFT
                     EDDVTAISFPPEGSSSSCVGGGSPHSSASTSPRHSPSRADNEEATLDGTFKGGGSSPS
                     MAKSRKVPTAFPTTTGSPTFASASVIDLDVPLSAPLFLTAVNLFEAKLLSKSKRVSTD
                     ALKLVRQAYALVWRDPGYLATLMNGDPCLAGASSTGSSAPPYGWSRRRDSASLASSHS
                     KPHLTCQALFSASAPAPTQRPDRRLALQLDECIRTLLVYANTSVNLCQSVSTNTRTLL
                     LLAFVTCAARRLEEEDDVPYGDGPGSAADIVVGNRNLHAELKKLESLWRSCGIEGRVA
                     DYLRECYLVEFLLDAALPPAVCSARYDGLQMAVYEKKQRIITDVVASRAGFASMMRMT
                     PLRGLCGLANMSAFGNSKLRARLLDKMASEGVVERLAAEMAAAIEAVLAPDTATTTPA
                     HSSTKRPRQSAVCGGSPAHQRSRAGASRPASRQGSLDSVSPAGKERRAKTIARVSTSL
                     ERLLDSDPTPVERIGQCADILMLLTCPDLRPPAGGEESPSLLSTSSASPVVRSTTWAS
                     RDAALHEICLYLLAICFVSKTHARYAELSSLQLYAADCMLQCAAYSGAFYAMVVHAMD
                     ALIDMMESMSAAPVASVQRTPLSSRRASCSCLVSPQKSGRTDAEEGDRLDSERGRRVL
                     QQLLPGDEAGLLPLLTNLLQYTIHAQANAKSIRRWLGFLADRLLPEVFEAPQLTMGRR
                     SSAAWGRQQQQEQRRRSQADSRASRLPGALGNGSPAAADGAFDAPVLARDLTRAEVVA
                     AAPYFCFARRAVEETSWRDGTELLFAKVVLLAFHVIVTQGHRCNLLFGQACACYDVVA
                     PVLLLRSSQSDNGASPGSRSPRSSRRSSQSSTSATYRRSTLLMHLREEERASMQAQLH
                     SNEDASEDGDVAGSEERETKGADEEEEVFIGSIIRRRSLSTRQRQRGSPVKGNAVSAE
                     RHSLAKKAGEDDQVFSPFIRSPSRSLVFYEACSPSDIKASSDRPLDSRGSRRRRSSPS
                     DRRSSDGGRSLGAALDEAAFAVPTASATLAESPEAVTHSWTGRLSLRSLLSSIGGHSE
                     APLLDREKRA"
     gene            <1208269..>1208622
                     /locus_tag="LMJF_32_3065"
                     /db_xref="GeneID:5656431"
     mRNA            <1208269..>1208622
                     /locus_tag="LMJF_32_3065"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685581.1"
                     /db_xref="GeneID:5656431"
     CDS             1208269..1208622
                     /locus_tag="LMJF_32_3065"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685633.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3065"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3065"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656431"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4W5"
                     /translation="MIYVPFGVGAGAFSVLNACGSIACWYRSRRRVMLLTGAINTCIG
                     GAAVVMYPYDAKLSNVYMCAAATSASAQYFLHAMRTPQLLAPSMMNFLYALWSVGLLV
                     YAYQRARWVYALRYD"
     gene            <1210491..>1211861
                     /locus_tag="LMJF_32_3070"
                     /db_xref="GeneID:5656432"
     mRNA            <1210491..>1211861
                     /locus_tag="LMJF_32_3070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685582.1"
                     /db_xref="GeneID:5656432"
     CDS             1210491..1211861
                     /locus_tag="LMJF_32_3070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685634.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656432"
                     /db_xref="GOA:Q4Q4W4"
                     /db_xref="InterPro:IPR004181"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4W4"
                     /translation="MTGDGGASPTDARRSKSQHMPNAENNEDEELMVASVEFSLLCPY
                     SRLPMRYPVRSNECNHLQCCDLDSWIVMLNKCRSMRDPAGPCPVCERRVTSSSLQVDL
                     WMKHVIDQMPAGTHMVVLEPDGTFRNGDTTRERRKEQMIMEVVDATQGDYENYFGDVV
                     DGDDDAVVQRHRVTTSDASASTSAAFFPVSSRRPRMESPAAPEARSDVPSTGGGHRVG
                     SPPLAQVKTEKAAILAAEAEAAAGTSPSVTGSQEDGGVVVVHFVEGRRDGLQALPSQI
                     RLWALHCTRCGAPRVKAEDGLVQGCQQCGHDAKGDWNFVRRFEASSSVSMELVPDGTL
                     VLQGVDILAPYLYRAGFYRSLFEVMEYASVAERQQQQYRPPADVWTSSFPLNRFEIDF
                     LEACCARIAQGETLDSIESMIVPSLFRIPRRRRPGGSGQTSFTQIGHGSGRYGGLGSA
                     TASQAH"
     gene            <1213636..>1215750
                     /gene="ABCB3"
                     /locus_tag="LMJF_32_3080"
                     /db_xref="GeneID:5656433"
     mRNA            <1213636..>1215750
                     /gene="ABCB3"
                     /locus_tag="LMJF_32_3080"
                     /product="putative ATP-binding cassette protein subfamily
                     B,member 3"
                     /transcript_id="XM_001685583.1"
                     /db_xref="GeneID:5656433"
     CDS             1213636..1215750
                     /gene="ABCB3"
                     /locus_tag="LMJF_32_3080"
                     /codon_start=1
                     /product="putative ATP-binding cassette protein subfamily
                     B,member 3"
                     /protein_id="XP_001685635.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656433"
                     /db_xref="GOA:Q4Q4W3"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4W3"
                     /translation="MGERVAAAGQEAQRSPHRPLPPVDQPASPGDALPFDAAQKTSTG
                     DATAEPETSVKKEKPTTSITTPPRLDGIQISEKASDIPVGRVLWKMWTYLWPHGEPKI
                     KMLVASSVVCVLVAKVLRVAVPFWFKTIVDLLAPTTATAEAVAVAGPLTVGVFGCVVA
                     YGICRITTFVSEELKTVLFAPVGGHASTKLSMEMFNKLHQLDLDYHLSRETGVLSKDL
                     DRGSRAFWSLAYVLLFMIAPTIFEMGLVCYALNSQAGPQFIGIALIAVFSYVAWTFSV
                     TNWRSKFRTRYNALESRVGGLIVDSLLNYETIKYFGSEKYESERIREETENMNKKLVI
                     LDQTMALLNFGQQLIFVVASVLSLYLATCGVLTGAMTVGDLVLVDALLMQLYMPLSYL
                     GMIYREVQSSTQNMQAMIALLDQRSNMKDTADEKAYKYIDGTIELRNVTFEYKTELDR
                     LVLRNLSLTIPGGKTVAFVGPSGSGKSTIFRLLFRFYDPTSGQVLLDGQPLDKLRMES
                     VRKCIGVIPQDTVLFNESVRYNIRYGRMDATDAEVEAAARAASLHDTIARMSEGYDTS
                     VGERGLRLSGGEKQRISIARVLLRDPPILLADEATSALDSMTELNVMETLKNATERTR
                     RRTIVLVAHRLTTVKEADMIFVLDGKGGLAEQGTHAELLGKDGLYAAMWHQQLSEQYQ
                     ATGGAAPEDAQATDAEPAATHG"
     gene            <1218472..>1223010
                     /locus_tag="LMJF_32_3090"
                     /db_xref="GeneID:5656434"
     mRNA            <1218472..>1223010
                     /locus_tag="LMJF_32_3090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685584.1"
                     /db_xref="GeneID:5656434"
     CDS             1218472..1223010
                     /locus_tag="LMJF_32_3090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685636.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656434"
                     /db_xref="GOA:Q4Q4W2"
                     /db_xref="InterPro:IPR007527"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4W2"
                     /translation="MLVLGDVSDSAVLDRKAQPEEERIEEFVPFPAKSSQALSALSFH
                     SSFFSYTTDSSISAEPVLTSKSPALVTSPSSSASRGGRAPLQRTGSLSPQSQPSAPAS
                     LSAVHEAGQSPDVKEEKFLFSSSLSSSAVLAEMRTTISQLTTSSFPVPPPLVAASAMT
                     TQVLPCCTDDEGQHCSRASPPAMASSSLSLWTPRTADKPQTEARELRCRGPSAKDPGA
                     ADTVLTLPLAALDELPPPTLVSSSSFFSASPSAASPLLAVAASLNETPVRASLSHLAT
                     SLLYADGVDPLADEPHTQSRINTAALPWVPMLLPTMPDPKRRQQRGTDTFPPHAEGHD
                     DVRCAAQAGGKPAAKRRRTRKGTKEEASTTGEVVSIAERGMPAPAPLPQSPSSRRRRT
                     SKAATKDAHQIALTTTVRKDAGLAPMPKSEAPLDQKENCDGARGLTESSKDHSPASHT
                     EPRHISLPPNSAKPSTALHPQELTVLGGDVPLSHLFATGSNLSADSKSMAPAACQPPA
                     APSVPSQSQEERLRRTRFRQARVPRTAAAAAEDGAPPSAGLVAAETSREEAEPASAAA
                     TSSPLCLSSPPVPRLPARSEKLDDGGAKAELPASGGTSAAPSLGAARGGKTPTSSLTL
                     PARKRRTVQTTPAGATETPSSTGSGDTSGSNGAATHAVSTSKCAADVQPSLLQAWWSA
                     ACTSASSSESGRSCLWVELSEGYQEAHGTLLRQALVYWGWLHSESSVSHCGGLELPIG
                     VSPLSSSSTPKCTSRRRARDRKRSETTAAGASAQCERTDRRVNNGLVVLLCPSPLPME
                     EALRWWTQRAHVEHSFMPPLLAVSMSADPQSSALGRSDRVPSASRAVPTPEEEYELLR
                     GAIQLASSVYCTDAARSLAVSCTAAGHAALAQLLSLNQVFDSLQVCADTLRSAAGLPP
                     VSSLVQTPLDEDADVGSLTAVLAVTALVQGAGSGSGSAREGGRAASLQERCFAELCRW
                     NGLAAALQRQPRRPQLVLRRVCVNPLHRNGGTSKRKRTPVGPAVSPSALMDPSEGVLS
                     ASSVAGSSLLPEERCQWVTYGMVLPATRNEDTFASSARREDRVLASQSPLVALAPAHL
                     SALYLFGRALFTPDNYATAVNVVESYARVSQRCLTDYISDYTCVMTGPLRYSVSATVR
                     RYLQVRVLVELAPLLALVGNMTAAQPLASTRLSAGGACVSPPSTSTLSAPVALFARSQ
                     WRTVMLSLSCTCNPRLYEQVPRTDDGVKVCRHVAELFHYFTTQQFSVVGHQAVQREQP
                     LPQHQVQRAPARVDPMLYLRSLSPVSLRTTSSEKRQLSRRSRTSTSTSTSSSGSSTNV
                     ISSSLPLPAPYTHSSDLCADSEGTARKQEKHEVSGSDSTDSASSARPPARCRSLQRSA
                     TVALSPATPSKAPRTRPSKKAQRSSTAAAANASVASSATASAAGTNFHTQALQYALRL
                     LQERLRDGSGERTADGGRASLATAATRDGGSLFRPSGPPPPARARKRTRSEGVSAGET
                     EHARALRLVEQLLRDQLR"
     gene            <1224640..>1225404
                     /locus_tag="LMJF_32_3100"
                     /db_xref="GeneID:5656435"
     mRNA            <1224640..>1225404
                     /locus_tag="LMJF_32_3100"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685585.1"
                     /db_xref="GeneID:5656435"
     CDS             1224640..1225404
                     /locus_tag="LMJF_32_3100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685637.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656435"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4W1"
                     /translation="MPADSTATAREVPIDTVALQLDAEMAQMRLQRQRYSTLCTRKNR
                     LQAHVDELNAQGKDLTFQRQREQTRSAQELEHGLASSSTSLPEISRTPGDQAQLPAEV
                     LGGALQELTACITERRELLQHLRDGSHDCLKLRDARFAKCSLSTVAGLDDHVASQSGI
                     HASDTTAVIAGRGEAPTRCAARNPVSDSAVTSAAPASGLRHVEEGLAKAHQALCRGEE
                     KALAEREYLLLLLQQCAQPQQLQQGRGRLACRQMAD"
     gene            <1226312..>1229200
                     /locus_tag="LMJF_32_3110"
                     /db_xref="GeneID:5656436"
     mRNA            <1226312..>1229200
                     /locus_tag="LMJF_32_3110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685586.1"
                     /db_xref="GeneID:5656436"
     CDS             1226312..1229200
                     /locus_tag="LMJF_32_3110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685638.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656436"
                     /db_xref="GOA:Q4Q4W0"
                     /db_xref="InterPro:IPR005645"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR013646"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4W0"
                     /translation="MPVRVLCLHGAQQTREIFQHQLSLFQDDLAGIAELVFLEAPHVL
                     PLITAQDDLPTRSWCSTDGREDYSAGDALVATAMQPAGPGTDLAFTVMLGFSQGALMI
                     YRYLWLHVADAAVAAQLRGVVVAGAPDPRRTFPRNAENTLFQSASDSAASSAAGVTAF
                     GALPFLHIIGKKDAVVAPEESAAFAQVCSSASHTLFHEHAHSIPALKEVRTAVREVCQ
                     TALLSSAKLAETLEARAEELEMVRSMYEEGCVLACGNETLVRIPLFTDAESLLASSSL
                     PVAASLEASAVHTLERIKVCFRVPWSYPSTLPMVEMADGPAWHSIKYERWAADIVVRT
                     SAYLADELGAETAMLLPAYLYAAGLAQEKLNVLVDIFAEEACGRGEADGEAAVSQLAG
                     PWAAEDELLREAYIAEAEAKAAELLLAEARRPRDDRRPTADVGEDDDGDFDSEEAESA
                     GASAAGGRGGTCTLTIGLIGKPSAGKSTFFNAVTNPAVESDAARVAAFPFTTIEPNIG
                     AGLAPLYCPCATLRAAAVARAGDGATDVAATAGSARSSSAALSSGLAGDLCDATYGHT
                     RALGSDRFRRHPVRVKDVAGLVQGAYQGKGKGNQFLNDLCDADVLVHVVDGAAATEAD
                     GTACAPGQGSTMEDITWVRSEVHSWIYDNLRAKWTSLVRQPTKLRTMFSGYRSTPTFV
                     DRVLRRVGIANEIALTAMLRTWGPPELHAFVALYVRLRFPMIVALNKADLSTAADVAA
                     ALRQAYPHEVFVLMTARIEWLALQLSRKGYVDYTPGAASLSLKADCGEGADLEKRVRQ
                     ELHDVTSFFRTTTSSPERLSSSVLRLTTTGVQDVLAAAMEACGVMLVYPVRAFHPVTS
                     LAHCLTFKLGSSAERVFNALVHLQLLEGKLARFEMIDLAPVKRQLHQQLLASLATAPS
                     NEASTPVPAQQQQCAVALPTSVQTLRKTEVIRSSAVLARILSNKRQLA"
     gene            <1231811..>1233070
                     /locus_tag="LMJF_32_3130"
                     /db_xref="GeneID:5656437"
     mRNA            <1231811..>1233070
                     /locus_tag="LMJF_32_3130"
                     /product="putative ribosomal protein L3"
                     /transcript_id="XM_001685587.1"
                     /db_xref="GeneID:5656437"
     CDS             1231811..1233070
                     /locus_tag="LMJF_32_3130"
                     /codon_start=1
                     /product="putative ribosomal protein L3"
                     /protein_id="XP_001685639.1"
                     /db_xref="GeneID:5656437"
                     /db_xref="GOA:Q4Q2Q6"
                     /db_xref="InterPro:IPR000597"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR019926"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2Q6"
                     /translation="MSHCKFEHPRHGHLGFLPRKRSRQIRGRARAFPKDDATQKPHLT
                     SFMVFKAGMTHIVRDVDRPGSKVNKKEVVEPVTILEAPPMVIVGIVGYRQTPVGLKTI
                     GTVWAHHTSVEFRRRYYKNWKQSAQLAFSRQKQFANTKEGKVAEARTLNAFAKKASVI
                     RVIAHTQLRKLRNHRVGVKKAHVQEIQVNGGSVAAKIALAKSLLEKEVRVDSVFQQSE
                     ACDVCSVTKGHGTEGVVKRWGVACLPRKTHRGLRKVACIGAWHPARVMYTVARAGQHG
                     YHHRTQLNKKIYQIGRSVAVEPNQATTTYDLTAKTITPMGGFVGYGTVRNDYVMLKGS
                     VSGPRRRVMTLRRPMAPQTSRQLKEKIVLKFIDTSSKIGHGRFQTKKEKNQWFGPLKK
                     DRIRREERLRKERAARAVERKAKAAKK"
     gene            <1234709..>1236148
                     /locus_tag="LMJF_32_3140"
                     /db_xref="GeneID:5656438"
     mRNA            <1234709..>1236148
                     /locus_tag="LMJF_32_3140"
                     /product="pyrroline-5-carboxylate synthetase-like protein"
                     /transcript_id="XM_001685588.1"
                     /db_xref="GeneID:5656438"
     CDS             1234709..1236148
                     /locus_tag="LMJF_32_3140"
                     /codon_start=1
                     /product="pyrroline-5-carboxylate synthetase-like protein"
                     /protein_id="XP_001685640.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656438"
                     /db_xref="GOA:Q4Q4V8"
                     /db_xref="InterPro:IPR000965"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4V8"
                     /translation="MASAEAEVAADMSAMWRYAEEARAGSSALSDLTYAERQAMLRAV
                     AKALQTNEARILEANREDMVAAKANATADPLLRRLELTPSKLATLIEGISTLADMPDP
                     IGQILSARELDNNLLLLKQTAPIGVVLVVFESRPESLPQIASLALCSGNGLLLKGGRE
                     GEHSNAVLHDLIVSAVESSTQGRVPRGVIGLVTNRADVYSLLQLDAHIDLVVPRGSNA
                     MVQNIQRSTRIPVLGHADGICHVYVHKDADVDAALAVAIDAKLNYPAACNAAETLLLH
                     RDLLHSPAHGTTAAQFLVNGMTEAGVSFYAGPQAIAAGLASELAASLHMEYGDAHMTV
                     EVVDDLAAAIAHVNRHGSHHTDTILTVDKAAAAEFQRRVESACVFHNCSTRFADGFRF
                     GLGAEVGISTARIHARGPVGVEGLLTQKWVLKPMGSLPQATEDGAAAAAANAPYATVA
                     EFQKGQRVFTHKDVTRKLQDEAAGLRLQA"
     gene            <1237527..>1244900
                     /locus_tag="LMJF_32_3150"
                     /db_xref="GeneID:5656439"
     mRNA            <1237527..>1244900
                     /locus_tag="LMJF_32_3150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685589.1"
                     /db_xref="GeneID:5656439"
     CDS             1237527..1244900
                     /locus_tag="LMJF_32_3150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685641.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656439"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4V7"
                     /translation="MASMVRHYSLSNPPPVEGALDGRETVHEAEILEVQALQAERDGE
                     CGRGVLLMERALQIRCHLVNRLREKWASAASGTGSSSAAGAHRVSVFANADAMGKEEL
                     LLEYQTQCGELYDTAERLVVRCNGLAVEHFKRGAFSEASPLLEYAMQLTEDGAYPLCE
                     VDERRRHLRGVTLNNLGCMERRRGHFSEALQYMKSSMEMTGVESPVAYMNTSAILIQL
                     RLSDEAVRMAERSIELLYQTPEDPSLLAVAHHNLAMALEPVDPARCLEEYALAYRTAC
                     STLGPESETSLCIQRSWRRYEATRVPPATGAFFMGGDGAAASRLRRLVAAAPTRRAYT
                     APHHLPATVPRTHTGKSGAGSPMDVIELFPHPFLPSASVSSAPTKTPRDVTPIYRPAV
                     VPRRPLAPGPPPGVRATSSSRSREPQSQPRHQQQEQHRQPRRQYGTEKVMRSSPPASR
                     TAVAAPRPPPTNRAKEAAVAAGSGRVAASMTPSPPPSRQRQATAQRRYSPTTQAQESS
                     RQSPPRTGNRQQRLSVQKSTADACQTASGSRKREKSTLHYANDRLTTQASSTALSSSA
                     AQSPGRGPRPPIKESSSSNHSLPMPLPRNLPPLQTAVAAEPPAVAPNSSYSRSLHDAK
                     ANASLPSTSASLSLTSDPLTFLQNRLEILLQDEEELEHKYVQATVIQRYYRGHLAHRR
                     VAALRATRASYARLAQLRCHIAARCIQRAFRRHRRHSRYPLAAGQLGRYAAAGGRRGA
                     QHQAATLLQRIARGWLARRHYAQLRKYACESPAAATRIQRWIRALQARRHYAVLLAAK
                     AEQDAVALEHERRQYAATRIQGQWLTHLQRRACQAALRHRMMARAAEDARCRMRAAII
                     IQSAWRGYQARRLYQDTYSRTFQLRTARLEYQRRRQAAVRLQAFGRMLIARQHATPLL
                     TVARFRAAAEIRTRSHEGQAAIKIQCAYRRHVAHRVFVTKRAARKNQISQDLVQVHTT
                     TVQRAGRGYMARKDVGTKLSVLQAEAERYERRLLALKQKELEAARAVALAVQLSISEL
                     RECEGEQRRILARAEQQQWHDMLTQCNALLAATKETEVEQEAMKVISSEALHDFSRII
                     KAKKQRAHRQEARDAYLDQCAAEDAEAHKEASARVVTDFMRSAAARSTLRSLVKTMSS
                     YNDARAMQEEDDKTPAAATTDGAAPKRPLTAEQIAAERAELDRLEREELLASEAAAAP
                     KRPLTAEQIAAERAELDRLEREELLASEAAAAPKRPLTAEQIAAERAELDRLEREELL
                     ASEAAAAPKRPLTAEQIAAERAELDRLEREELLASEAAAAPKRPLTAEQIAAERAELD
                     RLEREELLASEAAAAPKRPLTAEQIAAERAELDRLEREELLASEAAAAPKRPLTAEQI
                     AAERAELDRLEREELLASEAAAAPKRPLTAEQIAAERAELDRLEREELLASEAAAAPK
                     RPLTAEQIAAERAELDRSEREELVCKRDTTSAYEEEGPPAADESFTSADASISASALV
                     DVMLARLKAIWQAEVAAEKQRRHQREELHWAIFEHRQQRIAAAEEGEDLAPYRINRVH
                     LQMPSPAAPKKAHPSPAELSTAMGNRYRHERAAQELAAVQCIERCFIGWGARKHLKAL
                     LRVLDEYLSALQDFDRHEGPVLTYARLREVLARYPDLRTRVSQLPVSLSPPERAAIED
                     GNSSASPAISPTSRKTLQAFSCIIEAKKQRAHRQEARDAYLDQCAAEDAEAHKEASAR
                     VVTDFMRSAAARSTLRSLVKTMSSYNDARAMQEEDDKTPAAATTDGAAPKRPLTAEQI
                     AAERAELDRLEREELLASEAAAAPKRPLTAEQIAAERAELDRLEREELLASEAAAAPK
                     RPLTAEQIAAERAELDRLEREELLASEAAAVPKRPLTAEQIAAERAELDRLEREELLA
                     SEAAAAPKRPLTAEQIAAERAERDRLEREELLASEAAAAPKRPLTAEQIAAERAELDR
                     SEREERDVDAGEVKASQPLGFEQLLAEGAAVGHLERWEQISFDGGARHHPRRLTEQQV
                     VVERLALDQLDDLEQVAMERGRLGRLSCVEHNVLSAAALLAQRVQEEHCSADSAYTST
                     SSSVRPFEPRQREGLTSSEAGGRLWVFAKTIRDKKDLRQRQAARDAYLQEMHNENAID
                     TDEEEKQQEERPPTPSSGAITWRRCSNEVSGDDREMMSQEALHQLYHQERRSFASSLV
                     GGFVDIIKAKKQRAHRQEARDAYLDQCAAEDAEAHKEASARVVTDFMRSAAARSTLCS
                     LVKTMSSYNDARAMQEEDDKTPAAATTDDGSGEGAYATPAESCEHSPLSAALRIQRFF
                     RGVQARRRVRVLQEAHRAYLEEELAVEELLYSAAVAIQCLYRGHLARRQAAMIIVQRD
                     LYLLSLQEEDWLGGDSKRGEGSDASLPAALSFFASSPKSVAGGGAKAAATRPFTPRRS
                     SSSSYTGLREVASTAIVTEVNEADEAALDQLLHRP"
     gene            <1246851..>1249166
                     /locus_tag="LMJF_32_3160"
                     /db_xref="GeneID:5656440"
     mRNA            <1246851..>1249166
                     /locus_tag="LMJF_32_3160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685590.1"
                     /db_xref="GeneID:5656440"
     CDS             1246851..1249166
                     /locus_tag="LMJF_32_3160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685642.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656440"
                     /db_xref="InterPro:IPR025875"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4V6"
                     /translation="MSEGVGGGAGDASDRRLISATANTKGSRPSTKTASKEKEKVSAG
                     GKHKNLLKSSQEASTKPAEEETPPHLPVTLTITYVSLHYPVFCLNQRDMTPLSRAIPH
                     CPSLVSVELIGCGLSAQSYMQLVEAVYRSPRVLSVAVDFNQHISGSSYTPHSLEKGSH
                     ASVLTNAREQAGFVIDPTLLNAASPSLGDALDMSVGGVCGLSFASGNSQERPFGFNIV
                     PATPPGGTSAADAATGGDSNTSRAARGDPKPTVMRHSRLVQSAAADASVTVLAEAQRV
                     GETGDEDHGGGNLELYFYPTQYCGLDQLPTQLELQLQEETEKKGKVDGKRLQQVQAQR
                     DTLRIFNRQNRMEVPKSWDGILFTGIRFLSLRGNGIDDAAVTRIVDVLTHNPRSQLES
                     LNLWGNNITDLGATALAQLLRHNRDIRVLDVGNNKLSDTGLLELIDMFRMHQVSSIEE
                     VLALRRAYLTRRGATDEERKAAGQPLLATDIPSYEDLYAYWWYTQQQQLHQPPPPLPH
                     ATERSGAADATSQVWNNSSLSSALYMAPPPPPPQRDASLSPSSSSAKRASSSKSKPIR
                     SESAPGGCGGGPMASAAATLSSSAARAAMRPTVVFDRDCVRMCHLAENDSSIRVPGNT
                     VLEVLNLEENRYVTIVGVREAARRLALREPATTAEMLSMVEVREVHSTPSLSPSAPHS
                     TASSSMEGASKRLSSAIHRSTAAASQPTPTPLTVIHPPELHCAGLRLRACTVRCHRES
                     DRRTWREMDEVQQRLNASLAQWSHSRAASRT"
     gene            <1250664..>1251161
                     /locus_tag="LMJF_32_3170"
                     /db_xref="GeneID:5656441"
     mRNA            <1250664..>1251161
                     /locus_tag="LMJF_32_3170"
                     /product="putative NADH dehydrogenase subunit NI8M"
                     /transcript_id="XM_001685591.1"
                     /db_xref="GeneID:5656441"
