GenomeNet

Database: RefSeq
Entry: NC_007284
LinkDB: NC_007284
Original site: NC_007284 
LOCUS       NC_007284            2090474 bp    DNA     linear   CON 18-JUN-2017
DEFINITION  Leishmania major strain Friedlin complete genome, chromosome 35.
ACCESSION   NC_007284 CP000081
VERSION     NC_007284.2
DBLINK      BioProject: PRJNA15564
            BioSample: SAMEA3138173
            Assembly: GCF_000002725.2
KEYWORDS    RefSeq; complete genome.
SOURCE      Leishmania major strain Friedlin
  ORGANISM  Leishmania major strain Friedlin
            Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae;
            Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Rogers,M.B., Hilley,J.D., Dickens,N.J., Wilkes,J., Bates,P.A.,
            Depledge,D.P., Harris,D., Her,Y., Herzyk,P., Imamura,H., Otto,T.D.,
            Sanders,M., Seeger,K., Dujardin,J.C., Berriman,M., Smith,D.F.,
            Hertz-Fowler,C. and Mottram,J.C.
  TITLE     Chromosome and gene copy number variation allow major structural
            change between species and strains of Leishmania
  JOURNAL   Genome Res. 21 (12), 2129-2142 (2011)
   PUBMED   22038252
REFERENCE   2
  AUTHORS   Ivens,A.C., Peacock,C.S., Worthey,E.A., Murphy,L., Aggarwal,G.,
            Berriman,M., Sisk,E., Rajandream,M.A., Adlem,E., Aert,R.,
            Anupama,A., Apostolou,Z., Attipoe,P., Bason,N., Bauser,C., Beck,A.,
            Beverley,S.M., Bianchettin,G., Borzym,K., Bothe,G., Bruschi,C.V.,
            Collins,M., Cadag,E., Ciarloni,L., Clayton,C., Coulson,R.M.,
            Cronin,A., Cruz,A.K., Davies,R.M., De Gaudenzi,J., Dobson,D.E.,
            Duesterhoeft,A., Fazelina,G., Fosker,N., Frasch,A.C., Fraser,A.,
            Fuchs,M., Gabel,C., Goble,A., Goffeau,A., Harris,D.,
            Hertz-Fowler,C., Hilbert,H., Horn,D., Huang,Y., Klages,S.,
            Knights,A., Kube,M., Larke,N., Litvin,L., Lord,A., Louie,T.,
            Marra,M., Masuy,D., Matthews,K., Michaeli,S., Mottram,J.C.,
            Muller-Auer,S., Munden,H., Nelson,S., Norbertczak,H., Oliver,K.,
            O'neil,S., Pentony,M., Pohl,T.M., Price,C., Purnelle,B.,
            Quail,M.A., Rabbinowitsch,E., Reinhardt,R., Rieger,M., Rinta,J.,
            Robben,J., Robertson,L., Ruiz,J.C., Rutter,S., Saunders,D.,
            Schafer,M., Schein,J., Schwartz,D.C., Seeger,K., Seyler,A.,
            Sharp,S., Shin,H., Sivam,D., Squares,R., Squares,S., Tosato,V.,
            Vogt,C., Volckaert,G., Wambutt,R., Warren,T., Wedler,H.,
            Woodward,J., Zhou,S., Zimmermann,W., Smith,D.F., Blackwell,J.M.,
            Stuart,K.D., Barrell,B. and Myler,P.J.
  TITLE     The genome of the kinetoplastid parasite, Leishmania major
  JOURNAL   Science 309 (5733), 436-442 (2005)
   PUBMED   16020728
REFERENCE   3  (bases 1 to 2090474)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 2090474)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR796431.
            On Jun 1, 2012 this sequence version replaced NC_007284.1.
            Data release policy www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2090474
                     /organism="Leishmania major strain Friedlin"
                     /mol_type="genomic DNA"
                     /strain="Friedlin"
                     /db_xref="taxon:347515"
                     /chromosome="35"
     gene            complement(<3485..>5935)
                     /gene="SCG7"
                     /locus_tag="LMJF_35_0010"
                     /db_xref="GeneID:12980691"
     mRNA            complement(<3485..>5935)
                     /gene="SCG7"
                     /locus_tag="LMJF_35_0010"
                     /product="phosphoglycan beta 1,3 galactosyltransferase 7"
                     /transcript_id="XM_003722350.1"
                     /db_xref="GeneID:12980691"
     CDS             complement(3485..5935)
                     /gene="SCG7"
                     /locus_tag="LMJF_35_0010"
                     /note="previous protein_id=AAZ14230.1"
                     /codon_start=1
                     /product="phosphoglycan beta 1,3 galactosyltransferase 7"
                     /protein_id="XP_003722398.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980691"
                     /db_xref="GOA:E9AEH8"
                     /db_xref="InterPro:IPR002659"
                     /db_xref="UniProtKB/TrEMBL:E9AEH8"
                     /translation="MREENNVPAEWAPRDTHRLDPLQLLPSSQRHCGQSSAAGSGQGC
                     HSRSRGKPEVHSTRGSSGGKRSTGTLSRSDDCLNAVARTPLFNSCGHPRRSAAQCLCS
                     QIPKRVLAALAVLLALIVTVHWAINQFTTNVGSQQKSSIELLNEANREYESSSPFSVL
                     VQHERAVERLTTAQRGLAASGAGSLARLDRDQLPSWTLRVIDEDCTMCFDNVTYASAV
                     AADAGRSTNKTGHHKQKGLSVFATTSAPLGLMGPMLFAMASVTNDVDVAAELPRWQWV
                     TWSYAQQRRFVHASQSRSTGERPRHLIVVGIPSTDQPMRYPLRDAQRATWLTYREVAR
                     TENNFTGALLQLYVFAAAHRDSDYTAQYLGDTAQLAPTVSEYAAATEQHVAVEGGDVD
                     NAPPYLQRRVVLRDGWRDIPRSDDAVWKSPCAGVRTTVVTAASLVAGTSSLAALSAQL
                     SLPVTPAFTAAAQYVCHASAALWQEALHHRNSLWLDFLTDRKPTTNKKMGDAASWGVP
                     TEVGMTQKVVLWLNYAYTAFPDVPYIMKGDDDTYLKVPQYLSDLRHVRGGWQKPRNLT
                     ATLPHRGVVPPTLAIDDAEECLYRVWWWYDNHNVVFGHGPGYALDRRLIKAVLNPFDI
                     TNQRLLMLLTVPYTLVYHGHYLSLLMQYEDLFVGRQLQSLSARVKEVCMKRPLRYVSD
                     REPRSVQVLRPAPSSQTWTWSSVLMHYAMPEIPYFIHYYFKHEFKVAEAAKGALAQGI
                     NASAIDANATEEMKKWVASQVPTVLTGLKRVENVSWVRGAPRTAYVVAEGDGVAVYDI
                     AYRRRKTMLIECAIESGK"
     gene            complement(7814..8087)
                     /locus_tag="LMJF_35_0015"
                     /pseudo
                     /db_xref="GeneID:12980789"
     misc_feature    complement(7814..8087)
                     /locus_tag="LMJF_35_0015"
                     /pseudo
                     /db_xref="GeneID:12980789"
     gene            complement(<8344..>9918)
                     /locus_tag="LMJF_35_0020"
                     /db_xref="GeneID:12982186"
     mRNA            complement(<8344..>9918)
                     /locus_tag="LMJF_35_0020"
                     /product="pyruvate kinase"
                     /transcript_id="XM_003722351.1"
                     /db_xref="GeneID:12982186"
     CDS             complement(8344..9918)
                     /locus_tag="LMJF_35_0020"
                     /EC_number="2.7.1.40"
                     /note="previous protein_id=AAZ14231.1"
                     /codon_start=1
                     /product="pyruvate kinase"
                     /protein_id="XP_003722399.1"
                     /db_xref="GeneID:12982186"
                     /db_xref="GOA:E9AEH9"
                     /db_xref="InterPro:IPR001697"
                     /db_xref="InterPro:IPR011037"
                     /db_xref="InterPro:IPR015793"
                     /db_xref="InterPro:IPR015794"
                     /db_xref="InterPro:IPR015795"
                     /db_xref="InterPro:IPR015806"
                     /db_xref="InterPro:IPR015813"
                     /db_xref="InterPro:IPR018209"
                     /db_xref="UniProtKB/TrEMBL:E9AEH9"
                     /translation="MSVARMNFSHGSHEYHQTTINNVRQAAAELGVNIAIALDTKGPE
                     IRTGQFVGGEAVMERGATCYVTTDPAFADKGTKDKFYIDYQNLSKVVRPGSYIYIDDG
                     ILILHVQSHEDEQTLKCTVTNAHTISDRCGVNLPGCDVDLPAVSAKDCADLQFGVEQG
                     VDMIFASFIRSAEQVGDVRKALGAKGHDIMIICKIENHQGVQNIDSIIEESDGIMVAR
                     GDLGVEIPAEKVVVAQKILISKCNVAGKPVICATQMLESMTYNPRPTRAEVSDVANAV
                     FNGADCVMLSGETAKGKYPNEVVQYMARICLEAQSAVNEYVFFNSIKKLQPIPMSAEE
                     AVCSSAVNSVYETKAKVMVVLSNTGRSARLVAKYRPNCPIVCVTTRLQTCRQLNITQG
                     VESVFFDAEKLGHDEGKEQRVAMGVGFAKSKGYEQSGAVVFMIDIFQSKGIDVMRSTI
                     IVGKGRFGGHSISPSLSESLLPMLYSIALPLFIPGYRDGICGAYRPAQGCQQPATHTK
                     GFRTECCSQQKKVSLS"
     gene            complement(<11915..>13414)
                     /locus_tag="LMJF_35_0030"
                     /db_xref="GeneID:12982187"
     mRNA            complement(<11915..>13414)
                     /locus_tag="LMJF_35_0030"
                     /product="pyruvate kinase"
                     /transcript_id="XM_003722352.1"
                     /db_xref="GeneID:12982187"
     CDS             complement(11915..13414)
                     /locus_tag="LMJF_35_0030"
                     /EC_number="2.7.1.40"
                     /note="previous protein_id=AAZ14232.1"
                     /codon_start=1
                     /product="pyruvate kinase"
                     /protein_id="XP_003722400.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982187"
                     /db_xref="GOA:E9AEI0"
                     /db_xref="InterPro:IPR001697"
                     /db_xref="InterPro:IPR011037"
                     /db_xref="InterPro:IPR015793"
                     /db_xref="InterPro:IPR015794"
                     /db_xref="InterPro:IPR015795"
                     /db_xref="InterPro:IPR015806"
                     /db_xref="InterPro:IPR015813"
                     /db_xref="InterPro:IPR018209"
                     /db_xref="UniProtKB/TrEMBL:E9AEI0"
                     /translation="MSQLAHNLTLSIFEPVANHRATRIVCTIGPSTQSVEALKGLIQS
                     GMSVARMNFSHGSHEYHQTTINNVRQAAAELGVNIAIALDTKGPEIRTGQFVGGEAVM
                     ERGATCYVTTDPAFADKGTKDKFYIDYQNLSKVVRPGSYIYIDDGILILHVQSHEDEQ
                     TLKCTVTNAHTISDRRGVNLPGCDVDLPAVSAKDCADLQFGVEQGVDMIFASFIRSAE
                     QVGDVRKALGAKGHDIMIICKIENHQGVQNIDSIIEESDGIMVARGDLGVEIPAEKVV
                     VAQKILISKCNVAGKPVICATQMLESMTYNPRPTRAEVSDVANAVFNGADCVMLSGET
                     AKGKYPNEVVQYMARICLEAQSAVNEYVFFNSIKKLQPIPMSAEEAVCSSAVNSVYET
                     KAKVMVVLSNTGRSARLVAKYRPNCPIVCVTTRLQTCRQLNITQGVESVFFDAEKLGH
                     DEGKEQRVAMGVGFAKSKGYVQTGDYSVVIHADHKVKGYANQTRILLVE"
     gene            complement(<14132..>16321)
                     /locus_tag="LMJF_35_0040"
                     /db_xref="GeneID:12982188"
     mRNA            complement(<14132..>16321)
                     /locus_tag="LMJF_35_0040"
                     /product="phosphatidylinositol-specific phospholipase-like
                     protein"
                     /transcript_id="XM_003722353.1"
                     /db_xref="GeneID:12982188"
     CDS             complement(14132..16321)
                     /locus_tag="LMJF_35_0040"
                     /note="previous protein_id=AAZ14233.1"
                     /codon_start=1
                     /product="phosphatidylinositol-specific phospholipase-like
                     protein"
                     /protein_id="XP_003722401.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982188"
                     /db_xref="GOA:E9AEI1"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000909"
                     /db_xref="InterPro:IPR001192"
                     /db_xref="InterPro:IPR001711"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR017946"
                     /db_xref="UniProtKB/TrEMBL:E9AEI1"
                     /translation="MSLTLTEVNSWDSSLERKCTELADELKEKGVSLLRVTRSYKVKK
                     VLISFSPLGDGLQYQPASKHHSSLLFADMWAIQSLPPSHKICSKAGLKHFQYCFQVES
                     QFGWSWNLVCNTALERSTWVDFLEQHRRTFLDKSRANAANASVERYWFIAAQQGKTKL
                     SFTEISMLTNKLFGRVPAAELADRFRQCDSDKDTCLNYQEFCEFFRYFNEAKAVRSIY
                     ERHTSECAPGMTAEEFTRFCISNDAAATVTPMRCASLFHLFANRQSDRMALSGFTAFL
                     LHPHHNSIVDARQLRLTDSMDHPLPHYFINSSHNTYLTGNQLNSESSCNMYRDVLLAG
                     CRCVEIDCWDGPAGVPVVYHGHTMTTKIAFDDVVRTINDYAFQNPSNNQEAAWNPREL
                     PVIVSLEVHTSPEQTNRMAEIIRSVFKERLFLSRLDASSYTPAKLKGKILVKWKMNAA
                     GVEDLKDTAGSGIRADRRAPLLTTLSLSACASIGTVRSTSWGAEEQPFHVQSYVEGEV
                     ARLEACSPVDFARQNTHMLSRIYPSGTRIDSSNYDPMLMWRLGCQLVALNWQTRDHNF
                     RVNEGFFTHQNGGCGYVLKPMYLRDVDAGCSAVPFTLALRLICGSHLSTTFDGADATH
                     VTLRLRVHGEAWSHETIAVPTTIYPEWNESMELQGKCKETAVLCLCVVAHTRSGATHD
                     VCTACLPVRVLRTGYHAMPLRHVKSGRTAEVASVLCHFSFKTPTLFS"
     gene            complement(<17610..>18710)
                     /locus_tag="LMJF_35_0050"
                     /db_xref="GeneID:12982189"
     mRNA            complement(<17610..>18710)
                     /locus_tag="LMJF_35_0050"
                     /product="putative 2-oxoisovalerate dehydrogenase beta
                     subunit, mitochondrial precursor"
                     /transcript_id="XM_003722354.1"
                     /db_xref="GeneID:12982189"
     CDS             complement(17610..18710)
                     /locus_tag="LMJF_35_0050"
                     /EC_number="1.2.4.4"
                     /note="previous protein_id=AAZ14234.1"
                     /codon_start=1
                     /product="putative 2-oxoisovalerate dehydrogenase beta
                     subunit, mitochondrial precursor"
                     /protein_id="XP_003722402.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982189"
                     /db_xref="GOA:E9AEI2"
                     /db_xref="InterPro:IPR005475"
                     /db_xref="InterPro:IPR005476"
                     /db_xref="InterPro:IPR009014"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:E9AEI2"
                     /translation="MRRLFDASATAVVAASSAAAKRHGSVQPSEFVFAPAPGEEEAMR
                     NGVKMNLFQAVNSGLDHALSKERTVLLGEDVAFGGVFRCTLDLRKKHGPQKVFDSPLT
                     EQGIVGFAVGMAAVGWHPIAEVQFADYIFPAFDQIVNEAAKYRFRTGSNFHCGMLIRA
                     PCSAVGHGGIYHSQSVEGYFTHCPGLKIVMPSSPSEAKGLLLKCVEENDPCIFFEPKI
                     LYRSAVEEVNPDYYTLPLGKGRILVEGRDVTMVTYGSQVYVAAKAAEMARKEGISVEL
                     IDLRSLLPWDRQLVADSVKKTGKVIVTHEAPKTSGYGAELVSSITEDCFLSLEAPPTR
                     VCGLDTPFPLHERLYLPNELKLLDAIKSVVHF"
     gene            complement(<21207..>23219)
                     /locus_tag="LMJF_35_0060"
                     /db_xref="GeneID:12982190"
     mRNA            complement(<21207..>23219)
                     /locus_tag="LMJF_35_0060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722355.1"
                     /db_xref="GeneID:12982190"
     CDS             complement(21207..23219)
                     /locus_tag="LMJF_35_0060"
                     /note="previous protein_id=AAZ14235.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722403.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982190"
                     /db_xref="UniProtKB/TrEMBL:E9AEI3"
                     /translation="MQAKEVWGVLLRAAECAARQASSGAEAAVEDTVADELVPYPHLS
                     SEETTFVRNCAFNLSRFAALCEGAFQGYRDCYKRNSTYRPSMYLVAYLLIFQYRALGG
                     ATVREMFEGSMPKPRLCEFVEFLLFSESVSRYAVPLWRAVYDDSFIQHHVLAPLSSVA
                     EDATHDVLEWFRRQPSQSATAVACPAAEEAAALGTTHRTFRPSSTAVASRPLAGARLP
                     PHEVREMVFTVPEPRLPRIKTSPAPANAPLKRAPTTPVGFSFHQREAAVSAAHSEKAA
                     ERLTSADQDTAHEGARLSPAQLRTMLSTSKSVPTTVAALWRERRVRERQRDNTERTLR
                     ELEVTVHDSTEFDLWRQAQLEQEERRRQMEVLQRHLRAIEASDRARVQRERTTQAHRR
                     QIQRMKVQYQADVQAHKREQEHALSEHEQHAQQLRSELSRNCAAAVERVAAEKSALAA
                     QVKHESKQLRVAAEEAEEHRRTNQVLVIQEIHLLRERLREKHAAMGAERRRAWADGEA
                     DAALGRMSQAELRDALERLREEVAADEDSRRQWVAEVRSRTREKHERLERECIRGREK
                     QRRIRQANLTQRMAHRAAVEAERIQVERARMAQFHEKLEIRLQAKRDAHRAAHEAERQ
                     RRNEVLLRAQDGASMERKRWTQYEAGLVRRAEGEQLRVLKEAQHFA"
     gene            complement(<24170..>25048)
                     /locus_tag="LMJF_35_0070"
                     /db_xref="GeneID:12982191"
     mRNA            complement(<24170..>25048)
                     /locus_tag="LMJF_35_0070"
                     /product="putative prohibitin"
                     /transcript_id="XM_003722356.1"
                     /db_xref="GeneID:12982191"
     CDS             complement(24170..25048)
                     /locus_tag="LMJF_35_0070"
                     /note="previous protein_id=AAZ14236.1"
                     /codon_start=1
                     /product="putative prohibitin"
                     /protein_id="XP_003722404.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982191"
                     /db_xref="GOA:E9AEI4"
                     /db_xref="InterPro:IPR000163"
                     /db_xref="InterPro:IPR001107"
                     /db_xref="UniProtKB/TrEMBL:E9AEI4"
                     /translation="MAAEARKKMNAYGGFGNIIGMSALVGVGCVSIYALYKSVFFVPG
                     GFRAVKFNCITGLYNRTYGEGANFAIPFLETPVVFDIRNKPIEVPTASGSRDLQTVNM
                     AVRVLYQPNVENLYHIYRHIGVNYAETVLPSLINEIIRAVIAQFNASDLLIKRPEVSH
                     RIGVMLAERAKRFNIDITDVSITQMSFGKEYTNAVEAKQVAQQMAERAKFRVEQAEQE
                     KQAAILLAQGEAEAATLVGNAVKRNPAFLELRGLEAARTIAKTLRDHGNGRYYLDSDS
                     LYVNVKDLKIDHSGTK"
     gene            complement(<26086..>27825)
                     /gene="HKT1"
                     /locus_tag="LMJF_35_0080"
                     /db_xref="GeneID:12982192"
     mRNA            complement(<26086..>27825)
                     /gene="HKT1"
                     /locus_tag="LMJF_35_0080"
                     /product="Trk system potassium uptake protein"
                     /transcript_id="XM_003722357.1"
                     /db_xref="GeneID:12982192"
     CDS             complement(26086..27825)
                     /gene="HKT1"
                     /locus_tag="LMJF_35_0080"
                     /note="previous protein_id=AAZ14237.1"
                     /codon_start=1
                     /product="Trk system potassium uptake protein"
                     /protein_id="XP_003722405.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982192"
                     /db_xref="GOA:E9AEI5"
                     /db_xref="InterPro:IPR003445"
                     /db_xref="UniProtKB/TrEMBL:E9AEI5"
                     /translation="MPSGVNVPATLHRQVLPFEGGEQPPLTPLPTAPRDDYSRTSQLL
                     FEVPVLLPLTADQRHLIKQLDFFKKWYLFCHFVYICTWILIGFLGLLAMVPHLATVDA
                     FFVAVSSVCNCGLQSVDVGEWSAGATLFRHFLLLPGGVVITSSFQPLLRLFMLHRVRH
                     VFYPEEKDTPQEALLRTKKRAEARRLHYAALVSAITPFVYFVVVNGALMTLLWDLNVS
                     HLSAFDVFCMTLASFHSSIFLPMEAYARDAAVTGLVTAACALGFTAFPVLLRFFMLCE
                     WCLLWAVRRLTGLLCRCVELCRSPLDDTSDGEERSASETEDISAALLHAPSHHSYSLL
                     RCLDNMDAAFREAMSSKEPGTFHPFLFRPSETVFLGFAWCALTLMQAAPFWYEQWDGV
                     LHGHTWQYKIYLSLCQAAVVRFAAASFVPLLEYSNAHVAVTILAMYLPALPISTDRTY
                     RKWRQMFRTSVVRLLTSRLFWLFTGMVLILFAEEAEMRAQLLKSRFDIMTRTLFEVIS
                     AYAGCGLSLSLPDSNVSFVGCTDSFCKLIIAAVILGGRHRFVDLGIDLGFSSLQSDVD
                     ATSSSERISSSQM"
     gene            complement(<28795..>29643)
                     /locus_tag="LMJF_35_0090"
                     /db_xref="GeneID:12980707"
     mRNA            complement(<28795..>29643)
                     /locus_tag="LMJF_35_0090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722358.1"
                     /db_xref="GeneID:12980707"
     CDS             complement(28795..29643)
                     /locus_tag="LMJF_35_0090"
                     /note="previous protein_id=AAZ14238.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722406.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980707"
                     /db_xref="UniProtKB/TrEMBL:E9AEI6"
                     /translation="MPLAEESARHRVRKLAGMGKYELAEALLQSDCAQSEVALSAAAT
                     QLERDGAHQWNALQRAEGQCLLQQRRAASQEKRVHFERLLRSQAERRRADEEELARFA
                     ASETVKLQTMRIAVPREVLVLKQQETELRWESRFSEAAKRRRDAARLERELLGAYLSS
                     RGSLLEHRITRQAAALLKRETIALEKDDASVAALQAKHTGHRRCTVAQLRHIKDGMLA
                     AQRRAHRHLQETHARDGMLSATHTRAQRGTALEKRVYGDAYRLPSLCELYGSLMKDRP
                     STSPAV"
     gene            complement(<30776..>31384)
                     /locus_tag="LMJF_35_0100"
                     /db_xref="GeneID:12982193"
     mRNA            complement(<30776..>31384)
                     /locus_tag="LMJF_35_0100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722359.1"
                     /db_xref="GeneID:12982193"
     CDS             complement(30776..31384)
                     /locus_tag="LMJF_35_0100"
                     /note="previous protein_id=AAZ14239.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722407.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982193"
                     /db_xref="GOA:E9AEI7"
                     /db_xref="InterPro:IPR003197"
                     /db_xref="UniProtKB/TrEMBL:E9AEI7"
                     /translation="MMKPTSPNFMAQGIWAGFRYYIGHFFYPNMYREFLSVQNAHKVE
                     RALRLQKAIKANKIDYRALLALPVTDHAHPYKMEYPWEKVMQSDARDLGFYGKWYASK
                     MMCFYEGLQFHKWGCLQDDLINAHGWWNRAARTRAPKDKVVHGDRRVMRARVLKDKYI
                     YEPKDRWVHPVDNVAYFGPYVMMVADEWEEKWGFFAGQEVEY"
     gene            complement(<32266..>32820)
                     /locus_tag="LMJF_35_0110"
                     /db_xref="GeneID:12982194"
     mRNA            complement(<32266..>32820)
                     /locus_tag="LMJF_35_0110"
                     /product="putative coatomer zeta subunit"
                     /transcript_id="XM_003722360.1"
                     /db_xref="GeneID:12982194"
     CDS             complement(32266..32820)
                     /locus_tag="LMJF_35_0110"
                     /note="previous protein_id=AAZ14240.1"
                     /codon_start=1
                     /product="putative coatomer zeta subunit"
                     /protein_id="XP_003722408.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982194"
                     /db_xref="GOA:E9AEI8"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="UniProtKB/TrEMBL:E9AEI8"
                     /translation="MAFLHRVQAVVALDNTGSRIFAKYFIGEDTPESSKALAPFEKQR
                     SLEHAVFQAIHDPRRGNHVVYESEILVVEGHIALFHISEDVTIIVIGAGSENEVVLSN
                     VLMGLVDALRQELNTPSLTARLLLENYCALLMTIDEMLDEGIILETDSATVANDLEPY
                     LVDVSNDTARAALTGVNKYLRDNL"
     gene            complement(<33584..>34930)
                     /locus_tag="LMJF_35_0120"
                     /db_xref="GeneID:12982195"
     mRNA            complement(<33584..>34930)
                     /locus_tag="LMJF_35_0120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722361.1"
                     /db_xref="GeneID:12982195"
     CDS             complement(33584..34930)
                     /locus_tag="LMJF_35_0120"
                     /note="previous protein_id=AAZ14241.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722409.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982195"
                     /db_xref="GOA:E9AEI9"
                     /db_xref="InterPro:IPR006876"
                     /db_xref="UniProtKB/TrEMBL:E9AEI9"
                     /translation="MFIVDWIAAGVVAVLVLFLAVYVVCRYSAEEEDGDAWLPRVLVI
                     VTLCVACYMVLLLPLEVALRGDRPSFDFTWAWKGLLIAAYSLLFVGGPFAFVFYESWS
                     PTQSSVWTQVRPSLAVVVATNAMFAAAFGALWLWGDHLDTKDGTLTHVPAFVYFVTTT
                     SSFGWCFFFIFAGVGLAAVPLRAVAAFFNRPRPITKAEYELARAKLNMEVQHLLDAGR
                     RLDAQVGAGRPNQKQRQKMLLFRREVRDVERQSERNETAYHLSGAYILRCYMAAAMGV
                     VNGVVTVLWVLHILLSNILNVFPLMDRMICFLNGLLPMLATLVYAYCAMYLMWCTVVG
                     CRSVSGHVLILPVYPLRVRETMLNALLFNSLLLLCSAFAVLHLCVVSFSTYAASTFLH
                     NVFVVTLPHMFGVKYVAQGLQYALLAVFALSIPWLTVCPRCMTGAASDEDEDDGFV"
     gene            complement(<35625..>36185)
                     /gene="ARL2"
                     /locus_tag="LMJF_35_0130"
                     /db_xref="GeneID:12982196"
     mRNA            complement(<35625..>36185)
                     /gene="ARL2"
                     /locus_tag="LMJF_35_0130"
                     /product="putative ADP-ribosylation factor-like 2, arl2"
                     /transcript_id="XM_003722362.1"
                     /db_xref="GeneID:12982196"
     CDS             complement(35625..36185)
                     /gene="ARL2"
                     /locus_tag="LMJF_35_0130"
                     /note="previous protein_id=AAZ14242.1"
                     /codon_start=1
                     /product="putative ADP-ribosylation factor-like 2, arl2"
                     /protein_id="XP_003722410.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982196"
                     /db_xref="GOA:E9AEJ0"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9AEJ0"
                     /translation="MGLLSIIKKTKRKEREMRILMLGLDNAGKTTCVKKLCGKDTSLI
                     SPTLGFQITALTFRGCTLNVWDVGGQQSLRSYWRNYFESTDGLVWVVDSNDVERLLMC
                     KEELHHLLQEERLAGASLLVFLNKIDIPTALSPQEIAGLLDVDTIRQGKRHVHLCACS
                     ARTGEGLLDGISWMVDDVSKRMYFSS"
     gene            complement(<37048..>37407)
                     /locus_tag="LMJF_35_0140"
                     /db_xref="GeneID:12980698"
     mRNA            complement(<37048..>37407)
                     /locus_tag="LMJF_35_0140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722363.1"
                     /db_xref="GeneID:12980698"
     CDS             complement(37048..37407)
                     /locus_tag="LMJF_35_0140"
                     /note="previous protein_id=AAZ14243.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722411.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980698"
                     /db_xref="UniProtKB/TrEMBL:E9AEJ1"
                     /translation="MLRRSLLRCQVNRAPARPGPTLYGWGRTEQKRRLEYEATESKYH
                     KRDFNKSWDVAGVEQRYSDFMQVRTYFSIGSRWGTWLYNMIQFYVLSMLPIFAFMHFL
                     HKSIEAYDDSIRKAAWW"
     gene            complement(<38067..>38939)
                     /locus_tag="LMJF_35_0150"
                     /db_xref="GeneID:12982197"
     mRNA            complement(<38067..>38939)
                     /locus_tag="LMJF_35_0150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722364.1"
                     /db_xref="GeneID:12982197"
     CDS             complement(38067..38939)
                     /locus_tag="LMJF_35_0150"
                     /note="previous protein_id=AAZ14244.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722412.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982197"
                     /db_xref="GOA:E9AEJ2"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:E9AEJ2"
                     /translation="MSSVLTGALAYGSSVFTIVALYPYRDFVKSADLRHLPCAKDLGD
                     YCAKRYRGMLGSLSQPMLLAAPHAALYFGYVFATGGAAGAFLGGLLFGYTKTFVRTVA
                     HRMNGGGFRYSKPVQRGYSGLLDCIVLNAKQYGVLSFFPGALAASAVGVIWYGISLAV
                     LQQTYSRSFGEDLWNAFRVHALLTFLTAPVRNTMRSSMYPSERSGGIHAVRDYVATEA
                     AVFREAGGVFLSMARDEGLRFFFNGTLRTTFKSSVPFAVTYALFKAIGGSIGLPTGGA
                     YRGGRTGRPFSRRF"
     gene            complement(<39761..>40597)
                     /locus_tag="LMJF_35_0160"
                     /db_xref="GeneID:12982198"
     mRNA            complement(<39761..>40597)
                     /locus_tag="LMJF_35_0160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722365.1"
                     /db_xref="GeneID:12982198"