     CDS             1250664..1251161
                     /locus_tag="LMJF_32_3170"
                     /EC_number="1.6.5.3"
                     /codon_start=1
                     /product="putative NADH dehydrogenase subunit NI8M"
                     /protein_id="XP_001685643.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656441"
                     /db_xref="GOA:Q4Q4V5"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR016464"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4V5"
                     /translation="MSWRARFTPCVGSLTVWLNPKDPNCFGVRNWWRNNLPELQLLNP
                     FCTFTIQELSFGEPHMYVNYTPTDQRMIRLAGATEEECEEIMEACITYGMNHAIIERP
                     RTDDGGDLVNQPAITSFGYTESFTAKLEVAPPADIGQKTTEGVDDPGQKPRLYPRNVG
                     CKLMP"
     gene            <1252378..>1254399
                     /locus_tag="LMJF_32_3180"
                     /db_xref="GeneID:5656442"
     mRNA            <1252378..>1254399
                     /locus_tag="LMJF_32_3180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685592.1"
                     /db_xref="GeneID:5656442"
     CDS             1252378..1254399
                     /locus_tag="LMJF_32_3180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685644.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656442"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4V4"
                     /translation="MPSYTPYVAYTKRVTARLRARMHKQSFTNTILASTQADRTDLSR
                     VADARLRELMALRADHRRTFDPIFKQKALNLLQTLPLKAAADDPHFSYTLGALRVCGY
                     FSATQSPATFNLLNHATRHTFLLDAFSFYQLFLALEEMHHPQTAEILSIVLPRVMEVA
                     TDFTEGEARLLLDLYFKHNLLTKELSERLVGVITGSVNDLSGKDLTSAVSAVPNMGFE
                     QISRRFLEAATPRLCRALRETTEQVQLYKATYLEHAGRGAAASDAARLMLIHDADGQP
                     PPNPDMETPTERTLRRRKEEAWRQFLINHILEGISLHRELQKSIAWLCWAPRPLLNEV
                     VRCALIFSGPLLADSAEQLPAALKDNATGASASSGAISADGELAAIVAEREHYARDLP
                     QVRRRSLCHCLKMLHFTSYRHLPALRFLSARIAATKDVLGIVSPLVLARELSQAVEAI
                     AFFYATDCAPAVTAIIDDILEHIEPVTNSPALLNHFHALTTEELKLVERVVLRVLLSC
                     TRFLSTRISEKSEKSALQRAPAQEEAIRAILAQATALAISPITRAYLALGLRLMHSSK
                     AHGERGAKQVQCFTGTMHLLYATTVILTVSAQAGTAPTASGPAAHEALRAILRQLVPW
                     AQTMATMQAGEMPEEAAVEMAKALALLKKHPEIMDTLARDTTRREDKEA"
     gene            <1255286..>1258405
                     /locus_tag="LMJF_32_3190"
                     /db_xref="GeneID:5656443"
     mRNA            <1255286..>1258405
                     /locus_tag="LMJF_32_3190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685593.1"
                     /db_xref="GeneID:5656443"
     CDS             1255286..1258405
                     /locus_tag="LMJF_32_3190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685645.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656443"
                     /db_xref="GOA:Q4Q4V3"
                     /db_xref="InterPro:IPR009081"
                     /db_xref="InterPro:IPR019465"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4V3"
                     /translation="MFSNEQLIGPDFDEVAYLRYALRAANHSAEHARLESCIAEVKRD
                     IQSALAEHADSLIDQARCTYKTHRQVTAVRQSTDSLQKASGRLRIMIEEPYMQLQSRV
                     KELEATQEVMQLLQSTLRFLSLTARLQEQLATTSSIDIVRSSYTLKELEEVLQDGSIR
                     SLQVVEAQLPAVERHATTIRSKVHELLAMTELTAPPSGNGCTGGAAAVTSAAASASRL
                     AHQVSTGLQCAYVLRMLSRTVHSFMTERRREVLRTIMRELDAQAIEEHISSEYDRLSR
                     SSPSGHSGAVSEQAATAHVVLQHIQKTLFIAVQHTRCVILLWRLLLQRRDTHTQELYL
                     FSIDSPVQFLVEYWSAITEKLRERLNSLQKRHTIRLALASAYPRYHHLVASFLSRTDV
                     AGVAEGPLSTGAPGGVAADSEGSAVTGGAGTAAALFSIHVTQCGMGDYLDLIETVDAA
                     VRRGVAGNGGEGTPFKTSDKSPSLAHIGTATPPRTDTQDMRHTWLEQVTDEARDAFRT
                     HVLDRHREVIGGVFLRLSAVVPPSAAAAGQTATVAPVRMQGSLRPSIPPQANALDMAV
                     YTRLVTQEVQMFRQDPYTLDVLLDCIFSTLRQVWVKLSEAIKRYPLPPLPAVTAAPTL
                     TQVMHLSIANGCTTLAYDCVAVLAMVPHPAASQTAGGGAGAGGAAAASDATSGAHRHA
                     HQDPYALVLEQLGTKRMAIQQLIDAFHNMSERSTKPFADSAASVLLPTLTQAVDNVLR
                     NELALSSAAAATAASEGRAHANPAMPLCGSGGGDSRTALVQLQSQCRQFTDRFFFLVD
                     ARTSGWMEACQHVTNTMLARLLIRLATTPPPPTLRGTPLATAPAYAHTLQVMMPPLLQ
                     FVQMVQSAGTVGRITSLLRGCVRQVELFYETCGGLGGAGSGDGASAAAALRAAVMERL
                     RPPIPFFFAKLLVLQYGLFTTPASAPLENSQGAVGPSALAGAVRLSEQGLLECLEGVL
                     LTESSARATAVPSNLEGAGAPAAGATGADRKDEVLSAVDALFLEVVAAAPSESAACLQ
                     ELWASVQET"
     gene            <1260645..>1264598
                     /locus_tag="LMJF_32_3200"
                     /db_xref="GeneID:5656444"
     mRNA            <1260645..>1264598
                     /locus_tag="LMJF_32_3200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685594.1"
                     /db_xref="GeneID:5656444"
     CDS             1260645..1264598
                     /locus_tag="LMJF_32_3200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685646.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656444"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4V2"
                     /translation="MSGVLLKQLKQVLAPWESLPDKDKLDEGSGAASSLWAMPPPTAP
                     NCASSTSSVSAQFAPVTKCTSVGWPSEEAAAAYVAHSRTATTKLELARAALALFSSNA
                     GVYRPFLVKLLRFLFDHVDELREEQGQLRMEWWMRQQGGGSSTSKAADGDGGGGGLVV
                     GTPEEQNAVAAAYEKVRMTEARMAALVEEAAVQRDHFRSQMGMQKRHQHHLEDLLCHQ
                     IELTQTLLDHRLHQDLVSGKQSTAVTTVAAVSHTLQDSRGVARVGLGDGGDDHARGIR
                     EGSISARLAAGTTRDVSGLECSHVSIRPPERRDAAYVQRLISRAEKELLLERTEDQLR
                     DLRAQYDNLQNKVQSLLKLNSRYARQSVELSARLSILHEHNIALAADVQLFQRDYIRA
                     SQRAERLQRDLQVARGIALTMLHVQFGRQLGVGEEGREDTQGTSKEDNIALWQAGAAA
                     SRLSAPGKGGEARMRYAFETAEPLAPAAATAVTGLGETAPALGGKDTRTKEAQAMLDT
                     ENHAQESLHLAPCKGLRSQLQELLTMSDPRHTSIKASLLQNLHLRSDTNLQGGCGDSS
                     GFLFSSSGAQGWLSPASVPQWVPPYGLCPDVPLQLRSRSSVPLLHLHPVVAEVFVHEL
                     LSQRQELLWYSKQQLEERQAPPRMAEGRAWDNRGSGKASATTSTSTFMSLQEYIGLFV
                     LVVWLNRPDYYTYLLPPAMRLATAEDARARRGSRNGVVRNTPALSAPATDAGGAPQSQ
                     DLETVPASLWDLRHVLHTVRLTDDMEQLPAEGLQLTYALDTASLQLVAGPLTYAYGLA
                     SRGALCDVLFDLLRAERFVFVELCRAVEADILAKQEEARRQESQIHVARSEDPQLHAA
                     DPAAAALSPPKPGPQPSTPLRGCIPAVQVARILLAMYPGYSATIMDQLIQTAVNDGTN
                     VAENPVYLFYEVLLPSRMLPGPTTTSMSIDPSMAVGTSFASLFYTAICDDALESMQVV
                     EDSVRGFAHGHLHSSGMSALSSTSAATVMSGASTATAQQLTSLAFLGVPRAEAQYWGP
                     SLRSAIYRWPRLHSTIMEGPLVASTASADDAVLDGDAGTTREIPAVVDDEFPAAAAAA
                     AGRSDRFSLDSGVVLQAGAPSVHPIQDLHRAEDRKAAAKVSSVARVSVEEVVPYLRRH
                     LLLRRGLCDWATGTAAAPVDISPAPAEDGQTARKTSKTVVAKTAMAASIARTEGAQHW
                     SAAHSDLLRHWDAQWAQYSGKTAGSPSAFVGPTEPAEFQQMLKQVDPHRTCAWGSELL
                     RRENPLMHPVTYDWTQGDPVKLEPPPREEGDSSSSRRSGKSKKPKKDRRQSTVNR"
     gene            <1265388..>1266044
                     /locus_tag="LMJF_32_3210"
                     /db_xref="GeneID:5656445"
     mRNA            <1265388..>1266044
                     /locus_tag="LMJF_32_3210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685595.1"
                     /db_xref="GeneID:5656445"
     CDS             1265388..1266044
                     /locus_tag="LMJF_32_3210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685647.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656445"
                     /db_xref="GOA:Q4Q4V1"
                     /db_xref="InterPro:IPR013684"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4V1"
                     /translation="MAEEKIKIIVVGSVKSGKTTITNFLSGTRETATSKYYETNPLRI
                     VETEIELDSMNFTDRRVVFSGGDAKTKRVLVQIWDLSGNSKHQAGWPAVANKADGIIF
                     VFNPALKNGEKELSLWHKTFAVNQSELDALGNFAVRVPDKHCLVFAHHSTPPSNVAGE
                     GLPSMPKGLEKIKVLETSLDYHSDNFKAAFDKLIESIVVARMEAEEDEVLQREGRMHF
                     "
     gene            <1273953..>1275836
                     /locus_tag="LMJF_32_3220"
                     /db_xref="GeneID:5656446"
     mRNA            <1273953..>1275836
                     /locus_tag="LMJF_32_3220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685596.1"
                     /db_xref="GeneID:5656446"
     CDS             1273953..1275836
                     /locus_tag="LMJF_32_3220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685648.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656446"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4V0"
                     /translation="MLVESAMESGPCGDRHFSSTDTPTVTRTRPSHTTSTISMEEQMW
                     HLTDPHVAPPAVVAVADGHASKASIVSSEEVRRGLPRRLSVLSLDTAAESWDGCSDHA
                     ELHKGTTATAVEEGEAEDVSIPYDYESEMEECSQYTFSSAPYSPSTTAALAAATSPPM
                     DATSSSCRRPDTPRIPSMLSLPSSAARSLEQEPLSPQWCERQRRDNASHHAGEHYAWQ
                     QGMRHATALAPSHMRYGLRSLVREACCREIQALRSKPAVMFVHMAAPQSESRTRSSMR
                     ASCMLASATSTAQRKARYIEIVTEHWKALEERLEELLAETEKESAAASESHLRSVGYA
                     LNALSLFSNDPQLIIREINMVHVEEQRRQRHDREAQLLITLESQGRLFLLPTLYAEEV
                     EEPVPVLHIESVLTPNEKMGEYTHPWQLLSPDASLYSPSPSPTPDESIGAISPCSSGC
                     ISATCSPMLASQPPSVASTRLKVSRRDLWKDMQPPRLPLLDLFMTAPAVVSSTVVANS
                     EVGVPYVMPVDPTYAQHELSRQGALTQVTVADPLSSPQLSGAIVRGGSTSARSSDDHR
                     HPMLLDGTEDLWGSYMEEDVLDYAETIKLGDAEVLLLSFEMNEAVTAAGPAAATRATL
                     TDG"
     gene            <1285399..>1286676
                     /locus_tag="LMJF_32_3230"
                     /db_xref="GeneID:5656447"
     mRNA            <1285399..>1286676
                     /locus_tag="LMJF_32_3230"
                     /product="putative dynein light intermediate chain"
                     /transcript_id="XM_001685597.1"
                     /db_xref="GeneID:5656447"
     CDS             1285399..1286676
                     /locus_tag="LMJF_32_3230"
                     /codon_start=1
                     /product="putative dynein light intermediate chain"
                     /protein_id="XP_001685649.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656447"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4U9"
                     /translation="MPGSPVDRKPEASRNSVQKGAAEHPQPPRRPSKTASEEGAESPL
                     RQSQELSEAPTTAATGTSASIVIDPTKDLWQNITRNVKDANVEQTETSLVVVGASGSG
                     KTTLLHRIYTSFQSNSSGSGPKRVKATTALDYSFARRSERNVAPVAHFWEIAQGTQFS
                     QLLDIVVTPENVHAVVAAVVVDASEEGLPVAWETATYWLRRLDQRVSDISQRMKAKGS
                     TTPAKILTRAQKAIGLDHPDLKRMRLSGVPTVLVINKIDAFRRDMQQLKFLCRSMRYL
                     AHLYGAHVVFTSEQESVRWRALMNFTLFQAPFDPKYLQTDPERSAVLLTVDRDSFLDI
                     GDPDVSRLGGSASTGDAELDRWKAPFDEAFPPKKLNEEGKVVDDPFIRRLYDTSEGGF
                     GDPVIDALRKQKDEELEQYRKKSSSAANASKAK"
     gene            <1291069..>1294641
                     /locus_tag="LMJF_32_3240"
                     /db_xref="GeneID:5656448"
     mRNA            <1291069..>1294641
                     /locus_tag="LMJF_32_3240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685598.1"
                     /db_xref="GeneID:5656448"
     CDS             1291069..1294641
                     /locus_tag="LMJF_32_3240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685650.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656448"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4U8"
                     /translation="MPRIQLQSVNHFSAWLHDEILTEVPFGLSLRLRPLPMQGSTAVS
                     GGGFVLARPHVGHVIASLTAETSGVPEAPATDDGGAVEAVEQEAAEVSRSLSGRVHST
                     IDWYTLFLKTLLHLTSTNGSPPRHTGASSSPSSTCVVAATDGVGRKTTLYAAMLSHCA
                     EWWDAGRAMAPISARLWHHSPPLQWAVSLRRPFVFFDETSEAAGRLADPSRLSGRGSA
                     DGGARRRLLRVLRLLSARGGWQLCVRRSSRGGAARTITTTSSTLLHQEDEGSVHVDWL
                     DYLTERCVEVDLRPAGDYDDFESLLRGTASHMRLGSSSTAHPTPITTSSARTRSCGFA
                     CAVPDVFVPLSAVLWHVLSTEVEGPVLETLHGLLRQYLCWPFLAPPDCARDPSTTCRS
                     DVTSILRYAYHALQTLVHTPEQVFACELMHSDRNGTASCTAPALPPPLAGPVTLSCMI
                     PNSVCLAPLACDSASSRFFLQGPPASVAPDGMVLRRHPLRVLLLRVDPEGGWLPPPET
                     LTSQRTLHASFDGQRGEACDSDEGCEDGDNEMDDNFALREARGAGRRTVARPGAVAPR
                     QRTVLTSPPSPSLCADRSTTEDRVVSMLTAHVIRRGPFAQAVTSARNLDQCLWLAAIR
                     LFVYALLHDARVVFTPERLPTFVKVFGYRHLPQLHQRLCEVRGAFREGAADDGALLFC
                     ADAADPPTRAAAVSLLDAACQREPPIAVYVVDQVSLSGFSRLQARSRVSGTTSADRAV
                     PSAPSSLPLLPVVLCCNVLRHPCSFDEACGSSRPSGICEVTYCGVLDVIELCHISAFL
                     QSQHSPCSAEKFAMRCAAVVASEEGGASRLYGGRVFIAALHPIVTPSLTDVDDRFRTL
                     TGERGADPRARCGGDADAWKAAVVESELWQPLLPSVLLLAPIQQQTMLYGALLRKAAL
                     ALLEALPSPCTSKTYMSTSMRDTTRTARASIPGVVRGGGAFFVSLARQARWLMRRLSL
                     SPACADAAATFAGVGVAGSEPFASPDAVSWGIGVALQDHATVRFVLAILCESCAAMVT
                     RLAEPLTEWSAASGPALSPLYSARASPPPRGPHARRRLWVEALRAAVEASSTVPGQPV
                     LHAYHENVDVMFSEAANGTAFDACLGAPTLHERAMQWFASGRRLSSSISQSGADDDAC
                     THRGGCATEPPLSTYLFLEPLHTNVRAVREALALVLHTLSATVP"
     gene            <1296450..>1299770
                     /locus_tag="LMJF_32_3250"
                     /db_xref="GeneID:5656449"
     mRNA            <1296450..>1299770
                     /locus_tag="LMJF_32_3250"
                     /product="putative mitogen-activated protein kinase"
                     /transcript_id="XM_001685599.1"
                     /db_xref="GeneID:5656449"
     CDS             1296450..1299770
                     /locus_tag="LMJF_32_3250"
                     /codon_start=1
                     /product="putative mitogen-activated protein kinase"
                     /protein_id="XP_001685651.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656449"
                     /db_xref="GOA:Q4Q4U7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4U7"
                     /translation="MEAYETLGILGEGTYGVVVKARSRVTGKLVAIKRFKQTEQDEHV
                     RKTSSREVRMLQLLQHPNVIRLEDVFRREGKLYLVFEFIDQTILQLLESTTRGLHRRE
                     LRRYTYQLLRGIEFCHNHNVIHRDVKPENVLIDESGLLKLCDFGFARQTSARGKYTDY
                     VATRWYRAPELLVGDVAYGKPVDVWALGCMFAELSDGQPLFPGESDLDQLCLIMQTCG
                     PVPQRLVFIFMHNPLYNGISFPHTDILYTLKERYHRESNDWLEFLSSCLHTDPAQRLT
                     CTELMELPYFTRDGFRDRYEAELQAAMGLPQLRSTPTTSAPSTQRRAPDQAAALGDDL
                     KADTVVSPHKCRSSEIISPKLQGEQPPTVKNSSSDTHISKTALRPAAHDANAGKGKGA
                     GAPTFTLTSPHKAASEHPVQLPMILNSNSERAIAAALTDYLNQMPTSSSAVVPTPVQA
                     TPAEVAGGFTNTDLLSRSCGAVPPLQTSQTINASNTRDKKKKRNVSLAETELHRPSSA
                     SVSGDTEYAVTTDGSKGEPAKHISGHPRASATLPPNGALGGGDSHEPRREGEKTSASP
                     PLPSHGVAESHVRLLLTTAAPGKDGGETAVLNRRVLKPASADKAAATTPTAFSSPTLV
                     ATHGAPLAECLQDLPALSPHLPHHVQQERQTPAAEQPQSHTPLSAETSMSSFHVCTRN
                     PLAAASSENDDVSHGKANIEPTGSSVAKPRRGLSNSSVSTAASEVKKRKSARHKRDTS
                     RLHDQAVGPVSGSASRRSVQGNASDMVAYRAGFGSMVNSLKSTVSQSLSYTMGQQQRQ
                     PLLSPDSGGVHVADSHLHGVGAGPSAPDSTHNRNVDAAGPQLRKERRSKPLAASTHVL
                     QGSDQRHRQQPQPRLDGPLLSDGGASQRATATLMALSALRKVSLPPPTKSAGDADKSS
                     YDHHTRSRTNRNGSESVSPVVGGDGNDTHTCIASRARRPVAVCTVHGNNRDSDELMAT
                     RRAQKKNAVVTHGRTGNGAVGSISCTDSSTTSSYQATSIMHGAPYHPFTRASKVDGEV
                     SGAPQRQTLRRPKKKIADSRGSGIANTTSSIGPRHSLAPARQIQHQPQLAKEDGGSGD
                     GKTPQFNAATAASPYTGS"
     gene            <1303178..>1304017
                     /locus_tag="LMJF_32_3260"
                     /db_xref="GeneID:5656450"
     mRNA            <1303178..>1304017
                     /locus_tag="LMJF_32_3260"
                     /product="putative glucosamine-6-phosphate isomerase"
                     /transcript_id="XM_001685600.1"
                     /db_xref="GeneID:5656450"
     CDS             1303178..1304017
                     /locus_tag="LMJF_32_3260"
                     /EC_number="3.5.99.6"
                     /codon_start=1
                     /product="putative glucosamine-6-phosphate isomerase"
                     /protein_id="XP_001685652.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656450"
                     /db_xref="GOA:Q4Q4U6"
                     /db_xref="InterPro:IPR004547"
                     /db_xref="InterPro:IPR006148"
                     /db_xref="InterPro:IPR018321"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4U6"
                     /translation="MRIVISETAEKVADYTSNYVIKSINDFKPTEDRPFVLGLPTGET
                     PMRTYQKLIVAYRKGRVSFKNVITFNMDEYVGLPADHPESYHYFMKHNFFDYVDIPEQ
                     NRHILDGNAPDLIEECRQYEEKIRAVGGIHLFLAGIGTDGHLAFNEPGSSLYSRTRVK
                     SLNAETMESNARFFGNDVSRVPTMALTVGLRTIMEAKFVLMMATGAGKALAVARCVEG
                     GITHMCTATMLQMHPAAVLCLDEDATLELKVRTTRYFKQLLNTEKALEERQSNMNRAY
                     SKL"
     gene            <1305715..>1307355
                     /locus_tag="LMJF_32_3270"
                     /db_xref="GeneID:5656451"
     mRNA            <1305715..>1307355
                     /locus_tag="LMJF_32_3270"
                     /product="putative chaperonin alpha subunit"
                     /transcript_id="XM_001685601.1"
                     /db_xref="GeneID:5656451"
     CDS             1305715..1307355
                     /locus_tag="LMJF_32_3270"
                     /codon_start=1
                     /product="putative chaperonin alpha subunit"
                     /protein_id="XP_001685653.1"
                     /db_xref="GeneID:5656451"
                     /db_xref="GOA:Q4Q4U5"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4U5"
                     /translation="MQPKQKAALGINGTRTSGIAVRRENVSAALAVANVVKSSLGPIG
                     LDKMLVDDVGDVLVTNDGATILKSLDVEHPAARLLVDLAQLQDKEIGDGTTSVVILAA
                     ELLKRAQELVSQGIHATSIIAGYKLAMREALRYLNDNLGCAVESLGKDVLLNVARTSM
                     SSKILNNDADLFAKIVVDAIMSVKTVNDFGDVIYPRKAVSILLQHGRSLHESRLVQGF
                     AMNLSRAAQGMPTSVKDAKIALIDFDLRAVKMKLGINITITDPSKAEAIRQRELDITK
                     ERIQKMIAAGANVIMTTWGIEDSMMKYMVDNSVLGVRRVKKDDIRRIAKTTGAQVVHT
                     MSDLEGEEVFDPKWLGRSEKVYEERIGDDDCIVIAGTSNAVCATIVCRGANYFMLEEM
                     ERALNDALWAVARTCDASCVVAGGGSVEAAVSVYLDNFARTLSSREQLAVAEYAEALL
                     VIPKVLALNAALDATDLVAKLRVEHTQAQSSGQQTEARFTGLDLHNGTLRNNIKAGVL
                     EPKPSKIKSLQFATEAAVTVLRIDDCVRLNPDEEDQQR"
     gene            <1315075..>1317669
                     /locus_tag="LMJF_32_3280"
                     /db_xref="GeneID:5656452"
     mRNA            <1315075..>1317669
                     /locus_tag="LMJF_32_3280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685602.1"
                     /db_xref="GeneID:5656452"
     CDS             1315075..1317669
                     /locus_tag="LMJF_32_3280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685654.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656452"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4U4"
                     /translation="MTDLAAVAPAVAEDKYTFLVPYAKNSASDLVESVGTQTQGNTDA
                     AITHITSAEDSRSLSTPESDSFEITTAAATPISPSATVPRWSSVQKTLETCMDPVFVT
                     GSADTKDHMIAEEVLPLMDASMTVRVSALASLSCLQPFFTGRTCSERIRTMLSAVRAS
                     NKLMLRDGLLAPTSSVCMLSVDEAEAAGLRVGLCSHAEDHARNVRTLKCRQHTPECED
                     SPRSLTLSRLRATSPPQKTRHAELPSSAPCAPCFALASPLPADSAHAAPEENPPHEDV
                     SVSCPHDANAPGRALSIAPAFPVAVTEEPAGIGVSAPRRTLQCPRVVGEELLGSDNRD
                     CAADNQEKIHISTLRACVPVPKPPPTIDILLTDAAAKFHGVTASSSAKEAASVPTMSS
                     ALPAPATLSSATATANTTNRLHFSVTAAPFMPKSVLSSTSGVAPVPAPHRPANYACPR
                     HQPTVCKHADACPADISETLAKEILTDSNTGCTHATPDLCVGSSWGKRHGAAGAWRRG
                     LMAAPPMPVDESPSTFFRKEGCCMPAERPPRALGAEMPQAPRAIDVSPRTADALPLAE
                     LYPPRPLMVAMPPESVPGSGLEGCWPICPLPAGAQLSPCPLPQSRRHRHDPYSPAGFV
                     LCAENSCALSLSQTSIPAARALTSSASPRPASSACNSSVAGEMISFSFADPLIKATAR
                     LQERRHLLRADTTRAPSSELESASCSVAHSSPACESGDDVEAATRRPLPSCEALLAAA
                     LAEPTAAATVAFVSTIDGDAVSPADAAAAAGVPKSYAEALRLSAKALPPVLVVAAKPA
                     GKREKSPKAKSSAPHRSAAASSSHAKNSSRATAKAATKAKRPSLSQPKNGMCPMPADA
                     ERAPHKAT"
     gene            <1319965..>1320687
                     /locus_tag="LMJF_32_3290"
                     /db_xref="GeneID:5656453"
     mRNA            <1319965..>1320687
                     /locus_tag="LMJF_32_3290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685603.1"
                     /db_xref="GeneID:5656453"
     CDS             1319965..1320687
                     /locus_tag="LMJF_32_3290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685655.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656453"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4U3"
                     /translation="MSSSASTTPANYEGGGGGGIRDIGTVTSGMAIMNFDQKTKPYTR
                     NDLVQFLMHYQENLNEEELRLVEKGIVGTFAGMPAFFGAGYFLSGRFGWHRVVRVMAP
                     LNEGGRPSWFVTHLPKIGRTAFGLTAATIPYMAVQQWFVSRVLELDERESNLSFHVRR
                     LMLSQRSGMMFKRTATREVTKEEQQRFLREAEAHVNENRSGQRVSQGLGTGPVDVNLQ
                     LGQQVLTPVAQTGYKPMPTQQR"
     gene            <1322206..>1323408
                     /locus_tag="LMJF_32_3300"
                     /db_xref="GeneID:5656454"
     mRNA            <1322206..>1323408
                     /locus_tag="LMJF_32_3300"
                     /product="putative chaperone protein DNAj"
                     /transcript_id="XM_001685604.1"
                     /db_xref="GeneID:5656454"
     CDS             1322206..1323408
                     /locus_tag="LMJF_32_3300"
                     /codon_start=1
                     /product="putative chaperone protein DNAj"
                     /protein_id="XP_001685656.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656454"
                     /db_xref="GOA:Q4Q4U2"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4U2"
                     /translation="MTIARSRRATVRRTCVLVLLLLCVALSSRAFFDFGGGHRADAPS
                     AEVTHAQEVDYYMVLQLEDKREEATEKDIRQQFRRLSRLYHPDVAKTEEDKAKYSQVN
                     RAYEVLSDKRKRKVYDMRGERGLEQLERIDRSKDTPGGGVNPLSRLFGMRVDDGLRGS
                     DMKLEAKVDLAKLFTGGQETLQVNKHKVCHACKGSGADTTAAIVQCRQCGGEGVLRQR
                     IQFAPGMIQELHQKCPSCSGAGRRPERLCSVCRGNKVLFGSSTVTLELEPGMEEGHVL
                     KFEMEAEESPDRLPGDLLVHVHTLPHPVFSRRRNQIDLDTSLTLTLQEALVGFDRNIT
                     HLDGVEQVRVQRLDTVSPYGTVLRLPGKGMPKMNVASERGDLYVRLQYNMPAQLTEEQ
                     RKLVDMLL"
     gene            <1324411..>1325841
                     /gene="GCVL-2"
                     /locus_tag="LMJF_32_3310"
                     /db_xref="GeneID:5656455"
     mRNA            <1324411..>1325841
                     /gene="GCVL-2"
                     /locus_tag="LMJF_32_3310"
                     /product="putative dihydrolipoamide dehydrogenase"
                     /transcript_id="XM_001685605.1"
                     /db_xref="GeneID:5656455"
     CDS             1324411..1325841
                     /gene="GCVL-2"
                     /locus_tag="LMJF_32_3310"
                     /EC_number="1.8.1.4"
                     /codon_start=1
                     /product="putative dihydrolipoamide dehydrogenase"
                     /protein_id="XP_001685657.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656455"
                     /db_xref="GOA:Q4Q4U1"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR004099"
                     /db_xref="InterPro:IPR006258"
                     /db_xref="InterPro:IPR012999"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR016156"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4U1"
                     /translation="MFRRNIAHLASYDVTVIGGGPGGYVAAIKAAQLGLKTACIEKRG
                     ALGGTCLNVGCIPSKALLHATHLYHDAHANFAQYGLRGGENVTMDVSAMQAQKGKGVK
                     ALTGGVEYLFKKNKVTYYKGEGSFVNPNTIKVKGLDGKEETLESKKTIVATGSEPTEL
                     PFLPFDEKVVMSSTGALDLDHVPKKMIVVGGGVIGLELGSVWARLGAEVTVVEFASRC
                     AATTDADVSKALTDALVKHEKMKIMTNTKVVSGTNNGSSVTIEVEDKDGKHQTLEADA
                     LLCSVGRRPHTTGLNAEAINLQMERGFICINDHFETNVPNVYAIGDVVNKGPMLAHKA
                     EEEGVACAEILAGKPGHVNYSVIPGVIYTNPEVAQVGETEEQVKKRGIDYKVGKFPFS
                     ANSRAKAVGTEDGFVKVVTDKKTDRILGVQIVCTAAGEMIAEPTLAMEYGASSEDLGR
                     TCHAHPTMSEAVKEACMACFAQTINF"
     gene            <1329818..>1330729
                     /gene="CYC6"
                     /locus_tag="LMJF_32_3320"
                     /db_xref="GeneID:5656456"
     mRNA            <1329818..>1330729
                     /gene="CYC6"
                     /locus_tag="LMJF_32_3320"
                     /product="putative cyclin"
                     /transcript_id="XM_001685606.1"
                     /db_xref="GeneID:5656456"
     CDS             1329818..1330729
                     /gene="CYC6"
                     /locus_tag="LMJF_32_3320"
                     /codon_start=1
                     /product="putative cyclin"
                     /protein_id="XP_001685658.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656456"
                     /db_xref="GOA:Q4Q4U0"
                     /db_xref="InterPro:IPR004367"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR014400"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4U0"
                     /translation="MFVERERQAVARFNEGNASNESTNTSTLHAYYASPRYLQHQPEI
                     NEKMRMILVDWLIDVHLKFKLHAETMYLAVNLIDRYLSCANNKVDRTTFVPRAQLQLV
                     GVCAMLLAAKYEEIWPPEVKECVHISANTYTREEIIEMERAICTALSFRLTVPTPFPF
                     ASRAWTVLEGDDFLGIGMDEEQRRQYFAIVRHATSFFMEHALLDYKCLQFTPSQIAHA
                     SVFLALLMLRTKLELPKTPTFPVWTDALRYYTKSEVQEFRGCAEVILDYVNYVPTTKY
                     QAVRRKYNSSRYMEISKMLMPNELPAL"
     gene            <1332974..>1333318
                     /locus_tag="LMJF_32_3330"
                     /db_xref="GeneID:5656457"
     mRNA            <1332974..>1333318
                     /locus_tag="LMJF_32_3330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685607.1"
                     /db_xref="GeneID:5656457"
     CDS             1332974..1333318
                     /locus_tag="LMJF_32_3330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685659.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656457"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4T9"
                     /translation="MGFRMLQDFMRVQRWERSIRRREDHSDGIVVRGIRMIPWSGVAM
                     FFFIMVFFGFDLGAGIKQTAQQIKEQKKDAQTTLEVQKIQARQWSVEQVKSFREGEMP
                     QPSWEKGGPRAR"
     gene            <1334227..>1337565
                     /locus_tag="LMJF_32_3340"
                     /db_xref="GeneID:5656458"
     mRNA            <1334227..>1337565
                     /locus_tag="LMJF_32_3340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685608.1"
                     /db_xref="GeneID:5656458"
     CDS             1334227..1337565
                     /locus_tag="LMJF_32_3340"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685660.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656458"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4T8"
                     /translation="MLNKVIQDIYHLRRVHAVLPDAVLGDTLKNKLLRLSLQPSLQEL
                     KHRAQQACVSAHEDNQLCSLPSGSRWGHGGGTLSYSPYTINPSALCNLLDSLAYFHLG
                     SSAVAKEAVQLVQLSAPSMSVPQLCTTLAACCALGAQTDITATAMPLLRTALNSYTGP
                     SSSGDDGAAAASSAAGSHKSNEAPLLFSQGNIVLLLMEALQRAGVEDVQVWHLLAEHC
                     LRYLDSFDGRQLCNVIEALCAEGIDDYPDFFVAAERHITSQPSNYLSPDQLQRVVHCY
                     EDLHQPVVSLLALVNATPLHGEDVERSISAAAAVVAFSSSSGIDGGGKGSLCASGASG
                     TARVATLHPSLEAFEGAAITAVASADAQGVLDLLQKCEQRRVMTARAMDAILERLLAL
                     YYPELRRGAACAAAAKGTESASHTVGVTDAAAPPPQRRHAPLELHHLSQALVAAFEFN
                     DAALFAQQLPTAASTGDGDKTATVPAKPAAVTALLNALAGELTRWYHHRVLQLVRYAL
                     RLLPAPSQPHTFYCAVLDHLRRSNDLSSHEGPPQLRSLIDALLALRAYGGEAILVQYM
                     PAITVAVQNTPRSTQLELTALLANLPCAKEELIPGVYRQWGSQKRWLRTITEEEVGWA
                     LQIMSRSGGLRDSQILHAVLEYVQAHRAQLPPQRVVEYLHQLARLGMRDLEFFTQTAE
                     QLMRRAVESAPSVALAARGVAAQPVSASSSTSQMMVRHQQWQVTTVHDLCLLLFTFTF
                     VLRDSIRVTQQIISRLKMCASSAAPRDISLALYSFVKLRVAHNDEVTEQLCERACATL
                     AEFRAAELASMWSSLRCLRHPHGKLRQRTLDLLGSSTADVCPNWRFADNDCISLGSAL
                     LLTEAPPSTTDQPLVPPQAHEDSTAAGGADEGEAAALPGPSAPARRGLGAAVPLPPVF
                     ERHFVEVCQRLLPAATGQRLYLILCSLSACPTSLSVPVELWEKMLTTVDTHAESLSTG
                     TLGELVGTAQLEVLAALRRLRACVADPVALATVEVALEAMSRPSAAKKGAADTAGPGG
                     WVAPYCPPRLWSTLRPQWRELTCSAAVLTRSDLMEVVVDIKGGGDSPEAAAEPKAGRR
                     SAGASAKRSTVRKGRSVKDAVHLV"
     gene            <1340979..>1344932
                     /locus_tag="LMJF_32_3350"
                     /db_xref="GeneID:5656459"
     mRNA            <1340979..>1344932
                     /locus_tag="LMJF_32_3350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685609.1"
                     /db_xref="GeneID:5656459"
     CDS             1340979..1344932
                     /locus_tag="LMJF_32_3350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685661.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656459"
                     /db_xref="GOA:Q4Q4T7"
                     /db_xref="InterPro:IPR000315"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4T7"
                     /translation="MTATSPTSSQRTYLRIVVYCDDSQEPHTLPDVRVPRSVGEVQRL
                     VEDRVGQRAMVLSYWNHAHSRYELLKDVSELLQADGGLLSQRLHTSANEAAETAEADG
                     TTNTDGGATSASELAANHSKLCIYRCQLWMETTLIQLEPLDKRRDKLEYDELRSHVAC
                     WLGNKHVGFEVQDAMRIRCSFLTRMFDETRSRRLSANQNKVQLLYYSNNAWSVRDVLQ
                     YGFLLSNSVPQSLAAVLQSCGDSDVSSGTESRSSNPVSHVGGGASTPTSPSSAPPTAA
                     NTRRTPFVFTSSMLSAHVKYMPPNTAPHKVLLCEVAPGRRFMTDQGLTGESPDKQAYP
                     TPPMKPPRGYDSVCYMRAHKQKTSLRTEDAAEIAAEDLSLVQVQVQHSYQALPRYLLT
                     VVPSAATLSAQQRCKSGRYATTSPVRSPGTTAQAAAARENEKMNRAGGVPPPLPSPSS
                     PSSPSSPSSPSKTYNMKEWFKSSPRRGPVSEDKGANPKRAISPHSTSGVFREVRYAES
                     TAPCRRAASATTPGRGEPSEQRRAARETRAECDEDNTAYHSGGGLIEPWARDSAPARG
                     TETAVRSDLVTGSPWTPGVYSAGNGGSRSASHTNRVSYSGVRAASAPRAPPAQHLSPL
                     SPSAAQVSPSMNSSWATGGLVPSLSFRGAYNAHSSHNGLLYESLPRDRSATSRDAAYL
                     SVPAAAGRSAGGRAASAGAPLPAAHHGAPSRPPLLPLHEGVCGGGAMGSGGIAGPTLK
                     TVPPASSTAPFSQRQAPPAALGQFTCDIHPRQIKSLYCMACEELTCPYCASVGAHRSH
                     VVVEVAERATAVCAKAEALHEALRHWLTQCKQTEEQLRAEQTRYAARQQRYLRFIQQQ
                     FSTLNQALRQAERSMTQTVQEAQRRPPLAEAAAVVTKYTQAFAALDAALRHYYSTVAP
                     SSNGRCAERTCGPTNRLLDLLHFLRTTSSLIRQVQGSIARRKDEEKRLRDAIVGCEVQ
                     AQANEALFQQVDWAGLRRLLVSIGSARTNMVNVAEPQPPTSVGPFHSSGTASPSLHEA
                     TALSMPGAAPSRPNSAKVRARTETPTALSLPRCDASSDVPQRLLDSLPVGTLMQSANG
                     AATSPLAQQNLGLHRCLTDLQRGYIWVIQSATSYFAPGQRKTVCSTPFRLLGASWELR
                     VAPLPRERCHDGSASSTPMAEPGINSGVMDTAASRLTPPNVLEGGGRGLGGGQVHTSL
                     LLTRSAQEDHYTFAAEDVDDALVTSVPLSDEEEEEWLGLFLFPLQHRLRIDFRVIVFS
                     EVAWAEWQVTGWTARFAGSGWGLYSFLQRRELMQTDKLARDNTVKICIAPISDLY"
     gene            <1347766..>1349589
                     /locus_tag="LMJF_32_3360"
                     /db_xref="GeneID:5656460"
     mRNA            <1347766..>1349589
                     /locus_tag="LMJF_32_3360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685610.1"
                     /db_xref="GeneID:5656460"
     CDS             1347766..1349589
                     /locus_tag="LMJF_32_3360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685662.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656460"
                     /db_xref="GOA:Q4Q4T6"
                     /db_xref="InterPro:IPR002921"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4T6"
                     /translation="MTATTSSAEWNEEDEGEATTDVAAASPDSSADERYGYTISTDIA
                     NTAMEGAEVAELRHLDPFHVEVFGRPSWSALTKRIAREVQAQLTRCGLRKRDVSRYAA
                     QAALNSEMSRQTYKLWVRQGSRRIREGWLHSTTPADATGSPSPQSQLTVAPSEQVIVK
                     GKLDTLHTACYLARYAMAAYGLPFELNYFSSLRELSKLMAEPHRRYVYANSEEQLESM
                     RRMLQGEEPNALLECVASRYSLRVGQSCWALFLDHATNRVVLTFRGSLTPADIAVDVT
                     EGYANVVLERAPVEVAAAATGIEASQRLCTAIPLGFYESVVEAGTQLLPLLRTIHSQY
                     STYQLCITGHSLGGVQASLFHLLYCGPWRAALHSSTTLLRRAKTLTCPSSLPSAPPPS
                     SAAIASAETAPTTASTAAHVPFTKTVTCTFGAAPVVERRVTPLLNAWLYQEEQRTGSR
                     LVAFSNGMDVVSRLQLRSLQDAFLQQYARPTEESLSSDDRAAVDDTGAAVAGVSNKSV
                     PLLAIPGSLYNMTSGTRRRHLLAVPLTATAVREQVVLIPEAALHHYPSLYLRSLNELL
                     RRYRAKWQSICDDATTTPTATATAAAVALSTDNPLRESRGG"
     gene            <1350860..>1353499
                     /locus_tag="LMJF_32_3370"
                     /db_xref="GeneID:5656461"
     mRNA            <1350860..>1353499
                     /locus_tag="LMJF_32_3370"
                     /product="putative chloride channel protein"
                     /transcript_id="XM_001685611.1"
                     /db_xref="GeneID:5656461"
     CDS             1350860..1353499
                     /locus_tag="LMJF_32_3370"
                     /codon_start=1
                     /product="putative chloride channel protein"
                     /protein_id="XP_001685663.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656461"
                     /db_xref="GOA:Q4Q4T5"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR001807"
                     /db_xref="InterPro:IPR014743"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4T5"
                     /translation="MSAAYGNAGTSGTFDTPSATLRRREADAATAAWFHELVKEVEEA
                     GDAEVNRARAPLFEKAHRPHVFTAEERRRMDCYESIDYAEGQSLVHRVSSTRQSSTDA
                     KGWLRLLMFVLIGLAVGGWSLLVLQTLDYLAEVKLDAVQGVVRSRNSTYPPFNASKFY
                     MSTLRNSRHEGGDDEKAAVVLRTLSWSALLHGGVLYTMWGVLMALLSSLCCLVMPSAA
                     GSGIPDVMAYLNGVMFPRIFNIRNLVVKTLSCILAVSAGLPVGTEGPMIHMGSLIGAG
                     LPTGRSRSLGCSATSVFDLFRNPRDQRDFISAGAACGLTSAFSSPLGGMLFVLEEMAT
                     HFSVRLAWLVFLSCLSCMWIIQACNSFLSGWHLVDRSAMALGDLREASIAMFYIDTVR
                     ENTVSLYTYTFIPTVMVAVLSGLLAVAYTVSSIRFSRWRSRCLFPTALYRVLEPCVFA
                     SLFSTACYVMPLFTPCVPTPPHVREKKEALNVELFTAFCAQPETTHHPLATLTMTSPY
                     NLLRLLFSRRSVGLFPAWSLFLHLAIYVVGSSYAGGMFISCGTVIPSLLIGAVEGRLI
                     GVLFQRPLWADEGVVALIGAAAYFAGISRLTFALVVVMMELTADVSHITCLMLGILLA
                     KGIADKCCHSFYHASLEVKAVPFLEAQTSMHLLDTYTARDIMTSPVTVLETMDTVLHV
                     VEVLTMTRHNAFPVVRVGKADQTYEGMITRVQLQLLLWVVYLREMGDASEVLVDEEGD
                     DDSDGAADARSGMASAQVDAEGFIRSHVTAAELKRVHEFLFWNRLPGVPMMEHLPLSA
                     IRSYIDLRPYVDNSAPYVQQGVCVSRAYYAFRHLGLRHLPVLDRTQRVVGILTRVCFV
                     GDRLAERVGTQPAEGFGNTEWRG"
     gene            <1354952..>1357081
                     /locus_tag="LMJF_32_3380"
                     /db_xref="GeneID:5656462"
     mRNA            <1354952..>1357081
                     /locus_tag="LMJF_32_3380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685612.1"
                     /db_xref="GeneID:5656462"
     CDS             1354952..1357081
                     /locus_tag="LMJF_32_3380"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685664.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656462"
                     /db_xref="GOA:Q4Q4T4"
                     /db_xref="InterPro:IPR001656"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4T4"
                     /translation="MHLMVRWHFPHLRACADAPPLPRPADGISSGDDNASVISCSLDL
                     HHVLFCATLGCEAALCIARWSVEAQVARQERILSAEDRAELRKLLDSDDSEAWPGLRA
                     RSGAAAKGFCSTSFDSLTEAMRRQPPDGPAMRIAAESMPLVSEKDVRRQVHELLRRFY
                     PFVHCQVRGGHATLRFRTRPDGSNDTLTSDAAARSRRSADIGVGARRTRAEMEGRPGD
                     ASPLSAAPAYVHIVVRKRNLDTAEMRQLLGEYFGVKDSSVCVAGMKDKRAVSVQRCSV
                     PVVATGGEVHSRVRALLTNAAAVQPVTLRWPADSQQSYAVLLRASASSVPVHLGQLSG
                     NWFSLRVRDVRWAGEADRRMWPSPATACENVQQQEEEELRAFLQCRFARCAEAGFINY
                     FGQQRFSETVERVDDHTGVHLFAARWVAAVRSLYRACPDVYNAFPDKMEVRFVSSNSR
                     DVQVMTHALRQTYRMYFSDCPLSSADVQNESEVWTRLCAKAITEGVPFYLRSLWVHAG
                     QSVFFNLAASYVASRGLARPKVTAAAPHLDGSGDPHAASSAACTSSGSSTSEQPLAPL
                     SCDVLASAQLPLSGYHADRAALDGTHLSDPASAALWAQWKDAAIQHALRELRWTSAQG
                     FEQRRVAGVPVPGSWRAVVARPTNASLEWETEARAKAQRRSCSGGGGDASADAVYSST
                     MQLSFALPPSCYATVFLREVLGCDKWW"
     gene            <1358331..>1360133
                     /locus_tag="LMJF_32_3390"
                     /db_xref="GeneID:5656463"
     mRNA            <1358331..>1360133
                     /locus_tag="LMJF_32_3390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685613.1"
                     /db_xref="GeneID:5656463"
     CDS             1358331..1360133
                     /locus_tag="LMJF_32_3390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685665.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656463"
                     /db_xref="InterPro:IPR002893"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4T3"
                     /translation="MDVGREGHSGLYTMHFSTVFPVEKSAQEKTNSTATNSSSSSPPP
                     APAPLDGGKSSASGSPCCSLSQFSQWHMLIRVDVENEMFFVKGDAKVFSPTPSLASGM
                     ARGINRDGTPAQSSTSPDGIPIVPVHQKDRRCSVAIGSYYRQAEGLEAAGTMPSSSML
                     GLEVRMPRLEAAVLGLAEPEMLTDVVLNCSGHKSCGWYMGAVTVTAEGKAVETPQTIR
                     FLLKPFYGHRCAQCLDPVYAIGYTCEHCQVPYYCSRDCMNAHMKRHHKLLCPLLYDKY
                     RCQSGEVVTEVPDGSALVAWWRCLEHGTFSVLVDPNNSLGYAIELTLNVLKSARQEGL
                     QYRLVSSTTLTSSPPHEEVARFACVLLREVNRSAILEGCAPLAAACLDYLYAFSPTAD
                     FAIQAHILFFTTFHCEDLDVPIDTFEEYVSYARPLHALASLQINYALKSTIPAEFWRR
                     VKVAKDSIASLLAVTNVVPSGGVEGLREIITAQQRDALMMLSRIFVMMAARAPESECQ
                     RWLEQAERCLSQCQDGLAVPNSFEVDAMICFRRAALLLLFKTDAKTEEAKTQRKKGES
                     FLKLGQKPAADTASMQQQNGVEEGEQAKVDVKKV"
     gene            <1363485..>1365296
                     /locus_tag="LMJF_32_3400"
                     /db_xref="GeneID:5656464"
     mRNA            <1363485..>1365296
                     /locus_tag="LMJF_32_3400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685614.1"
                     /db_xref="GeneID:5656464"
     CDS             1363485..1365296
                     /locus_tag="LMJF_32_3400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685666.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656464"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4T2"
                     /translation="MAFLLRSRVAAAVLPLILTILVGCVLYSGSATVGARNDRLPQPS
                     WSRTCTSPYEVCSTIEVYQYWEEKKNRLSFTVDAMMKDPSAKGVLTVWMVMDDADVNM
                     AKDIFREGINVVIVRPRGSKQTPSFITCANTSNPYDRQCWMSEACAAELAAAASSTSN
                     SLNMSHYSADQAVHDLDWALRTLGDGRPNVVLGQGLSSMLVLRLLQYHQDTKAAVILL
                     DYVHPLMFDVYNYFGGGSMATALQHLLAMCDDQAACVGRLGAAEGSWNRLMTVIHMAK
                     EGKLSCASRLKWGPGKGSNAAFADKLRGVLALMLRYPVYPFLASNAGLLNLIPSLLYR
                     VQRCNKKDVAALNKLYDYLSAANGYTCPESVALHMHWLVNEFLQAAPPADIRSFRSNA
                     AAKHPILPSIRALTAFHSAVKKFPRISRSAQSKKLPMNATQQILLLNADTDALLPGGA
                     ASQVALAFRQLGDSVQLRQLRGIMNRPSTVLTPCLVNNLKMFRDHRVWADEAQCTLDV
                     AHKIDFINGATDVYYGTSDAWDFDKPNSDETNGGRDDNDEGGVHFKWRFIARALITLI
                     LLGCIGAVGYFAFTHFKANSPFHYSRVSDNFYENLNQ"
     gene            <1366550..>1374895
                     /locus_tag="LMJF_32_3410"
                     /db_xref="GeneID:5656465"
     mRNA            <1366550..>1374895
                     /locus_tag="LMJF_32_3410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685615.1"
                     /db_xref="GeneID:5656465"
     CDS             1366550..1374895
                     /locus_tag="LMJF_32_3410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685667.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656465"
                     /db_xref="InterPro:IPR007249"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4T1"
                     /translation="MMFASVASVSSNGVHAAASGSAQGVASPTDATTASTTAGAPSED
                     ADGQPSEVDAAVDHPEHGAVEACSFYSHSTPASQGPSSVQQAYTFSSSLPSPRSTTAA
                     VVRVAPVTDQPVLQDVGSSRAMSASDVAKWKENREYKMLERGMHKILSAIDSTLSADW
                     ATQASLLGQLLACLRQYKGVIGAVELPDGLHFAKALGRTLSPLSVVGVQRKALEVVQC
                     YLELANPVYPMAKDLPFVLPGLLELLPQASVQVKEDVLKLLDRGVVRRLPGSVLRACV
                     QGLVTALLSCLEESETSSIYRGAMGLLEYVQAALARDAPAPSFSSPSQRGEWAELRGG
                     QVLAAHMWVLIRDASALRSPALNVMKAFIAQSGGLTSGSAAGLAEGAAEDAAAASATT
                     STSTSALPDWVGGDAATMASALLNCLQDTQEKTHRLVLDVLLTVCPLTPVDCDSANFT
                     HTPLAAFFDGNTNKHTSASVGVSPPPCCGNGAIIPFEVKSLLVAAAVQLLGTRYGTSS
                     VARRIFQWLTVDPGVGGGANERPGTDDDDASDTDGGEHRRNTLNSRASSSCVAYVQDI
                     TSCVMARGFDMVVEHWWTRWVGKVGDDAPAEQAPPYMSAALSALEHSAAQAIRTATAS
                     RLASASSVVAALGAREASSNAIALLDVPVGISVPLVWVRALLVLFRYRSRSTQGGDGA
                     LLMSPVAGDAATYEGAEVPMETGCAPFLVHVAPLLLPSLSRLIAGVSSVVGDASGGES
                     AAAAAEMWIAELRELLRVLPWGLFVELDTCAVQNVEELLRSVLHPLCASGVEEGDEDA
                     APAAPFVSAHLQAVAATRAQKPIAAQMNNLCMTAKALESVLVDAAVEQPSPAQEYVRA