     CDS             complement(39761..40597)
                     /locus_tag="LMJF_35_0160"
                     /note="previous protein_id=AAZ14245.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722413.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982198"
                     /db_xref="UniProtKB/TrEMBL:E9AEJ3"
                     /translation="MALLAQLHKHDRAYYDQFAKNSTVQRFVPAWAVRTSQEGHIPTR
                     FTLPLPSHFINTGESAADFEPRAFFLEKALPADMSIDGKVPAFPRCGRSGLFFAREEV
                     VDNLQAAAADLKFSSPFWLHKHHPGLESGYLRLKEGNEAIVISLTASIIGFGDVETVE
                     AAKLHPSLRKAIKSDVNSASGFSVSDEIPLGMNALTGAVTKNPFVCSLPNRGLWLSQE
                     QLLHHNIRLSQHIQQAARAFTLVEIDQWELFNADQLQVPGRLGLRQSLNLAPNETVFQ
                     PV"
     gene            complement(<41207..>42205)
                     /locus_tag="LMJF_35_0170"
                     /db_xref="GeneID:12982199"
     mRNA            complement(<41207..>42205)
                     /locus_tag="LMJF_35_0170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722366.1"
                     /db_xref="GeneID:12982199"
     CDS             complement(41207..42205)
                     /locus_tag="LMJF_35_0170"
                     /note="previous protein_id=AAZ14246.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722414.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982199"
                     /db_xref="UniProtKB/TrEMBL:E9AEJ4"
                     /translation="MNGLNYATKCDELDGLLKRYCDHKKRQAKSLQERLKEEVSTNVE
                     LRKYIAFLEGKLQAEGENAKQLARSLDDRKRDVNATLMGRERHLHSLAAELESRLRMV
                     EQRERECAEFSTALEERDQHHWADVKSFQRSKALFEAGLAASKKTVRAERQHSRYTED
                     SLTEHLDDVPGTDRLLLARGCDLGFKTRYIEHVLLFERDECTARVNLLAAEIEERQSL
                     MCSFFCTSTAHLNRLRAEQQEHERQLHRAEDLLCLQQVDLAGRMRKAMDLQQDSYAHA
                     EMQRKVLALQCRRVLRSVGDVVGSFSGLDVEAVMLELEGRIQGILRVPSLDVSKEY"
     gene            complement(<42971..>45631)
                     /locus_tag="LMJF_35_0180"
                     /db_xref="GeneID:12982200"
     mRNA            complement(<42971..>45631)
                     /locus_tag="LMJF_35_0180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722367.1"
                     /db_xref="GeneID:12982200"
     CDS             complement(42971..45631)
                     /locus_tag="LMJF_35_0180"
                     /note="previous protein_id=AAZ14247.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722415.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982200"
                     /db_xref="UniProtKB/TrEMBL:E9AEJ5"
                     /translation="MKSAVTLVFLTEFFFVAVDRKDTGMSEKQDRINDVLAQRIKQLE
                     GELRNAQHDLSSALGQKERAEEEKKMLKDEAFDVVEQWSAENTELRRKLAVMEKESAA
                     DKATLRNRDEIVACLKEELDVAQQLTAQYFTQIEDQQEKHRNLEQQNAQLIESLAASR
                     SDLASSAQRVADYERLVAKFEGELKAALASRKKDTEALDHLRSSLAQATAENQALRNA
                     GENVSSSMEKLLERVAKLKEENESLRQNCDQLLSANDELTRQLHRDCQERRQLSDELG
                     SLSARVAASESEAQQLRQKCERTEKQLAASDSALQDSQTAAEQQLQLIQTLESDVLEL
                     KDREMTMGKALCDLQAELLRLHQQLDETSQQKEDLQTEFTAVKESYATALMELDNHKR
                     ASSKALAAMQSEFAAFKSDSTERCMLAEQNCSSAWLSVQELTDALRAQQLSELAQREQ
                     ISRSSILLNQQASIGGALEQRFHAVLVELSDCCRALERAEERIRQNKLNAAKTAEQIS
                     ALSNRCRTSEQTVSEQRKALSLLESQLSQGAVRLNEIILERDTFAKDNAWLRDQVESM
                     RQELGELDELLNSNLNEMREENERLQLENNSMRHDIAAANHKEQEAALRITALQVSVS
                     DLESELRAQTKTLEITEAELQALKAQVENLSTSLDFSKRRCEELEVVRTEADKSNAAL
                     ILQAAQLQERLGSQESKLSLILSEKRKESESLKRKLNAYVEKCEKCEQLLHAEIKARK
                     EVESASAAAKEHNGKLRSALDELKTRCASDASTLKELLAERDNLIRDREIIVGKYNRL
                     HDAFRNVRREAHSKVADELKRVMELAMSQETELQTLRKQNSTLKKSISMFVESAQPKA
                     EAVFMERLNLTEGPLRHPKKRSTASTTEQQ"
     gene            <47954..>48676
                     /locus_tag="LMJF_35_0190"
                     /db_xref="GeneID:12982201"
     mRNA            <47954..>48676
                     /locus_tag="LMJF_35_0190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722368.1"
                     /db_xref="GeneID:12982201"
     CDS             47954..48676
                     /locus_tag="LMJF_35_0190"
                     /note="previous protein_id=AAZ14248.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722416.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982201"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:E9AEJ6"
                     /translation="MNKQRIRGESFKQEYQAAGRHRTNRKRDPSMNKTDPHLVIAPQA
                     EIYQGKLVLVLDLDETLVFARSGPLYARPGIPEFFQMCKDEGIEVVVWTAGLKAYAQA
                     IVSNIDTCNAVSHCIYRHNKWFNGQPGYRKDLNALGRPLDRVLIVENTPDCIRGYQDN
                     GILVSDYEGGDGEDNTLYALAELVKVLSESNFTVPQFIANCDLLKREPVMTDVGDYIN
                     AYTLDTNCFDPGHVRVNRDLQR"
     gene            <50399..>56770
                     /locus_tag="LMJF_35_0200"
                     /db_xref="GeneID:12982202"
     mRNA            <50399..>56770
                     /locus_tag="LMJF_35_0200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722369.1"
                     /db_xref="GeneID:12982202"
     CDS             50399..56770
                     /locus_tag="LMJF_35_0200"
                     /note="previous protein_id=AAZ14249.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722417.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982202"
                     /db_xref="UniProtKB/TrEMBL:E9AEJ7"
                     /translation="MDDASAMWDQIQRMPFQQLQETNEFVYIKKVMSLVARYVFLESD
                     PKMADPRCTISIAKLLKTVSAKCLTEFARLSKTAEETAAEIANLRSAFKTQLSSKEEE
                     IEKLSDLLRKARIEGTSQNAAAEPSSSEELARLKIENDELSLQLRNLTRRNAELKEVL
                     ASRSDDMGDIKEHYEKAQLEYRHLAARYKRLADRSAKTEDILQELRQKEQGKKQKADD
                     ELDRLRQKVQSLQQENYALVQSRDRAEELCEKREAEALRDMTELRRLTKDLLDEERAK
                     NKSLRDEFVTVKQESDAHVEQLMHQHEVDLDEKEEEIALLRRQLEKATSQQKSHFHRD
                     SSISDGSSSHSSVKTGPPDISDKDAKMCVIPTEEQRRLERENDDLHAEVEQLELRIDA
                     LDEENLRLTRLVKNYESGNEGFYRLRQELADHTRTVEVLQSENAQLRERLNGMEDSVT
                     FNAALRELCKRVGVTEEEINSLRPQNAAAYSEMDTLKEELSLLKEEVEWLERERRHWM
                     NKVRLQPLMDTKLRFELGLSSEQLKQLDKLVDQMKAGTVLVEENDESYKDKYFKELQA
                     RRRDAEQFNAFVKDRINDALKNAFVDVSAPDTAAAVSALREHIDVITSSSTVEAGAQA
                     QEKIERLTRRLEELEQSENMRVEEIARLREQVVAGTTEKEVICRERDQYREAIFGAAG
                     IGAAQTEVAAGAGAPALGDFGESGAGGLSNAKWLTVANTLREQLRVKDTLIDSLSKEL
                     TVAKEQLEARRAADAEQHRRMELEKKADNSLQDQIKALAELNEELTERCGALSKTNKD
                     LEDSLERLDRGTTKELLLKVVLLRRREATLLQRLRRALTTQEESSAAVRRMESQMKNT
                     LWRLREILESDDPTEDAVLPRSSAGCSMESEMLSFLDYAVRHLLQGRMYREDSRFLLH
                     LKQVYQGMEANQEILELRLDTKRLRHELAEKQAEMDALSAEVAGLRAAATAAEDAKVN
                     PSPEYTAAAVAKSEAEAATYKQKYALAAKRLEAREKEVSQLENDIDSARQEVIEVRDH
                     IRNILNEGADTQATPCGSLPHAKVSPTELARLEKEIARLKTVNLGLLHHSLDLQSQGK
                     SLEIELEAKQQEITLLKSSADSQLVTTFVSAAIREHAALRRQSELALIQAKRLKMQLA
                     ATEANYHVVANEATVYKTGAYRLYRKYVEQVVSVVDYLRCVQRASKGSLSPHQAEIMD
                     RRLRKIVSDLGECFGRSKMLSMQLSDAQNTVTTLEQQLSLLRVEDGPAKRDAIDARLQ
                     EARSRVREHDRLMTECQEERQFLQAKLNRAEANNKDLNAEVARLEFGYMTASPLDAEL
                     LATLLQLKESVFDKAAAPSLNLESALSTASSKLGSGSADDSDLAIREYKNAVLRQTEL
                     AQQCAALKRQVADVDAERRRIEHMAAQLREGAQQSSEQAAFAQRQLEEERQKATQREA
                     RLLRAHETQLEVARRATEHNVHCLQEMIQKKEQLISSLQEQLSAERRKGVEYGLGEAV
                     RMERLHEHMFRENTAMVERFKSAIETVGDSVRHASESAALPLLIPGTSNGLQEQLQFL
                     TAETVRLRHELKEARATSIVLESQLEQQVQQQLSTRAPNAGAASGHNTDALMGIIRNQ
                     TAMVESLRQREMQLTAELQREKEQRVSMERQLSDVQAQHAEQGGMLQLLSQVASAGGV
                     SDAPLVGELRAQNAALDQELRMMRQMLEEERAHARRFQVDAAEWKTHIDALQAEVSAQ
                     QVETERAQHLAALNEGLRGDLNTVKEQNDKLMVAATILKQKLMDEAHRSGESARLHQQ
                     EIALAQRMGAIQQESAIHMKELDHRIRAIQKELNERVEKEKTMLEKNTESQRLVYQLH
                     QQLCAKDRELASLQEQLRQLSGISPVRLQQRASAVASGLQSRGTQVVAAREEPSLQRG
                     KEDAVAGSKAAAAGHQRAASMTDAAGVETLTSVIDNLKLVIAKLQSENADLRSTQVQS
                     AHYARQSRELRELKKREQSLQTQLEDLSRQLVSLRASSRGDGASSLSNAELNRRLATE
                     QAAAEQYEMELNNLRLQLSNADRRVVRPLDPTSGGAQATTVTPTAHSTVPPPLPKSRF
                     SHHQERRGGDMSSLAEPPQRRLSSTRLSDTASATADHSASPQFCHRGEL"
     gene            <57716..>57937
                     /locus_tag="LMJF_35_0210"
                     /db_xref="GeneID:12982203"
     mRNA            <57716..>57937
                     /locus_tag="LMJF_35_0210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722370.1"
                     /db_xref="GeneID:12982203"
     CDS             57716..57937
                     /locus_tag="LMJF_35_0210"
                     /note="previous protein_id=AAZ14250.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722418.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982203"
                     /db_xref="GOA:E9AEJ8"
                     /db_xref="InterPro:IPR009653"
                     /db_xref="UniProtKB/TrEMBL:E9AEJ8"
                     /translation="MSALFDFETVLYVLLLIVCTATYLRQFRPTLYHRDSFELYKKFL
                     YKCSVVGDRLSPWVSVCCLVLAFRIIFVY"
     gene            <58927..>59718
                     /locus_tag="LMJF_35_0220"
                     /db_xref="GeneID:12982204"
     mRNA            <58927..>59718
                     /locus_tag="LMJF_35_0220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722371.1"
                     /db_xref="GeneID:12982204"
     CDS             58927..59718
                     /locus_tag="LMJF_35_0220"
                     /note="previous protein_id=AAZ14251.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722419.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982204"
                     /db_xref="UniProtKB/TrEMBL:E9AEJ9"
                     /translation="MFCARSLLGAFCSTTRLFTISDEYIPRAFPVKSTTGLAGVAVEP
                     LWKPKLLAAASELQAFLHTSDIPPESTYYNVTMTLVKRINYGIKECQDDWCTLEKKFF
                     WGWPVEYILQVTWRELETAQKWNEWRFWELDPEQVKRVAREDQAIGKEGLGYNTPWEQ
                     VVREDFDKRKKALTQEEMAELKRMDTERMARETAAYKERKERIRDDLEKARGEMLKKF
                     LNKRYAVDKDLMRMQPGKSYSGKSAEDLIHELRASVKQTPPPTNK"
     gene            <60721..>61827
                     /locus_tag="LMJF_35_0230"
                     /db_xref="GeneID:12982205"
     mRNA            <60721..>61827
                     /locus_tag="LMJF_35_0230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722372.1"
                     /db_xref="GeneID:12982205"
     CDS             60721..61827
                     /locus_tag="LMJF_35_0230"
                     /note="previous protein_id=AAZ14252.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722420.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982205"
                     /db_xref="GOA:E9AEK0"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:E9AEK0"
                     /translation="MMPLSIYARTFVPSSTTYSPSGAKEQTAGPAESKDCVCIAFYEN
                     GKCPYGSHCEHAHRFSELNTETQMKLLRSVPVESIPAHFFGASQSRDEMLAALDAALP
                     RTLPAEYGCFSPIQSGEAERTVSTRRRPPGKDRQLVVSHSGPQPPIRNAASLSSSTSS
                     SAESLHVGGTHLSKRSSSPTAAAFAAVAAPTAADAAAFKMHLPLRCRYPHRSIPGTYY
                     DVLALPREASQDDIIAKYRSWQKDGFKRMRQVDPVGAEAVDRMIVEARNVLGNPILRS
                     VYDQQLPSVPMKQQPWTAASCGAGLTSTSTTPSKHHTQGQSSTTSSASDVHHRLGESH
                     KRLGHSRSNSSVYYADHAAPVVTISSLHNGDSIW"
     gene            <64736..>65050
                     /locus_tag="LMJF_35_0240"
                     /db_xref="GeneID:12982206"
     mRNA            <64736..>65050
                     /locus_tag="LMJF_35_0240"
                     /product="60S ribosomal protein L30"
                     /transcript_id="XM_003722373.1"
                     /db_xref="GeneID:12982206"
     CDS             64736..65050
                     /locus_tag="LMJF_35_0240"
                     /note="previous protein_id=AAZ14253.1"
                     /codon_start=1
                     /product="60S ribosomal protein L30"
                     /protein_id="XP_003722421.1"
                     /db_xref="GeneID:12982206"
                     /db_xref="GOA:E9AEK1"
                     /db_xref="InterPro:IPR000231"
                     /db_xref="InterPro:IPR004038"
                     /db_xref="InterPro:IPR022991"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:E9AEK1"
                     /translation="MAKKTKSKVDTINAKLQLVMKSGKYVLGTQQALTTLRQGRSKLV
                     VIANNCPPIRRAEVEYYCTLSKTPIHHYSGNNLDLGTACGKHFRTCVLSVTNVGDSDI
                     AA"
     gene            <65905..>68058
                     /locus_tag="LMJF_35_0250"
                     /db_xref="GeneID:12982207"
     mRNA            <65905..>68058
                     /locus_tag="LMJF_35_0250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722374.1"
                     /db_xref="GeneID:12982207"
     CDS             65905..68058
                     /locus_tag="LMJF_35_0250"
                     /note="previous protein_id=AAZ14254.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722422.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982207"
                     /db_xref="UniProtKB/TrEMBL:E9AEK2"
                     /translation="MSTSTRRISVTSEQLQSDALRAQLFSACCAYGVVEWAQYQEDPN
                     YNTTTVHIQFQKLSSADRLRSDVQQRGRLWQIESEPAALCVGTDVLLSAAEVLRLGRL
                     TAALPGFACTALAGVPVRNTSTAATVTQTPSLPTFEEKSFLLHGRSSASRTTPASSKV
                     TAEQEAALWSGFEQESSAVRHSCLGPYCAVLHFGSPHDANEFLCQHQLTLAEQHSVYA
                     IHVGTAPGCALAVALPKMLARHALADCAVDGRVVRGYVVAMHSSTYCVVDAGLYQSAD
                     QASITTLVHTHTNFLSVSLGDEVQVQLSASGGLTMAEKGMVGGKLLRVTSTSAFSTRR
                     SVTKAQLPDTAARTLRTSNLAHGLIGATSSPHQPQARPASGGRATDVAGTVRRGTLNN
                     KLNATVTGGGNGGAVTSKSAGGAAAKVLASKLFRSIQQRKSSGGESEGSSAERICAYP
                     AGLGAYARLLVRVERIEQDGLHARCVDDAENCGYAGPVFIPAAFVPADTSSTGQGWRT
                     FAVVGERMHVALLYMVAVGGSAATMRGVASKKEADLRHTAATAVAAAVRVTPGDVEGA
                     SVTAGTTVKATAMLKLYAGDLGVPAADHTSPYFPAFLLYPGLHVPASLRQTVLLLPLS
                     DLGSLDPTSLSTTPGFLIVSEVVNDVMRGQYAVVVPCAVYAARQAQRAVAQEQRKTAE
                     VDEVKRRLAAVMGQDILKVLNAEDGAAAKRPRAED"
     gene            <68491..>70380
                     /locus_tag="LMJF_35_0260"
                     /db_xref="GeneID:12982208"
     mRNA            <68491..>70380
                     /locus_tag="LMJF_35_0260"
                     /product="putative GTP-ase activating protein"
                     /transcript_id="XM_003722375.1"
                     /db_xref="GeneID:12982208"
     CDS             68491..70380
                     /locus_tag="LMJF_35_0260"
                     /EC_number="3.6.5.1"
                     /note="previous protein_id=AAZ14255.1"
                     /codon_start=1
                     /product="putative GTP-ase activating protein"
                     /protein_id="XP_003722423.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982208"
                     /db_xref="GOA:E9AEK3"
                     /db_xref="InterPro:IPR001164"
                     /db_xref="UniProtKB/TrEMBL:E9AEK3"
                     /translation="MDEVTLDTLFLSCECDVQWGSRGTLTVRRTVELHSNNILYCFEE
                     PKNSMAKHIREKVYVEGCHVVDGGAYNDASERLLLFLANRDYSEKVDLLGNHQAYIFA
                     AEQTTHNAPLGQATRSSSTSTLPNASYVVQLFLSDKMVKWRLLQAIQRASKEYLQLFP
                     DTDTAPALPAARTVGDGCVHAGRLTVAGPSASGVPNRFESKVLAGPSANPYHSRTESG
                     ISVLSDHEVLQLPDVLREYDALQERKRRLGAMMTSFPPQPKGEEEEEEDVLKSTSDDQ
                     GLEEAACVAGNEAGLAVTLSELQSRAPASLQHSPLYEWCIKSKPVNQICADCGEPFPS
                     WCILQPFGAFVCIQCIGMHRKLWSNKCRSAELDRWRDSDIEFMKARGNDVVNDELEYY
                     VALPTDSVEFALHTQPVVKPVLSFSSAEVRESFIRWKYEELFFTRRRHPTATRPLPPP
                     PDPVGLERSRLATATTATSEVEGYASAVSLGAAARLQQSFFLDQGPPQYAGLLDIVVK
                     ELVGPESITGAVCVLTNGFQTLRTQESRQLLHMRHSTAWDAHLQVGIEGAGQKPLYCT
                     VYRGRGELLAAAEMWMKEDVFQAGTSCMFALKLVWSQLHKKPSQRTPGELWTITFLTS
                     YQRLA"
     gene            <71254..>71487
                     /locus_tag="LMJF_35_0270"
                     /db_xref="GeneID:12982209"
     mRNA            <71254..>71487
                     /locus_tag="LMJF_35_0270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722376.1"
                     /db_xref="GeneID:12982209"
     CDS             71254..71487
                     /locus_tag="LMJF_35_0270"
                     /note="previous protein_id=AAZ14256.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722424.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982209"
                     /db_xref="UniProtKB/TrEMBL:E9AEK4"
                     /translation="MFLTYQFAPIWAMSISIVTFLVLRHNDPVDLNEYKEKAHGIPPV
                     ACCSAIAIPLIVLFVYNAALRMGPKPPCSSTRK"
     gene            <74186..>74485
                     /locus_tag="LMJF_35_0280"
                     /db_xref="GeneID:12982210"
     mRNA            <74186..>74485
                     /locus_tag="LMJF_35_0280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722377.1"
                     /db_xref="GeneID:12982210"
     CDS             74186..74485
                     /locus_tag="LMJF_35_0280"
                     /note="previous protein_id=AAZ14257.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722425.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982210"
                     /db_xref="UniProtKB/TrEMBL:E9AEK5"
                     /translation="MKDETELNALLQGSTNTSDFNERLVVPHFAYTESGASCDKFAAA
                     FKWLIQMNVSLPVIYLAARSDPITGESRTKAQCQVLIDAHPSIVYVETLAGGHLS"
     gene            <75652..>80196
                     /locus_tag="LMJF_35_0290"
                     /db_xref="GeneID:12982211"
     mRNA            <75652..>80196
                     /locus_tag="LMJF_35_0290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722378.1"
                     /db_xref="GeneID:12982211"
     CDS             75652..80196
                     /locus_tag="LMJF_35_0290"
                     /note="previous protein_id=AAZ14258.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722426.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982211"
                     /db_xref="GOA:E9AEK6"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="UniProtKB/TrEMBL:E9AEK6"
                     /translation="MRRLHQQLRRRVWTAGLIPNTRRLVTSAALGLGVSTASLPLPGR
                     SSAPIASVAPLPTEVLRAAPAAPAAPKAAPAAPAAPKVAPAAPAAPAAPKAAPAAPAA
                     PAAPKAEPAAPKAAPAAPAAPAAPKAAPAAPAAPKAAPAAPAAPAAPKPAPAAPAAPK
                     PAPAAPAAPKAAPAAPAAPKVAPAAPAAPAAPKAAPAAPAAPAAPKAEPAAPKAAPAA
                     PAAPAAPKAAPAAPAAPKAAPAAPAAPAAPKPAPAAPAAPKPAPAAPAAPKAAPAAPA
                     APAAPAAPKAAPAAPAAPAAPAAPAAPKAAPAAPAAPKAAPAAPAAPAAPAAPKAAPA
                     APAAPKAAPAAPAAPAAPKAAPAAPAAPAAPAAPKAAPAAPAAPKAAPAAPAAPAAPK
                     AAPAAPAAPKAAPAAPAAPAAPKAAPAAPKAAPAAPAAPAAPKAAPAAPAAPKAAPVP
                     PAAPAAPAAPAAPKAAPVPPAAPSVLSAPAVFWRVQSRKGSVAGGSYAAEQRMSSSGS
                     SRPRTAVSHETGATHTVACTPSRKQLPHRTDAEGPAVSSAPPSPPPAPSLSAATPAPS
                     ISPSTSPAHATIAPPSISAVGEVDSEVEEGRLFEALRPSLSTRVEAAVRQGRANRPLK
                     ASCKAQQPQSEKREPHVLCGNTGLHTDSSELVEGAAAGDWGWAKREERLQPLPASISC
                     SIDRHEIPAELGGDEGRSVAESITAGSTANDFSGGEASTSPKDSAPPSSAVAAELLEA
                     ATVERLPGEVWCGAETAGCERGATPPPRPPIADNSDVCLKVSASVTPELYAITVQLRE
                     PPSSPTACVQAVAGALDAVEVHCDAAVAARAAGRADSRVKAVPGITVTWCTLPHCPFF
                     ASLQNPAELPLSQRVSYVAAKEAVMKRFHHLVARFGTLVRFAAAASSGSVLDFGAEVF
                     FACPERRLLSLRVAACDGGGKTAAPAESSSPPVATVSVGFPLSRVGIFPSTSTVASLQ
                     HLCGSFHTVKWVPVLHTYDVRSLADVGLLSIPDAAGDATDKSKTKRWSLRLEQLILEH
                     VCRSPAQRRWAVEMLMWSRGFHDAAVRHKAVGAMSADIADGWYAYAMGALSRNPSSAE
                     AGAACRDAENATGIQPLLTTPPCRGAAHAVQVHSRSLRCALPPLPHHRFLTFPHVQRS
                     LWMNKIQTLAATAESAGAAVLFDCSDKAVMDTLDLVETHLTGTAAQRARLPYLNVVLI
                     GDATTARPILQRLPCAAVISSASAFCETGHASVQQVRLYASPKWPTDLQQDTLLAALT
                     YLKRRGAPHVVAAGAAPQRLLLALCQEAVLVARSLPDAMAVESAAKEQLGLCLGPFRL
                     MDAYGTVAIASMAAAERTRTAAASDVATRAAVAPVHELESCMRSMAREGLLGARGVRG
                     GFYDSVVATNEAVSAAPLLREAVLNAYVRHTTPAQVGDRLRAAVLNVACELLTRGEVQ
                     RVDDVDLLSMSALGWREETGGVLYQVDQLGADSLPRLVEQMTCLATTGIAPHLAPHPL
                     LLRMVTDKVRFASLKASGLL"
     gene            <81020..>82018
                     /locus_tag="LMJF_35_0300"
                     /db_xref="GeneID:12982212"
     mRNA            <81020..>82018
                     /locus_tag="LMJF_35_0300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722379.1"
                     /db_xref="GeneID:12982212"
     CDS             81020..82018
                     /locus_tag="LMJF_35_0300"
                     /note="previous protein_id=AAZ14259.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722427.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982212"
                     /db_xref="UniProtKB/TrEMBL:E9AEK7"
                     /translation="MPATTMVADPLSQIVSQVIDDVSFSQTHTVSDDFRVYPKLSIDS
                     VSTLQQEQRKRVEQTYGARAPSPDFLGSQLLAEYRGEAASLQLAKESGDPNFPTSISR
                     MTGEQSKQFKKDMKQRIHEWEATVRDATGQTEVYPDQKASLRCIYELYRATKMKVLGV
                     EPSPGPHGATAEASVAGSRDVSQSVAAHAAGASSASASAVGGARSESTRLSTSGAKDT
                     TAGSTKALSGSAAAAGGEVRAASSGAAAPAMAGGGADWIKCIERVPLGTEDVSTMTED
                     ALQTEKRRLKQVLHRFESDFEKYNGVRPGRHDRQGFTAEYHRYGELKNELTRRSQK"
     gene            <83055..>84338
                     /locus_tag="LMJF_35_0310"
                     /db_xref="GeneID:12982213"
     mRNA            <83055..>84338
                     /locus_tag="LMJF_35_0310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722380.1"
                     /db_xref="GeneID:12982213"
     CDS             83055..84338
                     /locus_tag="LMJF_35_0310"
                     /note="previous protein_id=AAZ14260.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722428.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982213"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:E9AEK8"
                     /translation="MQRKYTNAQALAVYQALQQSGGLSALEDDTATALYLSQNAAATG
                     ELNFTPGLLERLTKRLDKGGMVLDPFCSYDYADRRHIRNFSMSIPIPFSAFDGIRCSK
                     HQVQLTAAQEENVLKSFDKLLNGEDVKKSGTTPAAKGAREISVALPFVSAFFDQRCPE
                     LHSSVLTGSREGATYLLLSVITGHKELCAKCLKAGANPNNMSFLRDESPAPGDMFHGY
                     SPVFMAVLAEQVEILELLCSCGGSIHVYDRWGRTPLHAAMAVESTSTVQWLLAKGAPL
                     YVPDGFGILPADSCVGTQYAEYSMPMLALQEQPKCPPPSYFAEAAKSWAAPERESKTT
                     AEKEPKKDTAATSSGASAAEGETKMELCRCRSGRPVGFCGCIDDMLVRWARDRLNTEW
                     SPGVNFSALAKKQAFAEEERKRTTYSAGGSRGVKS"
     gene            <85759..>87339
                     /locus_tag="LMJF_35_0320"
                     /db_xref="GeneID:12982214"
     mRNA            <85759..>87339
                     /locus_tag="LMJF_35_0320"
                     /product="putative serine palmitoyltransferase"
                     /transcript_id="XM_003722381.1"
                     /db_xref="GeneID:12982214"
     CDS             85759..87339
                     /locus_tag="LMJF_35_0320"
                     /EC_number="2.3.1.50"
                     /note="previous protein_id=AAZ14261.1"
                     /codon_start=1
                     /product="putative serine palmitoyltransferase"
                     /protein_id="XP_003722429.1"
                     /db_xref="GeneID:12982214"
                     /db_xref="GOA:E9AEK9"
                     /db_xref="InterPro:IPR001917"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:E9AEK9"
                     /translation="MSEAALKREIALQEASDVVDNKSRVLPKSPADTRERTHEVVAAT
                     EPFEHPISLRSKVSAYVTLALLFLFARLRESYRQFFPNDESHVRPGYAPIVKDFDHYW
                     NRRFYRRVRDCFMRPIDSRPSRVIGVMERVSKDNNQTFEYSGRIVPAVNMGSYNYLGF
                     AEDTQSITHEVLDSIDDYGLASCSAPQGLGQSALVSRLEHEFAEFLGKEDAIVCGMGF
                     ATNFRGLPTLFGKETLVLSDSLNHSSLVNGVRSSGAKVKVFQHNHFGQVEKCLREGVV
                     LGQDPCGEYKPYKRIVIIIEGIYSMEGEIVNLKKFVELKKKYKALLFVDEAHSIGAIG
                     RTGRGVCEHTGVDPKDVDVLMGTFTKSFGSIGGYIAADKTLVRYLRQHSSIALHCDPL
                     APPCAQQVLSVLHVLLGKDGTDLGEKRIRQLKDNSSFFRRGLMDLGLVVLGDDSSPVV
                     PVMCYSIGRLSALSRLCLERGVAIVIVGYPATPLLQGRVRFCVSACHTREDLQRTLDV
                     IRELKGYVCMEDSTNPLR"
     gene            <90481..>91497
                     /locus_tag="LMJF_35_0330"
                     /db_xref="GeneID:12982215"
     mRNA            <90481..>91497
                     /locus_tag="LMJF_35_0330"
                     /product="3-keto-dihydrosphingosine reductase"
                     /transcript_id="XM_003722382.1"
                     /db_xref="GeneID:12982215"
     CDS             90481..91497
                     /locus_tag="LMJF_35_0330"
                     /EC_number="1.1.1.102"
                     /note="previous protein_id=AAZ14262.1"
                     /codon_start=1
                     /product="3-keto-dihydrosphingosine reductase"
                     /protein_id="XP_003722430.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982215"
                     /db_xref="GOA:E9AEL0"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:E9AEL0"
                     /translation="MLALFVAVAAVLGTSLVLVALWAVQRVPRWEWESSTVLITGGSV
                     GIGLATAKSLARKKVPFLVLAARRESVLREAVQQVEKVIGECRSCTRVSYVVMDVVDE
                     ASVTAGLARAKRQCDGRPINLLICNAGFAHPARFVDSAMTHARQMMEVNYFGCLAVLW
                     KVLPEMLEMNQGRVVLASSMAARAPIAGYALYSATKAGLRAFAHSLDMENSCLGVRVQ
                     VVSPPDVATPGYAHENEVKSPECAAISSFGGAKPFTAEAMAQAIVDGIADYSFDITLG
                     SDGRLLSYGSAGMEPATSVAALLVQSVLGGVLRLGLAVFSKIHYGIVTKVRLSEASSA
                     PSPR"
     gene            <92249..>93742
                     /locus_tag="LMJF_35_0340"
                     /db_xref="GeneID:12982216"
     mRNA            <92249..>93742
                     /locus_tag="LMJF_35_0340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722383.1"
                     /db_xref="GeneID:12982216"
     CDS             92249..93742
                     /locus_tag="LMJF_35_0340"
                     /note="previous protein_id=AAZ14263.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722431.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982216"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9AEL1"
                     /translation="MPTYFFRIPSLQVCTVSFFGGGTLVLGSGLWDLMRSRRNAVPVF
                     NSAAVVKTEESARYPCEKIKGFDVVVRSFYVPVAADTDGRAPAPALSLLAQLRRFSGL
                     FSNETHRIDSANSTKKTAADQPVRLVVRDAKASDGGANTSLIAAAHWPPGTSKYAALV
                     LVPTSRTSGDSSAALPAQSRSLLRQFADGATHQSLSRCNPRSTQLHMACESDPAYLGA
                     PYLRVFLSAFLLLPATLSQLNVAVLGVGGGSLPLFLQQYFAPRLHRCDLVDVEPMCIK