                     SLRWLEKVAQLLSEVLKALEAEMRTAGGATGGATTSKESLVCQGQVVQLLLSTANGLL
                     RLLGQRMRLMELMLASVLTAASATGTPSVVRVDFFSAFVSALDACLLGRIRSATAAVT
                     MAALHTSESDASGGGHDTAGGAPATAALFCFPEHASDLQGLLARMHRITLRLTSFLAQ
                     LHLRCQQQAVFGVLLDSAPENSAGSRERDFAKQTTLWLESMCDGATVAAAAGAHVFFS
                     RAVRLLLDALLRARGCLLPAVVYSTLEPVCPTAGGVAEGVVFTNTYLLAPVVRTLWEG
                     CAGGGDEAGDAVDMCRTSLLALIALSPACSRCLDTFLLETPADIAVLRLVGLQRELAA
                     LRARQRRGQSRSGSTPLLETLAELQDPGVLFLGLLTTLECLLCVPSGILVHGGVIAES
                     TRQPARAYISHAIVRDPSSILLPLHFSFLCPLVTESACSSSTSVESKRRGRTVDAVAA
                     ALSPPHSTGSQTLSTVPLTVLLPSVTAAPTAEMTGPVPLARTKWFKHVSGTTTVGHGG
                     VAPRGYRCVEAAELVRYLFALLQLPTAVEWVRQSMDTPTPNSLRVLLRALEEQSFAPS
                     HEVEVTSPSLSPSSSATALACGGATDTLFSATALLLLSLARHALLSGHAAHMRQPDSL
                     RRRPCLHSPSASRSSTSWLSREESTATPQWRCSTLLDAVACLNRLLEVSQTGPRMQPH
                     RTAVNTWQFTAAQLLPLLRLAVQADLHAVQAVLLDHIRGVVFYLDDAGGIPARHKSLS
                     RQANGVDGAVASRHWLPHAFRQSGRATDKASLCSTDPAAQKGHSTLAAAEAAAPASSA
                     SDDAAPAFSLPPSSSGTAVLDDLQRAPPAILSNKSLYATMGEVVERVLSHCDAAASPA
                     SEVDPTHTDAAAASRSRREEEDTLALWLHFYSDIMPYLYRDLVPSAEMAVDALLCALE
                     LPPGARAGDDAPRPVHSLSSYASVQSICYATLVDVAQFLCDLARVADDENYVLAMRKK
                     ESMSWIASTFTQEDPVAQAKRATLWDRSPVLSPIRGALPRLITAATHCIRACDAAASE
                     AGMIKQGAAYAMWAADTDTDEALGWGTTTAATAELLPSAGPETHLREQARRLLCLLNH
                     AAGPGFLTAFLHDWCAQYALSSTWWLFEDKQQRERRVSLEAVRHIETECASDVVAPRK
                     GGGDTGVTASGEDERVAAWRMKREAQKAACLLLADIGVSISEVTAVLTPLLRTAIKGE
                     PHAEPLQPEQAPAFTGTSVSGAAASALAPLAPRPSSAAERLFFLDQVVEGHCAERQGG
                     LSDKDAEAVLAVLADVVSQCSPDTLAFCCLFHLLYCVVAYAKDEGAEGQGGMKVRKAR
                     RVGGGSGRRRQPKASGTTTAAPATVSGVYRNGHFSFALCRLLEGFRVQPASAQCTSSL
                     LSLQLFCQTLRSVLPSSLAMVDNAGRVVDAATHVLQRVLIPVLRHGIASEAEAEIVLC
                     APLVCASLRVLRALVAGFAPDLAFERRAQRDTVSLLFSEHFFRYSRSSLHEWALLLRQ
                     WGSLDQGIHSLICERMVPSPGRLSAMMMSRETEALLWERSLRTLGFYTYAMHISEPPP
                     AVVGAAATTGCSFGASAATPSVPLARHAEFVRLLREQLTYAFQHFSSSAIPTVAQLQQ
                     KEVFLQPVRAALFVFRVVLVCNVRESLVASLWPIVLPELFRVLSIQPTEKGPNAGKGA
                     GSLSQPSSADVGVLREIAATQMEALKVLDMDYTLHPAHALTFRWLFTDDAALESLAAI
                     QARETVGPQGGLPCSDAVTRQPAVSHLEVLRLLQTSPQSVAEHLDAAAVVNAVHEPRV
                     AAAASHCDFCLAAPLSSIPRAWPTSPRPSAADTGLRRPLYNIPSMHYQCLDGVYRAAQ
                     AFTLLLQRLNIHIPHTSEATQSGQQNAATLASLCAAVSATVGTHNEVDMAYIYDLLEA
                     DMTSTHPDTML"
     gene            <1377034..>1378239
                     /locus_tag="LMJF_32_3420"
                     /db_xref="GeneID:5656466"
     mRNA            <1377034..>1378239
                     /locus_tag="LMJF_32_3420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685616.1"
                     /db_xref="GeneID:5656466"
     CDS             1377034..1378239
                     /locus_tag="LMJF_32_3420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685668.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656466"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4T0"
                     /translation="MRLLVMYSRPWYAYALLVLFSFFFGLSYASVTYLEEDQSELKDC
                     ATSVAFVLFLFVGTGAVALTAHLLLCRQPDSEEEPSFIEDAGQRRRLPTLWSYSVLFF
                     SASVAAIALSHFISLTVAVVMVISLACHLVAEHHNRGDGGDCVTLQDALGCVTAGLGA
                     ALVVLGGVWQEMATHHASLGGALLSLLGWGLSVIVSGVCWACFTRQLREMSQRMSQQF
                     LLSTSLVVCTVALGIGTYAANLTLTSDEASSAALAGAVAQTTGGGEAASAPQLLDPML
                     LPCHRFFPDVVMLLSGGVCSLLCWYAYHAVSFYVDHASSSACMVLGAVLSAVPLIVAR
                     ALRIGWADVTASVLLQGSLAAMVVGVALAEAGAAVVVWSGFRYRREVEIRIVLEKRRF
                     SFPRANANA"
     gene            <1380706..>1383129
                     /locus_tag="LMJF_32_3430"
                     /db_xref="GeneID:5656467"
     mRNA            <1380706..>1383129
                     /locus_tag="LMJF_32_3430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685617.1"
                     /db_xref="GeneID:5656467"
     CDS             1380706..1383129
                     /locus_tag="LMJF_32_3430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685669.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656467"
                     /db_xref="InterPro:IPR019579"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4S9"
                     /translation="MNQYFSSVNGYQGYKERREKMMKHVRPFAFESRELVKPPRIREQ
                     RAEADQRARDAAATEHRRHPYKATPVPPSTFMNKYELMVEEWCQRKAAIEMMSRERAR
                     IAKDDAAFVRLSAQSLRSTREGLMGVVYGPDGKPVTRNELRRRARSADVTRSRRKGTG
                     APLREVPLEVRMKLWPALSDHERLRRERIKFLATVRKSEVDAEVRQVMPLLTSPSPAR
                     CYDAASPGGIDMAALLAAANGANVGAAAPCYGVGQAVLSSKQTPFPTAEAGALAAALS
                     PSTVPPPPAAASGLSPLTSVPPPPSPCVPTPQPPTGAAMAVPAPVPSLPAAVPEPPSG
                     AVALPPLPIAPMAVPTAHPPFFPTGSAVPAPPSAGPPPPPAASAPSPAPTAAVVAPVS
                     SATAGAAAGSKAAKQSTQQDREASWRRYNPQLTFKPNVRPGVPNFEALWAHNRAALAQ
                     KKLQHPTTVPQPFDLTPSARDNKTVGRRPARSTSALGPPRRHGSPSGGKKRQAADTPS
                     MPAGNVTALAPPRSGAPRGTRAHALRTQAIYSHHVKQSEEQSVTAEGDEQYWKAVAQR
                     QREVRKRLSAYLVDHHAEHERAITEKVRALRAAMRESEKAAKERLAEMKQRVAEMPPV
                     FAEPVHLNEQSKVRVEAEKIVLQSLKEAGLDGATIKRILTSPLAAATDAATDALGAEA
                     ADTSRLEGDGVSPIAAREEDSEAQGAPPSAAAPSPLSKYSEASKHGSSGSGSSSDSDS
                     DDSSTTGRSRSSGGSIKKSPPGSSVTRRSSCPSASTLSVRAPPKPVVADRRSATEYSD
                     DSFESSDSD"
     gene            <1384387..>1386534
                     /locus_tag="LMJF_32_3440"
                     /db_xref="GeneID:5656468"
     mRNA            <1384387..>1386534
                     /locus_tag="LMJF_32_3440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685618.1"
                     /db_xref="GeneID:5656468"
     CDS             1384387..1386534
                     /locus_tag="LMJF_32_3440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685670.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656468"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4S8"
                     /translation="MEPSGCACLLVGRRRQKPSLSLPASPRRRVVIPGIVPGTVLRTR
                     ASVVEWIHKCRQLPASTEYTVLMRSGKQVPRHAADAGLAALPCGLAAANACQRCPWMA
                     VGNSGESAAAKHTCWRTSLESAARNMWASSAIADGATTLTRTHDDAMRCCSFLEPFAI
                     QVTPNRLLGLQLFFVPLEWTDSPASSRSRLAGSAAPACGTPAAATAVVCIEREGLSRP
                     LSVAAHVCRREPASPAAASGGVAELSPEALDLTQECLLESLEQKRLVPALQRWATQLP
                     TSTQARLLGVFISQPFTWAPHSETTTSLQVILVVERNTDVLGMQSPLCSPSHPADLLS
                     TEERQLVEVVTAAAPLINEVEVLVWVQSTCGEARGTAAAETALHRLYPTLSRDALPAD
                     VRCEDWQNGCDLVKGGTEARKLVRGQVTQTVRCWCQPLRKELSMNLPPYHAALCAVPL
                     PWFGKACRRRPQSRPSSEHRTASSPALDIGAAAGKAERAFASACSQRLPWVPTFWRHP
                     GALDACCSVLLSVLLEGTILPTRATSAVTESDTPRRPGSVEVCAPRLSAHLFAAAEAD
                     VGAAAGQTILDGAVVALAGEAERVVALSGKSEQAGHFASCGAPLPPTSFSELSAPRRV
                     LVSVREGDGAATAVTTAFVKQVLGSVHTQPARLCLYECTSTMKAAALGAQVAATLQHA
                     QRVGQSVSVDTGIVDVDPLASSFVAYACVSVHV"
     gene            <1389429..>1391105
                     /locus_tag="LMJF_32_3450"
                     /db_xref="GeneID:5656469"
     mRNA            <1389429..>1391105
                     /locus_tag="LMJF_32_3450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685619.1"
                     /db_xref="GeneID:5656469"
     CDS             1389429..1391105
                     /locus_tag="LMJF_32_3450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685671.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656469"
                     /db_xref="InterPro:IPR026319"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4S7"
                     /translation="MSGPALGGKPKTKGQRRSVGQAPNFIICYLCGRQFGTASIDIHR
                     PQCYLKRLIVWERGDPAIRGPKPLSPKEHEKMMKVRTANAEPAGRLATGGGYSCAGRI
                     GGGGFGRQAPLSDVELYNKLQMEAFNDTALSPCPNCGRTFLPDRLQVHMKSCKPGKTA
                     KPVPTAASRVAPPVATPSAATTSASPASAKDRRIRATGAYKVPTNAGAGDVPPGAEPS
                     RKPSHHTMPSYALPNEENAGDQMPPTNAWSSRNLDRAGSESNTRVLAVNAPNGAAAVP
                     KAPSRDVIEVVVEVDVEDTNPPSPRADTEQRLSFVAMTGADPDMLGSSAPNRPALMEP
                     SVAPSPTSSPPATNAHANGSNSNGAGNVPLSQSTWRDSAAGSQPHGHGMPSTVRAADA
                     PGVTEEKQAEGAFGADVHYNPATEHDFAVRGGLDGGAEGEHNSAKKIRLNNVSHFKNV
                     PSRLNVQRQSTEADLVPCTYCGRKFLPGRVQKHEDCCIDRSKPLTARKGGALPARPST
                     GAATPRLAKPTPAAPAVESAATGKAKFCGGCGCKKSEPDQKFCTECGHKL"
     gene            <1393261..>1394199
                     /locus_tag="LMJF_32_3460"
                     /db_xref="GeneID:5656470"
     mRNA            <1393261..>1394199
                     /locus_tag="LMJF_32_3460"
                     /product="putative exosome-associated protein 2"
                     /transcript_id="XM_001685620.1"
                     /db_xref="GeneID:5656470"
     CDS             1393261..1394199
                     /locus_tag="LMJF_32_3460"
                     /EC_number="3.1.13.-"
                     /codon_start=1
                     /product="putative exosome-associated protein 2"
                     /protein_id="XP_001685672.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656470"
                     /db_xref="GOA:Q4Q4S6"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR015847"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4S6"
                     /translation="MSLAPNTGSVELKAYSAHASLLLARGERIDKRAFDECRLPAIVR
                     EERVGGATVAGAGDGSPQSSASSNMTSTYTVLDGKSLAAVMYTDAYGTCIQCTVQGLL
                     GPPRPEQPAAGRLNVHVEAPFVEHLSGGATSTNYRSFQYMIASGNADLPLRQLEGYIG
                     TVLDGCFDLSQLSIYAGEACWVLKVSVLLLSVDGGLRAGSLHAALAALHKLHLPRIRL
                     PNGDVIEGRQVQLSCMPVACTFGFLAGAQVRLVADTTAIEEHVADGLITVVVDEAERI
                     LSVHHTGRCPLLAQALTAAAQQWAAASGSMRKALYG"
     gene            <1395834..>1397537
                     /locus_tag="LMJF_32_3470"
                     /db_xref="GeneID:5656471"
     mRNA            <1395834..>1397537
                     /locus_tag="LMJF_32_3470"
                     /product="putative RNA-binding, protein"
                     /transcript_id="XM_001685621.1"
                     /db_xref="GeneID:5656471"
     CDS             1395834..1397537
                     /locus_tag="LMJF_32_3470"
                     /codon_start=1
                     /product="putative RNA-binding, protein"
                     /protein_id="XP_001685673.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656471"
                     /db_xref="GOA:Q4Q4S5"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4S5"
                     /translation="MDLAAADLQNYQLARQLHMLPQLYDVFVSQVMCYPMFYQSLHPA
                     VRQLARVVLLSLNRRFNASASATGEAPVARRYQVDSMRLVLAFLSFPEYHTDRVSCVS
                     RLIAAAPLNKLELGTPMQGVVAAPSGSREATPSTLTPQRADPPIATTTPSELLLPPQV
                     VEDASSGRASGSASPASKPAHPPTAAAAAAVTGVLSRALFFIRPTAATAHADRTAPHF
                     GETAHLYVRMVHPHQLNEESLNPYFGRYGQVDVTPLQRIPVQRYVQYLGETATEALLH
                     LFPSTESGDTLYVQDFIITVDSHQNALYAVRHAYCKELVCIALHDATAGGGSNTHCLA
                     DVNNWMRRHAFVWRLRANPRAVASEASAAAAAAAHSSAAAEKRRKRARARRRRHERKM
                     KRRSILGIAVDDTSSTASSEEKVTGKGAGSSASSSGGSSSSDSSFSPTSDGDSAADDL
                     EGFVPDIVIDGFPYWTTEDQLKVLLQQYGTVAEMRLSVDDLSGAFTGCVLVRMASVEE
                     ALALSRAVHNILYRGYSLISGVVNERLEVVALEDGREVRVQSIPDQVPPDPTLNERVW
                     V"
     gene            <1398553..>1400463
                     /locus_tag="LMJF_32_3480"
                     /db_xref="GeneID:5656472"
     mRNA            <1398553..>1400463
                     /locus_tag="LMJF_32_3480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685622.1"
                     /db_xref="GeneID:5656472"
     CDS             1398553..1400463
                     /locus_tag="LMJF_32_3480"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685674.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656472"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4S4"
                     /translation="MSAEKPRKIHAKRSFLAPLCAPEPLTPSNDKGKSSASAVKPWAP
                     TSALEWLQLASHLLIASGGNGEAEERVLMVCEEAAVMLLEEDAKSRASAKSKAPTVAE
                     AEAAEYSTKEGGDAHEAVEGSAASGDGGQSAFAAAEEEPPSTERLQAAYLLTAAAVAA
                     AEAHRLPAAASAVRLARAAVEAYRCPMTACTLAMACVRWGMTSRDINSRAAAFQTAFS
                     VITAASRDILERETLPEEDAGYVLRMAWMLVGMGAADNARDQLMVVLQHNPKSYMGLL
                     LLTLLHAAEGDYDDANTAVIHLLNGHPNDVVAVVVHAAVQQKCRLPEPTDEHGRDAAA
                     EELAVAMARIATLGDEAASAAAAALKKKSLKGLCTHCAPDEDVEGGPKHSSGELKRRV
                     VGHWALLSHVATRLGCTAVAEVAIEAGTAAVAQSRMLYRRSFADLQCSQARLSLIRLR
                     EAVAAQQVHHGGGPSVPLVRDVNLLGTLDFNTAASSELAHMVAGLPLTSGVADTVRGT
                     FSLFSGSAMQRLLPSRLFDAVASTLLAAVEACPNHEEGHTLLGVTRLLEALQLDLPSA
                     TRHNRLQEAGRHFMNAMRAEAAMPEAYLGAGVVAEAQGATDESFDFYTSAAEVSVQAP
                     LIPWQYFDYLYQ"
     gene            <1403364..>1405418
                     /locus_tag="LMJF_32_3490"
                     /db_xref="GeneID:5656473"
     mRNA            <1403364..>1405418
                     /locus_tag="LMJF_32_3490"
                     /product="putative DEAD/DEAH box helicase"
                     /transcript_id="XM_001685623.1"
                     /db_xref="GeneID:5656473"
     CDS             1403364..1405418
                     /locus_tag="LMJF_32_3490"
                     /codon_start=1
                     /product="putative DEAD/DEAH box helicase"
                     /protein_id="XP_001685675.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656473"
                     /db_xref="GOA:Q4Q4S3"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4S3"
                     /translation="MLRKCPLRRWRPEKRLPLRFRDVPEEFTDLRTADSRPVLFTAKR
                     PAPLRDVTRLSDVLLDNTALSTHNPEDMAQKPVAVVAPERMGLPAQLVWYLEHRFLDT
                     NRSLSTTATAATSSASSSTSFQGFTVAQARILQHMYATQDVAVCAPTGTGKTFALCLG
                     VVARLMRDGPMKLLTTIILVSNDYLCWQVERWLQEMWWYPNDDRLVFAATSNLTEEHV
                     YRRLTKEIVRDASQTRKIVGTIDNRPYVVVTTPDVLWRFYQRRRAAIQKREQRRNRKG
                     YSFSLMPVLSTVDLIVVDEVDEVMPSTQPGAAGNLLLKELFRYTKYQAPVQVVLTSAT
                     LAGSTVNHIRRYMKKNLLADRTARVFEEARESATRLAAVSDTVSRAAVPHGIRHLFYT
                     ADTQREQRQCLAKVFAATCPSLHPLRSGEGEAGDGESSDPTSAAAAAHQDYILLILPD
                     CAKVEDFISHVLLPGQADALRILGSQDDARCTDYLVERLDHTVQVQQQQRRRAETRKF
                     IQRTVRKAEALDGDVGYPSSAPQPSPLFRRLEREVNATAAPIHAAASESQAPAPTSLA
                     TSPAVCAADSLTASSSPLRPPRRCFITCNCNNVRGLDLPHLTHVVILAQPTTALEYAH
                     WCGRVGRFGRPGVSVTLMARSATRHMHQFCDSLGIAFRVEKRHAEVDVNAERWLSGAD
                     AE"
     gene            <1406435..>1407949
                     /locus_tag="LMJF_32_3500"
                     /db_xref="GeneID:5656474"
     mRNA            <1406435..>1407949
                     /locus_tag="LMJF_32_3500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685624.2"
                     /db_xref="GeneID:5656474"
     CDS             1406435..1407949
                     /locus_tag="LMJF_32_3500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685676.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3500"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3502"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3504"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3506"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3508"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3510"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3512"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3515"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3520"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3530"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3535"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3538"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3540"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3542"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3544"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3546"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3502"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3504"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3506"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3508"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3512"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3515"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3535"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3538"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3542"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3544"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3546"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656474"
                     /db_xref="InterPro:IPR023393"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4S1"
                     /translation="MDAPVNVFLRFGLSHSERLNHLLERVGTAQAAFRIVGPRQQEGV
                     ARTPAHPHDGADCARVGAPFSVHSGSCSHTCKGEAHDELCASLARLPPLPSPPPASHT
                     CYCLHRTRFRCFCFPSPSLLQRRTLGGGGIGVGRAADVQHPFNGQEPALSVYFTHCHA
                     GLRRTSPRCLISYCGRVSSLRFAFPLGDQVTFFVPLFHTDTSSMGTTHEYEPPVAMKP
                     LEELTDADRREMRDLGIGEGMFNCILTSCMKFALSGGWSVRKHDAKYDIVWETKPSQN
                     SNKQAMRFTAKVPNCNTGSLEAILVADEYLEDDPNVSYMYKYDRLLQQNHAEKRIAGN
                     VTVQSTHYGAPVMFVAPRHIISYVTLGALLTPAQQKELWIRPTGLRDQLADAERKDDL
                     MAFTQCCIDYTGDAVELRKGSERGHVYSYSLLGQEEPDGSMTVTMTLDIDPAGKLPAK
                     VVDMSSDEQHKKMQRIVELLKAKGPQPHLCSVYQNTRDFPFRNPSKGEGEGKRS"
     gene            <1410036..>1411550
                     /locus_tag="LMJF_32_3502"
                     /db_xref="GeneID:12982169"
     mRNA            <1410036..>1411550
                     /locus_tag="LMJF_32_3502"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722330.1"
                     /db_xref="GeneID:12982169"
     CDS             1410036..1411550
                     /locus_tag="LMJF_32_3502"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722378.1"
                     /db_xref="GeneID:12982169"
                     /db_xref="InterPro:IPR023393"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4S1"
                     /translation="MDAPVNVFLRFGLSHSERLNHLLERVGTAQAAFRIVGPRQQEGV
                     ARTPAHPHDGADCARVGAPFSVHSGSCSHTCKGEAHDELCASLARLPPLPSPPPASHT
                     CYCLHRTRFRCFCFPSPSLLQRRTLGGGGIGVGRAADVQHPFNGQEPALSVYFTHCHA
                     GLRRTSPRCLISYCGRVSSLRFAFPLGDQVTFFVPLFHTDTSSMGTTHEYEPPVAMKP
                     LEELTDADRREMRDLGIGEGMFNCILTSCMKFALSGGWSVRKHDAKYDIVWETKPSQN
                     SNKQAMRFTAKVPNCNTGSLEAILVADEYLEDDPNVSYMYKYDRLLQQNHAEKRIAGN
                     VTVQSTHYGAPVMFVAPRHIISYVTLGALLTPAQQKELWIRPTGLRDQLADAERKDDL
                     MAFTQCCIDYTGDAVELRKGSERGHVYSYSLLGQEEPDGSMTVTMTLDIDPAGKLPAK
                     VVDMSSDEQHKKMQRIVELLKAKGPQPHLCSVYQNTRDFPFRNPSKGEGEGKRS"
     gene            <1413638..>1415152
                     /locus_tag="LMJF_32_3504"
                     /db_xref="GeneID:12982170"
     mRNA            <1413638..>1415152
                     /locus_tag="LMJF_32_3504"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722331.1"
                     /db_xref="GeneID:12982170"
     CDS             1413638..1415152
                     /locus_tag="LMJF_32_3504"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722379.1"
                     /db_xref="GeneID:12982170"
                     /db_xref="InterPro:IPR023393"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4S1"
                     /translation="MDAPVNVFLRFGLSHSERLNHLLERVGTAQAAFRIVGPRQQEGV
                     ARTPAHPHDGADCARVGAPFSVHSGSCSHTCKGEAHDELCASLARLPPLPSPPPASHT
                     CYCLHRTRFRCFCFPSPSLLQRRTLGGGGIGVGRAADVQHPFNGQEPALSVYFTHCHA
                     GLRRTSPRCLISYCGRVSSLRFAFPLGDQVTFFVPLFHTDTSSMGTTHEYEPPVAMKP
                     LEELTDADRREMRDLGIGEGMFNCILTSCMKFALSGGWSVRKHDAKYDIVWETKPSQN
                     SNKQAMRFTAKVPNCNTGSLEAILVADEYLEDDPNVSYMYKYDRLLQQNHAEKRIAGN
                     VTVQSTHYGAPVMFVAPRHIISYVTLGALLTPAQQKELWIRPTGLRDQLADAERKDDL
                     MAFTQCCIDYTGDAVELRKGSERGHVYSYSLLGQEEPDGSMTVTMTLDIDPAGKLPAK
                     VVDMSSDEQHKKMQRIVELLKAKGPQPHLCSVYQNTRDFPFRNPSKGEGEGKRS"
     gene            <1417238..>1418752
                     /locus_tag="LMJF_32_3506"
                     /db_xref="GeneID:12982171"
     mRNA            <1417238..>1418752