                     AAVEQLGMKELLNTVALRCEGGGVHYYLEDAVDYLSHRVGDADCRTGWPLQAGSGRSA
                     GSGEGASAAPHHGTPVFHDAVQPTPAAARATSAKRQRQLDLLFVDLFVGSELDTAVTS
                     HEFLCLCRGSLSPHGVAAFNLPAADKRFVQRCNEVFGSRNVYRIPVPASSNEVVLARG
                     GAKNSGAVANAPHLSHRLLFRRAQELSAQYRLPYDLANHYPVWWRLW"
     gene            <94488..>96599
                     /locus_tag="LMJF_35_0350"
                     /db_xref="GeneID:12982217"
     mRNA            <94488..>96599
                     /locus_tag="LMJF_35_0350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722384.1"
                     /db_xref="GeneID:12982217"
     CDS             94488..96599
                     /locus_tag="LMJF_35_0350"
                     /note="previous protein_id=AAZ14264.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722432.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982217"
                     /db_xref="UniProtKB/TrEMBL:E9AEL2"
                     /translation="MSATIKAARGCASAVLFHSLRLHAFEGALPHVLVVVDRVPCVLQ
                     KVVAEGYLQVLRAYGRQGAAYVTSNCDSVLRAPAEALPGTADDRESLQSHNDELFIPL
                     KPGAETPSGSVGFTPRVLLPSFAADDFAPLSYSLMLFCRDNFLSHVKRLQRFFRHCGD
                     GQLQRQGDQHETEAVAGDSSLKPPPPTALSSVWTAEYFKEEFEALCPLLGPLLSSKGE
                     AVEGDTTGEQPQWQLLFHGPPRELLGCVMVQENAFQNEMRRYRLRLSLFDLGIRVAEH
                     CHLGIMSQRADRLAGEGHFKEALEDDEVYSYARSCAFGPEHAQCLAKAIADSIDLYSW
                     RRSGCAGGAAARAVQVYPASITAALQNAELWSIFNSGALNVCTSATAADDTATDVEAA
                     LREPIEGPGMPLLIVCRDAAKVLTYGGGMEDCLTNTGHYAAAYAPERNDVARHRERFR
                     TVYSEASDGDGESERDEEDATANPPVHGRLKKAEYLAVLRAKGQRPNKPQHNGADDED
                     GTVSRSAPAGSCISNSIGGTFPIGEVISESFDLSQLSGTCDVFAYPDVFKKVTMSRPA
                     PFTMTVEKGVVTHISNGAPKEFLDLFSLVRQVEGKCYVRELGIGLNPYVGPAHVVSDV
                     TAFERQWGIHLSLGQRHPLFVKQRERRNADGSVATGVHVDGPVLKRKAGKYHIDVFVD
                     AAQLRMGDMFAVDFTKGIAVP"
     gene            <97692..>98585
                     /locus_tag="LMJF_35_0360"
                     /db_xref="GeneID:12982218"
     mRNA            <97692..>98585
                     /locus_tag="LMJF_35_0360"
                     /product="enoyl-CoA hydratase/isomerase family
                     protein,conserved"
                     /transcript_id="XM_003722385.1"
                     /db_xref="GeneID:12982218"
     CDS             97692..98585
                     /locus_tag="LMJF_35_0360"
                     /note="previous protein_id=AAZ14265.1"
                     /codon_start=1
                     /product="enoyl-CoA hydratase/isomerase family
                     protein,conserved"
                     /protein_id="XP_003722433.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982218"
                     /db_xref="GOA:E9AEL3"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="InterPro:IPR014748"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:E9AEL3"
                     /translation="MRACAPLRSAAATGLSAASFKVLHQDECVLRYDAASQIAILSME
                     RHARKNAIGVGFLNCIQQAIDVCRAGAPSGACTTASADCPPVRCLVVSSAVPKVFCAG
                     ADLKERKEMSVAESRAFVQRLRQTFNDLEDLPIATIAAIEGKALGGGMELALSLDMRV
                     AGDGATVGFPETGLGIIPGAGGTVRAPAALGVSRALELILTAQQVSARRAVELGIVNR
                     VVPAGSALEAALDLALRISKNGPLAVCAAKKAVRSAVGKTRAEAMQVEAEQYEVVLAT
                     EDRLEGLKAFAEHRTPLYKGK"
     gene            <99262..>100479
                     /locus_tag="LMJF_35_0370"
                     /db_xref="GeneID:12982223"
     mRNA            <99262..>100479
                     /locus_tag="LMJF_35_0370"
                     /product="putative ATP-dependent DEAD-box RNA helicase"
                     /transcript_id="XM_003722386.1"
                     /db_xref="GeneID:12982223"
     CDS             99262..100479
                     /locus_tag="LMJF_35_0370"
                     /note="previous protein_id=AAZ14266.1"
                     /codon_start=1
                     /product="putative ATP-dependent DEAD-box RNA helicase"
                     /protein_id="XP_003722434.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982223"
                     /db_xref="GOA:E9AEL4"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9AEL4"
                     /translation="MSDSNWKAQLNAPQKSTRKKTEDVESRRNVNFEEYALRRELQMG
                     IFEKGFEKPSPVQEEAIPVALQGKDVLARAKNGTGKTASFVIPVLEKVDTRELYVQAL
                     LMVPTRELALQTAQVTKELGKHIPGLEVMVTTGGTTLRDDILRLTSKVHILVATPGRV
                     LDLASKKAVDLSHCHILVLDEADKLLSQEFMEIIDDLYTYLPSQLQSMLFSATFPVTV
                     KTFAERHLHNPYEINLMDELTLKGVTQYYAFVEERQKIHCLNTLFNKLQINQSIIFCN
                     SVNRVELLAKKITQLGYSCYYIHARMQQQHRNRVFHDFREGHCRNLVCSDLITRGIDI
                     QAVNVVINFDFPKYAETYLHRIGRSGRFGHLGVAINFVTYDDRYNVYRIEQELDTEIK
                     PIPAEIDPELYAA"
     gene            <105581..>107431
                     /locus_tag="LMJF_35_0380"
                     /db_xref="GeneID:12982224"
     mRNA            <105581..>107431
                     /locus_tag="LMJF_35_0380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722387.1"
                     /db_xref="GeneID:12982224"
     CDS             105581..107431
                     /locus_tag="LMJF_35_0380"
                     /note="previous protein_id=AAZ14267.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722435.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982224"
                     /db_xref="GOA:E9AEL5"
                     /db_xref="InterPro:IPR005746"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="UniProtKB/TrEMBL:E9AEL5"
                     /translation="MLAFTITSTEQERTVKRLKVDSPSASLECEDGGENSCGSLPHIA
                     EANPALESAQRTPPMSKQAETPATEAVNGVSPEISPANSSRSRHSSDDDDDGKDEKDM
                     SDNHLSSPVAREFSGNTWRVTRTPTGSAVTATAAITGGAAVPPPPITTNGAITTLRTL
                     GQLQTLVSSTNTTSAKDKVHPSLRLKPGETVMLLLHFDETSLRSLINGATMELSQMRI
                     FTLNLAKLPLHDYEEAPERRLNASGCTSSSNASDRARRGGSTATPDAGVTQVTAQDTE
                     DEDEDEEELVPAVHPVAVSTAAAAGTSTIAEKECLPRASVSAGGALALDEAATVSSLS
                     GDLHHASDVISDKLHQMLAVDTILNPHASQQQRGHGNGDGGAAATGKREPLLFPAMIV
                     WRAAGAPREEYPPAPPQTYSSQPPCTPAELFSDRLSAQGGPLVVKEATGVDQVHSLTL
                     FRPVFTMEHLFHTLVRTVAPSFAARGTGEKSRTVLYLGASWCPPCMRFVREMPQLMRE
                     DLPSSVVCTLKADMDLAKPIYDYFKVEIIPTFVLLDNEVLMKCYETVRRQQSSAASCS
                     GGGASQSDYARAIQEAFSTAELGRLQNSNRQLVSTFISKHSQALRFDEDF"
     gene            <116945..>118588
                     /locus_tag="LMJF_35_0390"
                     /db_xref="GeneID:12982225"
     mRNA            <116945..>118588
                     /locus_tag="LMJF_35_0390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722388.1"
                     /db_xref="GeneID:12982225"
     CDS             116945..118588
                     /locus_tag="LMJF_35_0390"
                     /note="previous protein_id=AAZ14268.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722436.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982225"
                     /db_xref="UniProtKB/TrEMBL:E9AEL6"
                     /translation="MSYSFSTINGVLPLGAQRAYVPRASRPHLAWSAVQSSRVIGSQC
                     RLRGDGTAAREQTRGTECTEVEGGEAAVTSASPTELGLAGLLTTDAASGTRLTLYSDP
                     DSPQLPLCSAPIPSQRRVVALWIPPTSTSADRDGSSNVCAMAPLFVSDDTGGVFAYHW
                     SGSDSLREPAEKRRRTDADTGRTLSNDKDGVWTPVARAHSTLSSDVARIRSCRSAMSS
                     LFAVTRGAPGWAGLTALHASLPCSAALQLVSVREFYHDVRLIDPTRQAVVRTYSTTHA
                     PTGVLCPSVQAAPHCTLIVEGCLATLYDVRCPSAVLSLGEVYESQAEWRAAKDAAAAG
                     TDKQADSGVEGGKQGNGKSPEGVRAAAALAPVPPLIPGRLTSTVGQVRDICGTANPFE
                     VACAVDRALCVYDLRKFNRLFTSSSVLKYVIGSVASVAGGRGVVCAGIDAEVRLIPLH
                     EKSDTLSEEMLSLAARVVTQAQQKKQRSDTRKPEMQDSKAVGGAGANAVGPGGTFRTR
                     LSTSVSCTTTWQGGWVTACNGGGAVSVGVSVDGEVFLAQ"
     gene            <119460..>120254
                     /locus_tag="LMJF_35_0400"
                     /db_xref="GeneID:12982226"
     mRNA            <119460..>120254
                     /locus_tag="LMJF_35_0400"
                     /product="putative 40S ribosomal protein S3A"
                     /transcript_id="XM_003722389.1"
                     /db_xref="GeneID:12982226"
     CDS             119460..120254
                     /locus_tag="LMJF_35_0400"
                     /note="previous protein_id=AAZ14269.1"
                     /codon_start=1
                     /product="putative 40S ribosomal protein S3A"
                     /protein_id="XP_003722437.1"
                     /db_xref="GeneID:12982226"
                     /db_xref="GOA:Q4FX73"
                     /db_xref="InterPro:IPR001593"
                     /db_xref="InterPro:IPR027500"
                     /translation="MALGKNKRISKGGKRGKRGKAQETMARKEWYDVVAPANFEKRQF
                     AKTICNKTQGTRIAADVLRGRVFEANLADLNQSAGEEEAYRKVRFTVQEVQGRNLLTQ
                     FHSMEVTTDKMASLLRKWCTTMETTVEVKTADGYTMRLFVVAFTKPQANQQSRNCYAK
                     QRLVKWLRMRITKMIKRRLSKVQIKEAVSLLTRNVLSDALVRRCNPILPLRELRIRKV
                     RVVRTPKFDAQALLSAHGTIPASVEADQREVEEAVEAAPAAEKAAE"
     gene            <121344..>122138
                     /locus_tag="LMJF_35_0410"
                     /db_xref="GeneID:12982227"
     mRNA            <121344..>122138
                     /locus_tag="LMJF_35_0410"
                     /product="putative 40S ribosomal protein S3A"
                     /transcript_id="XM_003722390.1"
                     /db_xref="GeneID:12982227"
     CDS             121344..122138
                     /locus_tag="LMJF_35_0410"
                     /note="previous protein_id=AAZ14270.1"
                     /codon_start=1
                     /product="putative 40S ribosomal protein S3A"
                     /protein_id="XP_003722438.1"
                     /db_xref="GeneID:12982227"
                     /db_xref="GOA:Q4FX73"
                     /db_xref="InterPro:IPR001593"
                     /db_xref="InterPro:IPR027500"
                     /translation="MALGKNKRISKGGKRGKRGKAQETMARKEWYDVVAPANFEKRQF
                     AKTICNKTQGTRIAADVLRGRVFEANLADLNQSAGEEEAYRKVRFTVQEVQGRNLLTQ
                     FHSMEVTTDKMASLLRKWCTTMETTVEVKTADGYTMRLFVVAFTKPQANQQSRNCYAK
                     QRLVKWLRMRITKMIKRRLSKVQIKEAVSLLTRNVLSDALVRRCNPILPLRELRIRKV
                     RVVRTPKFDAQALLSAHGTIPASVEADQREVEEAVEAAPAAEKAAE"
     gene            <123228..>124022
                     /locus_tag="LMJF_35_0420"
                     /db_xref="GeneID:12982228"
     mRNA            <123228..>124022
                     /locus_tag="LMJF_35_0420"
                     /product="putative 40S ribosomal protein S3A"
                     /transcript_id="XM_003722391.1"
                     /db_xref="GeneID:12982228"
     CDS             123228..124022
                     /locus_tag="LMJF_35_0420"
                     /note="previous protein_id=AAZ14271.1"
                     /codon_start=1
                     /product="putative 40S ribosomal protein S3A"
                     /protein_id="XP_003722439.1"
                     /db_xref="GeneID:12982228"
                     /db_xref="GOA:Q4FX73"
                     /db_xref="InterPro:IPR001593"
                     /db_xref="InterPro:IPR027500"
                     /translation="MALGKNKRISKGGKRGKRGKAQETMARKEWYDVVAPANFEKRQF
                     AKTICNKTQGTRIAADVLRGRVFEANLADLNQSAGEEEAYRKVRFTVQEVQGRNLLTQ
                     FHSMEVTTDKMASLLRKWCTTMETTVEVKTADGYTMRLFVVAFTKPQANQQSRNCYAK
                     QRLVKWLRMRITKMIKRRLSKVQIKEAVSLLTRNVLSDALVRRCNPILPLRELRIRKV
                     RVVRTPKFDAQALLSAHGTIPASVEADQREVEEAVEAAPAAEKAAE"
     gene            <125095..>126570
                     /locus_tag="LMJF_35_0430"
                     /db_xref="GeneID:12982229"
     mRNA            <125095..>126570
                     /locus_tag="LMJF_35_0430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722392.1"
                     /db_xref="GeneID:12982229"
     CDS             125095..126570
                     /locus_tag="LMJF_35_0430"
                     /note="previous protein_id=AAZ14272.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722440.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982229"
                     /db_xref="InterPro:IPR010736"
                     /db_xref="UniProtKB/TrEMBL:E9AEM0"
                     /translation="MSSDRSGAAAKASAGQCSSDRPLAVAADPKQYSMALCPDTPSYS
                     LCGRLKSEWDKQSAAASPGPAAYDVPGYFDTLDPQQQQRHLWSGPVPGVHLGIRTVLP
                     ESREKAGVPGPGAYQLVRFGDELPRAREPLITRSSRRGRGAAADTPGPGAYDDPTSIA
                     YRADQVRRKRLFTQCSTFGGRWCRREFHTAGPGPAAYNTLVATKLLEKNQRHAPRLVR
                     RQPPLDRQSVAEAAAARMKVSGPPNPQAFPTLPSDFDFDFRKGKTIGGKPHEPLARTA
                     PSHLTQAADDKPSGSRAFWESPPPPGGRFAATPFDPQSHSLAAEKAGTNAARLAEAGN
                     CKPGPGSYNVEVDPTARRVPASLFGRTLSAKSVSVENGVPGPGHYRVVDDTSGRGTIF
                     YKGDFHPRGCSGQGGSAAESLGVGPGAHYNDDTMYSNSINGDRAHNKGFTMGIRYPAR
                     ATYQHCAPYDETTNINCVYDDELNWVVRPNQHLPLIRRGKL"
     gene            <128408..>130324
                     /locus_tag="LMJF_35_0440"
                     /db_xref="GeneID:12982230"
     mRNA            <128408..>130324
                     /locus_tag="LMJF_35_0440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722393.1"
                     /db_xref="GeneID:12982230"
     CDS             128408..130324
                     /locus_tag="LMJF_35_0440"
                     /note="previous protein_id=AAZ14273.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722441.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982230"
                     /db_xref="InterPro:IPR011021"
                     /db_xref="UniProtKB/TrEMBL:E9AEM1"
                     /translation="MPSSRGVSLSISLAEAEVAPGGMLRGEVKVKVDSSHKNGIVYEA
                     IRLVFLAVEKSCVWDDQGEFDELLNKYTSSRVYLDRHVTLTGFKTQSEDAETTAQVRE
                     EMLFLQHCATPYAAVAPTKPKKDAYRHYTREELLHGAIQMAATTKYTTGGVVAPDTND
                     STNICMGSQKPVQAGDGPRSAAAAPRGGATEVEFPVLMPGTHRFPFLFRLPPWLPPSF
                     YYSFVGAKGQLQYSASATMLFPGNGAGSWWFKICKDTSGAMRDMGKTFNRAAGSGAPS
                     GKRARKRPGRDESGEGVIDLDDDEVGERMNRRLTSMPVYGPSDLTTAIHFDVLSVMPR
                     RQLVAEYYQIDTHNLHQRPTNAPREAENAVSSSSNRNGAKKLQRRVDKSNDVGDVKPS
                     GVSTGLLEHHEDTHLALSALYQTFRCGWLGNMCCLQPQNAIEAEVLVVGARTVLLADD
                     VGALQALGVRPPITSDAPQLGGPALHAPDIVPSPDMAVAAPNTPWPVGGITLRVRVRN
                     YCPTHTVECVRVELKVMLEIFKSLKTPHTFPGISYSSFDYTIPIPPGNQALFDVRLGL
                     APRFRRHETDSESLLPPPGVRTANMTSNTFLQVSFPGMYTYVEEEEEAKGVVIMAETV
                     NLNDEVLELPVRYS"
     gene            <131467..>133278
                     /locus_tag="LMJF_35_0450"
                     /db_xref="GeneID:12982231"
     mRNA            <131467..>133278
                     /locus_tag="LMJF_35_0450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722394.1"
                     /db_xref="GeneID:12982231"
     CDS             131467..133278
                     /locus_tag="LMJF_35_0450"
                     /note="previous protein_id=AAZ14274.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722442.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982231"
                     /db_xref="InterPro:IPR011021"
                     /db_xref="UniProtKB/TrEMBL:E9AEM2"
                     /translation="MAFRVSVRLARDTFCLSDTVEGSVAVDVEGTSHDVAAAAPSAVR
                     VALRAVEEAGKRHAIEHMALVTTVAGPSTAHEEAAAAALRESVNRFTTEAARRHPLLG
                     VPVSTDSTMLVEGAASEHYTYSAGAGAASNPGGVTSETATSPPQRWEAGGHYVYPFAL
                     QLPPWLPPSYYYKPSAVKSHMSMRYTVAAFVVCGVEEADVDVVPREFRLQMTVLVPCT
                     PLPAKAWRGSSCTSDGGAEGADKRGTCASAPLLSPVRFLLPAEIPQLLERLPAAQLVD
                     FTVLSALPKRELQQCVERVSISPPFREKLTYHIYKYSLVLRGLLRNKPYTAVDVCITY
                     DSGAAVLLCGRQQSVVRGGVALGLAAPHGNDSGDAPAALSSAGSGVAPGGLTVMGTVV
                     GGEYSRAPRIHTDNHGMAPSPLGKRARGRQSPAAADPHTGDSANSLWRDGEGAGGSQL
                     SALSACTEPAINGALRLHVRVRTGSVAVSKVRVKLLERVRCTSAPATQPNDVYTLATY
                     THSEKIHANTSTEFPIELALPKQFRHIAADNEKYPPPAGITTAAVHTTTWLQITFPSL
                     HAVSEAQLAENVVLVGEDVDLTDTVPFLPCACPVRTL"
     gene            <134448..>137201
                     /locus_tag="LMJF_35_0460"
                     /db_xref="GeneID:12982232"
     mRNA            <134448..>137201
                     /locus_tag="LMJF_35_0460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722395.1"
                     /db_xref="GeneID:12982232"
     CDS             134448..137201
                     /locus_tag="LMJF_35_0460"
                     /note="previous protein_id=AAZ14275.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722443.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982232"
                     /db_xref="InterPro:IPR018928"
                     /db_xref="UniProtKB/TrEMBL:E9AEM3"
                     /translation="MPGADAVTRHPAATENAMLHHRLHSSEGVKSGVLPSSRVSLLAT
                     LCGCLTLTVALVASAPTQKGGLVVLLVWAYRMVRETMRVYLAPQSRCSLYRSPKPHRH
                     ALAQGAVCIAVLYVSLLVWLARPARAAFVSSSLISYCSDSGDENISCTKKMVVTVTVE
                     GEQLPGEESLLFLNSATDMTVNNGTSVQFSPLRITTSRSAVRYRYPLFYVQNYNAKPY
                     EATVKGSLLNQCNADFNADTATCGLAYDAAGKAIPYSQGFCCDCSMCQTLGLCQPDAR
                     ANAACNVFGKYTTASCLRFAQRWYSGYTIGGYMTWYTVNLTLSRNVSDSGGAGAAEKV
                     VMRLSPSNNGEVAGEGWDVMARIVGTYAPVDQPLDLTSRMLFAPAIPPNDARVQAGAA
                     EWLLLPTNLVTLDGRECDKVGVSYEAFASQGNKCNLRPGSCLSSQLEDYRTADLQRIA
                     AGNKGQYMATSFGDFNLENDAATSPYISYLAASPAATMISITVSADDLEYTVGLASGK
                     IISTDMNKPTLQAGTADGVMTVMVRNTAAVTGRLVVGTLNCSDGVFPMTAQKLSLAAQ
                     QQSAVTFKVYVQSSHASGNASCTVVVRNAHEVITDLRVVSWKVSSTNFHNGTQGGSAA
                     DGSGGGSTEESSAASCLNCRTLDIACAVRRRCWQLILLDLFVYLLIIAVILCVIFFWR
                     VFCCCLYLLGRQHRRGSAGEAEPKNEASRWGAYWKRRGESDATSSSRQTDHKNSGSSD
                     VLLQAAAPVSPAPPPAPAMMYVPIPVSYEPAPFATRSGGEEAASPAASFTPFLQALPP
                     PPAAAHPLALMPPPRWCPYGNEEAIDPGEGPCATHAFPPHSPIGSFAFAAPPACPAPR
                     YGEEWSGCGSVTSTSPLTPSRSTQEGSPYNKEARCTPRAFQRSWASTPRRPPSPGAHA
                     PYL"
     gene            <141624..>142214
                     /locus_tag="LMJF_35_0470"
                     /db_xref="GeneID:12982233"
     mRNA            <141624..>142214
                     /locus_tag="LMJF_35_0470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722396.1"
                     /db_xref="GeneID:12982233"
     CDS             141624..142214
                     /locus_tag="LMJF_35_0470"
                     /note="previous protein_id=AAZ14276.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722444.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982233"
                     /db_xref="UniProtKB/TrEMBL:E9AEM4"
                     /translation="MNRLLFSPPPPTLPPAALLHLSEVLLLGFTLLSLGCCACRRASD
                     PAGDFDDEMEDRGDNVSRSASLLIPATRLASPAERGFCSTSSGTSGAGDDNAVVSVGS
                     TEGVSAAAMGVAADASAAPAPFSPLAAAAPLLIHLNRLLLENKLFIAVNWLPLVPNCL
                     TYFLRPSQVLYTFLFTNDHLVLHAVSPRSPLPTPVS"
     gene            <142670..>143086
                     /locus_tag="LMJF_35_0480"
                     /db_xref="GeneID:12982234"
     mRNA            <142670..>143086
                     /locus_tag="LMJF_35_0480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722397.1"
                     /db_xref="GeneID:12982234"
     CDS             142670..143086
                     /locus_tag="LMJF_35_0480"
                     /note="previous protein_id=AAZ14277.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722445.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982234"
                     /db_xref="UniProtKB/TrEMBL:E9AEM5"
                     /translation="MLFIFHRYHLFFELGRLFGYVSAVTSVFLCGMELGCMLVHLRRR
                     WQRRRKAQTRGEGAAADALSSTDDAMHRPNPYGAIQRLPVAYLDEHLSACATLYVWTL
                     LEGDVLWVLHTALVRWYVCSLAFMVLSLLKCLRVFF"
     gene            <147371..>152404
                     /locus_tag="LMJF_35_0490"
                     /db_xref="GeneID:12982235"
     mRNA            <147371..>152404
                     /locus_tag="LMJF_35_0490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722398.1"
                     /db_xref="GeneID:12982235"
     CDS             147371..152404
                     /locus_tag="LMJF_35_0490"
                     /note="previous protein_id=AAZ14278.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722446.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982235"
                     /db_xref="GOA:E9AEM6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:E9AEM6"
                     /translation="MSWNATSFFTGSLDLEDEVKVLGDYVVGHRLGEGAYGSVYVVKY
                     LPSGDRFALKILQKQDLFTSSGIYPVAYYDADGGAAPWEAEGAESHPLGGAPVPTVAA
                     LAKTFEQQIISEAMVMQALEHPHVVKFYKFLNSTTAFYFVMELAEGGKLLDLILSKSY
                     FAEDEARMYFQQLISAIDYCHRNGVAHKDLKAENLLLSDDGRLLVCDFGFSSKIAKEN
                     IDDPEQTIGTGGNAALLDTINNGGMFGTLHYTSPEAVMASSQQWKLAFVGNMAVPAET
                     LGIPEDQQQGGPARYSPSSTATPWSSFSTSSSSASHTSSCSGSLARGWRRKAAEVVSS
                     KHWKARGKISGKGSGASLRTSNSTSLIDEAGTAHKLSADKRRVRPDSLTPLPSATEAA
                     APGSSLHRAGSTHSLASATNSHKHKWVSPTSGLNKVGEGLSILVKSLMGSNGSSSGGH
                     HHHHHSHDSHARSSHAKPPQEKQTAIVVRSSADAKAKLKRTSSTAAFSVGGEAEEGPS
                     AAHQPLRHLRTNAPSQARVPSPSSGMSPAVSPNTSSFASPRFHESVAAAAACIADSPT
                     AAGAAKLSTHSSPAGSPTDSKSVITSPARHRPGTKDGGAVSDADVGEFGPPVTAFDRD
                     AVGAPPLPLPVPPTTASTLKAPNSSSAPPRTLHHCHQAHEHKHHHHRHRQPRSNSSSQ
                     ILGTSTPCKSQLIIVDPFQQDLWSAGVILFFMLTGRLPFEGRDEEETLHLIQVNEFAF
                     ADEEAQRISPAARRLVAQMLAPEPTDRPTIEQIIANPWFRRDLQLEKDFPHRKDLMEA
                     LGSARPASALRHPLPPKSAKGARLTADASAGPSGAGRGSDTSAWMSTSHGVSSSCGSS
                     VTNAAAVSPHFHSFAPDARAPVPLVPSRDTSLNTGSSAHPGGAPGSSPGSDQHRDASA
                     PTTCNFLDFSTHHSVTPEEEWVLETAFRKVDSDGYGCITRDQVRDMLTTLHGDVVPTE
                     DVDELVRLFTGDASAASITFQQFRDAWVSKDLAHTPFSHNSEFQLVNIIGTEMDAIER
                     GVVRQLRTAFNSLDESHRGVIQLHQVQRVFERCHIAVHKEDCLSFIKYFHETELACCT
                     DWAPLHSQRRGPAPNTMSLLHASGTASPRGLAKVHSLPPATGSTHCSSPATTHYGATT
                     PKLPSETGDADTAATTTTTAGGTTYTGSQGTSRGAPKPPLSPSSITVSFNSFVHGIVK
                     SDILLKHPLGRKLAAATNLAALFQSRNVTECVRHGFLVTGLQNVILAKLTSMPEQLQL
                     LHSDEVVSNAENVYSFRYLGSSALMTIPTTSTATPPMSSPLVAMTASTGPATTSSPLE
                     LQGRFSAQHRDHATPAVSSLQRRTVSSDAGNGPTGSVAATSNAGTHLHNPSPCLSDQS
                     TVRSRATCTKPPSASHHTLARADSPGSVMHSPSPEKVSGSTLTSCSTLASQSQRSPTV
                     SMHCSSSGPRATGGTTAHRIASRSSSARGTTPSHAVGLSCPSNSLQHSPTSRCARIRH
                     LCGQDARTDPHHDTGHNDDGVRDDTHDFSSCPHNSSSAVNTAIDDSHSKRSRAALSSS
                     VGEELKDTNTTPVAGGRRRVKENVTQFPFPSISSAVAILPTTPAALAHREMAYSSSDP
                     VTLVNGVCDIDVILSPASLGYTMMQFRCMHGDTSDFHEAVAFISNALELEREQAMQDT
                     MTRGESELM"
     STS             156912..158172
                     /standard_name="ha2363"
                     /db_xref="UniSTS:515534"
     gene            <157801..>162108
                     /locus_tag="LMJF_35_0500"
                     /db_xref="GeneID:12982236"
     mRNA            <157801..>162108
                     /locus_tag="LMJF_35_0500"
                     /product="putative proteophosphoglycan ppg3"
                     /transcript_id="XM_003722399.1"
                     /db_xref="GeneID:12982236"
     CDS             157801..162108
                     /locus_tag="LMJF_35_0500"
                     /note="previous protein_id=AAZ14279.1"
                     /codon_start=1
                     /product="putative proteophosphoglycan ppg3"
                     /protein_id="XP_003722447.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982236"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR025875"
                     /db_xref="UniProtKB/TrEMBL:E9AEM7"
                     /translation="MSFHRRRCTRQHPAVAAALLCAAAVLTFICVGVHSASDEAGTLD
                     CSVPVPNYSAAEQQHTRMFLDAIKATIPALASVWTCDNFCAHEGVECTEAGLHVRLNV
                     NDLIGNLPEIPEGVIGSSVVVTKLTFSGDINNLKGTLPVSWHQLTALSSLVFISTGIT
                     DTPPEMRGTSIESRVTTHDAGFVPAAWATTTPRRSSLPVSRVSDNMVGSPHSAWAGAS
                     RMERDYLQNKASGRSLPEEWGNLINIKVLNLTNLNLSGTLPASWASLQRLEQLHAANN
                     LLTGTLPASWGSLKKLFDLQLIGNKFTGTIPQEWGEMTALQRVSLQLDYCTCIPESWI
                     ARKVEVRLYSTVLGSDCEITSDCSSSSSSPGLECDGPVPFYTPSQQMHTRNFLEAFKY
                     TITDLQPLWTCTNFCVWEYVHCTPAGVALEITGTQFFGSVPEVPADVNPSEVVVTKLD
                     FSHSEWVEGDYPSSWALLTSLENVSFAYTSMWGTLPSRWSSMSALKYLDLSFTWTDGR
                     FPESWSRLANLEVLRLVHLTIPDHLPASWSSMRALQELDLDSTGASGTLPPSWGALTN
                     LEILSLSNNNLDATLPGEWSSLTQLRTLHLHDNQLSGTIPETYNAMITLTRVSLEVNR
                     FCGCLPSTWADKNGVSMMITAQPELLASDCATENACKPETESSSSAPSASSSSASSSS
                     SSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPS
                     SSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSS
                     APSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSA
                     SSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS
                     SAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSPAPSASSSSAPS
                     SSSSAPSASSSSAPSSSSSAPLVSSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSS
                     SAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPS
                     ASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSS
                     APSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSS
                     SSSFLSGSGSDGGCHSDVPYYTPTQVAHSMRFLSGFSESFADASATWKCPNFCSWAGI
                     TCRPEGFSFELGGVVKSGYLPMVPGDCDGVQVPVLSVSAGGAEGGVTLEGTLPSSWNR
                     LLSLIELDFSYTGVSGGAPSDWSALVNLKKLNLGHNKLSGELPAEWSGMVAMEELYLN
                     DNKFSGKLPFEWFNMENLKILDLSNNELGGSVPGFIVSLSRSHDVSALLKRLLAVRK"
     gene            <166485..>188069
                     /locus_tag="LMJF_35_0520"
                     /db_xref="GeneID:12982237"
     mRNA            <166485..>188069
                     /locus_tag="LMJF_35_0520"
                     /product="proteophosphoglycan ppg4"
                     /transcript_id="XM_003722400.1"
                     /db_xref="GeneID:12982237"
     CDS             166485..188069
                     /locus_tag="LMJF_35_0520"
                     /note="previous protein_id=AAZ14280.1"
                     /codon_start=1
                     /product="proteophosphoglycan ppg4"
                     /protein_id="XP_003722448.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982237"
                     /db_xref="UniProtKB/TrEMBL:E9AEM8"
                     /translation="MALLHSIISTPRQHRHTALIAVSLLAVVLVFWGAGAHAADDDAD
                     VSACSGSSPYYTAVEHENTRSFLDSFKEAIPALKSLWTCDNFCVHPGIHCTAVGLHIT
                     LNASALSGSLPELPNNVDGFHVVLSGLTFVGKGERVIGSLPVSWNLLTRLSYLHVGAT
                     ALSGTLPETWGTSVERRVMTRHSRAPLARPCGNSCFRSIRLGGNHLTGTLPASWSSMK
                     DLQEIWINNNLFTGTLPTEWSSIANLRTLNARHNLITGTLPPEWSSMPSIREIAIDHN
                     MFCGCVPDTWKQTSGLAIDADTPLRAPDCAVSNSCEKHPTSSSSSAPSASSSSAPSSS
                     SSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSS
                     APSSSSSSAPSVSSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSA
                     SSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSA
                     PSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSS
                     SSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPS
                     SSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSA
                     PSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSS
                     SAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAP
                     SASSSSAPSSSSSSAPSASSSSAPSSSSSAPSSSSSSSPSSSSSAPSASSSSSPSTSS
                     SSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAP
                     SSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASS
                     SSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAP
                     SASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSLSAPSSSS
                     SAPSASSSSAPSSSSSSALSASSSSAPSSSSSAPSASSSSAPSSSSSSALSASSSSAP
                     SSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSS
                     SAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSA
                     PSASSSSAPSSSSSTAPSASSSSAPSSSSSTAPSASSSSAPSSSSSSAPSASSSSAPS
                     SSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSTAPSASSSSAPSSSSSSAPSASS
                     SSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSA
                     PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSS
                     SSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAP
                     SSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASS
                     SSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSA
                     LSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSS
                     SSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASS
                     SSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSA
                     SSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSA
                     PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSS
                     SSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAP
                     SSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSA
                     SSSSAPSSSSSAPSASSSSAPSSSRLRSSSSSAPSASSSSAPSSSSSAPSASSSSAPS
                     SSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPLASSSSAPSSSSSSAPLASSS
                     SAPSSSSSSAPSASSSSAPSSSSSSAPSGSSSSAPSSSSSAPSASSSSAPSSSSSAPS
                     ASSSSAPSSSSSSAPSGSSSSAPSSSSSAPSGSSSSAPSSSSSAPSASSSSAPSSSSS
                     TAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPS
                     SSSSTAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSS
                     APSSSSSSAPSGSSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPS
                     GSSSSAPSSSSSTAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSS
                     SAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSTAPSASSSSAPSS
                     SSSSAPLASSSSAPSSSSSSAPSASSSSAPSSSSTAPSASSSSAPSSSSSAPSASSSS
                     APSSSSSAPSASSSSAPSSSSSAPSANSSSAPSSSSSSAPSASSSSAPSSSSSAPSAS
                     SSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPS
                     ASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSS
                     APSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPS
                     SSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSA
                     PSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSS
                     SAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAP
                     SASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSS
                     SSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSS
                     APSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPS
                     ASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPLASSSSAPSSSST
                     APSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSS
                     SSSAPSASSSSAPSSSSSSAPLASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSS
                     SAPSSSSSSAPSASSSSAPSSSSSSAPLASSSSAPSSSSTAPSASSSSAPSSSSSSAP
                     SASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSSAPSASSSSAPSS
                     SSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSA
                     PSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASS
                     SSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSFAPSSSSSSAPS
                     ASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS
                     APSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSS
                     SSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSS
                     SAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPS
                     ASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSS
                     SAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPS
                     SSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSS
                     APSSSSSSAPSASSSSAPSSSSSSTPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSA
                     SSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS
                     SAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPS
                     SSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSS
                     SAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPS
                     ASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSS
                     SAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSS
                     SSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSS
                     SAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSA
                     SSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSS
                     APSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSS
                     SSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSA
                     PSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSA
                     SSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSS
                     SAPSASSSSAPSSSSSAPSASSSSAPSNSSSSAPSASSSSAPSSSSSSAPSASSSSAP
                     SSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSS
                     SAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSA
                     SSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSS
                     SSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSA
                     PSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSAS
                     SSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSA
                     PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSS
                     SSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAP
                     SSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSS
                     SAPSSSSSSAPSASSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAP
                     SSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSAS
                     SSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAP
                     SASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPLASSSSAPSSSS
                     SSAPSASSSSAPSSSSSSAPLASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSA
                     PSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPLASSSSAPSSSSSSAPSAS
                     SSSAPSSSSTAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSA
                     PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSS
                     SSAPSASSSSAPSSSSSAPSASSSSALSSSSSAPSASSSSAPSSSSSAPSASSSSAPS
                     SSSSAPSASSSSAPSSSSSSAPSGSSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSS
                     APSSSSSTAPSASSSSAPSSSSSSAPLASSSSAPSSSSSSAPSASSSSAPSSSSSTAP
                     SASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSTAPSASSSSAPSS
                     SSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSTAPSASSS
                     SAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSA
                     SSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSS
                     APSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSS
                     SSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSS
                     APSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSAS
                     SSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSS
                     APSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAP
                     SSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSS
                     SAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPS
                     ASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSA
                     PSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSS
                     SSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAP
                     SSSSSAPSASSSSAPSSSSSFLSGSGSDGGCHSDVPYYTPTQVAHSMRFLSGFSESFA
                     DASATWKCPNFCSWAGITCRPEGFSFELGGVVKSGYLPMVPGDCDGVQVPVLSVSAGG
                     AEGGVTLEGTLPSSWNRLLSLIELDFSYTGVSGGAPSDWSALVNLKKLNLGHNKLSGE
                     LPAEWSGMVAMEELYLNDNKFSGKLPFEWFNMENLKILDLSNNELGGSVPGFIVSLSR
                     SHDVSALLKRLLAVRK"
     gene            <193479..>245657
                     /locus_tag="LMJF_35_0540"
                     /db_xref="GeneID:12982238"
     mRNA            <193479..>245657
                     /locus_tag="LMJF_35_0540"
                     /product="proteophosphoglycan 5"
                     /transcript_id="XM_003722401.1"
                     /db_xref="GeneID:12982238"
     CDS             193479..245657
                     /locus_tag="LMJF_35_0540"
                     /note="previous protein_id=AAZ14281.1"
                     /codon_start=1
                     /product="proteophosphoglycan 5"
                     /protein_id="XP_003722449.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982238"
                     /db_xref="UniProtKB/TrEMBL:E9AEM9"
                     /translation="MALLHSIISTPRQHRHTALIAVSLLAVVLVFWGAGAHAADDDAD
                     VSACSGSSPYYTAVEHENTRSFLDSFKEAIPALKSLWTCDNFCVHPGIHCTAVGLHIT
                     LNASALSGSLPELPNNVDGFHVVLSGLTFVGKGERVIGSLPVSWNLLTRLSYLHVGAT
                     ALSGTLPETWGTSVERRVMTRHSRAPLARPCGNSCFRSIRLGGNHLTGTLPASWSSMK
                     DLQEIWINNNLFTGTLPTEWSSIANLRTLNARHNLITGTLPPEWSSMPSIREIAIDHN
                     MFCGCVPDTWKQTSGLAIDADTPLRAPDCAVSNSCEKHPTSSSSSAPSASSSSAPSSS
                     SSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSS
                     APSSSSSSAPSVSSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSA
                     SSSSAPSSSSSSAPLASSSSAPSSSSSSAPLASSSSAPSSSSSSAPSASSSSAPSSSS
                     SSAPSASSSSAPSSSSSTAPSASSSSAPSSSSSTAPSASSSSAPSSSSSTAPSASSSS
                     APSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSTAPSASSSSAPSSSSSAPSAS
                     SSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAP
                     SASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSS
                     SSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSA
                     PSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSAS
                     SSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAP
                     SASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSS
                     SAPLASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPS
                     SSSSSAPLASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSS
                     SAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPLASSSSAPSSSSSSAPS
                     ASSSSAPSSSSTAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSS
                     SSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSA
                     PSSSSTAPSASSSYAPSSSSSAPSASSSCAPSSSSSTAPSASSSFAPSSSSTAPSASS
                     SSAPSSSSSAPSASSSSAPSSSSSTAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPS
                     ASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSS
                     SAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSA
                     PSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSTAPSASSSSAPSSSSSTAPSA
                     SSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSA
                     PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSS
                     SSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSS
                     APSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPS
                     ASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSS
                     TAPLASSSSAPSSSSSTAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAP
                     SSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPLASS
                     SSAPSSSSSTAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAP
                     SGSSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSS
                     SSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSS
                     APSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSTAPSASSSSAPSSSSSTAPS
                     ASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSS
                     STAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSA
                     PSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSS
                     SAPSSSSSSAPSGSSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSTAPS
                     ASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSS
                     STAPSASSSSAPSSSSSTAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSA
                     PSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSS
                     SAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSA
                     SSSSAPSSSSSTAPSASSSSAPSSSSSSAPLASSSSAPSSSSSAPSASSSSAPSSSSS
                     APSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSS
                     SSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSS
                     APSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSAS
                     SSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPLASSSSAPSSSSSSA
                     PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSS
                     SAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPS
                     SSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSS
                     APSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASS
                     SSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPS
                     ASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSS
                     SSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSA
                     PSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPS
                     ASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS
                     SAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPS
                     SSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSS
                     SAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSTAPLASSSSAPSSSSSAPSA
                     SSSSAPSSSSSSAPSASSSSAPSSSSSSAPLASSSSAPSSSSSTAPSASSSSAPSSSS
                     SSAPSASSSSAPSSSSSTAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAP
                     SSSSSAPSASSSSAPSSSSSSAPSGSSSSAPSSSSSAPSASSSSAPSSSSSAPSASSS
                     SAPSSSSSTAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAP
                     SGSSSSAPSSSSSAPSASSSSAPSSSSSTAPSASSSSAPSSSSTAPSASSSSAPSSSS
                     SSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSA
                     PSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSAS
                     SSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSS
                     APSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPS
                     SSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSTSSAPSASSS
                     SAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPS
                     ASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSS
                     APSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPS
                     SSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASS
                     SSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAP
                     SASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSTSSAPSASSSSAPSSSS
                     SSAPSASSSSAPSSSSSAPSASSSSAPSSSTSSAPSASSSSAPSSSSSAPSASSSSAP
                     SSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSAS
                     SSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSTSSAPSASSSSAPSSSSSSA
                     PSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSS
                     SSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASS
                     SSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSTAPSA
                     SSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPLASSSSAPSSSSS
                     SAPSASSSSAPSSSSSAPSASSSSAPSSSSTAPSGSSSSAPSSSSSAPSASSSSAPSS
                     SSSSAPLASSSSAPSSSSTAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSS
                     APSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASS
                     SSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPLASSSSAPSSSSSS
                     APSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAP
                     SSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASS
                     SSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAP
                     SASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSS
                     SSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSS
                     APSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSA
                     SSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS
                     SAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPLASSSSAPSSSSSSAPSASSSSAP
                     SSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSA
                     SSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSA
                     PSASSSSAPSSSSSSAPLASSSSAPSSSSTAPSASSSSAPSSSSSSAPSASSSSAPSS
                     SSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPLASSSSA
                     PSSSSTAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPLAS
                     SSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSA
                     PSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSTAPSASSSSAPSS
                     SSTAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSS
                     SAPSSSSSSAPSASSSSASSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPS
                     ASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSA
                     PSASSSSAPSSSSSTAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSS
                     SSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSA
                     PSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSA
                     SSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSA
                     PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSS
                     SSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPS
                     SSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASS
                     SSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSTSSAPSASSSSAPSSSSSSA
                     PSASSSSAPSSSSSSAPSGSSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPS
                     SSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSS
                     SAPSSSSSAPSASSSSAPSSSSSTAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSA
                     SSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSST
                     APSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPS
                     SSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASS
                     SSAPSSSSSAPSASSSSAPSSSSSAPSACSSSAPSSSSSAPSASSSSAPSSSSSSAPS
                     ASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS
                     SAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSA
                     PSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSA
                     SSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSS
                     APSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSS
                     SSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSS
                     SAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSA
                     SSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS
                     APSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSS
                     SSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSGSSSS
                     APSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSG
                     SSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSS
                     TAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAP
                     SSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSAS
                     SSSAPSSSSSSAPSASSSSAPSSSSTAPSASSSSAPSSSSSAPSASSSSAPSSSSSAP
                     SASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSS
                     SAPSASSSSAPSSSSSSAPSASSSSAPSSSSSTAPSASSSSAPSSSSSTAPSASSSSA
                     PSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASS
                     SSAPSSSSSAPLASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPS
                     ASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSS
                     SSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAP
                     SSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSS
                     SAPSSSSSAPSASSSSAPSSSSSTAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSA
                     SSSSALSSSSSTAPSGSSSSAPSSSSSAPSGSSSSAPSSSSSAPSASSSSAPSSSSST
                     APSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPS
                     SSSSTAPSGSSSSAPSSSSSSAPSGSSSSAPSSSSSSAPSASSSSAPSSSSSSAPSAS
                     SSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSA
                     PSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSS
                     SSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSS
                     APSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSALSASSSSAPSSSSSAPSAS
                     SSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS
                     SAPPAFSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPS
                     SSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSAS
                     SSSAPSSSSSSAPSASSSSAPSSSSIRAIGVLVVCAVQQQQSAPSASSSSAPSSSSSS
                     APSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAP
                     SSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPS
                     ASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSS
                     SAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPS
                     SSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASS
                     SSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSA
                     PSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSS
                     SSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSALSASSSSAPSSSSSSAPSASS
                     SSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSALSASSSSAPSSSSSA
                     PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSALSASSSSAPSSS
                     SSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSS
                     SAPSSSSSSALSASSSSAPSSSSSAPSASSSSAPSSSSSTAPLASSSSAPSSSSSSAP
                     SASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSS
                     SSSAPSASSSSAPSSNSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSS
                     APSSSSSAPSASSSSAPSSSSSTAPSASSSSAPSSSSTAPSASSSSAPSSSSSSAPSA
                     SSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSS
                     SAPLASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPLASSSSA
                     PSSSSSTAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPS
                     ASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS
                     SAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPS
                     SSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSS
                     APSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSA
                     SSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAP
                     SASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSS
                     SSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSTAPSASSSSAPSSSSSSAPSASSSS
                     APSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASS
                     SSAPSSSSSAPSASSSSAPSSSSTAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSA
                     SSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSS
                     APSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSS
                     SSSAPSASSSSAPSSSSSSAPLASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSS
                     SAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAP
                     SASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSSAPSASSSSAPSS
                     SSSTAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSS
                     SAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAP
                     SASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSS
                     SAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAP
                     SSSSSSAPSASSSSAPSSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSAS
                     SSSAPSSSSSSAPSASPSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSA
                     PSASSSSAPSSSSSAPSASSSSAPSGSSSAPSASSSSAPSSSSSSAPSASSSSAPSSS