                     /locus_tag="LMJF_32_3506"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722332.1"
                     /db_xref="GeneID:12982171"
     CDS             1417238..1418752
                     /locus_tag="LMJF_32_3506"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722380.1"
                     /db_xref="GeneID:12982171"
                     /db_xref="InterPro:IPR023393"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4S1"
                     /translation="MDAPVNVFLRFGLSHSERLNHLLERVGTAQAAFRIVGPRQQEGV
                     ARTPAHPHDGADCARVGAPFSVHSGSCSHTCKGEAHDELCASLARLPPLPSPPPASHT
                     CYCLHRTRFRCFCFPSPSLLQRRTLGGGGIGVGRAADVQHPFNGQEPALSVYFTHCHA
                     GLRRTSPRCLISYCGRVSSLRFAFPLGDQVTFFVPLFHTDTSSMGTTHEYEPPVAMKP
                     LEELTDADRREMRDLGIGEGMFNCILTSCMKFALSGGWSVRKHDAKYDIVWETKPSQN
                     SNKQAMRFTAKVPNCNTGSLEAILVADEYLEDDPNVSYMYKYDRLLQQNHAEKRIAGN
                     VTVQSTHYGAPVMFVAPRHIISYVTLGALLTPAQQKELWIRPTGLRDQLADAERKDDL
                     MAFTQCCIDYTGDAVELRKGSERGHVYSYSLLGQEEPDGSMTVTMTLDIDPAGKLPAK
                     VVDMSSDEQHKKMQRIVELLKAKGPQPHLCSVYQNTRDFPFRNPSKGEGEGKRS"
     gene            <1420836..>1422350
                     /locus_tag="LMJF_32_3508"
                     /db_xref="GeneID:12982172"
     mRNA            <1420836..>1422350
                     /locus_tag="LMJF_32_3508"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722333.1"
                     /db_xref="GeneID:12982172"
     CDS             1420836..1422350
                     /locus_tag="LMJF_32_3508"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722381.1"
                     /db_xref="GeneID:12982172"
                     /db_xref="InterPro:IPR023393"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4S1"
                     /translation="MDAPVNVFLRFGLSHSERLNHLLERVGTAQAAFRIVGPRQQEGV
                     ARTPAHPHDGADCARVGAPFSVHSGSCSHTCKGEAHDELCASLARLPPLPSPPPASHT
                     CYCLHRTRFRCFCFPSPSLLQRRTLGGGGIGVGRAADVQHPFNGQEPALSVYFTHCHA
                     GLRRTSPRCLISYCGRVSSLRFAFPLGDQVTFFVPLFHTDTSSMGTTHEYEPPVAMKP
                     LEELTDADRREMRDLGIGEGMFNCILTSCMKFALSGGWSVRKHDAKYDIVWETKPSQN
                     SNKQAMRFTAKVPNCNTGSLEAILVADEYLEDDPNVSYMYKYDRLLQQNHAEKRIAGN
                     VTVQSTHYGAPVMFVAPRHIISYVTLGALLTPAQQKELWIRPTGLRDQLADAERKDDL
                     MAFTQCCIDYTGDAVELRKGSERGHVYSYSLLGQEEPDGSMTVTMTLDIDPAGKLPAK
                     VVDMSSDEQHKKMQRIVELLKAKGPQPHLCSVYQNTRDFPFRNPSKGEGEGKRS"
     gene            <1424432..>1425946
                     /locus_tag="LMJF_32_3510"
                     /db_xref="GeneID:5656475"
     mRNA            <1424432..>1425946
                     /locus_tag="LMJF_32_3510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685625.2"
                     /db_xref="GeneID:5656475"
     CDS             1424432..1425946
                     /locus_tag="LMJF_32_3510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685677.2"
                     /db_xref="GeneID:5656475"
                     /db_xref="InterPro:IPR023393"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4S1"
                     /translation="MDAPVNVFLRFGLSHSERLNHLLERVGTAQAAFRIVGPRQQEGV
                     ARTPAHPHDGADCARVGAPFSVHSGSCSHTCKGEAHDELCASLARLPPLPSPPPASHT
                     CYCLHRTRFRCFCFPSPSLLQRRTLGGGGIGVGRAADVQHPFNGQEPALSVYFTHCHA
                     GLRRTSPRCLISYCGRVSSLRFAFPLGDQVTFFVPLFHTDTSSMGTTHEYEPPVAMKP
                     LEELTDADRREMRDLGIGEGMFNCILTSCMKFALSGGWSVRKHDAKYDIVWETKPSQN
                     SNKQAMRFTAKVPNCNTGSLEAILVADEYLEDDPNVSYMYKYDRLLQQNHAEKRIAGN
                     VTVQSTHYGAPVMFVAPRHIISYVTLGALLTPAQQKELWIRPTGLRDQLADAERKDDL
                     MAFTQCCIDYTGDAVELRKGSERGHVYSYSLLGQEEPDGSMTVTMTLDIDPAGKLPAK
                     VVDMSSDEQHKKMQRIVELLKAKGPQPHLCSVYQNTRDFPFRNPSKGEGEGKRS"
     gene            <1428033..>1429547
                     /locus_tag="LMJF_32_3512"
                     /db_xref="GeneID:12982173"
     mRNA            <1428033..>1429547
                     /locus_tag="LMJF_32_3512"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722334.1"
                     /db_xref="GeneID:12982173"
     CDS             1428033..1429547
                     /locus_tag="LMJF_32_3512"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722382.1"
                     /db_xref="GeneID:12982173"
                     /db_xref="InterPro:IPR023393"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4S1"
                     /translation="MDAPVNVFLRFGLSHSERLNHLLERVGTAQAAFRIVGPRQQEGV
                     ARTPAHPHDGADCARVGAPFSVHSGSCSHTCKGEAHDELCASLARLPPLPSPPPASHT
                     CYCLHRTRFRCFCFPSPSLLQRRTLGGGGIGVGRAADVQHPFNGQEPALSVYFTHCHA
                     GLRRTSPRCLISYCGRVSSLRFAFPLGDQVTFFVPLFHTDTSSMGTTHEYEPPVAMKP
                     LEELTDADRREMRDLGIGEGMFNCILTSCMKFALSGGWSVRKHDAKYDIVWETKPSQN
                     SNKQAMRFTAKVPNCNTGSLEAILVADEYLEDDPNVSYMYKYDRLLQQNHAEKRIAGN
                     VTVQSTHYGAPVMFVAPRHIISYVTLGALLTPAQQKELWIRPTGLRDQLADAERKDDL
                     MAFTQCCIDYTGDAVELRKGSERGHVYSYSLLGQEEPDGSMTVTMTLDIDPAGKLPAK
                     VVDMSSDEQHKKMQRIVELLKAKGPQPHLCSVYQNTRDFPFRNPSKGEGEGKRS"
     gene            <1431633..>1433147
                     /locus_tag="LMJF_32_3515"
                     /db_xref="GeneID:12982174"
     mRNA            <1431633..>1433147
                     /locus_tag="LMJF_32_3515"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722335.1"
                     /db_xref="GeneID:12982174"
     CDS             1431633..1433147
                     /locus_tag="LMJF_32_3515"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722383.1"
                     /db_xref="GeneID:12982174"
                     /db_xref="InterPro:IPR023393"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4S1"
                     /translation="MDAPVNVFLRFGLSHSERLNHLLERVGTAQAAFRIVGPRQQEGV
                     ARTPAHPHDGADCARVGAPFSVHSGSCSHTCKGEAHDELCASLARLPPLPSPPPASHT
                     CYCLHRTRFRCFCFPSPSLLQRRTLGGGGIGVGRAADVQHPFNGQEPALSVYFTHCHA
                     GLRRTSPRCLISYCGRVSSLRFAFPLGDQVTFFVPLFHTDTSSMGTTHEYEPPVAMKP
                     LEELTDADRREMRDLGIGEGMFNCILTSCMKFALSGGWSVRKHDAKYDIVWETKPSQN
                     SNKQAMRFTAKVPNCNTGSLEAILVADEYLEDDPNVSYMYKYDRLLQQNHAEKRIAGN
                     VTVQSTHYGAPVMFVAPRHIISYVTLGALLTPAQQKELWIRPTGLRDQLADAERKDDL
                     MAFTQCCIDYTGDAVELRKGSERGHVYSYSLLGQEEPDGSMTVTMTLDIDPAGKLPAK
                     VVDMSSDEQHKKMQRIVELLKAKGPQPHLCSVYQNTRDFPFRNPSKGEGEGKRS"
     gene            <1435231..>1436745
                     /locus_tag="LMJF_32_3520"
                     /db_xref="GeneID:5656476"
     mRNA            <1435231..>1436745
                     /locus_tag="LMJF_32_3520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685626.2"
                     /db_xref="GeneID:5656476"
     CDS             1435231..1436745
                     /locus_tag="LMJF_32_3520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685678.2"
                     /db_xref="GeneID:5656476"
                     /db_xref="InterPro:IPR023393"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4S1"
                     /translation="MDAPVNVFLRFGLSHSERLNHLLERVGTAQAAFRIVGPRQQEGV
                     ARTPAHPHDGADCARVGAPFSVHSGSCSHTCKGEAHDELCASLARLPPLPSPPPASHT
                     CYCLHRTRFRCFCFPSPSLLQRRTLGGGGIGVGRAADVQHPFNGQEPALSVYFTHCHA
                     GLRRTSPRCLISYCGRVSSLRFAFPLGDQVTFFVPLFHTDTSSMGTTHEYEPPVAMKP
                     LEELTDADRREMRDLGIGEGMFNCILTSCMKFALSGGWSVRKHDAKYDIVWETKPSQN
                     SNKQAMRFTAKVPNCNTGSLEAILVADEYLEDDPNVSYMYKYDRLLQQNHAEKRIAGN
                     VTVQSTHYGAPVMFVAPRHIISYVTLGALLTPAQQKELWIRPTGLRDQLADAERKDDL
                     MAFTQCCIDYTGDAVELRKGSERGHVYSYSLLGQEEPDGSMTVTMTLDIDPAGKLPAK
                     VVDMSSDEQHKKMQRIVELLKAKGPQPHLCSVYQNTRDFPFRNPSKGEGEGKRS"
     gene            <1438828..>1440342
                     /locus_tag="LMJF_32_3530"
                     /db_xref="GeneID:5656477"
     mRNA            <1438828..>1440342
                     /locus_tag="LMJF_32_3530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685627.2"
                     /db_xref="GeneID:5656477"
     CDS             1438828..1440342
                     /locus_tag="LMJF_32_3530"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685679.2"
                     /db_xref="GeneID:5656477"
                     /db_xref="InterPro:IPR023393"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4S1"
                     /translation="MDAPVNVFLRFGLSHSERLNHLLERVGTAQAAFRIVGPRQQEGV
                     ARTPAHPHDGADCARVGAPFSVHSGSCSHTCKGEAHDELCASLARLPPLPSPPPASHT
                     CYCLHRTRFRCFCFPSPSLLQRRTLGGGGIGVGRAADVQHPFNGQEPALSVYFTHCHA
                     GLRRTSPRCLISYCGRVSSLRFAFPLGDQVTFFVPLFHTDTSSMGTTHEYEPPVAMKP
                     LEELTDADRREMRDLGIGEGMFNCILTSCMKFALSGGWSVRKHDAKYDIVWETKPSQN
                     SNKQAMRFTAKVPNCNTGSLEAILVADEYLEDDPNVSYMYKYDRLLQQNHAEKRIAGN
                     VTVQSTHYGAPVMFVAPRHIISYVTLGALLTPAQQKELWIRPTGLRDQLADAERKDDL
                     MAFTQCCIDYTGDAVELRKGSERGHVYSYSLLGQEEPDGSMTVTMTLDIDPAGKLPAK
                     VVDMSSDEQHKKMQRIVELLKAKGPQPHLCSVYQNTRDFPFRNPSKGEGEGKRS"
     gene            <1442429..>1443943
                     /locus_tag="LMJF_32_3535"
                     /db_xref="GeneID:12982175"
     mRNA            <1442429..>1443943
                     /locus_tag="LMJF_32_3535"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722336.1"
                     /db_xref="GeneID:12982175"
     CDS             1442429..1443943
                     /locus_tag="LMJF_32_3535"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722384.1"
                     /db_xref="GeneID:12982175"
                     /db_xref="InterPro:IPR023393"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4S1"
                     /translation="MDAPVNVFLRFGLSHSERLNHLLERVGTAQAAFRIVGPRQQEGV
                     ARTPAHPHDGADCARVGAPFSVHSGSCSHTCKGEAHDELCASLARLPPLPSPPPASHT
                     CYCLHRTRFRCFCFPSPSLLQRRTLGGGGIGVGRAADVQHPFNGQEPALSVYFTHCHA
                     GLRRTSPRCLISYCGRVSSLRFAFPLGDQVTFFVPLFHTDTSSMGTTHEYEPPVAMKP
                     LEELTDADRREMRDLGIGEGMFNCILTSCMKFALSGGWSVRKHDAKYDIVWETKPSQN
                     SNKQAMRFTAKVPNCNTGSLEAILVADEYLEDDPNVSYMYKYDRLLQQNHAEKRIAGN
                     VTVQSTHYGAPVMFVAPRHIISYVTLGALLTPAQQKELWIRPTGLRDQLADAERKDDL
                     MAFTQCCIDYTGDAVELRKGSERGHVYSYSLLGQEEPDGSMTVTMTLDIDPAGKLPAK
                     VVDMSSDEQHKKMQRIVELLKAKGPQPHLCSVYQNTRDFPFRNPSKGEGEGKRS"
     gene            <1446029..>1447543
                     /locus_tag="LMJF_32_3538"
                     /db_xref="GeneID:12982176"
     mRNA            <1446029..>1447543
                     /locus_tag="LMJF_32_3538"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722337.1"
                     /db_xref="GeneID:12982176"
     CDS             1446029..1447543
                     /locus_tag="LMJF_32_3538"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722385.1"
                     /db_xref="GeneID:12982176"
                     /db_xref="InterPro:IPR023393"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4S1"
                     /translation="MDAPVNVFLRFGLSHSERLNHLLERVGTAQAAFRIVGPRQQEGV
                     ARTPAHPHDGADCARVGAPFSVHSGSCSHTCKGEAHDELCASLARLPPLPSPPPASHT
                     CYCLHRTRFRCFCFPSPSLLQRRTLGGGGIGVGRAADVQHPFNGQEPALSVYFTHCHA
                     GLRRTSPRCLISYCGRVSSLRFAFPLGDQVTFFVPLFHTDTSSMGTTHEYEPPVAMKP
                     LEELTDADRREMRDLGIGEGMFNCILTSCMKFALSGGWSVRKHDAKYDIVWETKPSQN
                     SNKQAMRFTAKVPNCNTGSLEAILVADEYLEDDPNVSYMYKYDRLLQQNHAEKRIAGN
                     VTVQSTHYGAPVMFVAPRHIISYVTLGALLTPAQQKELWIRPTGLRDQLADAERKDDL
                     MAFTQCCIDYTGDAVELRKGSERGHVYSYSLLGQEEPDGSMTVTMTLDIDPAGKLPAK
                     VVDMSSDEQHKKMQRIVELLKAKGPQPHLCSVYQNTRDFPFRNPSKGEGEGKRS"
     gene            <1449627..>1451141
                     /locus_tag="LMJF_32_3540"
                     /db_xref="GeneID:5656478"
     mRNA            <1449627..>1451141
                     /locus_tag="LMJF_32_3540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685628.2"
                     /db_xref="GeneID:5656478"
     CDS             1449627..1451141
                     /locus_tag="LMJF_32_3540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685680.2"
                     /db_xref="GeneID:5656478"
                     /db_xref="InterPro:IPR023393"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4S1"
                     /translation="MDAPVNVFLRFGLSHSERLNHLLERVGTAQAAFRIVGPRQQEGV
                     ARTPAHPHDGADCARVGAPFSVHSGSCSHTCKGEAHDELCASLARLPPLPSPPPASHT
                     CYCLHRTRFRCFCFPSPSLLQRRTLGGGGIGVGRAADVQHPFNGQEPALSVYFTHCHA
                     GLRRTSPRCLISYCGRVSSLRFAFPLGDQVTFFVPLFHTDTSSMGTTHEYEPPVAMKP
                     LEELTDADRREMRDLGIGEGMFNCILTSCMKFALSGGWSVRKHDAKYDIVWETKPSQN
                     SNKQAMRFTAKVPNCNTGSLEAILVADEYLEDDPNVSYMYKYDRLLQQNHAEKRIAGN
                     VTVQSTHYGAPVMFVAPRHIISYVTLGALLTPAQQKELWIRPTGLRDQLADAERKDDL
                     MAFTQCCIDYTGDAVELRKGSERGHVYSYSLLGQEEPDGSMTVTMTLDIDPAGKLPAK
                     VVDMSSDEQHKKMQRIVELLKAKGPQPHLCSVYQNTRDFPFRNPSKGEGEGKRS"
     gene            <1453223..>1454737
                     /locus_tag="LMJF_32_3542"
                     /db_xref="GeneID:12982177"
     mRNA            <1453223..>1454737
                     /locus_tag="LMJF_32_3542"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722338.1"
                     /db_xref="GeneID:12982177"
     CDS             1453223..1454737
                     /locus_tag="LMJF_32_3542"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722386.1"
                     /db_xref="GeneID:12982177"
                     /db_xref="InterPro:IPR023393"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4S1"
                     /translation="MDAPVNVFLRFGLSHSERLNHLLERVGTAQAAFRIVGPRQQEGV
                     ARTPAHPHDGADCARVGAPFSVHSGSCSHTCKGEAHDELCASLARLPPLPSPPPASHT
                     CYCLHRTRFRCFCFPSPSLLQRRTLGGGGIGVGRAADVQHPFNGQEPALSVYFTHCHA
                     GLRRTSPRCLISYCGRVSSLRFAFPLGDQVTFFVPLFHTDTSSMGTTHEYEPPVAMKP
                     LEELTDADRREMRDLGIGEGMFNCILTSCMKFALSGGWSVRKHDAKYDIVWETKPSQN
                     SNKQAMRFTAKVPNCNTGSLEAILVADEYLEDDPNVSYMYKYDRLLQQNHAEKRIAGN
                     VTVQSTHYGAPVMFVAPRHIISYVTLGALLTPAQQKELWIRPTGLRDQLADAERKDDL
                     MAFTQCCIDYTGDAVELRKGSERGHVYSYSLLGQEEPDGSMTVTMTLDIDPAGKLPAK
                     VVDMSSDEQHKKMQRIVELLKAKGPQPHLCSVYQNTRDFPFRNPSKGEGEGKRS"
     gene            <1456825..>1458339
                     /locus_tag="LMJF_32_3544"
                     /db_xref="GeneID:12982178"
     mRNA            <1456825..>1458339
                     /locus_tag="LMJF_32_3544"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722339.1"
                     /db_xref="GeneID:12982178"
     CDS             1456825..1458339
                     /locus_tag="LMJF_32_3544"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722387.1"
                     /db_xref="GeneID:12982178"
                     /db_xref="InterPro:IPR023393"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4S1"
                     /translation="MDAPVNVFLRFGLSHSERLNHLLERVGTAQAAFRIVGPRQQEGV
                     ARTPAHPHDGADCARVGAPFSVHSGSCSHTCKGEAHDELCASLARLPPLPSPPPASHT
                     CYCLHRTRFRCFCFPSPSLLQRRTLGGGGIGVGRAADVQHPFNGQEPALSVYFTHCHA
                     GLRRTSPRCLISYCGRVSSLRFAFPLGDQVTFFVPLFHTDTSSMGTTHEYEPPVAMKP
                     LEELTDADRREMRDLGIGEGMFNCILTSCMKFALSGGWSVRKHDAKYDIVWETKPSQN
                     SNKQAMRFTAKVPNCNTGSLEAILVADEYLEDDPNVSYMYKYDRLLQQNHAEKRIAGN
                     VTVQSTHYGAPVMFVAPRHIISYVTLGALLTPAQQKELWIRPTGLRDQLADAERKDDL
                     MAFTQCCIDYTGDAVELRKGSERGHVYSYSLLGQEEPDGSMTVTMTLDIDPAGKLPAK
                     VVDMSSDEQHKKMQRIVELLKAKGPQPHLCSVYQNTRDFPFRNPSKGEGEGKRS"
     gene            <1460425..>1461939
                     /locus_tag="LMJF_32_3546"
                     /db_xref="GeneID:12982179"
     mRNA            <1460425..>1461939
                     /locus_tag="LMJF_32_3546"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722340.1"
                     /db_xref="GeneID:12982179"
     CDS             1460425..1461939
                     /locus_tag="LMJF_32_3546"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722388.1"
                     /db_xref="GeneID:12982179"
                     /db_xref="InterPro:IPR023393"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4S1"
                     /translation="MDAPVNVFLRFGLSHSERLNHLLERVGTAQAAFRIVGPRQQEGV
                     ARTPAHPHDGADCARVGAPFSVHSGSCSHTCKGEAHDELCASLARLPPLPSPPPASHT
                     CYCLHRTRFRCFCFPSPSLLQRRTLGGGGIGVGRAADVQHPFNGQEPALSVYFTHCHA
                     GLRRTSPRCLISYCGRVSSLRFAFPLGDQVTFFVPLFHTDTSSMGTTHEYEPPVAMKP
                     LEELTDADRREMRDLGIGEGMFNCILTSCMKFALSGGWSVRKHDAKYDIVWETKPSQN
                     SNKQAMRFTAKVPNCNTGSLEAILVADEYLEDDPNVSYMYKYDRLLQQNHAEKRIAGN
                     VTVQSTHYGAPVMFVAPRHIISYVTLGALLTPAQQKELWIRPTGLRDQLADAERKDDL
                     MAFTQCCIDYTGDAVELRKGSERGHVYSYSLLGQEEPDGSMTVTMTLDIDPAGKLPAK
                     VVDMSSDEQHKKMQRIVELLKAKGPQPHLCSVYQNTRDFPFRNPSKGEGEGKRS"
     gene            <1464177..>1465538
                     /locus_tag="LMJF_32_3548"
                     /db_xref="GeneID:12982180"
     mRNA            <1464177..>1465538
                     /locus_tag="LMJF_32_3548"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722341.1"
                     /db_xref="GeneID:12982180"
     CDS             1464177..1465538
                     /locus_tag="LMJF_32_3548"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722389.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3548"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3548"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982180"
                     /db_xref="InterPro:IPR023393"
                     /db_xref="UniProtKB/TrEMBL:E9AEG9"
                     /translation="MTEPTALVLVRRFLCIQGAARTRARGRLTMNYAPLWRDSPPLPS
                     PPPASHTCYCLHRTRFRCFCFPSPSLLQRRTLGGGGIGVGRAADVQHPFNGQEPALSV
                     YFTHCHAGLRRTSPRCLISYCGRVSSLRFAFPLGDQVTFFVPLFHTDTSSMGTTHEYE
                     PPVAMKPLEELTDADRREMRDLGIGEGMFNCILTSCMKFALSGGWSVRKHDAKYDIVW
                     ETKPSQNSNKQAMRFTAKVPNCNTGSLEAILVADEYLEDDPNVSYMYKYDRLLQQNHA
                     EKRIAGNVTVQSTHYGAPVMFVAPRHIISYVTLGALLTPAQQKELWIRPTGLRDQLAD
                     AERKDDLMAFTQCCIDYTGDAVELRKGSERGHVYSYSLLGQEEPDGSMTVTMTLDIDP
                     AGKLPAKVVDMSSDEQHKKMQRIVELLKAKGPQPHLCSVYQNTRDFPFRNPSKGEGEG
                     KRS"
     gene            <1467637..>1468971
                     /locus_tag="LMJF_32_3550"
                     /db_xref="GeneID:5656479"
     mRNA            <1467637..>1468971
                     /locus_tag="LMJF_32_3550"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685629.1"
                     /db_xref="GeneID:5656479"
     CDS             1467637..1468971
                     /locus_tag="LMJF_32_3550"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685681.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656479"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4R7"
                     /translation="MLSIDTFLQFLDVLQCCSTEEAVCHDPMMLAGGEGATVSQMSEG
                     LLRWLHSKVAANLRCELLLDDSARATSSKRYTASSKKPMVPKSGATLCDATPATTAAS
                     ASQRGSALAGPREDDCLRVRAAASSAALAMLSMALWPLVQDPQTAISTAGDTRETSAV
                     CQIERVCAVLLRLVTSNLDGCHGAWAAHEPAPSPSLISSSAVRLHLAASLKMWMHYFL
                     LFFMDWLHFLRSSIPSASDIATKQQRAAAAATGALRRQTRKPTAEAVRDGDRQTLQRG
                     QSALLPDPLRGCPADLARHPLHYYAQALQRVAATIESGCGTAPKRSSEGDDDELWATS
                     QSCAEHHKCGSPALPCVSAGRRRGAPLGGWGAVRRRCVEASSNSSVSDGSATRFPTES
                     PPLFCAFAPQRRRRAPAKSLPKRHALGGPDASADDDVPLSELAERLRARTLV"
     gene            <1469583..>1470332
                     /locus_tag="LMJF_32_3555"
                     /db_xref="GeneID:5656480"
     mRNA            <1469583..>1470332
                     /locus_tag="LMJF_32_3555"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685630.1"
                     /db_xref="GeneID:5656480"
     CDS             1469583..1470332
                     /locus_tag="LMJF_32_3555"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685682.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3555"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3555"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656480"
                     /db_xref="InterPro:IPR004942"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4R6"