                     SSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSS
                     SAPSSSSSSAPSASSSSAPSSSSSAPSASSSSVPSSGSSDDCYASVPFYGAGQRRSTR
                     KFLEAFKVTIPVLRDIWVCPNFCAWRYVRCRSSGVALEMAGADLAGSLPDIPAGVDAN
                     DVVVNKVDMSDVVDLGYAFPASWGALVSMQYMAVPGTLIFGSLPPEWSGMSSLEYFDA
                     SSTMITGQLPSSWSRLNNLKVLRITEAMLSGTLPESWSSMSSLEELRLGRNTIDGSPP
                     PSWCSLENLHTLNLQNNILQGTLPTSWGRLSNMEDFRINNNQLIASIPESYSQWTKIR
                     NAQMHVNNFCGCLPSRWIATNGLTMSANADPPVMATDCNIINSCRETSSPSSSSAPSS
                     SSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPLASSSSAPSSSSSAPSASSSS
                     APSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPS
                     ASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSS
                     APSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAP
                     SSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSS
                     SAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPS
                     ASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSS
                     SSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAP
                     SSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASS
                     SSAPSSSSSSAPSASSSSAPSSSSSTAPSASSSSAPSSSSTAPSASSSSAPSSSSSSA
                     PSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPS
                     SSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSGSS
                     SSAPSSSSSAPSASSSSAPSSSSSSAPLASSSSAPSSSSSSAPSASSSSAPSSSSSSA
                     PSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSS
                     SSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSASSASSSS
                     APSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASS
                     SSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAP
                     SASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSS
                     SAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAP
                     SSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASS
                     SSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSA
                     PSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSS
                     SSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSS
                     APSSSSSSAPSVSSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPS
                     ASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSTAPLASSSSAPSSSSS
                     APSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSTAPSASSSSAP
                     SSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSA
                     SSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS
                     APSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSTAPSASSSSAPSS
                     SSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAP
                     SSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASS
                     SSAPSSSSSAPSASSSSAPSSSSSTAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSA
                     PSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSS
                     SSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSS
                     APSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSA
                     SSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSS
                     APSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAP
                     SSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSAS
                     SSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS
                     TAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSS
                     SSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSS
                     SAPSSSSSTAPSASSSSAPSSSSSTAPSASSSSAPSSSSSSAPLASSSSAPSSSSSTA
                     PSASSSSAPSSSSSSAPLASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSS
                     SSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASS
                     SSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSS
                     APSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPS
                     SSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASS
                     SSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSA
                     SSSSAPSSSSSAPSASSSSAPSSSSSSAPLASSSSAPSSSSSSAPSASSSSAPSSSST
                     APSASSSSAPSSSSSSAPSASSSSAPSSSSSTALSASSSSAPSSSSSSAPSASSSSAP
                     SSSTSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSA
                     SSSSAPSSSTSSAPSASSSSAPSSSTSSAPSASSSSAPSSSSSSAPSASSSSAPSSSS
                     SSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSA
                     PSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSAS
                     SSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSA
                     PSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSS
                     SSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSA
                     PSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPS
                     ASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSS
                     SSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSS
                     APSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSA
                     SSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS
                     SAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAP
                     SSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSA
                     SSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSS
                     APSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPS
                     SSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSS
                     APSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAP
                     SASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSS
                     SSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSS
                     SAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPS
                     ASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSS
                     SSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSTAPSASSSSAPSSSSSSAPSASSSS
                     APSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSGSSSSAPSSSSSAPSA
                     SSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSS
                     SAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPS
                     SSSSTAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASS
                     SSAPSSSSSSAPSASSSSAPSSSSSAPSASSLSAPSSSSSAPSASSSSAPSSSSSAPS
                     ASSSSAPSSSSSSALSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSS
                     SSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSS
                     APSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSTSSAPSASSSSAPSSSSSAPSA
                     SSSSAPSSSSSSAPSGSSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSA
                     PSASSSSAPSSSSSSAPLASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPS
                     SSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSAS
                     SSSAPSSSSTAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSTAP
                     SASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSS
                     SSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSS
                     APSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSTAPS
                     ASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSS
                     SSAPLASSSSAPSSSSSSAPSASSSSAPSSSSTAPSASSSSAPSSSSSAPSASSSSAP
                     SSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSS
                     APSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPS
                     ASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSS
                     SSAPSASSSSAPSSSSSLECYGEIPYYSVSEVENTRLFLMSVRESFPALIPLWVCPNF
                     CSWPGIYCAPAGVVMDLSEMQLQGSLPSIGEMCDPSEVVLRVVDFGGAEMSVEVSGTL
                     PENWSGLTRLERLDLSYTGVSGTLPPAWSALSSLEYLNLGYNDLFGTLPYSWGLFPSL
                     REIYLNDNSLSGGIPSSWMHLAGFEVLDLTNNQLEGSLPSLIVSSQRTFGATATEPRL
                     QWKRRS"
     gene            <254266..>261543
                     /locus_tag="LMJF_35_0550"
                     /db_xref="GeneID:12982239"
     mRNA            <254266..>261543
                     /locus_tag="LMJF_35_0550"
                     /product="proteophosphoglycan ppg1"
                     /transcript_id="XM_003722402.1"
                     /db_xref="GeneID:12982239"
     CDS             254266..261543
                     /locus_tag="LMJF_35_0550"
                     /note="previous protein_id=AAZ14282.1"
                     /codon_start=1
                     /product="proteophosphoglycan ppg1"
                     /protein_id="XP_003722450.1"
                     /db_xref="GeneID:12982239"
                     /db_xref="InterPro:IPR025875"
                     /db_xref="UniProtKB/TrEMBL:E9AEN0"
                     /translation="MTLQQFSAQGARRTPKRQWQPAVPKLIIVAVTVLASFVSGTTAA
                     NPCIMGGKPAALIEKVVDCTGRDTIPFYTVEQQANTLAFLAEFPYTIAALSKTWVCRN
                     FCEWDGVHCSAEGVEVRLDSRQVVGRLPEVPTAVDAEQVMVTHFAVEGEGDGIKGGLP
                     ESWRKLGQLKSLEISLDYSSPASKSFEVQNNVYTVRTMIGTASRKELNRCFIPRNAEN
                     VSLNSNRMSGTLPPNLPICNPKMKYLYLHNNTGLQGTIPKEWGSWTSLQIINIELTNL
                     CGCPPKEWDTFNPSVIVLAADRITDPDLCKISCKDSSSSSPELECDGPVPFYTPSQQM
                     HTRNFLEAFKYTITDLQPLWTCTNFCVWEYVHCTPAGVALEITGTQFFGSVPEVPADV
                     NPSEVVVTKLDFSHSKWVEGDYPSSWALLTSLENVSFAYTSMWGTLPSRWSSMSALKY
                     LDFSFTWTGGRFPESWSRLANLEVLRLVHLTIPDHLPASWSSMSALQELDLDSTGASG
                     TLPPSWGALTNLEILSLSNNNLDATLPGEWSSLTQLRTLHLHDNQLSGTIPETYNAMI
                     TLTRVSLEVNRFCGCLPSTWADKNGVSMMITAQPELLASDCATENACKPETESSSSAP
                     SASSSSASSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSS
                     SSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAP
                     SSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASS
                     SSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSASSSSSSA
                     PSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSS
                     SSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSS
                     SAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPS
                     ASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSS
                     SAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSS
                     SSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSS
                     SAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPS
                     ASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSS
                     APSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSS
                     SSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSS
                     SAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSA
                     SSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSA
                     PSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSS
                     SSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSS
                     APSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAP
                     SASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSS
                     SSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSA
                     PSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSA
                     SSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSA
                     PSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSS
                     SSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSS
                     APSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSA
                     SSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSA
                     PSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSS
                     SSSSAPSASSSSAPSSSSSAPSSSSTTTTMDPTPDPVLPSSSSSSSHADTYFYDRLYL
                     LCPNAEETGVDMISMHKNDICCTEWEGSDHSTSCGDNIKNYSKAIVTCSGALGSRGYF
                     SCCTRVGPNGVGEFLGTRCQDSSVDGVEGPLTRGTWWNLRTSSGRLWVTLASVIAIAV
                     MST"
     gene            <268999..>272217
                     /locus_tag="LMJF_35_0560"
                     /db_xref="GeneID:12982240"
     mRNA            <268999..>272217
                     /locus_tag="LMJF_35_0560"
                     /product="putative phosphatidylinositol-4-phosphate
                     5-kinase-like"
                     /transcript_id="XM_003722403.1"
                     /db_xref="GeneID:12982240"
     CDS             268999..272217
                     /locus_tag="LMJF_35_0560"
                     /note="previous protein_id=AAZ14283.1"
                     /codon_start=1
                     /product="putative phosphatidylinositol-4-phosphate
                     5-kinase-like"
                     /protein_id="XP_003722451.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982240"
                     /db_xref="GOA:E9AEN1"
                     /db_xref="InterPro:IPR002498"
                     /db_xref="InterPro:IPR023610"
                     /db_xref="InterPro:IPR027483"
                     /db_xref="InterPro:IPR027484"
                     /db_xref="UniProtKB/TrEMBL:E9AEN1"
                     /translation="MESRDAHAKVSVDGGTDEAVPHDREDTVPPPAAPSARTNEREKD
                     LQLRRLRRENHLLRLQLLKLREQQHQLLANTSAAAVCSVSDSALAVSDAAEAEPQQTR
                     SDIIDEQATALRTRMLQRIKERQQRTTVVRSLLRDAEQLHSELPQQEQLEAERGNSSG
                     TDTPVSPASPPVKAAPAQSMEAAAAPPSPAAKLDIIEDGRDQIDQQHALLASPSSATA
                     SRVPPDRSAAYGAHAVDDLSAEAMLQRFQDRKSQRRLRLEQMLGPIYDAAGSGAAGPS
                     RENDSAEITPLGAALRGASAGQGGEGAQSPLDRSVAAWDGRGRRIDSRTRRGRANGHN
                     NAAATATPTYSGSTRNPNQIGRAVSDAVKNNSWYLCKVLEAALLDTIQARPANEATAP
                     VLSSSPEKYLPPGSHSRATSFAEMSSSSSSPGSASFLLGPLSDGRAAGGTSGSTTLTT
                     GTASGIPQPESMAAAPTSVRIPQMLYPKGVSDTALKRAIEESLLLHFRCVQDAPRRLT
                     SSQAAEESLPAFEAENRDAELRRCFAEGTGKDALLSSGARRDDDLGSTAAGNDDEEAP
                     ERESDMLGARDDNLDPFACLLLARLSADLPSKTTKSDWTGNHLSRYSSGKDGAKQPSS
                     TSLNASTASSPTNSKAGVAFVAAASGDRRMHVPKKHFSRLDEVQVEMHAPVIFNQIRD
                     FLRMDVERFRRSFIPTSSASQSDADGGEGTDPRRWRAAQPQQRLRVGASAGADETTAW
                     RITVSPGKSGTTLLYFSDFVMKTVRPREMEFLLRKFLPAYVRYCERNPHTLLPRFYAL
                     ATLRWWKAGVVQHFVLMQNVFTTPYYIHRIYDVKGSTVNRTALQPGKPPPRTAFGALL
                     LKDNDLPPQLIMCGTYQRAIVLAQLRSDVEFLRQLNVVDFSCMIGVRSRLFSREEGPS
                     KTLLLLRGQHHAGHVNTLGSSAVVTQGHIGQTCSEVMHATDKTAAADGESISVGAMEP
                     TLSPSSVDAQRSDYDDDVYVCIHGCDGGLLSLPIYTPGDDTTAREEVYYLGIIDVLQT
                     YNSVKKLESFAKGFVNDRRAISVIAPDKYAERLYKVLERITV"
     gene            <273245..>279604
                     /locus_tag="LMJF_35_0570"
                     /db_xref="GeneID:12982241"
     mRNA            <273245..>279604
                     /locus_tag="LMJF_35_0570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722404.1"
                     /db_xref="GeneID:12982241"
     CDS             273245..279604
                     /locus_tag="LMJF_35_0570"
                     /note="previous protein_id=AAZ14284.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722452.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982241"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:E9AEN2"
                     /translation="MRSSQSGTLTTSPSPPKSPPHDFTPDILPPTPFRLEEAPVYRDD
                     WARHHPFIHLLFHRDIITRLVWCAAACRYVTGGADGAVKLWRSELQPRVSSSHVNSLY
                     SAERPALIPEIHVVTLGGPVTDLRTSGREVGNSEVAVIASTDGTLTLCRTGTGEIIRT
                     LRGARGESLEGCGAVAETRRGPTRAGSGREDAIEDNDNGALGEGSRQVTQCSSKVLTW
                     YAADAYSYRLAPSSDMAVVRRPVYTVRAYRNEAREARASPSNEYFQGLRTVAPTYEHL
                     APHEMMIADVLMHFSVAPTSMTSTHASAMPRQWYACAIALAAAPAVIRTSNIGGCGSG
                     ASSSSQSTLDPLLLLGFPQGLVQVYVLPQRWFALHQHGETRLDTPAVRVPVFSGLLHS
                     AAVLCIEVIVSRDVVVSVSEDGTTQLRRLSCLRVPLRQLNVVVSLPTPMSRVRPSSSM
                     PVPPRASALRQRVGSAHGHSRLVTCCCVDAGQQLLITGSADHTLCWWSLMLGSSSTPI
                     RIVSLRDTATTVVPKGGADGTPSSSSSPPSMAARGGYPVDVSLFRRKLLAECHDEASP
                     DVVSCDDAGGSTSLPRGFQVGLFLLVLDTERVVRIFDALSGKLITHEIESRSAAAAVS
                     SGTVDSVSGVSKDVRLARYDGVNGADRVLLGGLCLVPWYLAHAAESGVTRGHTASIIF
                     TAWCASLKCAVTADARHVLLWRLRTGKQRNPTAQVLRAWHIAAGVRFVALCDTDTADD
                     EPSHLQQPSLFIAHGSEPVIGQYDCLLRDSSQEPGTGGLSQPRLLRQLSLRVGTGVTG
                     ATVDALAAVTLVAKTANVTHAGSAAGVVTTYALAACHVTRGKGYEESHAASEDGRLYV
                     YPLRLSRSTTRPEGSHAPATIDGATELIAPVRELHLSDWRADDKNSIVSVLGLPCVDL
                     LVVGGRRVLYTAPLSSAATSAVPCNPLPPGWAAAQQLNWRGSNLSMRAPRPAAVFPGP
                     LILLDDSTILETADEEAEGQANSSSLVAVELVDSSLTGFLSRLVHIPHDTAASTPDSA
                     EAAVCLVLSGSNDGLVQLWDVQHGRELWQCRAVPTREPITALAVHQHAARWLVAAGDQ
                     SGVVTLLDITSVLQAARQVVAADAQARPRPAASTAGWSVRHGLVGGEGRMLDRWLAHA
                     DTVSGAFFTTVPADVGDAAVTAPQLLTTGEDSVVMLWELPSWTLPSAPHVALIGELSG
                     IPLFRQGEDANKSKRRRYDVPVRVQPSMTKLPRAARQAYEPWRQQYVRERLLGGEDTE
                     LSAALTRFYLHDKSWGGTTASEWMNAAPSEDESEEEAKLIDSAWAVLAADVRAFSQFV
                     DPVEPQGDALAAAPQPRTVVHAWCTSLLPDATAEIPTTTLSSSPPAAKHRPHRDEYRD
                     STYRESATVSFVPSGAAGRPAPLPSPLIFAFADRCCAGRATGGHRSARHCRLSECKAG
                     ASSVRERLRQVLRVVVQNSVGTVSSQCTSGALTGMQQRQSTPLGPSLLPSVADPFASA
                     DDNTLSPPPLLPEGASSVIDSMPCNIEAKNEMLGTPPASAPAPTAPGESFYGVTPNGL
                     SQQVARHGATPRRQLGFTDESSESRSTQPPVPTAPVQNQSSRGYGVHAPLVRRASADR
                     RAGVTAEHGRLLRGKAPGKARHAAMSGSATAPRLLHDHFVDADADLGTEANASHRSLA
                     GGGVAATVMQQVNHHRRREEALQRLITLEQADFGTAGNKTAERKRKLSGAAVGRPAVR
                     SGTVALGLPQCNMRQASAATSQWGRSMAKQPKTRIDGSSQKSGSSHGVVVNPPTAAQV
                     LVSDAYLTPVLRRVGASSALLPDHTAAAQKVTTSVAAASLGSTLVPDSANSAWYVERQ
                     RRRDAAREKARLWNSQRVMKTLLKWTMQPAESCSGVAEPLRTTEGCVKDGHTIALGTK
                     AAIVAHGNALTTTGNTTSQPVLDLPPILTLRHSTDSALLPPVKEAIESPDAAAAALTT
                     LLWVSPTTAIDVAVRHGLPSRKTLRAEMAAAKMRMRQSVQARAAYQREHRAMAVEADD
                     DSDANVAEELGSGDTDCLSEEQRGPGKVASGGGASQRSHESQTVSHHAISVSASISSL
                     GKSGCTPRRALQPHEGAEPRRMATVPLPIATTRQELFGSSTPRRK"
     gene            <281553..>282227
                     /locus_tag="LMJF_35_0580"
                     /db_xref="GeneID:12982242"
     mRNA            <281553..>282227
                     /locus_tag="LMJF_35_0580"
                     /product="conserved SNF-7-like protein"
                     /transcript_id="XM_003722405.1"
                     /db_xref="GeneID:12982242"
     CDS             281553..282227
                     /locus_tag="LMJF_35_0580"
                     /note="previous protein_id=AAZ14285.1"
                     /codon_start=1
                     /product="conserved SNF-7-like protein"
                     /protein_id="XP_003722453.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982242"
                     /db_xref="GOA:E9AEN3"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:E9AEN3"
                     /translation="MNRLFGKANNAPKPTLEDASNRISCRSDVVDARIAKIDAELMKV
                     KEQIQRSRGMTQSRHKQRAVQLLQQKRMYQGQQDMMMQQQFNVDQLHFTTETMKDTHV
                     QVDAMKQANKELRKGMKKLNMDKVENLQDELADLYADTQEIQEIMGRAYSVPEDIDED
                     EMLGELDALDFDMEKENDADYLADALAMPGTKLPDVPTDSKVDAGSQKESNTVDPYSL
                     EQQLGL"
     gene            <283707..>285845
                     /locus_tag="LMJF_35_0590"
                     /db_xref="GeneID:12982243"
     mRNA            <283707..>285845
                     /locus_tag="LMJF_35_0590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722406.1"
                     /db_xref="GeneID:12982243"
     CDS             283707..285845
                     /locus_tag="LMJF_35_0590"
                     /note="previous protein_id=AAZ14286.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722454.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982243"
                     /db_xref="UniProtKB/TrEMBL:E9AEN4"
                     /translation="MPHPAILSEHTIARGVHASCLPVSIPHQLPALEVFGQAPVPHRV
                     STSCTLLRVHRRSAYEPARAQDRCANTAAAVVVAEWGSCPELAVPPAGGDEASLFRYR
                     CSGGPGASSAAPPSNVTCSTQWVVLRVRCVSHTGSAAEFESYRSGGGACQEWMEWRLR
                     LGTVLYASDWQFLVSQQEREEATTGSSFDLGVTGAKREQTVRADMDALSTFFPALHHG
                     RYYSTAQAFVHHCRHSDEHLVWCEKDPLLSVEWASVKEAQLEVPTHHDADSPTAKRCG
                     NAGVECTSVVGPENVDMWRSHVGRSRKRRRRWLSQRGRECPSVRARHDAVSAFTHHRS
                     TRATALSCSVGTTAATSATALDSIYCAYLLGLKHHRDCPSASGEGSVSTTAAAPAGVQ
                     NQCSESPNVPQPSLYTSSEDVEEVLQSSTYARWYLALRPACRSALYVPRSGRAAAAAA
                     VTVEARGAEKAASDEVRRRALQEVLLHGIAVSLALWFCTRSSSTCDSVEVCALQQREP
                     SPTPFTTSTGDATVLVAALLRDWWSQLSQEATEFSASATTARAGPQRRWNRCCIAHQV
                     WASLQMWDCASSLRPAATMVPPPAPVAHLCVACAIVVTRVYRSQEQMLWWSVCAATAK
                     PSQACADKAADCDASAGARSTRSDTNGGAADGSGRAPSMDEVASNMWCTSASCRLPRM
                     SVKESRRWYDDYRACMDLVLQLLLAEQQQH"
     STS             286379..287166
                     /standard_name="ha2345"
                     /db_xref="UniSTS:515531"
     gene            <286520..>287059
                     /locus_tag="LMJF_35_0600"
                     /db_xref="GeneID:12982244"
     mRNA            <286520..>287059
                     /locus_tag="LMJF_35_0600"
                     /product="putative 60S ribosomal protein L18a"
                     /transcript_id="XM_003722407.1"
                     /db_xref="GeneID:12982244"
     CDS             286520..287059
                     /locus_tag="LMJF_35_0600"
                     /note="previous protein_id=AAZ14287.1"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L18a"
                     /protein_id="XP_003722455.1"
                     /db_xref="GeneID:12982244"
                     /db_xref="GOA:Q4Q5J4"
                     /db_xref="InterPro:IPR021138"
                     /db_xref="InterPro:IPR023573"
                     /db_xref="InterPro:IPR028877"
                     /db_xref="UniProtKB/TrEMBL:Q4Q5J4"
                     /translation="MVKPHLRHYQVVGRESPSEKNPEPTVYKFEVFAPNFVVAKSRFW
                     RMMRVKNKVKATHGDVLSCKVVKDAKLVARNYLVDIAYYSQRCGYTRMVKEFRDVSKT
                     GAVSQAYHDLASRHRARYHNIEVLNVKSIPDHEVKHLSIAQYHAPNLSFPLLQRRTKA
                     TRKDRAIFVKKNTKRAVVA"
     gene            <288268..>295788
                     /locus_tag="LMJF_35_0610"
                     /db_xref="GeneID:12982245"
     mRNA            <288268..>295788
                     /locus_tag="LMJF_35_0610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722408.1"
                     /db_xref="GeneID:12982245"
     CDS             288268..295788
                     /locus_tag="LMJF_35_0610"
                     /note="previous protein_id=AAZ14288.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722456.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982245"
                     /db_xref="UniProtKB/TrEMBL:E9AEN6"
                     /translation="MESSISEQHHVLACATTLHVTLLTSHYAEASQRDDAAAASSNNA
                     AAGHRREAPPSMKASSSTTHTKVAGSEEVEVYSCSSAVEQLDTVARVLCTILRQQSSA
                     SKGGVADAARRIQMAKAVRDNAVPWFKVAAAAAAAQGDEPHDHCLPRHSSESPGDSYL
                     SLAPTLSVTAPSLCAAGAKEGGAQRPAGGNGHRNTPQQQRQSSVRLSTSRSSMHSSSM
                     FSGMQRHMNEMEQEQRQFYLAKELPPCELVMIPGETPASAPSCVIFVYRLAHEEDVLA
                     ELSALSAAEQSSSAEKMDAPAADSVEPSGREKRDTCVFQAAAIVTRALWSTIRPILRN
                     HLHATSSSVIPAHVPVVWAMADPRMVSGFLPYTSNDADHVFSPYACPAPVSPSSIRSP
                     DETAAVERWVRLVPRTAFYLYDPSASSAAVQDTLAVLQAHLAKWTYSQASSPRAPRPF
                     SSGDTKKPMPPQRGGGSSQTGAATKATRANGPAPSGSRGSKGRSGRGAAGAAGAAAGN
                     TSALAPSAPHQTALQSRQLSMGIDLQATPAEFPYCTTNPRSLAYYLYARGVASAPSPP
                     QVAALAAPSPSPAGLEGELTSYLSKMAAFQQAVVTVSEADMPGSATEGAFERMWCAHA
                     PLLRWVHAYLSDSVASTATSGSAVEQVSSGADGDPRAGHQRPSVALEKAVHLSLSRRL
                     PDDSRWPLPLWKVAALPIAPVPPLTLLCRGPDDAATSTSAATDSVAQWAAAVLSVVVD
                     YGKTVGGTEGNSKTPLMPLLSRLVRLIDAYNGWSLNNSLTPARGARSDGRNGTRVAAA
                     EKAAGDYSVDASAAVQRSIASACCTGGVFNIMSAVCAWMATVSESLLLQKPSCELTAL
                     CATPESPVSRSAGGHLVSDAATAMSIPPSGLFRRYAQPFQKLSVPSSGGAKALMNAGT
                     LAATVPRLPKTTETRASDSAAAAAPEGKRCAVTTSARVHHHNADVVLPPYPQEVLWMI
                     RHVIAKNTGHFEVNVARGTDTVTPTVARTGLPPSMLDLATGGSSSLATRQSTMATMTI
                     ATPSTGLFLQQQRRRLRWQTSGVATKLQPYLQGVHLIKEMARNLLGRRPLAEAAVALQ
                     EALESTLAAPQCEVAAGEGRGGSVSARSHQSRKKHCGGSAEASTTGTEQVSALDLLQR
                     YLVSVDPMQAHLSTKSKPVALQRPALVPELHPSKENSESEMLATRAAAENLMPRIYEH
                     TLQQAFLYQLLRETKLESTRHSASLPSYGHTSTAAREEAVCEDDDWSVTQQLPVQAIA
                     ASIVNFQERFGAHNVVWRSCALHYRPLQSPTPTAAGSAGRGIDAVASTEEDKDGEVHR
                     TSAYAHNALNVHPTRRVTHMWVAGVAVPDVQMAEYIKKERGPNSDAKAWQSSRPSLGQ
                     RRSRRWVDMVPRAGTVTSVEVYALWQSLLQQQQGSDATMQLRAGPAELTIRTMHNLIS
                     QYVQRHAEVSTSLVGASGMSSTPSESAMATESSTMRFDIHETLYPYGDAVLEVWVSEA
                     QRLCRYIKATEVIATLHAKSSSTGVSNVHLTVHWDDGLLFTCTGGSGRQDCSSMVPPI
                     DLTLTTCNAVFQWRDGESRIRLRHYPNTSSSTTAAAAVALKELSGQPTATLPQGGIIE
                     TCAALLEERVTLYCVHHCPTEFTAATSVELEASSEKETSCEVDERTGVVHRFYASGMQ
                     QLLFPSGATMVRRPLKPVVAKSAAPKSASQYCDTLVTLDGRCFVRNGSGTGDTSANAP
                     AAGSKTVQPSAFQRVQVRIARANSKGMKSGTGAHDAQAPPFIHTEITYDAVHHCYMRS
                     RQDGLTVAEYESLASYSETNAKKNGGRAGAVLARVVVFPDGTTITTVAPREARRRALV
                     RRPDGTSASASLSSPTLCALLEELQAVEDSLFGAADDAAELSVRWCVEASTMPRVYLA
                     PAPVGSSEEARECEALFVAVFGDGTVLQRRWAAAPTLPAAFSTVGTEAKAGEDDGLEG
                     GEVGEGGAHSAPAYRGGSFETVLARPSTSAVRVLHQHAIATIEPADVLATITHASPAA
                     YAVGQGLLFFDLACGGGMRMVDGARCVWEVRGLAEANDAPQVLHPERPSTYEELLRAL
                     VSPHYSPHRLPRAAQLMYAREQRRETAAYARQRAAGWCPSLLRRMREIAEPFIRTAQL
                     LRTDVLAPIETAAAAAEERAFSACSAPDTDPSTAVKGGATAAARTGSSSTGIAPQCMS
                     RVLPICFGQLDNGEAIRYWHVSEVLSSLSESCASSTPAAASEPHVIQRLVPGIATDSV
                     LGYISTAPGHAYGADAIGVLLCGHPAATSGYRGVLWQRLATVTRLSLLFSGVLAPAIP
                     PAIRRPLPASFASGAPSPAPESSSAYTTSLPPLAVLLSHGSRWLPPTLQPPQQFGAYQ