                     /translation="MVLSPLFTPSVPPPCSCHAPISSTLRTRVCVGPFSFPISCEVPQ
                     VQTGISTAFCVRVCVLATCIPEIAYSISNCTTLPLFTIVVYLCSARSHLQVCLAALPA
                     TTCAVPFLFFPTVQHAPAHIMSAEKIEGVIERITYTKGVLGVVVCTSEGAPIRDSFQN
                     LDRSLAQSYAAMAADLARQAAVLFAPVKSHGAAAESSSKMGAKKQTTTPPTPPIQESS
                     VELIRVRTLLHEIIIRCSDDFLIAVVQEPVV"
     gene            <1471180..>1472901
                     /locus_tag="LMJF_32_3560"
                     /db_xref="GeneID:5656481"
     mRNA            <1471180..>1472901
                     /locus_tag="LMJF_32_3560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685631.1"
                     /db_xref="GeneID:5656481"
     CDS             1471180..1472901
                     /locus_tag="LMJF_32_3560"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685683.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656481"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4R5"
                     /translation="MHTTRRILLGAQLPPPRSYALDLEYVKFNGTSYVRSLALVPFAR
                     AELPSPRPSHESEVHVRAGSPDGSRVQLPPHTLTELGGTPTVLELNPREVMRVAEPLP
                     CGHLLLPKIQKALVQGAALEELRAPLEAEARGAMASFLGLRRALRKEGKRATREKNDL
                     GALAALRHGESSGGDIDAAADFVDEANTFSFLESESASALPAADPATEAEKLVVRELQ
                     IRLSTVQLFKGLDPFGIPNIHRFNREALELLYAAPVESPDFVAASQHICGLRAYSKGR
                     QGYKSLAHLSRHHPHFLQALLRRSFERPSAWYSWLADCALSVEANLIEVRNAHRDDTR
                     VSAWRHVGRSTGDTAVDADRVQTASAPVPASSSLNFQESLTMQDLAKQINLLWSGLVH
                     APASPYSGSEGASMCSRAKVYVYGSSDASVLRRTLGLAFTGAPLQCPRSERGLRAGSR
                     FPGRKQLRDAAAAAHAAALSSAHQTPPRPLRPLSPPLEAVIVDATRHPLFTAAGFAPS
                     PKQPPSLMTALEKAANSDATAAELLSAPQWHDPLWDAQALACVCACAGMVRVPVEREK
                     DRKTQHT"
     gene            <1473803..>1477492
                     /locus_tag="LMJF_32_3570"
                     /db_xref="GeneID:5656482"
     mRNA            <1473803..>1477492
                     /locus_tag="LMJF_32_3570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685632.1"
                     /db_xref="GeneID:5656482"
     CDS             1473803..1477492
                     /locus_tag="LMJF_32_3570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685684.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656482"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4R4"
                     /translation="MLTLTRRVAGHHAKQRLPRSLRGLPTPSVRRAWGNMKNLSSEEK
                     RELLRGAWREATPVQLVPDPSSRDSRATSEPIAFATDEAAGRYLAEEEEDEVAEMHES
                     TLGLARRFFVELAAAAAEEVDGTQMPPAPQSDEERRREVRDVQREFFGDFYVEQGIID
                     ESERYAFVDTMLRPSRPLFLVNSVLPLTRLTVRDQLEVHSAASTSLDSGIESSGSAGV
                     AGAPCVLPVFTPTLFDPCLYAVPLPPTQAFGAPLHVCFSAATSRLQSREPYTGAATPV
                     IHGGCASSVPIPKEAPSAIGDQAALPSAAASVDLIADADALGAMMLDAPPYAGTDSSQ
                     ALAAGPSASLTNGARESATTAAAVSDRTAASALAVAAPAPSPSTQPPSLAHMYWLQRQ
                     VASNTVLHVDDVSLVVSLLSVRLAAAAVSSGDGVPQPYEAVLCQASDRGETACTYHTE
                     IVHYLFRAAQAESSDPAAVDRLARVVIVVEDASFTGRTAAPRHQVKGGGHKGLRSQHR
                     QTNVASLPCDESAVAVTDRYPNVVYLQPRSPNRRGWPLTPPRCSLADGRSEAAVSHLL
                     SRVVLCVPATSQDGVRPRGWLAGGDEEAADEDADLVPLGGHTPSSYRRGVSSFVAGAP
                     PNTFVERCQRASANFSKLQKQLYAAIQAVRADSCGWVIYATQSANVIENEAVVCAVLQ
                     RICMEGDGLQPRLPQQSGRAEGEAADDGAAAAGHVRRPLGVECVPLDSPTMEACMTSP
                     EATSVLRLLCREGRPGLSTWVAIEDGSAGQEAEQYSPELRDSVAQAAWRTDPMRTGSD
                     GGFVVCLRVTPAAQLREHEHGRSGGAAASVPPLPCFWWTHPDSHVVSALTPATFQFVK
                     DMERADVAGRGRSSKTVSRILHAGVPVGCASPLPAASASNSSVGAAGLALPADCGISS
                     ATCHVDVLGALRRLLPHLTLSAKALCELLLLKHVQSHVLRRQLRLLQKQSTAQQRRQL
                     GVEDSAADTAAETRNFLTAVEKAAENHLLLSAPSSAQLSGRFYVWVGAAAESLLPSSR
                     IMATAQATGSAEAPPAPAGTALHPAVLGELEAAGVVAEVEYQRHPTLRDPASSVIDFT
                     VRLDVPPDMPERSKHLAALEEWRVALRDALLYVLRRTCKDSGSVRLWASPSVDSASVP
                     ASRVGADGGSGAVRAPRTNEVLELTENEYETVHTAQPMPTGGVVHPHALWVRPTLPGM
                     EAEDRRADWLHDTNYQKWRRRRAQR"
     gene            <1478225..>1478578
                     /locus_tag="LMJF_32_3590"
                     /db_xref="GeneID:5656483"
     mRNA            <1478225..>1478578
                     /locus_tag="LMJF_32_3590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685633.1"
                     /db_xref="GeneID:5656483"
     CDS             1478225..1478578
                     /locus_tag="LMJF_32_3590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685685.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656483"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4R3"
                     /translation="MPTISAQSASDFAPSVGGEDSTQQLLSGFQFVLVCLIVIASYYV
                     SLWISAHAVGESTASLSAPIIAASNLFADVSNTILKKINRRRHRTQVGAVVYEEEADD
                     ASNFVFVNQPGPGVQ"
     gene            <1479422..>1480024
                     /locus_tag="LMJF_32_3600"
                     /db_xref="GeneID:5656484"
     mRNA            <1479422..>1480024
                     /locus_tag="LMJF_32_3600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685634.1"
                     /db_xref="GeneID:5656484"
     CDS             1479422..1480024
                     /locus_tag="LMJF_32_3600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685686.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656484"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4R2"
                     /translation="MSVPSLRRSDRSGDPTRDRVHYVRAQRQHLVRETRMLQMALEEL
                     QEEAERENTEEALMRRGIDTTHRELLRCLLHLALAEQDSTRGAAAASGAQAQYDETSA
                     IICEVLRRYKHEQDAFTQEAKQRLESIREEARQACMNVGDTLAVPQGEHAHSSGVGSV
                     VEATDCDSLRSALEALREMQAEVDEETEATLLSIGRTLFC"
     gene            <1480798..>1481241
                     /locus_tag="LMJF_32_3610"
                     /db_xref="GeneID:5656485"
     mRNA            <1480798..>1481241
                     /locus_tag="LMJF_32_3610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685635.1"
                     /db_xref="GeneID:5656485"
     CDS             1480798..1481241
                     /locus_tag="LMJF_32_3610"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685687.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656485"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4R1"
                     /translation="MAPPKASLPARIFAGDFMGINWNRVSWMAPYNNFYPITMCGGWG
                     GRMWSSFIQYGRFDNRAGLIMVRNLIMSIPSALMALLMLGNMDWYQCMQCALYLPGIP
                     MPQWAQNEYAKEMEWYSWNKPGAMAKHHYAGTVSIPGTEKYITEM"
     gene            <1482562..>1483380
                     /locus_tag="LMJF_32_3620"
                     /db_xref="GeneID:5656486"
     mRNA            <1482562..>1483380
                     /locus_tag="LMJF_32_3620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685636.1"
                     /db_xref="GeneID:5656486"
     CDS             1482562..1483380
                     /locus_tag="LMJF_32_3620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685688.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656486"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4R0"
                     /translation="MLAAQEECRLLAAQLEKSRAARAASTCGPQGKIRAAPATAPVAA
                     TSPPSPRRTYSAATATVAVKGLSIGSSTSTSPDRAGSPSAAPPSASPARVVIPTAATH
                     KEGTLLHLVRGSGLFGSGSRSFVPHYIAVSGSAGISWYASEAEYRQNPSRPLGHADFW
                     IETFNSRGSRFKKAAVCWPLILPDDCPEAKDANKTYFAVDYYTPDEAREQVVLAASSP
                     AERDEWVQLLTKYIDLYLAPRAESEELQHIPRGAEVPLHRSGVIEGEAPGGNIL"
     gene            <1484405..>1485358
                     /locus_tag="LMJF_32_3630"
                     /db_xref="GeneID:5656487"
     mRNA            <1484405..>1485358
                     /locus_tag="LMJF_32_3630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685637.1"
                     /db_xref="GeneID:5656487"
     CDS             1484405..1485358
                     /locus_tag="LMJF_32_3630"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685689.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656487"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4Q9"
                     /translation="MDSSAHAASGSQRSASPPTAAPFPIMRVRATDMHQYVDPYSAYE
                     ADYLGRQEAARSSYVDASASGEARLPTNGSAAESGGLQHRDTTHPHEEASSVSAEVSA
                     LTAPGDEPQLSEPAPSASHAVTPAPTAALTSAPAIHPVLHLIANQVLQQQEEGEKTGR
                     ENAEERAHPSSSHAVLDEKLHRLMAQLNEAETQLTAAMAEKEATEQVWLPYYSRLKTS
                     RVYVNELKSRLQSAASLYLLQRYERETLQQAHIGVAMESISLQLVLRDVRARLEDEQR
                     SSLTDGHHQATESDRLAQQLSAVLGVPAAASQRNAACDRTN"
     gene            <1485752..>1487098
                     /locus_tag="LMJF_32_3640"
                     /db_xref="GeneID:5656488"
     mRNA            <1485752..>1487098
                     /locus_tag="LMJF_32_3640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685638.1"
                     /db_xref="GeneID:5656488"
     CDS             1485752..1487098
                     /locus_tag="LMJF_32_3640"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685690.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656488"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4Q8"
                     /translation="MQAAAHTHTHTHTHSDRHPLLTPHASAVVMPTFWKEQAHVRRLY
                     SAPDSTSELIATCDKAYVPSLAYTASTNSAVVVAEDDATAPRVQLPFPAIDLSWCPFK
                     KGTENAAYATACHSQPIQIWDLEDAELRASYTATNDSDYHVHAHALCWFKAPTHQHWI
                     AGGYGGFEDVTQVRVFDIMAEGSQPIWSYSDKRGKGIVSAMHDCQWQGTVSLLVVGSY
                     DVPSVHLIDCRKRCPVAELHGLKRGVQVIRSGIDGSDPYCVYAGGSQGDSRIACWDVR
                     KPCAPLFTLSRPVHTNQVFQFDLLHVHAAAASDDGVSGCSRGLVSTCSTGGVLLYRWR
                     PGEIPSDGTEVHIGASVGPTSGLAVVGPDTVVVSTGSRTYDVCPEGSKERARTLALPL
                     PCRDNNHGDETLQPRFPVHRRQRSPMQDESDEESISAKLGLLTTTEATNIAVLSLT"
     gene            <1488025..>1489113
                     /locus_tag="LMJF_32_3650"
                     /db_xref="GeneID:5656489"
     mRNA            <1488025..>1489113
                     /locus_tag="LMJF_32_3650"
                     /product="3-hydroxyisobutyryl-coenzyme a hydrolase-like
                     protein"
                     /transcript_id="XM_001685639.1"
                     /db_xref="GeneID:5656489"
     CDS             1488025..1489113
                     /locus_tag="LMJF_32_3650"
                     /codon_start=1
                     /product="3-hydroxyisobutyryl-coenzyme a hydrolase-like
                     protein"
                     /protein_id="XP_001685691.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3650"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656489"
                     /db_xref="GOA:Q4Q4Q6"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4Q6"
                     /translation="MRSAVTCIKSPGAALFTDTATCRTITLSRPDALNVMSLPMVQDL
                     HRLYITEPHPNEDAVYVVRGDGRRSFCAGGDLKALTGPERDTHNPLFYRLEYEVDSHI
                     AVMRRTQVAMWAGHVLGSGVGVSVHSRYRVACETTRFAMPETQIGGANDVATSWVFSS
                     LPICGLGMYLAITGNALQGADVFHAGLATHYIPVEKFGAVEAALAALPSSEGVEECLR
                     GFSEDVAVPPFTLAESAPVLAKAFGTITPWTRLRDIMDVLRADGSAFAASTLEVMERN
                     SPLGMTLALENMKRQHTPGCNTVMESFRGDYTAIQTSIFADELAKGVEALFVTKEKRP
                     QWTVESVDEVDVELVKQQFALTETTVPL"
     gene            <1492599..>1493687
                     /locus_tag="LMJF_32_3660"
                     /db_xref="GeneID:5656490"
     mRNA            <1492599..>1493687
                     /locus_tag="LMJF_32_3660"
                     /product="3-hydroxyisobutyryl-coenzyme a hydrolase-like
                     protein"
                     /transcript_id="XM_001685640.1"
                     /db_xref="GeneID:5656490"
     CDS             1492599..1493687
                     /locus_tag="LMJF_32_3660"
                     /codon_start=1
                     /product="3-hydroxyisobutyryl-coenzyme a hydrolase-like
                     protein"
                     /protein_id="XP_001685692.1"
                     /db_xref="GeneID:5656490"
                     /db_xref="GOA:Q4Q4Q6"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4Q6"
                     /translation="MRSAVTCIKSPGAALFTDTATCRTITLSRPDALNVMSLPMVQDL
                     HRLYITEPHPNEDAVYVVRGDGRRSFCAGGDLKALTGPERDTHNPLFYRLEYEVDSHI
                     AVMRRTQVAMWAGHVLGSGVGVSVHSRYRVACETTRFAMPETQIGGANDVATSWVFSS
                     LPICGLGMYLAITGNALQGADVFHAGLATHYIPVEKFGAVEAALAALPSSEGVEECLR
                     GFSEDVAVPPFTLAESAPVLAKAFGTITPWTRLRDIMDVLRADGSAFAASTLEVMERN
                     SPLGMTLALENMKRQHTPGCNTVMESFRGDYTAIQTSIFADELAKGVEALFVTKEKRP
                     QWTVESVDEVDVELVKQQFALTETTVPL"
     gene            <1497172..>1498332
                     /locus_tag="LMJF_32_3670"
                     /db_xref="GeneID:5656491"
     mRNA            <1497172..>1498332
                     /locus_tag="LMJF_32_3670"
                     /product="3-hydroxyisobutyryl-coenzyme a hydrolase-like
                     protein"
                     /transcript_id="XM_001685641.1"
                     /db_xref="GeneID:5656491"
     CDS             1497172..1498332
                     /locus_tag="LMJF_32_3670"
                     /codon_start=1
                     /product="3-hydroxyisobutyryl-coenzyme a hydrolase-like
                     protein"
                     /protein_id="XP_001685693.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656491"
                     /db_xref="GOA:Q4Q4Q5"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4Q5"
                     /translation="MRSAVTCIKSPGAALFTDTATCRTITLSRPDALNVMSLPMVQDL
                     HRLYITEPHPNEDAVYVVRGDGRRSFCAGGDLKALTGPERDTHNPLFYRLEYEVDSHI
                     AVMRRTQVAMWAGHVLGSGVGVSVHSRYRVACETTRFAMPETQIGGANDVATSWVFSS
                     LPICGLGMYLAITGNALQGADVFHAGLATHYIPVEKFGAVEAALAALPSSEGVEECLR
                     GFSEDVAVPPFTLAESAPVLAKAFGTITPWTRLRDIMDVLRADGSAFAASTLEVMERN
                     SPLGMTLALENMKRQHTPGCNTVMESFRGDYTAIQTSIFADELAKGVEALFVTKEKRP
                     QWTVESVDEVDVELVKQQFALTEGVRVSAGGKDGRACFGVFGCYRAQASPVG"
     gene            <1499257..>1500372
                     /locus_tag="LMJF_32_3680"
                     /db_xref="GeneID:5656492"
     mRNA            <1499257..>1500372
                     /locus_tag="LMJF_32_3680"
                     /product="putative 3-hydroxyisobutyryl-coenzyme A
                     hydrolase"
                     /transcript_id="XM_001685642.1"
                     /db_xref="GeneID:5656492"
     CDS             1499257..1500372
                     /locus_tag="LMJF_32_3680"
                     /EC_number="4.2.1.17"
                     /codon_start=1
                     /product="putative 3-hydroxyisobutyryl-coenzyme A
                     hydrolase"
                     /protein_id="XP_001685694.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656492"
                     /db_xref="GOA:Q4Q4Q4"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4Q4"
                     /translation="MHRTGARCSASVLYKDYPHARHITLNRPNSLNALDYGMTRELHR
                     LYVTEPAPPPSLYILTGAGTKAFCAGGDVIGLTTNNPPGCGREFFYWEYQVDYKASII
                     PAGQVCLWDGYVLGGGAGLSIGSAYRVASEKACFAMPEVAIGMFPDVGASWFLPRLSV
                     PGLGLYMGLTGHRLRGADLVHLGLATHFVPSAKMGELEQALVSMSDAGDVEAVLDKYT
                     TPTTQLPPCTIAHSISSLASHFDITADLTISSILDACREHAQTDPLAKAAADLMPSFS
                     PTAMTLALELLKRGAKLSTPVEAFQMEYCVSQRIIAEHDFREGVRALLIDKDKKPKWQ
                     PSTVAEVSAEAIDAYFRPTTPDQPVWDPVAPLSERAS"
     gene            <1503519..>1506440
                     /locus_tag="LMJF_32_3690"
                     /db_xref="GeneID:5656493"
     mRNA            <1503519..>1506440
                     /locus_tag="LMJF_32_3690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685643.1"
                     /db_xref="GeneID:5656493"
     CDS             1503519..1506440
                     /locus_tag="LMJF_32_3690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685695.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656493"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4Q3"
                     /translation="MSSDTSPPGGYRPPLQAAASIPSSIADVGRKNSSSPLRSCGLAD
                     AASMWDETRSVSSSVRSIRRRRGGEVSGAGAAEGRDWTQAFMDLEQMRRENQELLHGS
                     LRGDRSETGTLLDDTFAGSRSESSAISSVRRRRRGMAAGVSASGSRLVSGVSFEKSLS
                     GAPVVAESVTDTAEAEASAAAPASAGEANSRNHGSTSGAAEERLTSSPPPTTYLSADA
                     DTQSRSTLPEPGHTSGLPDWLKRPTVEERRASMAKALTNASAAAPTEATEATETTKRG
                     EVSVCAPASSPVCSLIIDAPVKKLNEAACPSSLATKSSTHANPPIRHFASPMQKARAD
                     PARAGAPSPSRGSCSRMVAANSSATAPTSNASSPSPTTAAATLVVGAAAACPTRCASP
                     SFSAASQRLAQTYMARQTKATAVGIVPSSSSGGNARFSPTPVRAAVSPVLTASPDPPA
                     APTAAKAAYTPSKHSAEVPAAVPPAVKPAKEKPRASASCVLARVSFEAKSGSPELRPQ
                     LLPAEVEAGRPTTMELKAPAPSMTATVAEPPSLCNALEAPNAPVYRKQTALHDRAASA
                     VRTLRGAGQPNALSRLAAEDVTRSGEKSRTAPRVAASVPRQRKCSFVDRLSREGTAFG
                     PSQPKGGAAPLTGAVGLLNRTTVLTELRRQEVMRDRLAREHKTAEEARARLAVLKQAE
                     VSRINASGAHAVEAESSVRAVTGSAEARSSSPQDTSQHVSKDRRRSLAVTQPRMPHKR
                     VALTSPSLTAAAVPANGLRACTQHPSHVGAPRSSEVVGAAPSKIHRTNTSVTLLLSAS
                     TPKGDRGHCLRGERPKSSPSLTGAEAFAHLRKPLESTVLLGTQPHLLSAAVRKDAAAA
                     ANANSRNPATNGGVWREQHWPNIMFAPPQPSSAETGKVSSAPAKKAWPQPDATALIGP
                     VAATTVSLAQPAPYRTAPSLATTGQLRPLPFCAECGYRHMDDVAKFCTVCGQRRAYLC
                     C"
     gene            <1507933..>1510116
                     /locus_tag="LMJF_32_3700"
                     /db_xref="GeneID:5656494"
     mRNA            <1507933..>1510116
                     /locus_tag="LMJF_32_3700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685644.1"
                     /db_xref="GeneID:5656494"
     CDS             1507933..1510116
                     /locus_tag="LMJF_32_3700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685696.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656494"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4Q2"
                     /translation="MLRTLEGAAVEFDVDRQASADRVIIRNRLTPITAESYRQRPPVD
                     FLSPAMLSWAGPRAATSKQDEASSDNTERKSGFSDGGNTAVEAEELFAKNIIIDVSSI
                     PATQIARWSGPLSEEAVIKPTKNLKDMRSSRLFDAEINAYVRLKQQLGNAADAQRVMA
                     EQRERAAKGAVRREVIAEKTEGIILAWSGIHRSGLIREGIQHRGDEASSDGTLPATLD
                     NGGGAAEAALCIIRNAHAFQSALPTSQSLQHRRVAFTKVSYSAQPHRYYAENIVVIGD
                     VRYNAAVPSLEEARAIKERERAAAMQPRHFGALFMEDDDGHGAGSGERQPSNSQESVA
                     ARPAEETSTHAGASALLKDDEVQVDPNKVLYGVIVRWSGGQGVIEGGDGRHFYLHSAA
                     DFEQLVDKNSHHLRGAVVQFKQDAASPRHACQVDILSTAATTMSELKPLLEKTEFNVF
                     AANGAAPAANGEAAAAASKAVPEGVEWTHGTLLSWSSMEGQGIIIGEADHKARYVLRD
                     PEENVVDYTAKQALLRKGRRIKFTPFGSTGRLACNVVLLEAEVDEEALAEEALRPKEP
                     QLSMDGNKNEAVPSPMSTSYWLNRMDKAGYDTKEVKNLQGRALRLDEDEDDDGAEGGK
                     FLDSEELLKKDHWWSDPRKNVRFPNSDMTAGHLALIGPASMMNVAMKTKDPKKLDKML
                     KKYQSRLTEEQKEYAWRQAKEMAPKYEECVRKGRERNEEPTFYFF"
     gene            <1510774..>1511181
                     /locus_tag="LMJF_32_3710"
                     /db_xref="GeneID:5656495"
     mRNA            <1510774..>1511181
                     /locus_tag="LMJF_32_3710"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685645.1"
                     /db_xref="GeneID:5656495"
     CDS             1510774..1511181
                     /locus_tag="LMJF_32_3710"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685697.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656495"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4Q1"
                     /translation="MVSKTRKQRQKKKAGMQAHDGVLPPVVPSVPKSVHLKKTRPNMK
                     GKMKIRLGLESPIDIYNGFEERKGVIWRCPTCAKACRVVGFCVDCASGVKSKSHAGQL
                     SGRASTKKEAAQTRAPKLRIKEKSRVVKLRRKK"
     gene            <1512715..>1514142
                     /locus_tag="LMJF_32_3720"
                     /db_xref="GeneID:5656496"
     mRNA            <1512715..>1514142
                     /locus_tag="LMJF_32_3720"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685646.1"
                     /db_xref="GeneID:5656496"
     CDS             1512715..1514142
                     /locus_tag="LMJF_32_3720"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685698.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656496"
                     /db_xref="InterPro:IPR004324"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4Q0"
                     /translation="MVTLLLFFSSLVQGFSSSVISIFINRELALQPVEVVRYWMYIGC