                     RKRPAVGAGTEVEYADVAWVRDSTAALSNAAASTAYVQYVLDQVNPFTALRTSRAALQ
                     REVARRELYRHEQLAQLSHYHRVLSSQWPMETPAAAREEQVRLEMRFEELQRGLQSAA
                     PSPATVSCLPLPSAIGGPGKSERMVV"
     gene            <296643..>297779
                     /locus_tag="LMJF_35_0620"
                     /db_xref="GeneID:12982246"
     mRNA            <296643..>297779
                     /locus_tag="LMJF_35_0620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722409.1"
                     /db_xref="GeneID:12982246"
     CDS             296643..297779
                     /locus_tag="LMJF_35_0620"
                     /note="previous protein_id=AAZ14289.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722457.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982246"
                     /db_xref="UniProtKB/TrEMBL:E9AEN7"
                     /translation="MLPYGTLWKLDEMLHAAAPPPRRTTAVRRRQALFYFVWGISLVS
                     VFLIPFHYASLRRLRIDSERELLGLVAPTVDLTQLHIRQDQALQRLKTWSTARWVNKH
                     PERCEDDNVGDADVTADFALAFYLHPSSRTRLDGVFAHPYVQAVAGGGAGVLWPRLGD
                     AAEAPDAPQHVPRARTLNEVAVDAAEDPLNPAKCLIALRRDLLQAGSEGIEYDEKTDL
                     VNALQETLSQDSGLYRINVGGPSHAGKMVVDAGDGQAATENVLAALLLWLTGRHKCSH
                     AQEEAISRALAVCQAPLSRSLRMSFGWSAAPGAARAMAPIVATVQEEAPAPQYLCLCS
                     KHGVQPPVALVEPRSGTVTPLFLLDPARLEASTETCADACLHSG"
     gene            <298417..>300210
                     /locus_tag="LMJF_35_0630"
                     /db_xref="GeneID:12982247"
     mRNA            <298417..>300210
                     /locus_tag="LMJF_35_0630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722410.1"
                     /db_xref="GeneID:12982247"
     CDS             298417..300210
                     /locus_tag="LMJF_35_0630"
                     /note="previous protein_id=AAZ14290.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722458.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982247"
                     /db_xref="UniProtKB/TrEMBL:E9AEN8"
                     /translation="MWKQTVGDWQERRQRRRGGLILESPQANVPDSADATESILRGFL
                     PREFRDHVPQSVYPASDGPETRPQPSQYTRLEQQTLGCFIASTWVVVSGVPADDILDV
                     RDYFDAYVGRTVAHYLSLTTSARSEVYMQFASPLQAAQAVRTSSYSFNVEKGTAAESL
                     RSFPAAGGMPEKPPRSLELVVGWCRDQVFLEWRERLRRQLLEAWPRSQGGAASEPVSS
                     VGKALHASELPTPRSSAPPSLESSARGSDAAAATGGGDKDAAAHPLLPRHHGRPSGAR
                     SVSHPSTTAETSQSHFSASVSAPTGDAASGDSTAAVHPLMSGSKDYCHYNEAYRCDGG
                     FFSNGLHSSFSGAGMHHTTLLSLFFHPCSSSPSARWTRFLYYPLRFVVLLSWTLWNML
                     AQLLPSRSAVVLKGGPASRRQPQAVPGGVAPAADTQPLSPPRVIPQTSRWRLRRALRA
                     SDVVPASASPFEYMSFLLYKYIPFAPEPEDVDVALWSWLVLYNPYPQQSLRLLKQSLL
                     VRQQVVSAMAGRPQADGGLDVAAADVSKWTSFEKVGVMGVERLTGWETQQSVRCRQEL
                     PVLLAWRPAWWFARYSSLSLFMFVVLIYWYA"
     gene            <302145..>305417
                     /locus_tag="LMJF_35_0640"
                     /db_xref="GeneID:12982248"
     mRNA            <302145..>305417
                     /locus_tag="LMJF_35_0640"
                     /product="beta-fructofuranosidase-like protein"
                     /transcript_id="XM_003722411.1"
                     /db_xref="GeneID:12982248"
     CDS             302145..305417
                     /locus_tag="LMJF_35_0640"
                     /EC_number="3.2.1.26"
                     /note="previous protein_id=AAZ14291.1"
                     /codon_start=1
                     /product="beta-fructofuranosidase-like protein"
                     /protein_id="XP_003722459.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982248"
                     /db_xref="GOA:E9AEN9"
                     /db_xref="InterPro:IPR001362"
                     /db_xref="InterPro:IPR013148"
                     /db_xref="InterPro:IPR013189"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR023296"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:E9AEN9"
                     /translation="MPRQHHHHVGGAVSAAVHALAVAVAAFVICASAAAAIKVSFVSD
                     VHYDPAYGTANAHGTCNTTSASPFGQPGCDSPAALLAVATSDIMMQRPAYTFFAGDWQ
                     RHGMSSTSLTTTDVFEPLSQYFARIMDASKDPSFNRPHVTTVLGNNDVIPNYYFNITT
                     TPHTTLNTQIDIMKHYKLLNTTQGTVMSECGYYSGIASAHLRVLGVHTLVWTYNLSPA
                     LSDTETDPCGQLAWMESEINAARAAGQKVIIIGHIPPQPDVFRIINRGAVGPVEDDMY
                     WKPMYQNAYTSLLSKNKDIIALQLFGHSHRFAILGDEEMGVPLIVINAMTPLYGNRPA
                     YLIGDFDTATWKLKALRQRFAQTAFIQWSSGLEVAAALGITDFSNVSAIHAAVAKMFT
                     NDTLFENYMTLRTGGVIDDPCTTTFCRVYTVCAMLYAAHDNINSCVRSQIPSSSSSSS
                     EPTDSSDSAPTPDPSVHIDSKPQYHIRPPKNWINDPTGPYRDPVTGKIHLYMQYNPNG
                     PLWGDIAWYHVTSEDYVKWTIPSTPIAMYADRWYDKWGAYSGTMMSNKYSEPVMMYTC
                     TEPENIQRQCVATISPSDLAGKRTLSMFEKNPLNPILTEESVPGLVGLGNFRDPTEWW
                     RDPANPSQWLIAFAARVKDSDGDNAHIVLFSTTDPSFQSGYSFSHSLYVYKYNLDHMF
                     ESPDFFTLKQGGEHYLKVSSMASHRDYIVYGSYQANPATGKYVFVEDPARSFTFIDYG
                     PFYASKTFYDPILKRRMMWGWTNDELSNEQIASQGWSGVQNLLRGIEYDSVEQKIKTY
                     PVTELKGLRLSRLYSRPETDPLVLVDGAPQILITAGTNATRQHEIIVTFKLSSMEPFK
                     GNTYYTESAAPDFGVMIRTNANLSQYTTVSVRMPEAVRQPISNRAQDTTWAPIKMYPG
                     AGANAVSNCSAECAKERTCVSWTYTTLPSSTCALYWKTSRRVYNATAHSGTVNIPLLY
                     MDRTHSGSIGSSQPLLGRSPVKQTNPNVVRLHIFVDDSVIEVFKDGGLETMTGRLYLP
                     GGESQTGIAVYSKNMGSVTVTASAEIFSMDSAFAAEAGPNLIRNYANSYYNLLTALGV
                     AS"
     gene            <306649..>306822
                     /locus_tag="LMJF_35_0650"
                     /db_xref="GeneID:12982249"
     mRNA            <306649..>306822
                     /locus_tag="LMJF_35_0650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722412.1"
                     /db_xref="GeneID:12982249"
     CDS             306649..306822
                     /locus_tag="LMJF_35_0650"
                     /note="previous protein_id=AAZ14292.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722460.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982249"
                     /db_xref="UniProtKB/TrEMBL:E9AEP0"
                     /translation="MKTTLPSLFSPPLLPARMTSTKKLSDSQEELRVHVDHVFFSPPP
                     LPLFLSFRTLLPV"
     gene            <307421..>311263
                     /locus_tag="LMJF_35_0660"
                     /db_xref="GeneID:12982250"
     mRNA            <307421..>311263
                     /locus_tag="LMJF_35_0660"
                     /product="conserved RING finger protein"
                     /transcript_id="XM_003722413.1"
                     /db_xref="GeneID:12982250"
     CDS             307421..311263
                     /locus_tag="LMJF_35_0660"
                     /note="previous protein_id=AAZ14293.1"
                     /codon_start=1
                     /product="conserved RING finger protein"
                     /protein_id="XP_003722461.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982250"
                     /db_xref="GOA:E9AEP1"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:E9AEP1"
                     /translation="MVTQLAASPPAQRPPDQHHEQTTDTPPPRRPSPMSLVNFSFTQF
                     FVALDEVAAEEQRATAEAIAAAPVTATSTSSAVLPVTMPHTTQPLANAATLSLHDCVL
                     LKLSLTCALCGRLLRHQPAAIETCGHCFCYECINTALENGCAPRTIEWPWCTLEKEVG
                     AAEVRWAAATVVSTSAKSLRASTAAATPGGAPQATEETADGQHDCDEVQVAAPLESRA
                     ARSTDAQPPRQPRKLRKVHQMCPLCLGPAFKWMLVPLQPLADLCNSLHSAYPGLEGAL
                     GHLTATTSDSAVSITESRAASENCDEAGGEIDGDMQWHVQPASDSADLITAAFAPRSS
                     VPGADDWQSSQDEEAERRRRRSTRGPRKEITFAADIASRVSSIPAPVTADAQATVNQT
                     SDSAADIACVAHSAGVEAIEEETPISAEAEEKDGGVAGAAVAAVLQLSADLIPSPGGI
                     PAPALPAATTQAPRDIVSSSSWQRGASLNALAPTPLSREEVLGHSPTDAKEDEDTQQG
                     GKRDVDAVVNLHLAPVHQHEKGAQSTAVATSTAAAPQPLFLFFTAQRHHRLLLDTVPT
                     PSDKSGVPWPVTTSPTRKEEADGWAPPSTRLPAPLGSIDAILRARASSTSGWSVVWDG
                     VEERKSDDSSDSDEGCPTTRARSSQRPYSTVQVAELGEDECAAREERRGNSDVGCEHR
                     HPVPATAFSGVSRHTVKDALTFVHMQDVWELHTALVRRHPRLPPCFVALRHGRVRWQA
                     DVAAEEDDSESAADSTCNGAPHPPPPILCVVGHYPQQACRSDSSGLRLLPTLTPTACT
                     ALVLGVPCVDMTWVASPTSSPWTAHAVSGWQTNTAVVDGTSSPSERERQRPNAFQNAL
                     ERLTAASGASSQPQRLAEPLPASWMATTQRALLAHLHPTAQPRDTQKGADTTAAHAAV
                     DTYVFFLLPDGATRQLGKMLYHQWTRAELWQSPQAKDAPPTVVAPLSSSSRKRRRDGG
                     GVSGIIHGIGNWSATDGHPQRAWRRLLLVAGGAAVELSWTLFEALVATAVALEDGDSL
                     VEGRSATGTDSLVKALTSHLRHRRASGTGSLWIHVDVADCEREPSPPPSSAASPVHSC
                     GAQHTLFLLYSMAVARDVFAQLVAEKNVRGKTPCTSPSSSSPAPGDHSTTRTRAYLRR
                     FKVFLDRLAALVAVVAAPALPGSASLYGGASHQQEARPSSWLLENIAQGRRSAGSSVN
                     ISALSQTQEDAGDVRASSIIRSETQSSGEQARRRLDAASLSTGECGAEGERQVEGAAP
                     LPAQRAGVYRSLLYADTP"
     gene            <311982..>324506
                     /locus_tag="LMJF_35_0670"
                     /db_xref="GeneID:12982251"
     mRNA            <311982..>324506
                     /locus_tag="LMJF_35_0670"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722414.1"
                     /db_xref="GeneID:12982251"
     CDS             311982..324506
                     /locus_tag="LMJF_35_0670"
                     /note="previous protein_id=AAZ14294.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722462.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982251"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9AEP2"
                     /translation="MPPKKKGHTLVGRQKVFRHAVEHVRLGLGHTVLGNLSLGLAASS
                     TTAAEGSSTAGRPAFYVELNEQLLSHTSKDFKRFRWEVLELCETNSLFQLNHRQLAQK
                     LLACLIDRRTHRVDATTDEAAGTKETTKPASVQRQHGDGSTTQAYEAFARLTIAFVRD
                     MGSKFLPYFQIFQQAVQAGMYDHYGNLIVDTARLQLVFAVQAAWCRELRECWADPAHA
                     ALVRRVIRQYVAQLHDTKEYVRRLSAELLAFLCRLSRPLLPLVVEEACGDVLRSYEET
                     ATAAAAVERDWDGTSSRGSASECDGNDGVGEEESNDSQNSVEAAPSTSIWANGAQLLD
                     FVRTTLPHHPVVDGLAYFIGELFRGVRGSLSSSFETHYVRLLHAFQLLTRQSGDWDEE
                     RSPVDVVRLLHQLRHPLVPFLDAVSEEDEEDAAVQHKKMRRYADLHSTRWSVVFGLPN
                     HGEEGEEGATVLSGSDVQGAQHLLRSIGSLALGNATATVLRETKKQSVFLQPDSSEED
                     ELDDGASAETAPSPFAASAVKSATMRPSHRILAAAVLSIDSTYLSPSWPHYIDFLAAM
                     MGSVNFALWVDSRESALLQRLAAQLLAALRHPPSSASSGTRDARTHGAADATYLLEVA
                     AAALGLLSPLCLSPCLGSSAGAGADASSHLLQLQQWFVPVAKAAVQVCVKAATKAPPH
                     VAQCHRCEQAQQILFAFAQDVLQKNYAFALEQERRMAEEADARDLAGGEGGAHRVGST
                     AGLHDTREDAYMSEEEDDADGTEAGGAYAVKRAQHRSEHLRIPSYLTPFALTLLHAIG
                     MALWQGATADVRELRSAVTHTAAPSTSLDDALITALRQSSVRRAVLLSRLLQDHTQHM
                     AVSPLQQLLRLKSMPSTAAKWNNAKGNSAVAATDREVSMRDVLESMTLELLQYYKATQ
                     RPAPSSTASEAIAYVSCALPLIQLLVSSALAATPSSTSPVKAALLSLLQNIEAQDQED
                     AKPSRPAARTAAAAASSLVRATALDPAVYALYAEVAAMLVQLTTGPSARSGTKLLKKA
                     LKKRQHASENGVHDDSATRGDEQEGLRHLCRTVAVLVHGFQQLRAATSPRETSGSSST
                     NNPVDEDTELAAATTALSDETRVQLLHGAEVLLHALLRMFSLDSNSQLYGDDSGTGAA
                     ACAQMRGKPALAAESLPAHTRAALCTLRAALPSVLHRAFVQDVLLECLAAPIAGLRLL
                     ALRLLRLVCHPSLDMADRLVGAPAVPLDLIDALLSAASFNPLSHTGKLDGMQQELSLL
                     TYQVESGVITQPFHRQLIARTMIGFLYMKFTGAWEIASKVLCSLVAQEQTGLMSVKNL
                     DDDDDDGRNAEAGRDEQGDEETRKGGSSSTSLPTAAQHHKPQRLRRLEPVVWNSVVCV
                     HARALVMGDVVAAGGATSSTETVRLCGDEHVITDNTDDVAAATASCQAQLTRLPCLYG
                     IHLTDQQRHVKGELVSRVFSSTQYSTAAMTLLNSTKTDYEVVQWDQHWMLSQRCMSNS
                     VDAVKAATSRKQQQGTSVTTAALYATSTDRSTLAQTFLSIMEAMVKSSSAIDRKVRLV
                     EDVVLELVAVERNRHPSGVDGSQLRKLDQRLEIAMRACAAAPSGVLTAHQRKHVTAAV
                     QRDIDARSAELQGIFLSYLSEANPRLQRVAVDNLKRLRVEPFNAYHAKLVPYCDSIKN
                     LFAFLSTFHVESDVPAHDVVAYVSAALSLALPKLLTTVSKKKLKEQAVLSRRLMSYLD
                     HLTPSAAVSNNNSSSSPRAAAKDPLAEVFDQLLHRLLSFAMPASTTLASVAADGASAY
                     DFLANVWEDIVYRGCGMSLANEAGGASGCAVGTATVSEPRRRSSHHGIRRLERFLKQL
                     SKALRLLEAMLHAVGQRFSVYVSTCLHVALQAYLVACKQSLRAPVENLLASLTSHEAT
                     PQEERARRWAALLNKSLATSALSTSLAHVRRAAMTIVALLFEQFPEDVMDVLRGRSDA
                     SVRGGSSAVGHAATAAALPLFTRYLTMLFENSKGTTLDGGSGALVSRAGPGAVAVAAK
                     SSVTPVLRLLTAWVRSPALLPLFSAYPDVAAGTLEEVFAVNHNAASVHRASTQALNEG
                     LRCVSELLSCAEEPVHELPGVPAVVADKKGGVCSSRLPVKATFRHSFLEKHIVRVFTS
                     LYTLLTSGAAREEKEAAAAAMTTVTAAVSRGSGEAVAARTEQRKPSRSGKQTRTASSK
                     GRQSARDRERPTSIMSLSVSMWREVMRTIAQLSRFLHVDSATSTSVSASSLASMMNRL
                     LELALKMVAHPVCMTDAPTTQMVTSIAQALMEQVAEVDYRAHWQPLVRLFNLVANPHA
                     RHTLCAMLSLAVTKLALPTSSPSADPPRVEWFRRQLAAAARAVACLNSFENDETFERY
                     DFELRYHTLHSLHDFFVHFGNYGALHRGCTANSSGKGGSGTSAVRKVRAYDGGEDVQL
                     PLDKEHAPVLAAEAMAVLAANVVFFLRDPEQTIRALVLPLLHAMVRYASLGGQRSSGN
                     VALTEQQLAYRTQLLETTLRHEVLASLRRGVVAKDVHIRCAHMQAFEGFGRHFSAEFT
                     SFALLYSPNTEQNFYANVGHVQHRCRLHALAVLRQHAPDMNVRDVLRVFVPFLLSAVK
                     DFAEGKRSQANLTEGRARGYCDAVLLTVSSIAARLPWMAYYRVLSLFLSNANANANLR
                     ATMLRGVVQVLSTFHFLDDPAEASAEGAAVHVGDEGEVGEDEVNDVDDAVHAELSAKQ
                     REYRHAKVMRVLEVDVLPQLYSYLGDKKASKAISGRGAVNQHSITAVRQEQEREDAAS
                     AQAKNALLQLPVAMAITKIVKHFPEDRFHVHVDHLLDELIKKLRTKNDKHRESARRIL
                     GAMLQETGPSKLKFVVAKLKDNLVHGYQLHVLGYTLVTLLYQLYEPNSKLLQPSKSSS
                     SAAVAAASDSPARSAPQDPVQEALEGAKKQHRRNSPSSPPSRRQRTEKAADKDGKSGT
                     DTPPAEEVDEDTAVERAEEALLQELGTAMHARFDYRHGMDCLTEVLEDLLLIFLDDYL
                     GEVGVQKEQVEVMSTMVEVKRNRALQGFAFLGKHCDAETVMQAFLHRITWVLTPPSDT
                     AFSAGELHGSARARALLVKEMKSKYVTISKGGSADLIFVNKVRLLAVRVARSIMANPT
                     MSVEKSFEQVRRLLDQHNRTREEKIVAFEAKNGTRRIRGNAHVILHTAERQSRKEQLD
                     QNYLVAPVPERVDVDFSAHTVLATQQKQKLRVYRGRYGKELMEAAKNFYREDPVTAVV
                     LDTLDEFLLKFLLSVLKQVLGIGKEKRYSKAAMKLDMLRHHRARQQEREADGEDGATS
                     GDDEGVEDEEDHVDEAQEAHRERGSEEDEEEEGGAAGTDTVESGENVDGLGTFAEAQA
                     VAEGDAKNATRQARGEAQLAAALLAPGSDLTVTFTREHRGLLESLVPAVLTCLQGEGS
                     DAVVANALDCLLALVSLRPPLDAVNGLQKELFETVTSFIERGSVIKQRAIRLTAAMVA
                     HQKCVISESNAVQLVKLVRAELMERNEYMSVCLSLLYAVLGKHVHIAEIYDLIDIITE
                     LLLHWSAHRVIRRRCILILVRFLLEYRLTPEKFKSHIDLYCRNLDYPELTGRTALLEL
                     LDTLILRLPAVILREEAPVLLVPLAATVTGSEWVECRRQGGTVLQHLARCAGVDVLVP
                     ILSSWMAAAQPRATRSMGVQTWAAIVPALAEFYELDADENGEDDDGDEDAAAAKAQNR
                     AAFQACCAWSVDAVLDGCMFDQLAAACRNKQLHQLSAKSREKVEMKGWAYIFYSLRAA
                     ETMLTALPHELYPLLAPRLLPRITEVLILHTHPWVRAVAMRLLRHYLYTYVERHCHYL
                     QEDAWQESACQQADSGTTDDDAMTSKGGGDVAALLFVTEAASTPSKAAVAKTLQTLQA
                     FSSLLKRLLGIVSASDVAMEMYNAHRAIANPVRSELLKVAIYVLRAQVQLALFALTRA
                     AATGRHRYHRDVQQRVRTVYTSLQHQICSLTSPVVQQESLVNYMVRSTTLMQLFGGWA
                     SVLPHEVAVNASDGAEPNPAYSVHNAQVRWLTQTQLCPAALLRECVVPLLGLGLRAKS
                     ISEKISLIAFQVTGVVVQQLEERRHELAAPLRANASMAKKDDEARLGKKRSRSAAAVA
                     AADDGDEADVATGRVPLDEVLVALKTQLASIHEARRDQQVTQNTKKALKRSRRQMERE
                     ERQPMQKSRRPA"
     gene            <326149..>330717
                     /locus_tag="LMJF_35_0680"
                     /db_xref="GeneID:12982252"
     mRNA            <326149..>330717
                     /locus_tag="LMJF_35_0680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722415.1"
                     /db_xref="GeneID:12982252"
     CDS             326149..330717
                     /locus_tag="LMJF_35_0680"
                     /note="previous protein_id=AAZ14295.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722463.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982252"
                     /db_xref="UniProtKB/TrEMBL:E9AEP3"
                     /translation="MPAKKVSSATKLSSTATHPPRRRTSGLLGSSTNGSEQGGSVASL
                     PSAAAGFAQPLKRSGIKSRNSISYTSFSAQQAAAVASSGDAHAPHVNAKVPVATAKAA
                     SGRPRAVAAIPVNHTAPPPPAACESAPSPPCPAAAAAVQKAPSLGSSSATTIAGAVRR
                     ARFGIHTPSVTAPSATVGPPGASPAAQNGSPKANLPTLSTVPPSLPTAKRATHHSDVD
                     TNRTAVPLASAGSWAAKPQARCSFPASGPRRLSSSSFHAIKAASSAPAAAATPSTAAP
                     EAASVEADPREAPAARQCASALLAVASKPNGQSKSAADPSTDSTAAPGTSSSSVAQAS
                     LKSRGRSLSVMGKKKVMRRASTGTATSRPPSAATSRRPSVSCSAAPMLDAESAPSTAL
                     NTARTAGPTAVKTPTNAGSAVSAGTATPLPRGPVVSEEWARSIIKPGDENLLYRATAA
                     ATTYSGFARTPSGISMSGDAASAARQASTVRSSIKDTQLRRAQETVLRLRNPETPTPG
                     WRSTKAASVGAGSAVSVASGGSGSRFGSTVKRSGTRLQRCRQENEVRQRSLMETMAMP
                     AGENGGNVDGGRASNPGTAAGSASPTPSRISEASTNTMMRGGGRLSGGSARPLLEQLP
                     GGASVASDIMDQRRSPSLKLFAKPSPRTFSTPSPRGSTGAPGMKTTFGVSNRPYYAGN
                     EELTRLTWVREEMLRALMQSAAPPAASAVTEENNAAAVVTSMPSPKDGSDTNALEASA
                     SSVLTMHFDPQVGETVPVSPPFSSAGKRPRQRVYSIDVHGGTSSDESAPPKQSTAADV
                     TQPRRQSAGSGTTPLHASSIRQKPGNSAFVSRPAPPGSPVRVGATPGPTSARPTLDSS
                     AFASGAPPAAPTAAARQQRRTAVTVAMCSLQSPNTIAERVRLELVRQEQQQPAAVRNG
                     QMQAAAPSSAPAANQRPTATPIDAATRLLLLDPLFPLISEENYQRLVLRNDEYTTRKA
                     LLTHIGAAPPPSSSASRPYESPPPVPPLHVDKKPHRSGAEVPPAARALEMDLAEADEA
                     APSRSLTAAALTSTPAAAAAAPPSPSASPPNAAGIGSTPPRRPSVQYGGPALYATFSP
                     SRAPSPSPAASGLTSPTASPGVGLGGATSSARDGKLLVNAVMPTEKSGTIKSLAAGGV
                     WYAASPMSEFTGQSTALPSLNASLLVSVGGSGALGGTGNSPIRMRSTSPTASCSSSRN
                     VTRRGSLLRSLQQHLQPQATTAATPSRSDSTGDEVSTASDEAVDLAEVELCKALPLWG
                     PFRTSHAAAPSDPNAVEQECVTKPGTIVGDTTTGEATVTAPRTTKTSAHGEASPLVSP
                     TGSTPSPLSMAPALSLAMAEELQAYVHVFLKRYRNVDAVTAEEMGPVPETPLALQRAV
                     RRSLRLSTGDSANAADGTDAVELEDSLDDGSYHIQNVQYVLDLLGSLLQTEASFCEDD
                     AARAASGAHPLTAAAQRRTKKRVTGAQLIAAVMGRPASSSAEDTADGAVPKHTRSATA
                     RSAAVRPALKLHDPELRAVELMFVNDAP"
     gene            <331491..>333359
                     /locus_tag="LMJF_35_0690"
                     /db_xref="GeneID:12982253"
     mRNA            <331491..>333359
                     /locus_tag="LMJF_35_0690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722416.1"
                     /db_xref="GeneID:12982253"
     CDS             331491..333359
                     /locus_tag="LMJF_35_0690"
                     /note="previous protein_id=AAZ14296.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722464.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982253"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:E9AEP4"
                     /translation="MTFEFGEECNNLARAAHQTKNYGDAISLYDRALTMRREKYGPIH
                     KKCAATLHNIGRVFIDMKEYGAAENAFTEAAAIYEQVEGDKSLEYAESLELLALCYTH
                     LKFLDEAEKAFKDSIRIFRDQCYNYGNNSWLPDDKTPPAEPNKHPLSSAAHALADCAA
                     LFLFRRQEHQAVAFLEEALEIRRFLYSRHVKFRPMIAQTLNKLCELKKSLDDAVGAEM
                     CINECLEICIETLGRDHPATAQATSSKAGLLAAKKQFRDALRLYEESTRTYAMALGKD
                     APLFGQELMKLGRCQELCNDVVNAEKTFRRGVEIITNGFGPNSLQLAEANTFYGSLLA
                     RRLDIDQAVGMFRDAIRIRKSVDKHDPQLAYLYQKIGDAYAMRREPHAEAYFLLAVDA
                     FKQNATIEPLQRTYMTDVLDDLGLFYLDFQHYEKAEKCFKEALDTRIEMLGENHATVA
                     YSYSNFALLYLQRQDYANCEKMAEAALDIYSKTARSNVLAQADVHTTLGQCYHQQNQF
                     AKALEMHEKALNVRRTRGDTTETAVAESLNQIARVYITMKRYGKAYRHVKEARRLVWQ
                     FNVEITQPLRNEIVKTEQMIPPMEEWTNEERAEAQVMIGDGSSAGNGSAATTATGA"
     gene            <334023..>334853
                     /locus_tag="LMJF_35_0700"
                     /db_xref="GeneID:12982254"
     mRNA            <334023..>334853
                     /locus_tag="LMJF_35_0700"
                     /product="putative vacuolar ATP synthase subunit d"
                     /transcript_id="XM_003722417.1"
                     /db_xref="GeneID:12982254"
     CDS             334023..334853
                     /locus_tag="LMJF_35_0700"
                     /EC_number="3.6.3.14"
                     /note="previous protein_id=AAZ14297.1"
                     /codon_start=1
                     /product="putative vacuolar ATP synthase subunit d"
                     /protein_id="XP_003722465.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982254"
                     /db_xref="GOA:E9AEP5"
                     /db_xref="InterPro:IPR002699"
                     /db_xref="UniProtKB/TrEMBL:E9AEP5"
                     /translation="MSSTSRYPALPSRMSLIAFKTRLKGAQKGHSLLKKKADALSLRY
                     RTVMGELRTAKLEMANQIKGSYFTITQAQFIAGDISLAVQESLKIPTYRMELQVENIA
                     GVQVPSFHTQNDDAVDSQSNAAAGSRLKYDSQCSTGAVTGSLTAGLGKGGEQIKEAYS
                     AFRHTLSLLVKIASLQTSWITLDIAQKVTSRRVNALEKVVIPRVQNTLSYITSELDEQ
                     EREEFFRLKMVQKKKIAAKIQQTARQAETSGIEAERTQKRNLLMAQRDSGVAEADMVV
                     "
     gene            <337030..>338625
                     /locus_tag="LMJF_35_0710"
                     /db_xref="GeneID:12982255"
     mRNA            <337030..>338625
                     /locus_tag="LMJF_35_0710"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722418.1"
                     /db_xref="GeneID:12982255"
     CDS             337030..338625
                     /locus_tag="LMJF_35_0710"
                     /note="previous protein_id=AAZ14298.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722466.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982255"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:E9AEP6"
                     /translation="MPIFDNNNDEKILKVMKAGDLLHYDYRPADKHCGSRAKLSDTFR
                     VVQWNIERGVKLDAIIADLKALHADFIVLQELDINCRRSNYANVPKEIAKALEAELYL
                     ACEFEELDSSLRAPVNAVGPRSQPALVPETLPDSGRSESSTLKPAKSHHFHGNAILSR
                     RATLREPTVIPLTSPFVWDEAGYWYKEPRRGFRSALRVRIDAVDRTSAHMAPLYIYCC
                     HFEVFCGGLARVRQLADCMADMQRIAHVSTALNGPRSRQPAFLLAGDLNTIAHGIVRL
                     SRHHGTDRLRWLSFGEVEACWLQRKVLGRNMQLLQAGYCPFSYHFLAGAASRVYQFLC
                     SNSLVWQYVYGFTRSEQDRMSNVHLCLYDPSDKFTSITLDNPTYYGFARGKLDWMLLS
                     NLQPRPFRTARNGDEPIDIAVLEKNGSILTTSYSARYLHSIYDGSHDKAGEASVQSNE
                     ASAKCVPQDGYLLFNENYTTSDHRGLVMTVQQNNGRPQDVYPSKGAPYTTSWTAVGFF
                     ILTRALPVVAVPLWLCHMHKLLH"
     gene            <341321..>342826
                     /locus_tag="LMJF_35_0720"
                     /db_xref="GeneID:12982256"
     mRNA            <341321..>342826
                     /locus_tag="LMJF_35_0720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722419.1"
                     /db_xref="GeneID:12982256"
     CDS             341321..342826
                     /locus_tag="LMJF_35_0720"
                     /note="previous protein_id=AAZ14299.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722467.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982256"
                     /db_xref="UniProtKB/TrEMBL:E9AEP7"
                     /translation="MLAGFGVAYGGYYRVYVPQRAAQLAADQRLEQCKLPYQDVICAY
                     SQLQRAIEQQAAIASSLPSSSAGARPGTSAWHTNGEKIRFFCDVQRMRALLLSLPHHL
                     ITEKDLRAKLQQLSVWESQHCTELNFRSAPLSFSQTLRSSACFVIYLLCFRVLSPLLR
                     VWDSSGGWQSRLQHSVSTRIVEALEIKVLLTVADCESPNGSSEVAGGPSRGYITLNAT
                     HWIEEVGFWACPNNPLLHRRPASPPAAVGRQGVDNCHMELLRCLPIMACSSNAAPQNG
                     GASSFTLPALRQRWCDLLWCGPSTSATAYTTTYAEHWRRLEARQRERLGRRTEGGEAA
                     SLMTVADVSLGYPVLSCVSQLECAVGHEAYYIPVGISGLSHVLYVDAAHAKPDVRPRR
                     TREETYARVQQAQFAHASSAVSVKRTPADSTIAAAPQTPSRLHEWQAHRGFPCWRRAW
                     WGGVYGGGPRRSSTTLHYHLGSASTAAEYASAAIAASQAAETFTAAATSAV"
     gene            <343480..>345669
                     /locus_tag="LMJF_35_0730"
                     /db_xref="GeneID:12982257"
     mRNA            <343480..>345669
                     /locus_tag="LMJF_35_0730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722420.1"
                     /db_xref="GeneID:12982257"
     CDS             343480..345669
                     /locus_tag="LMJF_35_0730"
                     /note="previous protein_id=AAZ14300.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722468.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982257"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:E9AEP8"
                     /translation="MRCASRPLVLCALPLRAQRCQHSTPAPAPGESPSKAAPNAEVRV
                     STAPPPTTSSSAAPSDSATDQHRGADVPHRSLHPRVKLRATTQERPYKRRGFVAFEEA
                     ETGDEQRPPLEDGSAQVIAHFPTAAETGGAAILPGHPRSHAQTSLATQEGGCGQLSDA
                     VEGNEVQQFLDEVQRQVDVARHARNEAIPFPQKPEANSPSFRRIKWHAKMKIEVPDPD
                     YPTFARKDQVMQLPPAQEHPWVRKNTPIGPFIVHGDGQIHQTGGTGQVDFDDSSVNEK
                     LPQSYRGLQHRSTLQRQLPQDNGRVLQEAVIKHSFTLTGRGVFATRRIAKGETIMIVQ
                     STARNVGVKGELQRLEEMCTDILIACRDGDTRACDYLHDWILTGQPSSLLEHWPTAST
                     SRVMDAIGGADVLRALELHPIHIARMAAIIDLNSFLVESSFSERKGMAYFPEAGFLNH
                     SCAPNATYNIMPVHVFRDTDYYLDEATRVTAAESGEEEDVQGTAMAADDAGTSSTAAT
                     CPARAAQRPAEVGNVSSSQVSVRDGVPQGQRHVAFFGREDRLAAYPDLTEADAPVYLF
                     CCRAEKKIEAGEEIVISYVPPQWSFDNRQYVLHDRYRFWCKCPKCSPVLDKKYARVPK
                     MIVAMVLVSIVLQIMVFRQRSLKNAVDKGYEQLAAMSEEERLEELRACGIDVEEITAN
                     AVERRKQRRVGLFEMLEEDRLNRLYEPENRGPMNIVNLMDAHAKPPR"
     gene            <347874..>350669
                     /locus_tag="LMJF_35_0740"
                     /db_xref="GeneID:12982258"
     mRNA            <347874..>350669
                     /locus_tag="LMJF_35_0740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722421.1"
                     /db_xref="GeneID:12982258"
     CDS             347874..350669
                     /locus_tag="LMJF_35_0740"
                     /note="previous protein_id=AAZ14301.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722469.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982258"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="UniProtKB/TrEMBL:E9AEP9"
                     /translation="MSRRKASRTAASPVAAASHDSPVSTHPGEPATFQLTVVNSCLCN
                     EDVQLPRLPTPALLTPFYAQYESTAAAASLRTTSPWKSDYWCTKVAHVALGRHSALPA
                     AYRLRHECAGRLHARVVYVQAAAVHRQLYKAYPPLPRCRPHAATVGEVGGDDDVVIVE
                     PTTRGDVVVAGPAGPPPPTAFKASYYLLINHSENPIFVGPDGVPQGRSVVLREGDVLS
                     FLECAFDEDSGVLDEAGATDGGDSAEGHCRDTSIGAEGVECAATTVEQIQQLAAESLW
                     RCVDTSAAGSASRPSSSSTSFTAHQVRVPQGTVATRRFYEVPHVVQEYMRWWHRHTTQ
                     LCEQRHVNSRHTASPATEPMGATFSWMVSGNHLVRAPSIANSGVRSVTPVCAKAEGAC
                     DISAATVGQLSSSPPPLCSQRRGSRSPSPLPRMQQQQHHRFSEDLLKTPAVVTALRQW
                     LKDTEDMEEVADEVHSPLAARLLLDRAWLWRLVRRHHRQQAAPQLQPSSPAARDGFSP
                     SLVKLEDKTPTTTTTTAGLACAATVKKREGVEPGGTPPQLGGSSSPQRASDMMERFRV
                     SVPTVLDDSVATGHGTSLALTAMPSRAASVVQTVLEELRQSHGKKRSPASEEGTHALL
                     PPLFRNEPKTGTEVARTAPDVSRTLCLDAEPIHVYADSNAHSAARPVSGEASQRPLKR
                     LSSPAVSAGMPTCVPAVRIRPAILPVYVFTRRSPSPDAYTREQSSFTYARSFSSPRVT
                     GRARGGGASGSTSGLGTAKQFVYYYYETDDRPPGADAGAIEHHQSRSRGSTREHGGRW
                     QNGQQRKTTGGGAASDPSPALVEPSSPILTAAALPPHESHADSSTHEDSFLWVDESEK
                     VEKVRCASTTRKRRPGKKTSATRKRRASETIPSAAEAKAARADSTSVAFEAPLPTPTA
                     KSTPSRHAKTTPRINSR"
     gene            <351267..>351938
                     /locus_tag="LMJF_35_0750"
                     /db_xref="GeneID:12982259"
     mRNA            <351267..>351938
                     /locus_tag="LMJF_35_0750"
                     /product="putative proteasome activator protein pa26"
                     /transcript_id="XM_003722422.1"
                     /db_xref="GeneID:12982259"
     CDS             351267..351938
                     /locus_tag="LMJF_35_0750"
                     /note="previous protein_id=AAZ14302.1"
                     /codon_start=1
                     /product="putative proteasome activator protein pa26"
                     /protein_id="XP_003722470.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982259"
                     /db_xref="GOA:E9AEQ0"
                     /db_xref="InterPro:IPR003186"
                     /db_xref="InterPro:IPR009077"
                     /db_xref="UniProtKB/TrEMBL:E9AEQ0"
                     /translation="MAQAIRDAFTEEASLTVVEEWSSKVVSDLEARATNAHHARQGVL
                     VKPYTADAAETVPVTIVASLREFQGQLYDIYRAAETIRTVIACRIPELKAEDNLGVEV
                     QMTVLKMIDSLEGKLLGSSSGDKEGGAPGVAGMYAAREYLAARGSVEDKVLGKVSDDD
                     KKTKSAAPSVLMELQQIDADALLKLELSATQISTQIRSFINAYAVNWKKLIQPRTNAS
                     EKSIS"
     gene            <353833..>355278
                     /locus_tag="LMJF_35_0760"
                     /db_xref="GeneID:12982260"
     mRNA            <353833..>355278
                     /locus_tag="LMJF_35_0760"
                     /product="conserved CBS domain protein"
                     /transcript_id="XM_003722423.1"
                     /db_xref="GeneID:12982260"
     CDS             353833..355278
                     /locus_tag="LMJF_35_0760"
                     /note="previous protein_id=AAZ14303.1"
                     /codon_start=1
                     /product="conserved CBS domain protein"
                     /protein_id="XP_003722471.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982260"
                     /db_xref="GOA:E9AEQ1"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="UniProtKB/TrEMBL:E9AEQ1"
                     /translation="MSASEVQHSYYPASAAHTSYQAGSSLLEAGYRPTDEECATLAAP
                     IASFLRNCSCYDMLGVSTQVVVLDVQAPLSVAFIAAQETRIQSCVLWDPRKRQYIGVL
                     TSTDYICILMYCQAHPKEADAVALWTIEHWQEVRAAQGLGRPKEKLGAPPGPKSSIVT
                     CKTDTSLHDCLQMMREHCVRRIIALAEKEGEDFSLVAMMDVEQIVEYLGVMFFHIEKA
                     GGSIGRTGGGANSSTGDAAGDGAGGAGAPHRTNLTISTATNRTNVAGDSDLSSLQHNN
                     SHQLRSNDFDEYDDDPQGVFALGEAYVLPPYVASIITQAEAAGASGSGGVGIASDVRV
                     GPYSSIFDVPFMYVPQVGAHRRKPIFATMEQKLSEALTLMLDHNTESIAVCSPKEGVI
                     IDVVSRSDLLRMENQGVYDTQLTVREALASKISDHIFVFYEKDTLREIFSHFVRRRVK
                     ELFMVDPDTGRLLGQLNVAEFVYFLVFGVSD"
     gene            <357596..>358990
                     /locus_tag="LMJF_35_0770"
                     /db_xref="GeneID:12982261"
     mRNA            <357596..>358990
                     /locus_tag="LMJF_35_0770"
                     /product="putative rRNA dimethyltransferase"
                     /transcript_id="XM_003722424.1"
                     /db_xref="GeneID:12982261"
     CDS             357596..358990
                     /locus_tag="LMJF_35_0770"
                     /note="previous protein_id=AAZ14304.1"
                     /codon_start=1
                     /product="putative rRNA dimethyltransferase"
                     /protein_id="XP_003722472.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982261"
                     /db_xref="GOA:E9AEQ2"
                     /db_xref="InterPro:IPR001737"
                     /db_xref="InterPro:IPR020596"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9AEQ2"
                     /translation="MHGASGSSLLPQAAAPVALPPLRCPGGPRVKAEGIKQLYKVPHA
                     GFLAKYDQRFMLNLKLTHQLVSYLSRTTLTTPDKVLVELGPGVGSLTRSLLTRPCVGV
                     LGIEVDERFNPHLEQIRNYTNNKFQWVTADVLKVDELELLKSAFPHFVKANIRRPPSP
                     GQETWAANSAADPAASSGSQRVTFTDDAGENDADGCEGAPLRSAQRERLLRQRRARQP
                     YQHSDDTHCRGAEGAADPETAASPNAAFDVTNHRWSNGNAKVEVIANLPFEIITELLM
                     RYAADCSQHRGLFAFGRVPIHVFTQREVAERILAPAGSVQFSRLSVLCQCFFHVRLKQ
                     TFVDQTYYPRTEVEGAMLTLEPRSVPLAHGLSASSLIHFTNLLMKPGLRAATVHKSLS
                     RFAPAELVQYMLQELRMDGAMTVLDLSVVEVTRLACLWQQFVTMSQQQPPQEGDGAEA
                     EAGSLNAGSPSGAV"
     gene            <360810..>363149
                     /locus_tag="LMJF_35_0780"
                     /db_xref="GeneID:12982262"
     mRNA            <360810..>363149
                     /locus_tag="LMJF_35_0780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722425.1"
                     /db_xref="GeneID:12982262"
     CDS             360810..363149
                     /locus_tag="LMJF_35_0780"
                     /note="previous protein_id=AAZ14305.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722473.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982262"
                     /db_xref="UniProtKB/TrEMBL:E9AEQ3"
                     /translation="MSYAQQHFNRLQLRYHEVVQPPHGFYAASAAVHNSRTPVRLRDV
                     VIGTHNQEPLPRGGSGDPASDAHDSYMACYPHPHSIIGASAAAAWCETTPSVSGAGVP
                     RQVFQLLQHNPKHASPPRLKASQKRFTSPHSSVTTSETAAGQPPVRLSPPPRVLEETV
                     DKRCRPSAPGHAGVPHDSLATKLHGSRPLSADAHRRPGDRAEHSKGNSLSTGGLSAAR
                     LSTSQLSASATFAARLSNIIETRQQIELLMQRQRQDEEELIHAIAHIDAQSLGRSHPR
                     QSPHPGTMLTDSVLSPWRQQQQQQQDAVDRPSYEQVLIERAAVFAALRRFKEKGNIIV
                     HKLYNTVKAQQEQVLELVATVEALKKANKRFKDALSNGGGAAGGSLGSGAGAAATAGG
                     VTRLPDTVAELQEKVITQRRVIEQMDQLMQNADRMLLAMRARVEAAEQRASGASAERR
                     RLPPLPLTPGSGTSNASTPRQAPVGGDGDAATVSAQQQQFLLGRIAQLWQALKQEQAQ
                     RLHLEEVYGATSEETARNVALLEERLQRVQNTRGVMYNSSGSATNAAAVQMELHTLLE
                     EGGHGSGVSVAEEIRRKNKEQRTMLPASSRSPSSTLARTLFTAVSVGDAAAAEDYKAE
                     KEDDAKQAPDGSKRQPSSEPAAAQNARQRRAYLGGPWSAADSTSVDLAAEEQDLQLGI
                     PVPDASHLRDSTSRSFHSCSSGASRRLVGFLPAKAADVMSCTVDSASDGANDNDEGHV
                     AVVRSGSNARGRAAVIATANPMAIHSSSSPLPDTIPSVG"
     gene            <363973..>365532
                     /locus_tag="LMJF_35_0790"
                     /db_xref="GeneID:12982263"
     mRNA            <363973..>365532
                     /locus_tag="LMJF_35_0790"
                     /product="putative actin-like protein"
                     /transcript_id="XM_003722426.1"
                     /db_xref="GeneID:12982263"
     CDS             363973..365532
                     /locus_tag="LMJF_35_0790"
                     /note="previous protein_id=AAZ14306.1"
                     /codon_start=1
                     /product="putative actin-like protein"
                     /protein_id="XP_003722474.1"
                     /db_xref="GeneID:12982263"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="UniProtKB/TrEMBL:Q4FX37"
                     /translation="MQSQQHHYTASPTASPALSRAGVSSTPVLILDLGSRTIKSGLHT
                     ATTPHLTPALVGTPKYPRCLPQVSSSFNQSSSISTSCFVVGSDAASRRGVLRLSRPIQ
                     HGGVIMDWVGTRPLLRQSIQNALVPPSSSLAVRQPLEEGEDVIYSLVESPYASRPQRA
                     RLAELLFEGPDQEAVMSDSGKQQRVGPRAAGVFCGVGPLLALYATGQTTGVVVDVGDG
                     AVSTAAAADGYVLPQCLQREADGATGAAVTSYLTRLLYQSGVLGPAAATAAFRRSAPP
                     SLLGSATNHLSSGAGAGTQQERELVYALKEACCSVSATPLFSTKSSLAAADASTAATP
                     SLAELNSALIAAAQRTQHSGPGGSGAAHASTPFSHPFTLPDGSFLEVGGAEAAQASEV
                     LFYPALMGSEGRGVVDVVLDAVAAAPAELQPQLLGNVVVTGGVTCSAGFGYRFFNEMQ
                     QRIRGCAASSTNGSSNQRICVSAPEQRAYAAWMGASYVAQISSFASSMVVTRAAYEEE
                     GEAALARRVLT"
     gene            <368476..>371523
                     /locus_tag="LMJF_35_0800"
                     /db_xref="GeneID:12982264"
     mRNA            <368476..>371523
                     /locus_tag="LMJF_35_0800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722427.1"
                     /db_xref="GeneID:12982264"
     CDS             368476..371523
                     /locus_tag="LMJF_35_0800"
                     /note="previous protein_id=AAZ14307.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722475.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982264"
                     /db_xref="UniProtKB/TrEMBL:E9AEQ5"
                     /translation="MAYAYTDPTSINYILQRAHTELRRGENQHYRSTEAQYTNHVKEL
                     LGNLERYLETCGVRLPTQVQEGAEITATAEAAGETESERTPFSAPPRGRLVATQRVNQ
                     GRRLSSGSAFASVTVGSAKCDSNAVNRHEEASNNISVYSSGPVRSGWGKLATPCEAQR
                     GSGAANACHVASSCPVAAATSTLHGIFLKHDQVNAMSDSSSSPLGAAYQQHIAPDNRC
                     VRAVTSESEASILYKSQQATTAHAAYSSSSSSVAVDAGADANAEGSTTSLLHSGDAAG
                     VDSCSVDSGSAPIVAIIDSGCGGGNSTRSRGRGESVAMRSPPAPPQLPDHYTGEGARG
                     GLYASGDSFSRSTSTHLMVLNAIASASCVSDADAGAACTAAAHDRWGEFGTFVQSITE
                     SRQNSNLASLRSAAAAGCPLPDGVNGAPVAPLPAPMRNAENGSSGAVSAPLAVVAPPP
                     GVDPMVGLQLPSLPSTGTSMTTPPAPVSSAAAGRQVQPSPLHSSGAKITTSSLTLQVA
                     HGAGSSAVRALAAAGVAAEAGGSSEMPNAELDKPLSPSFGILSSPPLIAPVPQFECIP
                     CPPLHSGPGRPAYFTAVVAPMQRVASEPLASHRLCGGGGDGTDSIVHHQQAQRGPVPP
                     HPGTSADAVAATAATATTASTRNPEKAQLMCRLREVLERSVFGKSSVQPPAVPSAVAA
                     GRRSSLSDNAASGVGENQEKHSAAGSTRVPVSSLVPSPQSLRQNQQMPGYPTPLPSTT
                     KTDDTPGGSANAQRSDSPSELKDGDKRGDGTGGVAWDDSWDFLRLATAAISEFPHTTS
                     SKDIVSEAATSHSVPRGTVRPKDAGGDEDRGSMGPPRCDHAPKEGCRAHGYVGSSNKA
                     ATMNAARPPGGLSVCRRWDMGSCATANNTSSRAYAKEMVAASLVANAQQYRPSLPVPM
                     LWMRPARSPPGIALQGASVSDGYRTGLTKSNVDNFSRAEEEVPRARQRHSAGGKRVLG
                     DEQQPSQDDDGERQSFSTNLSPAHAEKQQLMQRLRMVLSRHGE"
     gene            <374322..>379256
                     /locus_tag="LMJF_35_0810"
                     /db_xref="GeneID:12982265"
     mRNA            <374322..>379256
                     /locus_tag="LMJF_35_0810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722428.1"
                     /db_xref="GeneID:12982265"
     CDS             374322..379256
                     /locus_tag="LMJF_35_0810"
                     /note="previous protein_id=AAZ14308.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722476.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982265"
                     /db_xref="UniProtKB/TrEMBL:E9AEQ6"
                     /translation="MSNAASSSGESAEPAHPHQTPVICIRPNGQTSHTADSFKSKQTP
                     LPILNPKSEAPCVASPSPSAHSSTVNALAATTAGSHNPPSTHGGAVNRSSSCALPLSS
                     TPSALAPVTPPPALLDAQGAHSPATAPATQAATAQSPTTWGKDACTALPAAAQLYLGP
                     TAVATVRNDLSAAAAAPRNGASNLVTDYLSTSSSSSGFSPGNNSSPHHLLPTGFAVHV
                     AEAPMGAEELTKVAAGKQSAVSEQLLSSAAQLQTSPHDSDPLALQGPCRPAHGVAGAQ
                     VHPSSSARDNEPQIPSQKDPTSTLSTTEHDASYTSGLASRMRAVDTSTTEGGDVMGSF
                     HGTAEAGTDSPNMPRLRTRMHTEQQGPGTGEGRLSDAISGAVLGKDVMNANPCTIDFS
                     VSGVGGGGNNGNTVNGASMTLGRSISSHFSAPRGHGTGSSTPPPHLAGDEDKCKLAAA
                     CCRSDWAAPRQSSSASFNCTSSSAGAAAEPVNTPTRITTSSTGAAAVDNPRESPSLWQ
                     HDESLEGTFEALVSTLRTTPSTANATPGDVEPVSLQEAQRTPAGQQMKQPLLQTLGFS
                     LRDSSGGGASTSTQSKRRAAKSDAATTLSIASSGAAAAMSAGDAQPHSPMLDLNNNTG
                     ARPPPTSTAARDTCEAGGKESSGEELAQTTDTGTEDRSQMQFSGDCSAPDPCKSAILT
                     PSPLQPIDATNRNGLENLTGPPDGDRAAGGVGSPTARRSPVADDHASFRSSNSGLSSL
                     LEKSSVEEGEKNFGRASAAATGHDARVDALRGADLVSSRCVGSLAARSDVQPSPAVGV
                     LKDKTFTAHRLSGTSAPDTQAVLPSFNIVPEQDSGFRSFPHSQSPGYSATGSNDENGQ
                     SVHGAAAATHPPGADATVTAVRLQPIRRMKYGEAPDPLMEAYSIDPLPRKDASGSTAA
                     AGAGGGAGSRNSSGSGVFCSSLPLSAQRQTYRDAVTWAPAANSATRPPLSESYVHEKG
                     GARAGLARRPDNVTANGDCAGSTSSCTFSDGLLANSTVTTVASGSWSLLGSAEQQPQR
                     PCPVVMVGAVAEDDDMWGAPISSAPAPAAQSPAEATVRAPVRHVTFASPATTHFVEPL
                     PLPWVDSDYFLPNYAYMEYKDSEEGSPSEQQQQQQVADVPMVDEEEAEVLQSVLPFRF
                     RHRNARAQASSQLSGVAVHLRAPVWETWSRGSDSMRSKTSAVSTGEDARTESCATHAQ
                     QQVEAVVPMPSHGSGEEAEARHAAAERAQGVFFTKERLASRAALMRSRRAGVQAAGST
                     SGPALRIHLNPPSVATANTISLALPDFAAPVMSTSAATWHKSKVAQTRSPPTSDDNKD
                     AARGVDDDGGFGGSIQQQKHAAPARPLAETAASPIASQPLTRELCAQLLASLERGSAP
                     VTQSTASFALDTECVVDVLRDIFGDTAAVSDSLHGEPLLPAAPPVPISADGASPVDLL
                     VPGESLSTVERILEALSFTSLTSRASGASLTSSCAMEASVSSGPHSGEQSFAASAGVA
                     AAVLNDGYVVPWRMHATAAGVTHLTGASASTDGKGPVQAVDGTVAGVSAEMAALQEGD
                     FKDGADASVHLTRQRLFPLSAHDASPRRRGTAALSVASFLGTRRLPDAPTAAQWTERD
                     VLVAVLQEQRSMALEYGGVSETERLEDVLRTACS"
     gene            <379854..>381092
                     /locus_tag="LMJF_35_0820"
                     /db_xref="GeneID:12982266"
     mRNA            <379854..>381092
                     /locus_tag="LMJF_35_0820"
                     /product="putative aspartate aminotransferase"
                     /transcript_id="XM_003722429.1"
                     /db_xref="GeneID:12982266"
     CDS             379854..381092
                     /locus_tag="LMJF_35_0820"
                     /EC_number="2.6.1.1"
                     /note="previous protein_id=AAZ14309.1"
                     /codon_start=1
                     /product="putative aspartate aminotransferase"
                     /protein_id="XP_003722477.1"
                     /db_xref="GeneID:12982266"
                     /db_xref="GOA:Q4FX34"
                     /db_xref="InterPro:IPR000796"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="PDB:4H51"
                     /db_xref="UniProtKB/TrEMBL:Q4FX34"
                     /translation="MSTQAAMTTAERWQKIQAQAPDVIFDLAKRAAAAKGPKANLVIG
                     AYRDEQGRPYPLRVVRKAEQLLLDMNLDYEYLPISGYQPFIDEAVKIIYGNTVELENL
                     VAVQTLSGTGAVSLGAKLLTRVFDAETTPIYLSDPTWPNHYGVVKAAGWKNICTYAYY
                     DPKTVSLNFEGMKKDILAAPDGSVFILHQCAHNPTGVDPSQEQWNEIASLMLAKHHQV
                     FFDSAYQGYASGSLDTDAYAARLFARRGIEVLLAQSFSKNMGLYSERAGTLSLLLKDK
                     TKRADVKSVMDSLIREEYTCPPAHGARLAHLILSNNELRKEWEAELSAMAERIRTMRR
                     TVYDELLRLQTPGSWEHVINQIGMFSFLGLSKAQCEYCQNHNIFITVSGRANMAGLTH
                     ETALMLAQTINDAVRNVNRE"
     gene            <385944..>389528
                     /locus_tag="LMJF_35_0830"
                     /db_xref="GeneID:12982267"
     mRNA            <385944..>389528
                     /locus_tag="LMJF_35_0830"
                     /product="NADH-dependent fumarate reductase-like protein"
                     /transcript_id="XM_003722430.1"
                     /db_xref="GeneID:12982267"
     CDS             385944..389528
                     /locus_tag="LMJF_35_0830"
                     /EC_number="1.3.1.6"
                     /note="previous protein_id=AAZ14310.1"
                     /codon_start=1
                     /product="NADH-dependent fumarate reductase-like protein"
                     /protein_id="XP_003722478.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982267"
                     /db_xref="GOA:E9AEQ8"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001834"
                     /db_xref="InterPro:IPR003374"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR010960"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR027477"
                     /db_xref="UniProtKB/TrEMBL:E9AEQ8"
                     /translation="MGGCATATQRRCAATDSHTGASVVVVDPEKAARERDRIARDLLT
                     TNFPELHVNQRWVLLYKDVMHTVPYTLTIAVDGSVARQDADPVVKAILSDCFAMVDKH
                     LNSFNPDSEVSQVNRMPVGKKHVMSEHLFEVVKCCEEVYHRSGSCFDPAAAPLVHKLR
                     DAARRQDSTEGDFAITAEEAGRFTLTNSFAIDIKEGTIARKHEDATLDLGGLNKGYTV
                     DCVVDQLNAANFADVLFEWGGDCRASGVNVQRQPWAVGVVRPPSVDEIVAAAKSGKSM
                     TMNAHSLGDHTDEPAPSTLAADGAAKPAHKAFLRVMSLSNEALCTSGDYENVLFANAL
                     GCALSSTYNWRRRCLIEPCQNELAQVSIKCYSCLYADALATASFVKRDPVRVRYMLEP
                     YRHDYNRVTDYAAYTREGERLAHMYEIAHESPACRIERIAGSLPARVVVIGGGLAGCA
                     AAIEAASCGATVILLEKEARLGGNSAKATSGINGWGTRTQAVNHVLDNCKFFERDTFL
                     SGKGGHCDPGLVRTLSVKSAEAISWLESFGIPLTVLYQLGGASRRRCHRAPDQKDGTP
                     VPVGFTIMRHLEDHIRTKLQGKVTILNEMAVVSLMHDVSAMPDGNREIRVHGVRYTSM
                     TDASGTVMDLPADAVVLATGGFSNDRTPNSLLREYAPNVYGTPTTNGTFATGDGVKMA
                     RKLGATLVDMDKVQLHPTGLIDPKDPSNRTKYLGPEALRGSGGILLNKNGERFVNELD
                     LRSVVSQAIIAQDNEYPNSGGSKFAYCVLNEEAATLFGKNSLTYYWKSQGLFTRVDDM
                     KALAELIGCSVESLHRTLETYERQSTGKKACPLTGKLVFPSVVGTKGPYYVAYVTPSI
                     HYTMGGCFISPAAELLMEDHSVNIFDDMRPILGLFGAGEVTGGVHGRNRLGGNSLLEC
                     VVFGKIAGDRAATILQKEKHGLSKDKWVPVVVRESRASDQFGVGSRVLRFNLPGATQT
                     SGLTVGEFIGIRGDWDGQQLIGYYSPINMPDDKGRISILARGDKGNLQEWISSMRPGD
                     SVEMKACGGLRIELKPHQKQMVYRKTVIRKLGLIAGGSGVAPMLQIIKAALNRPYVDS
                     IETIRLVYAAEDEYELTYRLLLKQYRTDNPGKFDCGFVLNNPPEGWTEGVGYVDRATL
                     QSLLPPPSKGLLVAICGPPVMQRSVVADLLALGYNAEMVRTVDEDGAL"
     gene            <390728..>391717
                     /locus_tag="LMJF_35_0840"
                     /db_xref="GeneID:12982268"
     mRNA            <390728..>391717
                     /locus_tag="LMJF_35_0840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722431.1"
                     /db_xref="GeneID:12982268"
     CDS             390728..391717
                     /locus_tag="LMJF_35_0840"
                     /note="previous protein_id=AAZ14311.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722479.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982268"
                     /db_xref="UniProtKB/TrEMBL:E9AEQ9"
                     /translation="MAPSSQARSRSGSAAISQRSSIGAQVAPLGPHDLTPNADGSTCS
                     LEVTGTALTLEEVGCRSVTQRFLSALRRHVRQRGSGLFKSRDSTLRAALQSGEVYLHH
                     HPSLHLPSQNYFSHSLQEKYDKLNTTDASLEALYVRPAFQEWFVANREQLLRDMRLRE
                     AFAKWCNVATVFVLVVALLLLPAYSFSMQTNATQWVSPLTSVDDEATVAAAPLAQLLA
                     TRLHYIQSRGSTPRIATSTTLSSSRPRADASVMATNAVKAAEYVSVVAAACALVTSCF
                     MPRESCTTASVALVSFLLLVVESALVPEAAVKLGLGFLVVFTIVAMSVCRAAV"
     gene            <392729..>394324
                     /locus_tag="LMJF_35_0850"
                     /db_xref="GeneID:12982269"
     mRNA            <392729..>394324
                     /locus_tag="LMJF_35_0850"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722432.1"
                     /db_xref="GeneID:12982269"
     CDS             392729..394324
                     /locus_tag="LMJF_35_0850"
                     /note="previous protein_id=AAZ14312.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722480.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982269"
                     /db_xref="InterPro:IPR021261"
                     /db_xref="UniProtKB/TrEMBL:E9AER0"
                     /translation="MVDIIVWAYVVGLFIFMSCKYIAYRLQGLHYFFLDYCYFHNSVL
                     MCFLLWRLVDVQWSEQPIISWSAHMPLSRWLHDYGDNVSNLAMSTAVHAVDNETWWRP
                     ILTGTPIRRESCTRLIVPPAARNYRFDGVYLPISFEILTCGYVVAHLTEAEVISSFMF
                     FFTLLAGTFGPILGAILMWRNALLFHSFDRMSSCYLHLAPGIVQSLLLHRLFTSARHE
                     IESLDPGRLYENVTGIAKQLNVSVGSLLPGVHTLMHNMSDVSTAAAENATKVGSTHRG
                     PARLISSVYSTLTAKQQQLRFTQYAATHQLEALCGYGTLCYDLRRAVTYGNLLRLHFI
                     MFCVWQVFYHTFNEWRRHAREQWWKKRLAKLERQQREFVQLASATGTGAELLHSAAVM
                     SEGDGGNPAERMTSYKWMMAHPPGGRKGILARFVLLFGEGRLPTTVMFQVTQWLLHMF
                     FFTCSYPFIHVCFHYMLSAWPLMVLVLAFALLCVYNAACVNHKWISKLQQTASKRMEA
                     GWQDQPTKSMAQTTGSAATTKAR"
     gene            <394886..>396160
                     /locus_tag="LMJF_35_0860"
                     /db_xref="GeneID:12982270"
     mRNA            <394886..>396160
                     /locus_tag="LMJF_35_0860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722433.1"
                     /db_xref="GeneID:12982270"
     CDS             394886..396160
                     /locus_tag="LMJF_35_0860"
                     /note="previous protein_id=AAZ14313.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722481.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982270"
                     /db_xref="GOA:E9AER1"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="UniProtKB/TrEMBL:E9AER1"
                     /translation="MKRSYRDSKPRFHKHRQGKMLLPHNHLAGLFFTVNPRQEPRAQR
                     EAQLYLSTLTSDLEAAHEAFIKSSHTTSSSANDAAGRSSNDQVDATVPPPSASLSSLL
                     AAELAACSTHDANGNRFNTTKRPRSEDDEADEDSPADNGADSEPGSRRRRDTPHRRSE
                     WFAPLETGCKGYLFLNVPTVNATVTCPTCHAVSNLATKAEGVTAAPGAGGAAPSTTEA
                     DALPPHTIVVNPLVSRITERMFEDLAANPRPIFRNCFRLMPAELTCCPTLPEMQAALR
                     KLLSLHFAAEMADSTVAADDRVDFAQRIPLPSWGADRPRRSMHTIALQLTVKNNTSVE
                     RKKGAMASALTAAIPANRFIVVAQPSHKTKCTVEATVCIFVAHATCVMGVQRRVTERH
                     SFNLHAVGEEAFVLSNAVQATPKAEQRTVRHE"
     gene            <396904..>399675
                     /locus_tag="LMJF_35_0870"
                     /db_xref="GeneID:12982271"
     mRNA            <396904..>399675
                     /locus_tag="LMJF_35_0870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722434.1"
                     /db_xref="GeneID:12982271"
     CDS             396904..399675
                     /locus_tag="LMJF_35_0870"
                     /note="previous protein_id=AAZ14314.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722482.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982271"
                     /db_xref="UniProtKB/TrEMBL:E9AER2"
                     /translation="MKFVTIERQALHDLRDSSKAVKTPCDRENDRTADTLAQLVEKLK
                     MNEPVCVSVQVYDGRFQKYACTTPVGTHILDLAASIDCSGSVVQGQITEHQCQLLVSF
                     PERLANVVGQNRNATFLFDSTLYWERLCDTVLLFHFTKAQQTDNCEGVQVDTKHLLTV
                     LKVLAVLLLRRGKSDIMIRRLRMMPKYLFDGEYFCERFANLMEAAFEASKQPHFSLKS
                     QRRAEVSSLWHRWNSLLFQLVEKRAEIKDVVLSAVSNLINTPAGGNSIQLANNVFYTV
                     CVHQLSVAAPTRATARTIVRDFLPAVAGIADANHGLTHREQECFSALFKKWESKEFVT
                     SADLSLNTRLLHPVMYALLYLHKKAPAESKFPDAFVGALLTGVTIRLDSTRGPELRNC
                     AMTVAAAYATLFVTSADGIAPLLQDSNFSTALNEWMKEEPGTSQYAETVSAVTQMKNK
                     PIVAVGLEMRVSSLVEVFPLDPDEEYHFFARPSHSREEKLIAAQTIDAPVAIMQLDST
                     EAPLPSFGQQKYTKDELGEHVSILSSIRECYDALVGVGRSPNAQLHEVQEATESGLRG
                     LSDAFGKLRQRIGSDLFNAVSRETGSLVAVLLPTLISLSIHAPEDEKQHLVQLRYKII
                     VDLIVLNPPLALNQLSGMVYRSNYGIYQRTELIKAIGEAAFVLSQVDVAPASAASTGT
                     GREQATVAEKLQRVYPPIPTHELSSGRKPSIVVSEGKSTRRWGNAVVERQNRTRPRHY
                     SNLLGGVAAAFVAVFLHKLDADHFAFFQEVDPYTPCAILDSLTSVFQGITNVRHVAAE
                     LSEKNFDFFFAVCTRHPNLAVRKAAWASVVEVMRTWCGVAPLWIRRKDGERIFNRDAV
                     AYRSLVFTKTWMSALEILQHACADMVQKSDPCGHTALIAVSSLRDLVCDRDDFYSMLA
                     RVEEHALEE"
     gene            <400340..>401899
                     /locus_tag="LMJF_35_0880"
                     /db_xref="GeneID:12982272"
     mRNA            <400340..>401899
                     /locus_tag="LMJF_35_0880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722435.1"
                     /db_xref="GeneID:12982272"
     CDS             400340..401899
                     /locus_tag="LMJF_35_0880"
                     /note="previous protein_id=AAZ14315.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722483.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982272"
                     /db_xref="UniProtKB/TrEMBL:E9AER3"
                     /translation="MMAAPATTSLDKIRAQLVALRNENRRIVEEAKQVAEQRQWEKLV
                     KEQKEKDVLRVGIGLTHEKTRGDSLTKLIQSEYSRLNKPNDAFRVGKEVVDGVAQRSF
                     LLQEKRFKDTDDVLRKNGNATDTRRYMALTFSSSPEQRSHLVDVLKRMQAQWAAECEK
                     LTRASDSTQSSCSNNINVTVEASSSVVSQLAWLTVLEGLPDEDTRALWEADILDAETL
                     SSLLSDPLSDTSSPTERSATSERTRNDGGQDTSDEDAPADLLFKKVKYAQQLYYLQEI
                     TNTIRETELGDVPPIDLAPAIVKAKRRQFDDVTEDELRQLEQYEESAAMHLPLKVSFP
                     STGASRGVKAEPCNVCVPAAMLERALFPSNCFLNAVAQKDAALRRSLERMERIKRETL
                     LDPEFQEAVRFAHAVEEASVAPHLRGWDSSNGHDGDASGEENGALLRATRRTVSKREK
                     RAARSHQLRGPMARSPYSPEVIPYFYNDMRSIVPPRGAFNLPDPAPTKAERAALRGRR
                     RRARKGARYSK"
     gene            <402418..>402915
                     /locus_tag="LMJF_35_0890"
                     /db_xref="GeneID:12982273"
     mRNA            <402418..>402915
                     /locus_tag="LMJF_35_0890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722436.1"
                     /db_xref="GeneID:12982273"
     CDS             402418..402915
                     /locus_tag="LMJF_35_0890"
                     /note="previous protein_id=AAZ14316.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722484.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982273"
                     /db_xref="UniProtKB/TrEMBL:E9AER4"
                     /translation="MFSSHKTPAKAQRDGYDDEQHLVAAVSEFKKVEASNQSMVDQLH
                     QRLASPFQITAKPCEAGRAAVLQCYQQLQSSSAVTTSNAASSTSPAPPPGARSDSKSA
                     KVAPAEAWLSIPYQQCYETALAYHQCVEDTLAKHLALVAAFEQCGTQQKIAHQSAMKA
                     QDKPQ"
     gene            <404221..>404928
                     /locus_tag="LMJF_35_0900"
                     /db_xref="GeneID:12982274"
     mRNA            <404221..>404928
                     /locus_tag="LMJF_35_0900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722437.1"
                     /db_xref="GeneID:12982274"
     CDS             404221..404928
                     /locus_tag="LMJF_35_0900"
                     /note="previous protein_id=AAZ14317.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722485.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982274"
                     /db_xref="UniProtKB/TrEMBL:E9AER5"
                     /translation="MAPKKNNTKKETKRKELTEEDMLRLGMTPEDIRRILEERGKSSE
                     DKQAEQAREEAQRREAEARLRQQRDHQKQVESMVAEETTTRATLRYNEDQEWTLMESC
                     ELMPAKQKILRHVAVMEAQRRAEEAKRRQAEELAAYQARLQSMSDEQRAAFLEEEKEK
                     EKRHIEDIVASEEKRMERERRREARRKARKERLLNNENADDLLSSDDEEPKGKGAKKG
                     KESAIDELEFDLHEKYL"
     gene            <407235..>412871
                     /locus_tag="LMJF_35_0910"
                     /db_xref="GeneID:12982275"
     mRNA            <407235..>412871
                     /locus_tag="LMJF_35_0910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722438.1"