                     TMWCQPVVGCISDAIVVFSEKRRPLFVLAAVSNTVIYTIYSLFPGATRSFGRFVALSM
                     VSQFCTMGLYVPLNGLVVELGWHDAETAEESNARMSAIVSKTMVWRSAGSLAGAVLHT
                     CLIALLPVRPLLGITGILFLVLVPIVLVTPRRLFLRSSTQDYSFCHRVAKACRMVWCR
                     FDIRDPRSDGVCLVLVLAFVFVYAMMPDASSVYYSYLYVVFEFPNWFYSMNGCVGHLG
                     FIAGAYVFSCWADQRATQEARGGTRMSLFFIFMIGSVAWAVGYVTNLLLCTGFITETL
                     GVPAAAYVPVDTFFTSLVARFAFMPTLVMAAEHAPRFFEATTFEVFSVASMGGSVVSG
                     LLISSIAEGLHITRTDYSRLWALIVVSMVAKLAPIFLACLLPERRSAHGGEGRRDDAV
                     VVAEDEGRDSPARANGATHLGVRVL"
     gene            <1514784..>1515401
                     /locus_tag="LMJF_32_3730"
                     /db_xref="GeneID:5656497"
     mRNA            <1514784..>1515401
                     /locus_tag="LMJF_32_3730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685647.1"
                     /db_xref="GeneID:5656497"
     CDS             1514784..1515401
                     /locus_tag="LMJF_32_3730"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685699.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656497"
                     /db_xref="InterPro:IPR026721"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4P9"
                     /translation="MSFLDSLQEWLGSAEDEFWTAHNEVMEATGARAFLDAAAASSLS
                     IGSLAEGFLREIYNFYTAVNWSEPFFRYIGVFHVVVWVAAITATWGAVSDERIMAVCA
                     VLGVLLLSGIPANSYAGRHAEWLFQEPGVNYFTEDGTMLMVVYLLPLLVLLVYLQLRQ
                     GYRVVSLMVRLKRAQLRRRMRQEARRESCGGAHGEEATGDSKKTQ"
     gene            <1516227..>1516694
                     /locus_tag="LMJF_32_3740"
                     /db_xref="GeneID:5656498"
     mRNA            <1516227..>1516694
                     /locus_tag="LMJF_32_3740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685648.1"
                     /db_xref="GeneID:5656498"
     CDS             1516227..1516694
                     /locus_tag="LMJF_32_3740"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685700.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656498"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4P8"
                     /translation="MSSWLSFESFLHSHTAKWCRYGLVAFGVFGVWSDYYLTHHYQAF
                     DPSEGRQYVVDWSPIGKPRCQMLLIPNNYYTNYSPWTPKNGDVVLAREVEDEPNYLQL
                     LNGRFVERQTCGVTLLRPIEEVTQSRREEQLQRERLLSYMFSTDDTARPPTDH"
     gene            <1517520..>1518341
                     /locus_tag="LMJF_32_3750"
                     /db_xref="GeneID:5656499"
     mRNA            <1517520..>1518341
                     /locus_tag="LMJF_32_3750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685649.1"
                     /db_xref="GeneID:5656499"
     CDS             1517520..1518341
                     /locus_tag="LMJF_32_3750"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685701.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656499"
                     /db_xref="InterPro:IPR003827"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4P7"
                     /translation="MRAQILSNLRTNTNDRSLAGRVDPQIAELVDYINGSFTQYVTSS
                     SCGGRVALFHKGTTSTGTASTPHAAAESAGSSSPTAASSVERRKRGSFGRGTLYQSHD
                     SLPKDTSITVRESIVPALEKFWAWRQAQASDARLQTTEVLQLKFEPMILHVLCADFEA
                     AAELLKCGSESGQMNSGIVSCSRGTKAHRKITCCITSPLCVDVPLFAHDTWCISPANF
                     RSDVWAAFLTASLDHVNTLFAENATRRERFELALHASAGKAAAQQQQQQRSGIRG"
     gene            <1519077..>1520903
                     /locus_tag="LMJF_32_3760"
                     /db_xref="GeneID:5656500"
     mRNA            <1519077..>1520903
                     /locus_tag="LMJF_32_3760"
                     /product="putative enolase"
                     /transcript_id="XM_001685650.1"
                     /db_xref="GeneID:5656500"
     CDS             1519077..1520903
                     /locus_tag="LMJF_32_3760"
                     /EC_number="4.2.1.11"
                     /codon_start=1
                     /product="putative enolase"
                     /protein_id="XP_001685702.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656500"
                     /db_xref="GOA:Q4Q4P6"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4P6"
                     /translation="MSSSVSWQRYDDEFHVSGVLTEAARACVSAHPTDVKDFFSRYFR
                     EVAGGTSVKALHHNEVLSAAGETAITFTMELCVGPEVSVTTGDLLASADRGRDGEARA
                     SLAASEGATDAEGNSYSAIQTTCAAAVSKLLQLGYAEPQHEWDSALRAALSTSPLANG
                     TSALQWVLSIMASLVVAKQRCMPLHQYIAALIDDRRSGGPAVRGAHSTPARTGVSAAS
                     TARAGSDTSARSYSVPQLLVTFLVRAARSDAPEAVHSVRFSHVYVALDVLTSSVGDAS
                     GVEKSMPVSGAVLRQRMQKVRRAAQRFVQSHPTSSSVGTGGTLHWDGAVNLTDVVKAV
                     TEALSGAQLNVGAEVCLGLSMKASTTRVPAANTADGGAAKDAPGECRVLYSLFGGGEP
                     PVTGDQLSEYVKEQLKEVGPDIVQFLEDTHVMEDCVARQRLQMALQDSIVLSDVVAGQ
                     REAGSAASGLASPLPVQAHDGAFPNSVMSPCDCGTVSDVVDYVCATGEDSRRAVTVLV
                     STAAGDPQTAAHVVDLAIAGGASYVLVSAGIFSAHTAAAVSRLATRTDELTSMQMVAP
                     RPSAQRFNRYDWPPLPTAEVAPIRRKGDKKKKDIGKANSRRK"
     gene            <1522011..>1522409
                     /locus_tag="LMJF_32_3770"
                     /db_xref="GeneID:5656501"
     mRNA            <1522011..>1522409
                     /locus_tag="LMJF_32_3770"
                     /product="putative kinetoplast-associated protein p18-2"
                     /transcript_id="XM_001685651.1"
                     /db_xref="GeneID:5656501"
     CDS             1522011..1522409
                     /locus_tag="LMJF_32_3770"
                     /codon_start=1
                     /product="putative kinetoplast-associated protein p18-2"
                     /protein_id="XP_001685703.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656501"
                     /db_xref="InterPro:IPR009071"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4P5"
                     /translation="MLRRSRELLRVSPFALFVQDVAKAGKLKGAKNVCATAAKMYRKL
                     SPAEKSALARRAKEKTFPLQEAYQRMAKREMRRLRDMPILKRQEHIRAKWASMRRSRA
                     SKPTNTVSSAKAKVKAASKAGKKIAKGSGK"
     gene            <1524435..>1524845
                     /locus_tag="LMJF_32_3780"
                     /db_xref="GeneID:5656502"
     mRNA            <1524435..>1524845
                     /locus_tag="LMJF_32_3780"
                     /product="putative kinetoplast DNA-associated protein"
                     /transcript_id="XM_001685652.1"
                     /db_xref="GeneID:5656502"
     CDS             1524435..1524845
                     /locus_tag="LMJF_32_3780"
                     /codon_start=1
                     /product="putative kinetoplast DNA-associated protein"
                     /protein_id="XP_001685704.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656502"
                     /db_xref="InterPro:IPR009071"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4P4"
                     /translation="MLRRSFTLRRVSPFSLFQKHLGETGVLKGIKNPAKKSAQMYSKL
                     STPERKMFEERARRVTYPALDAYNRFQKEYAPRFLHLPMKQRQRKVAQLWAELKKNGT
                     VKIPKNAKRKIRKVAKKTKPRVSMSKTAKKQSAK"
     gene            <1526571..>1526870
                     /gene="CKS1"
                     /locus_tag="LMJF_32_3790"
                     /db_xref="GeneID:5656503"
     mRNA            <1526571..>1526870
                     /gene="CKS1"
                     /locus_tag="LMJF_32_3790"
                     /product="cyclin-dependent kinase regulatory subunit"
                     /transcript_id="XM_001685653.1"
                     /db_xref="GeneID:5656503"
     CDS             1526571..1526870
                     /gene="CKS1"
                     /locus_tag="LMJF_32_3790"
                     /codon_start=1
                     /product="cyclin-dependent kinase regulatory subunit"
                     /protein_id="XP_001685705.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656503"
                     /db_xref="GOA:Q4Q4P3"
                     /db_xref="InterPro:IPR000789"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4P3"
                     /translation="MPAKPAQDFFSLDANGQREALIIIKKLQCKILYSDKYYDDVFEY
                     RHVILPKDLARLVPTSRLMSEMEWRQLGVQQSQGWVHYMIHKPEPHVLLFKRPRT"
     gene            <1528222..>1528896
                     /locus_tag="LMJF_32_3800"
                     /db_xref="GeneID:5656504"
     mRNA            <1528222..>1528896
                     /locus_tag="LMJF_32_3800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685654.1"
                     /db_xref="GeneID:5656504"
     CDS             1528222..1528896
                     /locus_tag="LMJF_32_3800"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685706.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656504"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4P2"
                     /translation="MNARQTQVACVTVVIGGLLGALSYAAYRQLSQNSAASPDRNAHV
                     PGSPVQPPAAAAGAQASPPPPQAPISLPVESPCPAADKARALELLNVLKRNANIAFQE
                     GRFEDALRGYQDCIEVTSVLGAADAEAVETEQIVRANVAMVCIRMHEYDAARSVATML
                     LQDAAVALPEDLKVKVLYRRGLASKALNDRAAALADFKAAVHFSKDHRNPAVEKEIAL
                     LQRGGA"
     gene            <1529545..>1531287
                     /locus_tag="LMJF_32_3810"
                     /db_xref="GeneID:5656505"
     mRNA            <1529545..>1531287
                     /locus_tag="LMJF_32_3810"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685655.1"
                     /db_xref="GeneID:5656505"
     CDS             1529545..1531287
                     /locus_tag="LMJF_32_3810"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685707.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656505"
                     /db_xref="InterPro:IPR007009"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4P1"
                     /translation="MITPVFECSQEGGFVVIRIVLSAICKVMSAVFDIHETQFTFYCS
                     PYYLRLRFDQCLQEGKGERASYDLEANVLTVYLPKANPAEVFTKLDNPAYLIATEKQR
                     ASLIQVLSVASSSDAATGAGEELEETEYVQSLPDATATGSAADRSESMAPVEQCSYGF
                     ANAFSGLFQKLDADVVREVVSLRDNPECTTREERRRLRLAAEMRDFDVDALLFAFEDA
                     EGEVAQVLRYVPAHIRDFENALHGNAVGSGEEQASLSVVFASIPELGAGRADPLEEEE
                     TTLLAGDDARPVTVWSGNVADFKKPLIEELHPAVDDERKPTASEAAAGAAAAASVSFQ
                     AAANAAAPPGPRTRLAISRVRPSLKFTREETEVLMRLKLPRLLFPPSPAEVEALTADL
                     LFSEAYDDLVTEGSGCSESLWNLTQLSPALSYLDPADTLYDACVAFARRALVYPLYRH
                     CALLQRVWAVVGTRLLLGRNYTIRALLRIRIILSHAEHKHLLSTIYLDPLIAYWMHVS
                     ESDERLMRMALEIHQHVSRTEPVTVSAASTPGASVLQSMLVDAKKVTLYPLTLVHLGL
                     PLSEEEEEEGRCEG"
     gene            <1532279..>1533358
                     /locus_tag="LMJF_32_3820"
                     /db_xref="GeneID:5656506"
     mRNA            <1532279..>1533358
                     /locus_tag="LMJF_32_3820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685656.1"
                     /db_xref="GeneID:5656506"
     CDS             1532279..1533358
                     /locus_tag="LMJF_32_3820"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685708.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656506"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011044"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4P0"
                     /translation="MFYTGINEPRPTAMNFSFDGLHFVSAHTDDAVRFIDVGNMTNTD
                     VIICDAFGVHNVRYTHSSSVVCVAPRFHLDGHLHLLNTETSQFFGEMAYLNDAESEML
                     PVANTPVYSTLAQCPATDVIGAVVVAKGRLALFHPLISGCIAATPERSIVGSRACVQF
                     SRDGHRIAIGDDHRIVLLDRRSFFGAPLAVLENKHVFTTSTSLTRCKGLEFSADANRL
                     LLTSSSGEVVVYDWLRGETVANYFHGDARRHFVGSADAIGAQHVFPYQSASPILQLTS
                     SMTGGRHLLVYAGCPSNSAASTRQGRLLYELQSKDSDVPVAIAVNPRLQLAATAARSI
                     TWWAFHNSVVEAYATLTEAGMTAAD"
     gene            <1534768..>1535319
                     /locus_tag="LMJF_32_3830"
                     /db_xref="GeneID:5656507"
     mRNA            <1534768..>1535319
                     /locus_tag="LMJF_32_3830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685657.1"
                     /db_xref="GeneID:5656507"
     CDS             1534768..1535319
                     /locus_tag="LMJF_32_3830"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685709.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656507"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4N9"
                     /translation="MRVIESQKEVLHTLRHPSQHSATDRKRAYMFLFVYVLSAIAFGG
                     NLLHFISGWIAATVLQVVMTILIMIYAFNINDYSDKSMSSMECERACNPLLDAYIALR
                     AVQLIQALFLRSFVCTFFFATVLIGTLFRVRQRKLYVDAVNLWREVSQYEREGFIFIG
                     VDVVMIIVLMLSMVFSIVANYGG"
     gene            <1536461..>1537027
                     /locus_tag="LMJF_32_3840"
                     /db_xref="GeneID:5656508"
     mRNA            <1536461..>1537027
                     /locus_tag="LMJF_32_3840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685658.1"
                     /db_xref="GeneID:5656508"
     CDS             1536461..1537027
                     /locus_tag="LMJF_32_3840"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685710.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656508"
                     /db_xref="GOA:Q4Q4N8"
                     /db_xref="InterPro:IPR003377"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4N8"
                     /translation="MSSTKRLTDAFWLQFEWIPVLITDRSHHTGRDRKRAMLFVLLHA
                     SFLMVLCGHFMSVIVSWALAFVLQSGAMVLCVTHLALLEEYADSMKNALELEHMINPL
                     IIAEVAVRCFASLQCVLTGSWMLLLAGSIELAYDLHVTQHRSLLIDAATIWKELEIFR
                     TDGRVRTAYQVLMVLFAIFYFIYSFSTA"
     gene            <1538076..>1538951
                     /locus_tag="LMJF_32_3850"
                     /db_xref="GeneID:5656509"
     mRNA            <1538076..>1538951
                     /locus_tag="LMJF_32_3850"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685659.1"
                     /db_xref="GeneID:5656509"
     CDS             1538076..1538951
                     /locus_tag="LMJF_32_3850"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685711.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656509"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4N7"
                     /translation="MRTAVGSGAGASAAARAIPTAVPLTVADIDALARRDGVVSSDAV
                     VSQQGTVASSRSVAELQAVVQSLQQENAELRERLERDRRQMLRSAMDVRDLHASQKQI
                     RQRDLDRIEWLYCDNQRLRKILEMQGSAQELAGVLSPQPPAAAPATAHRPSLEGLRPL
                     PEVPVELNAIEEEMPALEAEVVHLRGALVLKTQHLDDLWGHAERAEGYVQDLLQKLEH
                     VQGIVREESDSCARRSKHLESTDQPLEDIVSFVSLRDHSSATQLTGPSSTTPFPFATV
                     GRCEHIKRAAAVHGG"
     gene            <1540735..>1543485
                     /locus_tag="LMJF_32_3860"
                     /db_xref="GeneID:5656510"
     mRNA            <1540735..>1543485
                     /locus_tag="LMJF_32_3860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685660.1"
                     /db_xref="GeneID:5656510"
     CDS             1540735..1543485
                     /locus_tag="LMJF_32_3860"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685712.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656510"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4N6"
                     /translation="MGLQSPLWLWTHQQITRDAGAPKGMRKIMHLVHWMHRHGVESRH
                     IAILAPFSWKAMCQQEFAQHSAQVEMKECPIILAHHELPALNKRDHTKYRYRAVFYLM
                     DALPRNLSLSAPLQASEELLISEAMGAAMDAFVLCADAGWMAPQVQAKWYEKFVAKLE
                     GVRAVISYDATTTTQAAMEAAAAYFPSLVGPTIPLCCSRHPNQRQLEYGLARMEPCCK
                     RLCLSLYACRRPDHVCTRTCHPEESHLTCSYACGAFLPCGHKCLLECGAPCNCFEVVE
                     MQLACSHEKLLGMNKETLEPIYAVVRHVYKGVCGDAALPCAVSYETECARCLGLFTVL
                     CFEAREKGHSLAHRTLICAACKRRERELWAKLLGELLTGVESQKKKVKAELQRSLHHQ
                     RKAAAQGLFRPGTRVEIVDATKCVPPLFAEDDFPGIEFVDMEAPMFFQEMEGAYGTFV
                     SNHVDVMDRSEVRNLVRLPSGKHVLVTDGGLRMIQALTSNITQAVPLMLTCKGRDDGA
                     VDGAALDSAEFAAAKLMLHGVYYLAQPVACDEVAGEEVLTDKVVRVVALDPLSAKNVV
                     VECELYRVSERTHDDIGDEHSDSAHVGSAPTGSLNGTPKRRRLERGAGSISRYECTEQ
                     IVRLSVPIAALEPMPGMVEGKYVFVSAPERQVRNPHDMVRIEAMLRRLTDLSLPTDAH
                     VTAAPIDPDTPYSLVKVVNPPVNCEAARGPCAVLKCSDARVVVRASPDKLQHRRGGGA
                     RHNGDRGSPQRGLRAPPTAAASALLVVVPFVYAVGDELTEAEGALDAAAQKVFEQRLQ
                     AELTAASEELALRHEEEAFHAQQQMPEVTPEMLAADLHAYSVPMPLPTAADVAAARQK
                     SMELPVGTPIASRLAHTRDKLLCKQEALQLPQWMTAMTERAHKEKESDALHVKYIRSL
                     CR"
     gene            <1545731..>1548883
                     /locus_tag="LMJF_32_3870"
                     /db_xref="GeneID:5656511"
     mRNA            <1545731..>1548883
                     /locus_tag="LMJF_32_3870"
                     /product="myosin XXI"
                     /transcript_id="XM_001685661.1"
                     /db_xref="GeneID:5656511"
     CDS             1545731..1548883
                     /locus_tag="LMJF_32_3870"
                     /codon_start=1
                     /product="myosin XXI"
                     /protein_id="XP_001685713.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656511"
                     /db_xref="GOA:Q4Q4N5"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR001609"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4N5"
                     /translation="MPERVSVNQEVYYLDTKSGWLRGTVKEVDGAKVTVEDNASQSAV
                     KVAADNVHSYISESYDIEDAELFHVSDLHVATLLHCVKDRFEKLHKQYSLMGEMVLSV
                     NPFRLMPFNSDEERKKYLALPDPRMLPPHVWQVAHKAFNAVIVQGQGNQSIVISGESG
                     SGKTENAKMLIAYLGQLSYMHSKDTSQRSIADKIDENLTWSNPLMESFGNARTVRNDN
                     SSRFGKYIKLYFDPVSGVMVGGQTVTYLLERSRIIMQSPGERNYHIFYEMLAGLSQTE
                     KQQLGGLKTAQDYKCLNGGNTFIRRGVDGKPLDDAHEFQMVRRALSMIGVPLETQECM
                     LRVLAAILHLMEVEFESDNNDKAQIANGTPLATACALLCLDEAKVRECFLVRSKTSLV
                     TILASKTEAEGLRNAFCKGLYVGMFDRLVEFVNAAIQPRVDCRDCKYVGLLDIFGFEN
                     FTRNSFEQICINYANESLQNHYNKYTFINDEEECRREGIQTPNIEFPDNSECVNMLDA
                     KRVGIFSMLDEECNFKGGSTDRFTTNLWEEWAGRNQYFVKPKSTIPNQFGVNHYAAFV
                     NYNTAEWLEKNTDALKEDMYECVSESTDEFIRTLLSTEKSEARRKQTVAIRFQRQLTD
                     LRSELESTETRFIRCIKPNMEASPSFLENLLVGSQLESAGVLQTISLKRQGYPVRRPL
                     EQFCRYFYLVMSRTTASLFKQGRYSDASQDFLQRYQRLYGWAEPNYAVGKTKVFLRAE
                     VWSALERLVLRRRAQLLHRCKPYLRRWIDELRERRRIEEQKRLEAARKLREAREAKAA
                     GAANGVPAEKLQWVEEASNMFPDFDTDTLIDVAVEADTRGEALSAILAIQADCLDKQM
                     ASGFMDVMAAANVHRGVINNFVSADIKTVSALSRLQPEDMKSLGASEMEVVAITKKLT
                     EQQGQRVKYQRLAEAIGTDGEYAAADAVQRAAVARHEEDFDTKVQTLASMGFDESISR
                     LVLAHYNGDVQRTAARLLYGVDSRKMKNNARKHKNFNTTDPNVQQLISLGATKQDAKM
                     ALRRNSGDANAAVKMLFKVS"
     gene            <1552694..>1553767
                     /locus_tag="LMJF_32_3880"
                     /db_xref="GeneID:5656512"
     mRNA            <1552694..>1553767
                     /locus_tag="LMJF_32_3880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685662.1"
                     /db_xref="GeneID:5656512"
     CDS             1552694..1553767
                     /locus_tag="LMJF_32_3880"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685714.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656512"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4N4"
                     /translation="MEFLGREAAGVVSIACSSASTTSFATLSSHGTLSLWDVRIPRRN
                     YLQFRNPNSAAAAEASELRYLHDRHAAVALCGKTVQLFDTRKCVSCVSELTSEKECVA
                     FLRDEPPPDSTTTLIVDEDGGMFAYDIADGTRPPYIEAYIFGQQERCPLPKGSRFGCL
                     TNYCSGLHCVDLAPGEGGAATRLLFAVGMDGEGALYSGSDDTDSARVAFSIAHESPSD
                     GNAQIVNPPLVNCTAICGAQVAVGRADGMYSVYEIERGGLDEAMASPGHAVNGLCYVD
                     WVSPEVLLTVSLCGEVTGWAVGAFMAGSSAEAEGPEVVAALAHREVPGCQLAIVNCAD
                     RLAGMRYIFGDHLGGVALAQLDL"
     gene            <1555373..>1556539
                     /gene="ATG4.1"
                     /locus_tag="LMJF_32_3890"
                     /db_xref="GeneID:5656513"
     mRNA            <1555373..>1556539
                     /gene="ATG4.1"
                     /locus_tag="LMJF_32_3890"
                     /product="putative AUT2/APG4/ATG4 cysteine peptidase"
                     /transcript_id="XM_001685663.1"
                     /db_xref="GeneID:5656513"
     CDS             1555373..1556539
                     /gene="ATG4.1"
                     /locus_tag="LMJF_32_3890"
                     /EC_number="3.4.22.-"
                     /codon_start=1
                     /product="putative AUT2/APG4/ATG4 cysteine peptidase"
                     /protein_id="XP_001685715.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656513"
                     /db_xref="GOA:Q4Q4N3"
                     /db_xref="InterPro:IPR005078"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4N3"
                     /translation="MGTNAKVAEKTPCVDSGSLFKWWLNPSKIFRTPNRKLKNTTPVV
                     VVGSGSHSGDGTTEFVKVATKKLLYFSYRNCFPPLPSGSTTDTHWGCLVRTTQMLVGT
                     CLLRYHCKGAYVLPEADNAELKERISRLFMDVPSAPLGIHKAEDEAHKNSVKYASMLS
                     PTEAGMAIAAALIAFRAQGGDVPFTFCCESRHIDEPAVMAKLLEGQHVVLIIPVVLGI
                     APMSDQYELVMLKILDVKACCGIAGGFKQASLYMFGHQGRSVFFMDPHYVQNAYTSSR
                     TVGTLEGSRGELRARRFDPCMVLGFYLHTPEDYRVFAEELAVANSLVVFPLISFGRRP
                     REGTTLSEDRVVSVAESAESITLHEKEKPQRSRNPLAADGEHARSSNSISSPPS"
     gene            <1558694..>1559476
                     /locus_tag="LMJF_32_3900"
                     /db_xref="GeneID:5656514"
     mRNA            <1558694..>1559476
                     /locus_tag="LMJF_32_3900"
                     /product="putative 60S ribosomal protein L2"
                     /transcript_id="XM_001685664.1"
                     /db_xref="GeneID:5656514"
     CDS             1558694..1559476
                     /locus_tag="LMJF_32_3900"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L2"
                     /protein_id="XP_001685716.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656514"
                     /db_xref="GOA:Q4FWX5"
                     /db_xref="InterPro:IPR002171"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR014726"
                     /db_xref="InterPro:IPR022666"
                     /db_xref="InterPro:IPR022669"
                     /db_xref="InterPro:IPR022671"
                     /db_xref="UniProtKB/TrEMBL:Q4FWX5"
                     /translation="MGKTVLSCRKGNGSVYQVHGHKRLGPAKLRILDYAERHGYMRGV
                     VKSIEHEAGRGAALARVEFRHPYKFRRVKELMVAPEGMFTGQSVFCGQKAPLAIGNVL
                     PLGQITEGCIVCNVEAKPGDRGTLARASGDYCIIISHNHETGRTRLKLPSGQKKSVPS
                     TSRAMIGIISGGGRIEKPVLKAGNSFYRFRGKRNCWPKVRGVARNPVEHPHGGGNHQH
                     IGHPSTVSRHSPPGQKVGLIAARRTGRIRGGKAVKGAWHPEE"
     gene            <1560558..>1561487
                     /locus_tag="LMJF_32_3910"
                     /db_xref="GeneID:5656515"
     mRNA            <1560558..>1561487
                     /locus_tag="LMJF_32_3910"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685665.1"
                     /db_xref="GeneID:5656515"
     CDS             1560558..1561487
                     /locus_tag="LMJF_32_3910"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685717.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656515"
                     /db_xref="InterPro:IPR012936"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4N1"
                     /translation="MRAARNWQRADFFRHIPRDLTESTTAGSIISVACVVVMVLLFAG
                     EVIAYVFPRIQSDMIIMPDLDDRNTIKVSMDMTFPKMPCAVLTLDILDVLHNHMFNSM
                     EHITRTRLDAAGQPISDGRSSDDFVSVAEGCRLEGYIKVAKVPGNFHISSHGRQHLLA
                     QHFPNGINVEHSIHHLSFGTIDVKKLAKKAALHPLDGKEHRSEMPMVYQYFLDIVPTI
                     YESSFSTVYTYQFTGTSSSTPVPARQMAAVVFQYQLSPITVRYSLARVSLTHFLTYVC
                     AIIGGVYTVAGLLSRFVHSSAAQFQRHVLGKGD"
     gene            <1562699..>1565119
                     /locus_tag="LMJF_32_3920"
                     /db_xref="GeneID:5656516"
     mRNA            <1562699..>1565119
                     /locus_tag="LMJF_32_3920"
                     /product="putative DNA repair helicase"
                     /transcript_id="XM_001685666.1"
                     /db_xref="GeneID:5656516"
     CDS             1562699..1565119
                     /locus_tag="LMJF_32_3920"
                     /codon_start=1
                     /product="putative DNA repair helicase"
                     /protein_id="XP_001685718.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656516"
                     /db_xref="GOA:Q4Q4N0"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR006935"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4N0"
                     /translation="MAHSLSGDARTGEKCLFVESRIESDGYITIIAESFRRSYVNIRP
                     FLTTLAEAISRPSLMHEYLLTPFSLGAAVSNGIDAAEATAFLETHAYGLAESSERRQL
                     VRQFIESCMKRYNLARIIIDAERTLVQCKNEETAQMLLRDAVIASVAATPLRIFYEES
                     SWEESPAPYPSFLLQSRAMSKVVAAQCVVLGLPIQQQYDFENDTSVRTAHISLRTQTK
                     PRRYQIEAVDAAIHDGTLNSGCLLLPCGAGKTLLGIMLMCKVKKPTLVLCAGSVSVEQ
                     WKSQILDYATLETPPRTDDGDASDAHGGRPHQIKDGAARIACLTGKQKDPITEETDVV
                     LTTYSMLVTAHRAKMRQQATTTSSEDGLFTGRGLRKRKENPKEKLFAPYGLLILDEVH
                     VMPAESFRGSLGFVDAKGVIGLTATYVREDHKILDLFHLVGPKLYDISMETLASQGYL
                     AKVHCVEVRTPMTKEFGLEYMQRSSKVARAGTAPVLVMLAAANPNKMMCVRELVRQHL
                     DAGAKILLCCDHIMLLKEYGELLNAPVICGSTQHKERLMIFSDFQSTSKINVICVSRV
                     GDVSVNLPNANIVIQVSSHGGSRRQEAQRLGRILRPKERAANGRTVDAWFYSIISTDT
                     VEINYAAHRTAFLVDQGYTCRIMEYSPFTSSVDTALGGVKQQVKKHRIGDVVSIKQES
                     LYETLHQSSVLRPRSGECSGRDADAGDCRAESLSYQLKLLSKVVSSWEIEFQQECRKR
                     RRTAVRDADDNAANETDSADDVVEVRPIRTYAAIKSEWRGGADSAARVTALRDLVGVD
                     DGFVYHEL"
     gene            <1570140..>1582403
                     /locus_tag="LMJF_32_3930"
                     /db_xref="GeneID:5656517"
     mRNA            <1570140..>1582403
                     /locus_tag="LMJF_32_3930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685667.1"
                     /db_xref="GeneID:5656517"
     CDS             1570140..1582403
                     /locus_tag="LMJF_32_3930"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685719.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656517"
                     /db_xref="GOA:Q4Q4M9"
                     /db_xref="InterPro:IPR000433"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="InterPro:IPR001870"
                     /db_xref="InterPro:IPR003877"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4M9"
                     /translation="MCIQDPGGDNKGAMELDTMSLSQLYATGYRMYRKKHQPDSKQNF
                     TLPTSPPDFDGDAPIDPQTVVRHVRSLANAYNSVTPTPPPFLIYEQVILDAQDALKTT
                     TEESDQSTVLRNDEVHNSSAPYTADNSMGDLFVYSSTFGSQPQSDALMMSVNLLNGMQ
                     SHVRSLQLLYQRLLFDANLSRALAPSVVKELLTQLDISVREATPPSAQVMERCAIAGL
                     LVGRRHQLDEVLRYADILEHLISTSASIVPVAVPHAREIVQSFSLHAADICPITSPID
                     CFQDEPIKMKMALGEGTGVQRFCVSPNQQYLATVGSQKVMILNLSTGSLHAERELPEV
                     VSGCWNATFSEDSTHLICTDASGLRHAVLTTDLVTKEDRTTECVSLVTDYHKGVLETT
                     PSPLLPSGSTASLHMLEANVKAYMASFSHPFPDSVDCFSLCAHVYNDCAGTLIHVVPD
                     TGESLSVEVSGNVLRLRQGSSVCRGVLPSTSQWYFLHAHWCRGVWVVSVNFSIVELSG
                     SHYTQSQTMKIKLVECLRCTGHFGSMALWSGSNGSATVRRFFQERVVDSSVAPLFVLP
                     MDEGTGMWLKEMVGRQCLSLNTKPFTWDSSVAVPVATTNLSAVPLDDRALLSGRVLKS
                     AYRLFVMLPPAEKGSDDLVAEVDRESNRIVRVYQCPRSCSENAYAMLGDESELIVYQQ
                     RFSTFSSVRLFTRRRMEKELALCDPSETCPCAGSVPWLLREIYRCIYTESYELERVLP
                     ENSPLSFCTLSSLAQALRLVKPSTPPLKVLAFMSLTLVHLRRLATLNDTRISDIASSL
                     KASCSTIMELFTEKAFLEVTHKLYRVATAWSLTVEDQTEMLLHMDSGEHADLQWSYFS
                     RERVHTVIRHIVQHRPEDIVSAAKNLLRQCEREAASDPGEPKSATHLMTSFVLAVMTT
                     LHTNATGKSQAYVSQLLELFVDYMFRCKSLFTPARVDEQPNSVLLTGVLPLFVTVANV
                     CPAAVSAVTQEHLLELCDRLRAVQASPEQVVGFSTHEAYDMYVPNKEDTGIWRVCLDF
                     STARSVSLIKEASSPPVFVVQSGAQNGKPDNTVMDESNSFKKLDGGVLHIHGRGDNSF
                     TAIVQYEFALDVSLASVMREAILRVLLAAAAELMQKPPTSCEIVIAPLFRYGLTTSVL
                     AAHNVDTHGVPHENLFDFPLRVLEDRDEGKEFVDEVSRAMRGSILPSMRPAIRALLSI
                     LLHCGLTRGQAEDELKLRWFSGEWSTKLQGTTKTQTIVFLTSLARWMMECVFFEGDGT
                     TPMCGRRTSVRLENSLNGSRSLSERRGSASLRRSVVKLSSQSDSLEQVRVLLAKGITP
                     LMIQEDLISRARAAQNIEKGLQLLSRLLQIDPANLTEHFLTKALRVLYAFTCTDNCQH
                     FTEVLCGAGVDAETAVRRAFHGALHSFVAVLKSSSSMVGYRAALTQKAFQGRALMLFH
                     AILCLPWDEADCEEFKRSFETDNDILKFLESQMGSPTALAALTSPWRLRHEASRPAED
                     VAADQEQTVRTELLGAADFTSLSRVFPNGFSVVIPAIQTARSQFGVVMEKGSGAAVLV
                     RADEGWQLNWKEGVPRVYYYEVTINSPINKFDVGVQLPRTELAVRGEDLFFSYSSLGD
                     VYWGEQAQLPPFTEGDTVGCGIVATSRLLFYTLNGRFLSFAGRVNVPAKANAGSALLY
                     PVISFDDRSMVRVVVNFGTVPFAYDYRQLHPALTIEKGPTWYRITSTAEMVLHYFTAR
                     VCAVQESKSHSARGALKQVCDVVCRHVNSVTSSLMNIGVGGSSNSSPTTRVQQAVALS
                     VAEYSIMVLISTIRHIATHGILLSEYISNMVFDAVSILMLLPLHSVQIATIGLLPDVI
                     VHVKEVPDGKAAGNLVSTLFENANCATDSEDVIPFVPMWCECDASAMAIVNVQNAHML
                     QDAQRSIVLGNVLPRTGMVFFSVKVVRRNMSKGHSLKGGYFIGVSVAGLSPLTPTSNS
                     QSWKAVNPPIVWAIQDTSPQLPHATNPTVKLNNFQRTFGNADVIRVVVDRDKRCIDFY
                     REGEFLKTLFSDIPEDVDLVPFVQLYNDDATAEISAGTMTAPITGPMLLGAASVDVLR
                     SMLTLDPFQCLVAQRLCEELSCQRFPKVTLLIFKSMPDPRLLQLRSSVGEEVTVTVSR
                     LNDLRCKFTLGDKANYEHLYNMRTPAKPRTVCTFDIVLPTSRLTGLSRCIDHLIAAAE
                     RMVMPRITVEALCCTEQDERRKIVREEKDHWDFLFHGLRVGSFITVLRRLPSITAMHA
                     PPIPHDYTFSAALSNPGFVLPSHYCGRLATVPTGAKGVSTPFIAIAEPAIPTGAKVSI
                     RCQLIRGNQGQILGGGYYFGVCTPSFHWKHKDLNVHTGEVWALHDMDDSPWRLRHLRP
                     DATFPVAAEPRCIIVSGDIIRLYIDRTARVMHAFRTPVNGDEIPLGLIFDNLPADGAL
                     YPFVSLFNTDAVAVFLPSNSTAPAIRLPCQKLQYALCTADERKACDGCNANLGDARVS
                     GRWFKCNECADYTLCSNCFLTCVHSNHSFTMMHGSPIAYSTTTPATVERGMEVTIPAT
                     PVMYLRSSGCRMHEAKMNCVAEAVEDNALCAWGLVSQDGSEPFSVVIDTVDGSPLSPD
                     APVLVGIGPAQDIVQSTRDKLRDKCLANIPTIATYCSDPSLRQPLESRSRDPYGFKRG
                     SRITLKYDAAAGRITISRDWVVVGTKSVALKDSENAVQPIGCFVLLGKKGTTVSVFPE
                     RACTLTTTVEEVTGNILKTVGRDGSVWFVTRENCRLPLTPCRGLFQKSSLGYILMDHR
                     LAQCRRHSWDNRLIRVQVLETEEVVSVPLHHYLINESSAISEEWFLCRRDRNEGATVE
                     EGFVMSRLLLILSCLCENESLSHLVSLHQERLLSMTKRLATVDIENDAPVDSLDEIRT
                     SVASTANRRRWALEKRHIAPFVPVLNTDERKRRFHNGTLVHTVDSDDVFEVTSRRGES
                     LTVRNTRSESVSKVSYRNCVPLKQCGGRAWYTRQNGLPCSLYEHTVRLSDPAKASESV
                     PLQDEWLGEIAFARVAKSLTVSFSPHGIGRADIAQGTTEETRLLVVYDHNRYFRVVRL
                     FMRLYSADLECKLQQLVTSSGEGSLAPTRDYQELVDFLNRAAEPVHDRPVVAGQEMYF
                     GMVGLLDAEGLRLKGVFQCHQGKNGTFTLNSCRRFALLSSVSEKWMVEPLPDFLDASI
                     PPAPHRNMRESTHRLVVLLARHLYLVTCSQIERPPADFLDHIFFFTSHPLADTLVCKD
                     AGTHQLSVMLSEVNIRITDPSVKPWDAISLSRLATNSLLLRPEAIHNVREHLLWDCLH
                     GVVTAAHRCGRYHRHEVLRSITAFVQTRLQYTSIYQQLFSTLFSYVEGWVVALPEDRE
                     IKKDVAAGIDLLLALGSPLDEQVRKIPVAPLHCLIDLWRSVTAEVALPRVVDELHLAI
                     DHESPPVDTLCTFGDYVRQELKVGKVTSTCGTAGKGHYYYEVTLPDRITSAYAIGWGT
                     AVHNEVPGQHVGSDRNSFAYNGSDINTRDGKEEYKIPTESIPGAVVGCLLNVEERTAA
                     WSLNGVVGHFISIPISFTTNTPLFAFASIGTCSGMKVRLRANEFEYAPDGYTDLSGRF
                     ARPVVDSYNRDQRSLMDQQPYAFYLHLASFLSDVEDYLDDQAAQSHTSSLSQLPEDPY
                     KLFVHAYPLLQSYPPSTLQRFAQVIAVTESCMATANNFVDLDEETVTGTLSQAFLSMK
                     GLVRRSFRQRLLVNVTPLETVSTAPTIFVRVTDLYSSLPRTTEGALRHSILAQLYRQI
                     GFLTEEQWAVSPLFKVNLHISGSGHAPVDMGGPYRQLWTFLAFELMQHPDKCYPNSDF
                     HRNPLFVFVNNSQRISLVPDSRANSIYDLNLFTFFGKIMGHSARAKTPLDIDFSPFFW
                     KFLVDDELTIKDFYTHVDSVVEATVKDDNFLLSGVADELIPGFAESVEWLDSDDNDEV
                     VAQQRRTIAERCLVHSMDEQLGAIRSGLWKTLSRRVVRCLSWRDLEHLVCGKSNLTPQ
                     DLQRYICVQLTGSREAHFWQIVEQLSMEQRASLICFASGQRRLPLIRPITVAENNESV
                     DYLPRAQACGSLITIPQYTSLEMFREKLLMALQHQMEMELA"
     gene            <1583736..>1585406
                     /locus_tag="LMJF_32_3940"
                     /db_xref="GeneID:5656518"
     mRNA            <1583736..>1585406
                     /locus_tag="LMJF_32_3940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685668.1"
                     /db_xref="GeneID:5656518"
     CDS             1583736..1585406
                     /locus_tag="LMJF_32_3940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685720.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656518"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4M8"
                     /translation="MPARFISRAPSPFILAASRAQSWVDVLRAYSKCCDYLQGVYQPT
                     CVELEHGLSYMPNSQSTSLFYYGLIKASIAPATPDKSLVQAVLRRYKECGSIAALRRV
                     IQEDVNSATLEGARGKLALASTAGLWEAALETLLSHPPLMDNTVQRRVVLSTLCNSDQ
                     WRLALGVLYMEPKVDLHPIMVRPLVRCFGRLHDHRSALRLTAAALAAGHSMSPPLLSA
                     LLPTLQETGKWHLALHAAHELQLLSATRAEARTNVSIYKQLVDCLYEADVYASFSLDD
                     VVQQIVDRMRPRELKERHGQSRAKQLRLHSPVDVFQQFQSVLMALTTVYSKAMGVPRW
                     YSRSIGSVVDSALQENTALLVLDTNFLLQLVKKQLPLEHFYAYMKQQYPNLRRYQFST
                     VVVPFTTVSEAHAHIWGPKEHFPADVRKVLWSRAVSLLQQPNVYVLSIAGEYPCSSLN
                     IIPRLAYRTMPGNVAGAFQRDPDLRILSVCATLQHYLRTAKVTENLGGSTVPEGVALF
                     SLLKYHVRRYCNTVKGCCVDRLLLCTLDKRMSRGAVQMGVQVFPCLSP"
     gene            <1586315..>1589299
                     /locus_tag="LMJF_32_3950"
                     /db_xref="GeneID:5656519"
     mRNA            <1586315..>1589299
                     /locus_tag="LMJF_32_3950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685669.1"
                     /db_xref="GeneID:5656519"
     CDS             1586315..1589299
                     /locus_tag="LMJF_32_3950"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685721.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656519"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4M7"
                     /translation="MSEIDDLVRRLRSLTGYVVATPAPAPTPVAAAPVEKRVSKESLL
                     ILQQSLRRHPCFAVFGLSRAEVECQLLKQLEDAAKAPLSVAGEAPETVIWRVFINNAA
                     EELETERLRGVFKNPSERIRGATKGLVRRLGVAEAPALDQVGSGYACPWNVLTVLENG
                     ILFGGGDAAELEKAQLEVPNATVSILQNTKRVYTNTFDTMAWLHLLHQMMSFPVSSVR
                     AVWHAALYHFPTAAPLVCVYVRLEMAALAKKTRLEACCGETDTKDVYEGCLRLLNTFY
                     RHLPLAFSCELYYLFFSFAAEYVQPDSASLDLLYRTCLRRDVGMLPQSTALWVQYLNW
                     RSASFRDHMRRREWRKQMFNRILSTPLIGLDAVKDEYDVFVATELRGRVAPDERIELE
                     KRLARVKTEADDLSRLMYFFYPTEWAPATSANVPFPYTLYLARPLTVDGPTTSLSLKE
                     SVLSRIEMDLWSLWSTLLQRVCRPLFPGAGGDILHYSRCRNFVTMMACFFPHQATLWM
                     ELVDFCVHQQPLLSDKERFHTVAAAIHLAVAFCRQNVCVRLFVAQVYHADLGATEMAF
                     REVKECLLNLRAWLLSYVRSDEEGAAAEEALEKLQHITVLAVNYMRMGNAQGRAEHVR
                     LVARFVMHHVDFLSLTMGALRKLLKSGAVATPAPFLHPFHRFCAHWILLELVRNRSPR
                     SALLILQQWCEHLKMILCSGKKKGWSCEECGVDELVLDACANILTADPSCGEAVRATL
                     GDLENVAGSDGLQSQNFLYLARQLCHRFFLPCTRLEKDYTSDIMLTAKLLLPHAAPHR
                     YDTVQFRCPLPQRPLFLPGVDKATTPLLEDTVATQAEHHGEGQTPRTPPIHPAHTFPE
                     ETLWSSSAAIRNSSAPGRQRFDPARRGPYPSRFRNGPDGADKELPAVPTALPSRLAIV
                     SEAVQLPTLLDCLASVRGGAGEATAVEGNTATKLPPLDYLEEFIRQLPSVYEYNPDME
                     EDGQEASTDWVFLALLSCEALS"
     gene            <1590116..>1590673
                     /locus_tag="LMJF_32_3960"
                     /db_xref="GeneID:5656520"
     mRNA            <1590116..>1590673
                     /locus_tag="LMJF_32_3960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685670.1"
                     /db_xref="GeneID:5656520"
     CDS             1590116..1590673
                     /locus_tag="LMJF_32_3960"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685722.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656520"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4M6"
                     /translation="MLRQLCIRQAPKVEFISPTPSSPIQNFDLRPIAASLLYRKLLKL
                     YLRKFDTDTNTIIRAWKQTKYEFWVHRNVPKEEADLLNIKGQQVLEAIRAGLVPVYHN
                     SKTNQTYYKYDADTLSAVHNHVDPVSAEEFVRRFHDRMDSRDVEEIKATLKKLGRWTG
                     PDELRKEDLLRVKTKRMVKCTDPDE"
     gene            <1591790..>1593889
                     /locus_tag="LMJF_32_3970"
                     /db_xref="GeneID:5656521"
     mRNA            <1591790..>1593889
                     /locus_tag="LMJF_32_3970"
                     /product="cyclic nucleotide-binding protein-like protein"
                     /transcript_id="XM_001685671.1"
                     /db_xref="GeneID:5656521"
     CDS             1591790..1593889
                     /locus_tag="LMJF_32_3970"
                     /codon_start=1
                     /product="cyclic nucleotide-binding protein-like protein"
                     /protein_id="XP_001685723.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656521"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4M5"
                     /translation="MERRKNSSVFLTGINVSDGRGQDLSEEEDECVGVLVSFRVPPMP
                     HPVVSHRYVSLNHPMASSSSVSRTLLNWEKQMILSRLQKNPCVDTEVFQERLSRMKTR
                     NDRHYIRQVRDRVAEATQAEATARQAAFLRAEERRDSIFYKHQHLVEIKRREQTLTRA
                     RKWSIIVVCHVFLAALMQERRVQEALDTFSFLLAPMIRRFLALRARRREVEELTRRHL
                     RDIPFPFPHVIQSMTGTFFEGWPPALLEKLVEKSKPCYLRSGQYLMHEGDVGRVMFMI
                     TLGTVSIVLRKKGREKRRTKENSSGVLQIKAPCYAGEFALVCKEPRSASIICETDIGY
                     WAVSPEEYEEVAKYLSPAVASKQREATDVRRRQNLKRFFPLHVAFLRNFPYFAQFSDK
                     SLTQLIDSVEPIVLHDGDYLFREGEIDSSTYFVQDGEAVLRDREGADRKVLKGSCIGV
                     FECSCGVNESKRSSIVSVNYCDIWRLSRDVLIEIGMSEPAALLHCRDAAKKDRALEMH
                     KDKGALQCFRKDPYMSFCCPRSTLTHLFEASTPTVFLNGERLALMGKTLNALSVVMSG
                     VLDITMSRNEQHITMRVHVTASCVSDAATRNASAPFRGLSRVIGAYEFASSLSQYACT
                     VTSVGLTEAFVIERAQLDMQVPAALRVLMHDSVRSRECVSRAYKQENAGLLYNDEALS
                     FSRLYRELRSLEGETRK"
     gene            <1595184..>1595780
                     /locus_tag="LMJF_32_3980"
                     /db_xref="GeneID:5656522"
     mRNA            <1595184..>1595780
                     /locus_tag="LMJF_32_3980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685672.1"
                     /db_xref="GeneID:5656522"
     CDS             1595184..1595780
                     /locus_tag="LMJF_32_3980"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685724.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.32.3980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.32.3980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5656522"
                     /db_xref="GOA:Q4Q4M4"
                     /db_xref="InterPro:IPR007504"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4M4"
                     /translation="MADATLVLPIRQISEAPVAVVSAVSAASRSCVAEAVPQTLPMDV
                     GTRLCLADGTFVGYVSSVLGPVKQAFYVVTSTRDDVHKLIGDHRLAEGVALHYDLHHQ
                     QIMYDPFEQCDAAKGTDASYINDEELPEYVRPDFSDDEKELEWKRQKRRRGDDNESIS
                     SDEMQEEIEWSKLQLDEDAVPCGGPHVVVPQWIQSAPR"
     gene            <1601292..>1603091
                     /gene="LPG1G"
                     /locus_tag="LMJF_32_3990"
                     /db_xref="GeneID:5656523"
     mRNA            <1601292..>1603091
                     /gene="LPG1G"
                     /locus_tag="LMJF_32_3990"
                     /product="putative GIPL galf transferase"
                     /transcript_id="XM_001685673.1"
                     /db_xref="GeneID:5656523"
     CDS             1601292..1603091
                     /gene="LPG1G"
                     /locus_tag="LMJF_32_3990"
                     /EC_number="2.4.1.-"
                     /codon_start=1
                     /product="putative GIPL galf transferase"
                     /protein_id="XP_001685725.1"
                     /db_xref="GeneID:5656523"
                     /db_xref="GOA:Q4QD44"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q4QD44"
                     /translation="MRKSTSVYTLRSHRCFITLRAVIPILIFICLCGAVGTIFLTSSH
                     QSALGWTREPTTSAPSGELTTTEPGEPRRSMTPTSAITTSAPATATTAEQTPLPPEQT
                     SMFDAPGTPTPAVSAASARATGAQDSSTLMEGAKTETTKQNLAMKGLDRWMKMQLPAD
                     WMECIRQNLQLDKHGQPMHAVTEMKDAIPLLITPLTGDVKFFPYFVCSMDVAVRYHYV
                     IQNERDPDTTAVIDDLQRRFGNSGRLLVVRNRYNRGYSGSMNQAFEWALKERTAEEVP
                     WVFACGVDAIFEPGLLAKMIEVVQQNTRGDAAMLAALRAEVELEERLVREGNYSYYER
                     WAPRGRPLKVLRSGYPGVPLNVRTAPLLPDRIRYTVADENRESGIVRPAELRTRFFGN
                     YVATVTPVPDALGTIAVTRLALSAVGYFDENYFPAYMDDIDLRWRHFAYGFGALHGER
                     NGPVTRWHHYNAANLRGSPFVDPDLEKYGTEDNYSRRAFLSYIRRSKGIYDKLKYGPR
                     DMDGVWRQAAQKAEFKYSSFNVSHYPADTWVLDEDARGCMFHHTYNYKTQNWSRPSDC
                     SYNPRTLEESGILGVDQLASYRSMLAEKAFAYQ"
CONTIG      join(FR796428.1:1..1604637)
//
DBGET integrated database retrieval system