                     /db_xref="GeneID:12982275"
     CDS             407235..412871
                     /locus_tag="LMJF_35_0910"
                     /note="previous protein_id=AAZ14318.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722486.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982275"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="UniProtKB/TrEMBL:E9AER6"
                     /translation="MRPNSTPAEVSPGAGYETAQQKASTLQQSAGDRSAPPAARSRIG
                     RHLAPPWRKCRAASALGSPSHASPSSSPSASDMQSTSSRTCSSSSDREARGAYRSLQR
                     DSQRNRGRGATPATAAHPSASSAITKGSKTSWRASQQQRKQRRVAAGGAYSSTSSISS
                     ASATSPNDTAIKSARTPSDSWLSRRKCASRDDEGDAFLSPSSSTSVEPICAFTDVLPR
                     DVYLHICGFLTEADCCTLLEVSLCMHAAITSADSIVWRHMCVSTWLYKQGFQTFIQHV
                     RALEVLARQEELEVQALQQHMLLLREQGIVFGESDVSATCDCTTVLIRRRQHERARWM
                     AAAAAGATTSKLHRSRLTSKVGSAAASASSTTQTGSSCVISGAGGRPRCKSRRCHRNT
                     KRSTTTTASTSRRSGNICGAAGKRPTHAVRWAEPSTQRPNSRSTATTATSRTIRSRRK
                     CSDGSRDSDDTSESLSRSCSSRTLSSSESSKEETCNGMHHIQTHPPSHHSADGSAAPL
                     RPGGSDAGEKASSATGCPPPSPPPSSSHADASAEPREKERGGSSAALRSTSSSDDRGH
                     NAYEYLSTEDGKTEDRRERRVCIRLPEAEAEDEGNANLTDASVLAVRSRSGSRHRRRS
                     RRSLSRSLLHPAHGYPHHHRHDGSSRQQQQQPGSRHRRSHREKRRKPARQRRRKRGRS
                     RGPRSTGGGGSRHRSQPHRGQGRQHRSSHQHHHNPKATKSSRRRRRRQRNAAAAAAAA
                     AQADRDGGSGSFYASSPNAAVGGGISTYFYQTATYEAIKSTSPVHAAQHVAPSMVPFR
                     LGGRQASSVSGPEAVVIQSRGKVQRNPRQLCGSEVHACEASAAGALAQPAAPLNSGSD
                     VAQRTISAPPKTGSVSQQITSPQTVATAPIAATAFGTGANEERLYWWQLTPEARQHQL
                     RRMQQLVLQQQFAASSGELTTRTSPSLRDGDELADEAALREWDELEASSLGSSSGTMY
                     EEDADASREGDREEGYSDRNGASVSSDDTERRSECSTNEDEDEGEGSTDSSDYRRRRH
                     RSRKLWRTQSRSTRRSVTSDETTSTTALCRLSYRQRHGGEPSTSSFSSCSSRLHTAPP
                     SLTNGESTASECGVDNEKERWMHAGVRGAASLPHQRCKLSDGAGGGTSEGTADRYDSD
                     EGATAASSATASVVSQADNKLIAGSSSKSGSGKRVLPRGRRSGHPYTSPDISVAALVP
                     SSSRLAIRAERRVAKALEKRYEGIEEAMVITRSKSMLIHTLERQTHAHLPRLLAAAQR
                     QHRLMMNARPAATAAHHADPSLVSPTVALHRGTPDFSEVASEPTARAIILIGAGSSGF
                     SGCGTSTTLPAAASLAAPPASHLLSSLDNSFATVAASTLAVPASPLYQLARTSSSNAL
                     TSSSGERGGGLSGTLSCQDSPRSSPPSTSTASLAADTTGNGGGVAAAPRAPLQGVLER
                     HRMAATAAAAVGDNGVRGGAPSSAGGAPLQPTNDDEAVDDDDEEEQFAPVSWKFAFFM
                     SRREAQRVKITLQDLIEGMWVVCFRSSGRTHPIRFVGQHQVFLYPPLPTTEEEEAQRL
                     QQNGLESSEAEGEAGHTTTTAAATSATSAAPPLPFHILQGGAQLVVHQFPPMKVMRRN
                     GAAPGNAAAAGGTPAAVAPVSSANAPAAAAVTPAMMAERRFAAEPQATLRKLRLRMLS
                     SAARDAATFETMPYGDVTGGLAAAGCAVDDEHNGGSGRDLGCRDCTSYDLHDTAAVSS
                     TATTNDVRRAIAQGLGFCAAYMKEALGQLPFRSGEEHTNEDEGATTRRGCSAAPSRAK
                     RRRFFYGPLTQREYEARQRRELCFAPGGAGDVLNDWGWTITSQYVKIFSLDITAPLYV
                     KRLQRVADVEVIGRNHGGGAAQVIRSEERLSPLGCG"
     gene            <414353..>418390
                     /locus_tag="LMJF_35_0920"
                     /db_xref="GeneID:12982276"
     mRNA            <414353..>418390
                     /locus_tag="LMJF_35_0920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722439.1"
                     /db_xref="GeneID:12982276"
     CDS             414353..418390
                     /locus_tag="LMJF_35_0920"
                     /note="previous protein_id=AAZ14319.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722487.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982276"
                     /db_xref="UniProtKB/TrEMBL:E9AER7"
                     /translation="MNTAVDAAAWPIGQANSDRSSTSSGFPLAICLHRYLRWLGQLHG
                     TIDAVSDDAYTLDRLIFQGVLPLRQRTGIEPTAAEARLRAAVCALLIGDAAAQSARPQ
                     ESMWATSAATTGGGYSAASLRSAALSPPMVHTEAPSCPCRVYFEQQQREAESRRLSRS
                     RRSSQEEDDDKESHPGHAATISSVSGSDDESKDCAVHLSATMTHLPARLKDVSRDADN
                     TGSSGGLAGALLAHTVTLGCSGGDSSPRGDVAAFGRKVRTGSRPSVAPPQPMPLLLPV
                     AAATPSCTASVELGSDAPQANSNGDAQRHQRGGRKGSGSSADSFFWPRPMPVGAETRA
                     HRTLHPMLAHVRPEDVRRCSLCSAQVLLESAWHAIYQMSLLTLLSAAPSMAAPLPLPP
                     PDVLRMHPAEALLLLYQCAQRCFVSGIIMATSVGLPASSLRGGPSSPQGDVSAQPLSA
                     LDVLRGGHGGWAATTACFSEQQQQCRTTEEGVLAGLAGGLLCVVEGVIGTAAPQLWPR
                     ATTAAPAKRALEDIMGDALRLRFGLFHTIFVILTTENGSHAALAKLATVCGELLACLH
                     RLTFWHQKDLVSSESSPRSFSLAQRSDGGTHLPEGDGQGMISSKEAAGEAAEAVAAEK
                     LSSSSTFVDTNPIEEAHEALIQAFALLDVPHTTAGGVGDAIDDKAMTVLMEDISVLCC
                     VAALVGSFARLVRAREMSASVAADAFLSASEPAFSSSSRLSSSPLLPLHHHSLLLDCH
                     VYPCLQRLQSSIRGDCSVQARHLIALWWLLRAETVRHWVWAATIGPSHVQGCSTLDTA
                     EELHSTECSALHVLGVDITLYEDLKREAQPVQEQQRQHWPQWLKDASRAAVRASDVAN
                     EFLGLTLIQTWSSASLPLLTKPPLPVTSAASMTTPLRWQLPAFSTPPLSPQTPGAFLP
                     LPWIRLWLLLCPPLFRTSPADVVALRQRVQRQLQHEEEEAPTAFGVPTTANHSAVPVE
                     AKTIAAVATNKRKSVQVRQASPKNTHQVGSGAQSKAAQRTAGAPTSLGVADPRIGSRN
                     RGGSVTSASAAPSDNQDKETQLQRRLQLSKEPVCFWLRWCLLFTPSPLVQPRSIDSDV
                     PRKSSSALLLSALEYVVRGLRCPKAAWIQGPQRSPAPSTELVCLLQHAFPLYTPANVV
                     AALKVQAQLFVAREVDLQRGVATETQAAAAPLPMPETLEGLTFAPYSFAAALASLQDV
                     VKHSQVAAAASIPPHEQDVSRATISGSLSAADPPQSKPKQLVPSPPSVENRSRSVVGA
                     ATVATVTQSTQRSGTRRSPLVAARVLSRRVAGTSAKSSATDTATGEADCGKVDKAAKS
                     AAADGMEPEAADSATAESTRRTSAI"
     gene            <421648..>422157
                     /locus_tag="LMJF_35_0930"
                     /db_xref="GeneID:12982277"
     mRNA            <421648..>422157
                     /locus_tag="LMJF_35_0930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722440.1"
                     /db_xref="GeneID:12982277"
     CDS             421648..422157
                     /locus_tag="LMJF_35_0930"
                     /note="previous protein_id=AAZ14320.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722488.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982277"
                     /db_xref="UniProtKB/TrEMBL:E9AER8"
                     /translation="MAVRHQHATAADEAAASSISASASSPSISSSSGNLGGDDGVRID
                     PRRLPSTIPGMTQEELAARIVRYHSQQSKLAQEMSEKALAHDVELMRRSLSPSSFAEY
                     MARLEKEQQAAVKEEAKMAAMSPVELHQYRQRKRRQAVRYEWYKTFLVLVAIAGSIAF
                     LFSLFIFFK"
     gene            <423452..>423943
                     /locus_tag="LMJF_35_0940"
                     /db_xref="GeneID:12982278"
     mRNA            <423452..>423943
                     /locus_tag="LMJF_35_0940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722441.1"
                     /db_xref="GeneID:12982278"
     CDS             423452..423943
                     /locus_tag="LMJF_35_0940"
                     /note="previous protein_id=AAZ14321.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722489.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982278"
                     /db_xref="UniProtKB/TrEMBL:E9AER9"
                     /translation="MKPNPNEATSGQFERSFEKLTDKIESRLPFRQHHVLHGNIYEQP
                     YGERSEHDMWVEAQEDLHGREKEKPAARQARSYFSDEDLSPDAMHVRSPELKVAQNLQ
                     RQAYDKKILKTTAEPAAYYYPVVTLEEKRRYRWKLIAGWSAVGVMTLTGLRRLCEYMR
                     TAG"
     gene            <425381..>426619
                     /locus_tag="LMJF_35_0950"
                     /db_xref="GeneID:12982279"
     mRNA            <425381..>426619
                     /locus_tag="LMJF_35_0950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722442.1"
                     /db_xref="GeneID:12982279"
     CDS             425381..426619
                     /locus_tag="LMJF_35_0950"
                     /note="previous protein_id=AAZ14322.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722490.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982279"
                     /db_xref="InterPro:IPR007557"
                     /db_xref="UniProtKB/TrEMBL:E9AES0"
                     /translation="MAYTESHVNKAIDVFLDTRSGSPLAVTSANAAVSNNTVDHNRFA
                     TMIALQNRLLSIMAEAQTIVQHLQQNGFFPRGSGANPEEDAANIIMQMLRASLEASNS
                     SVTSPIGMGSGSPSAMDTGSAQRVPSPNSTNMPAGLDDVSSWAPTKSFPDNNSHSRSD
                     TENAIHSAVSHNAVEEFLLSGQDGQQQKQQQNYSSAAGADHNEEGDELPEGSEMLAFV
                     EFKRGRVRKYVCDHRIEPGNYVLVDGDRGTDCGLLVQTIERKPNNETAVVSMEGCDIR
                     DDKIKLENGRVLRQASEEDIDRLHNIIANAESVALKTCRQRCLELGIDIDLQDVEYQF
                     DMKKISFFFDCDHSVDFRSLVRELYRTFGARIWMENINPKVKNSMPDASGHERGHGGG
                     HHGNGGGWRNNHRGGRGREY"
     gene            <430305..>432689
                     /locus_tag="LMJF_35_0960"
                     /db_xref="GeneID:12982280"
     mRNA            <430305..>432689
                     /locus_tag="LMJF_35_0960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722443.1"
                     /db_xref="GeneID:12982280"
     CDS             430305..432689
                     /locus_tag="LMJF_35_0960"
                     /note="previous protein_id=AAZ14323.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722491.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982280"
                     /db_xref="UniProtKB/TrEMBL:E9AES1"
                     /translation="MLASSLPLLRRRGTGHVVKYLEGVPTPTKLIDHLAGADLHASAE
                     LPFFTTVPRYVDVQREQRLSRLYFHHVLYPAGGARLPYQAVVVRGGRAVRASETHLLR
                     VKKATSWTPLHAEQQQQQQPTAVVAPAARRPSPLAVPSSQLGSSGPASSSPAAAKVPV
                     MSVSTTVPTEDVPAPASWARVDPARRPYFSAGTPRSHEHRRSSHRPPEDTERSARVVE
                     DTTLAPLRGALEHFWNELRTTRNSSTQDVTGGPPSAALLATNEMAERVRQLLVSPAAG
                     LLWMPTSASLSNAADICEESRHTSSGVSDSSERRFWTELMAHVQERVSAMTMHVGGGG
                     DGEVKSPAAVRTCLYVQTRLPPSATVTLPLAQVRDYVHDGRETAGDLSVHDDASERVV
                     CRLAGGLEPVVSFAVGRPLTPVTTDGAATSPSDRAFAHVTCLTRLNMRVTSAPLAKAP
                     AVNAANVSSGTHPVKEAVPHFRDSTLPSAEPWRLGGVGLDLMTPLHARTVAERHTAKP
                     SAHTNGRLTALTENGTSNVKANADSAEAGRYVIGRTDAETYVLPQRELLLTLHVPTHT
                     EDMCAAQNQERLRRQVRLGRASRAAMSAAWPTEQARLTSARRAEGQYANAMSANETGA
                     HRTNAPLQVATTPLAASPSMPLLLSRLSYEVRALPGDVVYIPRGWGFDVQRIVGTATI
                     DNGSRGRKGGRDADKVGFYDHRAVAAHKGTWPGHRPETPSKSSEPNKTESHVASTASV
                     QLTSVEVDALCLNYQPYPELTEKQAAVYVAANYVHSGVDEFYERGGNSVYRSYQ"
     gene            <433955..>435070
                     /locus_tag="LMJF_35_0970"
                     /db_xref="GeneID:12982281"
     mRNA            <433955..>435070
                     /locus_tag="LMJF_35_0970"
                     /product="putative aldose 1-epimerase"
                     /transcript_id="XM_003722444.1"
                     /db_xref="GeneID:12982281"
     CDS             433955..435070
                     /locus_tag="LMJF_35_0970"
                     /EC_number="5.1.3.3"
                     /note="previous protein_id=AAZ14324.1"
                     /codon_start=1
                     /product="putative aldose 1-epimerase"
                     /protein_id="XP_003722492.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982281"
                     /db_xref="GOA:E9AES2"
                     /db_xref="InterPro:IPR008183"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR014718"
                     /db_xref="UniProtKB/TrEMBL:E9AES2"
                     /translation="MQFGIKVEPYGYDKLVWLETDALKVGLTNYAASVASIQVYHPAD
                     NKWIEVNCGYPKNPEEAYADPDYMGATVGRCAGRVAGGVFTLDGVKYYTQKNRGENTC
                     HCGDDAYHKKHWGMKLIETANVIGVRFNYTSPHMESGFPGEVKNYCTFTIDRSKPNAL
                     KTIYDSYITDNSPCDASPINVFSHTSFNLNGIPGQQDGEKNWVQPESVRNHWLRVPAS
                     RVAEADRMAIPTGEFLSVEGTGLDFRQGRVIGDCIDDVALLDRDPCGYDHPLAIDGWE
                     KGKLMLHAEAKSPVTNICMKVYSTFPCMWVYTANNKPLPASGGPGQRYARWTGLLVGP
                     QNFSDVANHYPKYPSCIVRRGERQYSETTINEFTIEQ"
     gene            <438341..>439474
                     /locus_tag="LMJF_35_0980"
                     /db_xref="GeneID:12982282"
     mRNA            <438341..>439474
                     /locus_tag="LMJF_35_0980"
                     /product="aldose 1-epimerase-like protein"
                     /transcript_id="XM_003722445.1"
                     /db_xref="GeneID:12982282"
     CDS             438341..439474
                     /locus_tag="LMJF_35_0980"
                     /note="previous protein_id=AAZ14325.1"
                     /codon_start=1
                     /product="aldose 1-epimerase-like protein"
                     /protein_id="XP_003722493.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982282"
                     /db_xref="GOA:E9AES3"
                     /db_xref="InterPro:IPR008183"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR014718"
                     /db_xref="UniProtKB/TrEMBL:E9AES3"
                     /translation="MTFQVEVRPFGAGKMIWLKTARLRVGLANFGATISSVQVLHPQR
                     QKWIEVNCAFPESAVETEADTDYMGVTAGRCAGRVAHATFKLDGVTYHTDKNMAGRHT
                     CHGGHNALNKKHWGFAVSETATEIGVTFNYTSPHMENGFPAELVSKVTYSIERTKPNV
                     LKTHYDSYIPETSPADATPVNIFNHAYWNLNGIPERNGKCNAVWVQPESVRNHWLRVP
                     ASRVAEADRMAIPTGEFLSVEGTGLDFRQGRVIGDCIDDVALLDRDPCGYDHPLAIDG
                     WEKGKLMLHAEAKSPVTNICMKVYSTFPCMWVYTANNKPLPASGGPGQRYARWTGMGL
                     EPQYFPDGANHYPKYPSCIIRRGKSRFTETIVNEFIVDCGSKM"
     gene            <441920..>444493
                     /locus_tag="LMJF_35_0990"
                     /db_xref="GeneID:12982283"
     mRNA            <441920..>444493
                     /locus_tag="LMJF_35_0990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722446.1"
                     /db_xref="GeneID:12982283"
     CDS             441920..444493
                     /locus_tag="LMJF_35_0990"
                     /note="previous protein_id=AAZ14326.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722494.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.0990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.0990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982283"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:E9AES4"
                     /translation="MLHKYDKIEDAMAACVSLEYPLIIALHDKLPTFLNNADEATCGS
                     GASGVAGGRSAAELTFSFLPTSRSMAMIQSSSSFFADGSDSCEASHTAPDLAAAAANS
                     SLGYLMRPANLTAAAAANASLMAQALADGEELALVPDFPLGSVQGGAAQREALLVTFL
                     ESRLGSVMLLHLIEAETPDYAAFSTAVPAAPGTPGISLPRVHIFFPPSAGMTPVVLSG
                     NLLTPQSVYNCVQMSLLKPKVHTSPATASGGTDELLSFFSATVSAMNREYARARQRAN
                     SASPIADLSAAPLLQQRHSDPAATTGMAADGEKPTTTAPIVAVPAQRAKGTSSSDALE
                     AAHSIRVAGLPMSFTTSATAQAAHKTILTTSSMTLQTVWRVVEKHLEWAQREVQQAQA
                     ASTWNGTTPPKPGAKLTFTIEPSATSAEAAAVTVTTREEAAKVRLQDYPRNTVVKVYF
                     DGVALPPPQPAVPAPAAATTSALRPSQYMCEGDVCRWRVPEDTPAPAAAAVATAAPAP
                     KGESTLAPASVVASSAATATASVRLRCSLPNGKTLDLAQLDPSVATLRDDVRPAVADA
                     LGYDNFVFVCAYPPRRYSIETDEPLPLKEVELGRSSALRVVSLDGPTSPDASSRRAQP
                     QPQPGHTRQMLVNAASSLMAMLASARGNQGGAPGAATAAASPSPDTRQSQQQRRTFNS
                     MAEMLAANEEAERQTAMERLRQEQEQQGLGSSSSSRHQPDAEQRAQGKKSNRYFGGGS
                     TEFIAEDGHDEVGKDSDGKRVAMEGLTPEQQEAFLSAQLRQLMNRHRRQSGEAGNENE
                     EDDEGGTQRRVEGYRAFQGQGRRLAGDAPPASGDSSNTASPHPLSPSDSALAPAAEKK
                     Q"
     gene            <445600..>446574
                     /locus_tag="LMJF_35_1000"
                     /db_xref="GeneID:12982284"
     mRNA            <445600..>446574
                     /locus_tag="LMJF_35_1000"
                     /product="putative casein kinase I"
                     /transcript_id="XM_003722447.1"
                     /db_xref="GeneID:12982284"
     CDS             445600..446574
                     /locus_tag="LMJF_35_1000"
                     /note="previous protein_id=AAZ14327.1"
                     /codon_start=1
                     /product="putative casein kinase I"
                     /protein_id="XP_003722495.1"
                     /db_xref="GeneID:12982284"
                     /db_xref="GOA:Q9NHE2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q9NHE2"
                     /translation="MSSALENCLVQGGRFRLGRRIGGGSFGEIFLGVNTQTGEVVAMK
                     VERTRTAHPQLLSESRYYTLLSQGRGAAYMPTIFGYSSEGEFNVMVMELMGLSLEDLH
                     EKCGNRFSLKTTLMLADQILWLIELVHSHSVLHRDIKPDNFLMGTGKKGHHVYIIDFG
                     LAKKYRDPRTHAHIPYKEGKSLTGTARYCSINTHLGAEQSRRDDMEGIAYLLIYFLRG
                     SLPWQGLRASTKERKYSLIAHAKMSTSVETLCKGLPIELASFLNYSRALRFEDRPDYG
                     YLRSMFRRLFMREGYQEDYVYDWTVRSMHETLTARQRKNAAKRGKKQK"
     gene            <449109..>450170
                     /locus_tag="LMJF_35_1010"
                     /db_xref="GeneID:12982285"
     mRNA            <449109..>450170
                     /locus_tag="LMJF_35_1010"
                     /product="putative casein kinase"
                     /transcript_id="XM_003722448.1"
                     /db_xref="GeneID:12982285"
     CDS             449109..450170
                     /locus_tag="LMJF_35_1010"
                     /note="previous protein_id=AAZ14328.1"
                     /codon_start=1
                     /product="putative casein kinase"
                     /protein_id="XP_003722496.1"
                     /db_xref="GeneID:12982285"
                     /db_xref="GOA:Q9NHE1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q9NHE1"
                     /translation="MNVELRVGNRYRIGQKIGSGSFGEIFRGTNIQTGDPVAIKLEQV
                     KTRHPQLTYESRFYRILGSGGGAVGIPMMFYHGVEGEFNVMVIELLGPSLEDLFSFCG
                     RRLSLKTTLMLADQMISRIEFVHSKSVLHRDIKPDNFLMGTGKKGHHVYIIDFGLAKK
                     YRDPRTHAHIPYKEGKSLTGTARYCSINTHMGVEQGRRDDMEGIGYILMYFLRGSLPW
                     QGLKAHTKQEKYNRISERKQTTPVELLCKGFPSEFAAYMNYVRALRFEDKPDYSYLKR
                     MFRDLFVREGYHVDYVFDWTLKRIHESLQEQQSFPGGSNGGGAAGNGSPVNQSPAQGG
                     NGGAPNSANNQESGAPEQQ"
     gene            <458419..>459717
                     /locus_tag="LMJF_35_1020"
                     /db_xref="GeneID:12982286"
     mRNA            <458419..>459717
                     /locus_tag="LMJF_35_1020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722449.1"
                     /db_xref="GeneID:12982286"
     CDS             458419..459717
                     /locus_tag="LMJF_35_1020"
                     /note="previous protein_id=AAZ14329.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722497.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982286"
                     /db_xref="GOA:E9AES7"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:E9AES7"
                     /translation="MNTPPLSSGSLYEQAHAATSSEDSRRDSLTEATWIAITSLTGQQ
                     NSQCGANERSPGCATIVSIGYPEMDSSPSWQSLSNQESFKAVPASPSGVALNKSALKS
                     SDGSANNSSTNTPTTVAAPVAGSVPSSNAASHYKTKRCRHFDQSGWCPYQHRCVFAHG
                     DREFALYTAQKNGGNGGNSEGGGPTTSKLVREHIERNVQQLVEEYELAVAEASAKAAA
                     RSNSAGGPSHTHGHRGPQMGSGSKGPTMPVARNMSPTQPSPLSPATTQHHASNVHILT
                     ATSLAPQAVMAINGASNSMASFQALQPQSSQQYHTHQQQFAFVGQQPLLISTVNGVPA
                     ASTFAMVPSSSLLAAAPQSLHAFPSHYQQRSMLFAMPAGAPGVLQLQQHQQQPIYFIE
                     APSYDNMAANGSSAAVPTYPSGYTSDHAGLFNDVLAARFM"
     gene            <472463..>473116
                     /locus_tag="LMJF_35_1030"
                     /db_xref="GeneID:12982287"
     mRNA            <472463..>473116
                     /locus_tag="LMJF_35_1030"
                     /product="putative zinc finger protein family member"
                     /transcript_id="XM_003722450.1"
                     /db_xref="GeneID:12982287"
     CDS             472463..473116
                     /locus_tag="LMJF_35_1030"
                     /note="previous protein_id=AAZ14330.1"
                     /codon_start=1
                     /product="putative zinc finger protein family member"
                     /protein_id="XP_003722498.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982287"
                     /db_xref="InterPro:IPR009327"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="PDB:3M3I"
                     /db_xref="UniProtKB/TrEMBL:E9AES8"
                     /translation="MTSPALAPPQNTAEFWIKRLQLVPHPEGGYYSEVVRSAHKVDNE
                     EGNRRHAYTTIYFLCTPESPSHLHRLCSDETWMYHAGDPLQLHVILKDPQDEDRIAAQ
                     PPAAPQAETDTADARPKYQVYRRVLVGARVERGELLQYTVPGGAIFGSSVAADGADGQ
                     AGYSLVSCIVSPGFDYRDFEIFTQAQLMELYPQHEAVIKQMAYETLPNHARLQTTEI"
     gene            <473926..>474879
                     /locus_tag="LMJF_35_1040"
                     /db_xref="GeneID:12982288"
     mRNA            <473926..>474879
                     /locus_tag="LMJF_35_1040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722451.1"
                     /db_xref="GeneID:12982288"
     CDS             473926..474879
                     /locus_tag="LMJF_35_1040"
                     /note="previous protein_id=AAZ14331.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722499.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982288"
                     /db_xref="GOA:E9AES9"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:E9AES9"
                     /translation="MTSQPHVTMSKNTGSVTEQHKRMSHTTGDNNEEEKHILAGRYKT
                     KLCKNYVARGECPYDVRCMFAHGEDELRTSDDNIRDGLVTEEAIKDFQRQQNQAKRRA
                     AFAAAREHNNHDHSHSHNHSHSHNHTVRPVPHGNVYEMEENVESNEVYRNRNRHHNLR
                     LHPPQEPVSIPQPQQQQQQEQQFQLQSVVAQYYTHNPYVFDLIPAAARLFPVYQEVVE
                     EGCWYEEEPVPAQEDYYFPSSDMMMPLVPSLVTQQYLPYPHQQCSKQLETVASASTYS
                     CEEAMYGHSESSASSAYRSVARCTAAELPSNSDIPAMVMEP"
     gene            <488292..>489761
                     /locus_tag="LMJF_35_1050"
                     /db_xref="GeneID:12982289"
     mRNA            <488292..>489761
                     /locus_tag="LMJF_35_1050"
                     /product="putative protein kinase"
                     /transcript_id="XM_003722452.1"
                     /db_xref="GeneID:12982289"
     CDS             488292..489761
                     /locus_tag="LMJF_35_1050"
                     /EC_number="2.7.11.1"
                     /note="previous protein_id=AAZ14332.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_003722500.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982289"
                     /db_xref="GOA:E9AET0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9AET0"
                     /translation="MTVLPPRVNVPATPALDGVDINSLYDVNHGKLLGKGGFSEVLAV
                     RHIPTGEIRALKVMMRSALVGKKGEMVAHEKEILRRTCHPAIITLHEAVQTPDKVYFA
                     LNLMNEDLFEFIVRNKTVNEGLSRAIMHQLMSGIAYLHEQSIVHRDIKPENILINVVV
                     KSDAKNAANDDSESVPHVEGLQVMSDINSIPLEQLNVEVKIADFGLAKVVMEWDVCST
                     PCGTSFYIAPEVIRGIEEQGAKPLCTNQRLVKSVDVWSAGVVFYVLLCGRPPFHGQVR
                     TGQDRRELLRRIDHGVLFNPNHGWDSISAEAKNLILKMLDQESSKRITSEEVLRHPFF
                     TAHGYSRPVPASDPRRRLVQAQQLSLKIKAPAAQSAKAQVTTMSPLSGPDGQQIKASS
                     SSGGSPSKGSSNSTGSFLSNIKDFFGHRSKHTSDISKEERQRMHAELAELQANVIAEE
                     DQEGDVTSYKPSMPVKEAKPARIAVMNMKAKVGPDALRK"
     gene            <492335..>494107
                     /locus_tag="LMJF_35_1060"
                     /db_xref="GeneID:12982290"
     mRNA            <492335..>494107
                     /locus_tag="LMJF_35_1060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722453.1"
                     /db_xref="GeneID:12982290"
     CDS             492335..494107
                     /locus_tag="LMJF_35_1060"
                     /note="previous protein_id=AAZ14333.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722501.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982290"
                     /db_xref="UniProtKB/TrEMBL:E9AET1"
                     /translation="MGKRSESGGGDASSWRRHRSRQSDRRNDDDDVGDYGDRHRRRRR
                     DSDSLADRQHHHHHRHRSSRHHHRGSAERREDSSEAMRSERVLRSHHRPRPEHSDSDD
                     EYGSFDDNRLSRRQRDGQQRWERSRSEEDNIDDRRGRREKGKRYRDTAAADDDDDGRQ
                     QGRKYRRDGRQSVDEVSRSVSGNAAASLSDRRAYGDRFQAGNSATSPTYSESSTVDWS
                     SRRGRQRMPSLAYDVDQQKRFLGFLDRRDASGSRTAAAAMEFRIGPDGLVQMPPPPML
                     VRRQNRSRFSATDDNDGNGSGVRQQPQQQQHRRRRPPSSVAPTANTHDEDGDDNSSVA
                     SHESLYNDPAAANMGILPDIIPPSNLYRVALCGVDLSVTASHLSSIVAQLLGDGAKLW
                     RVRRPAREMLHAAVSHNHAAQQQPRHQQPLHAPLPSNKSTITSSASSSGVLTDPPANM
                     SSTLHSVDTSLIGVLSCEPSIIGGGGRCRGVLPDADGSSAASGVLGDGIETISGILQD
                     EAVGQQMHKEAKENDEGVLPDGSPLPQPPQPATPAFYLPGLHDVNGPGGMVVLEFTEQ
                     PHALRSVQLLNGAYVNGRRVAASM"
     gene            <496555..>498078
                     /locus_tag="LMJF_35_1080"
                     /db_xref="GeneID:12982291"
     mRNA            <496555..>498078
                     /locus_tag="LMJF_35_1080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722454.1"
                     /db_xref="GeneID:12982291"
     CDS             496555..498078
                     /locus_tag="LMJF_35_1080"
                     /note="previous protein_id=AAZ14334.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722502.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982291"
                     /db_xref="UniProtKB/TrEMBL:E9AET2"
                     /translation="MRAKNMTRPAYLIDHVIHAVPVAMVHYCCELKRQLATLPLLRFF
                     DLLPSPETVKTRGGTCRSPAGAAVAAWLPTEGWFEKLPAPRVAHLLLMRWMLAATESY
                     IEKLFFDQSLVVRQLRSKRIRRRLLGWGLRLVSHAVFDPFLLSIVVPLLLSWGATPNA
                     GDASSLLPSPPPRVLFTVAGAVRGLVISAVGVTIQQLLMPLASQLVDRAVLTVFEAVE
                     YLIMRRYAQWSDDDEDNDYNEDDEGDDDRASLASGASEEARSQQSLSMSIATTAPSGG
                     GAGETATLSAEKRVEHVQRRLRRERRERRKRRERWQAEREHAMRLAILRAIVYRVVAS
                     LVAQSLIDHPLSVLVELLRGRATLHLTGLLQTYAVMTDASDGLSWANLWRYALQLVSP
                     TVTVSDATNGGDADEEGVPPLVTVLRRAGRTITQEVVVLSSSVLTASGQTAAIAAVQQ
                     RAAQTVAQGGIPSAADSADFMARTLSSLSPFYYGIQFTMIDKVLSFYMAVWTRLTKQ"
     gene            <499381..>502530
                     /locus_tag="LMJF_35_1090"
                     /db_xref="GeneID:12982292"
     mRNA            <499381..>502530
                     /locus_tag="LMJF_35_1090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722455.1"
                     /db_xref="GeneID:12982292"
     CDS             499381..502530
                     /locus_tag="LMJF_35_1090"
                     /note="previous protein_id=AAZ14335.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722503.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982292"
                     /db_xref="InterPro:IPR018034"
                     /db_xref="InterPro:IPR024626"
                     /db_xref="UniProtKB/TrEMBL:E9AET3"
                     /translation="MPPTTSSSSASAKVPHRIVFDSDDSSSSDGEGHKCGGDSLAREM
                     TAAAERERRKNPHAESGRARQPRAHPLAPSGAPTVKASSTAVPHRAEKMDLFGSDSSS
                     DAETEEEAKDAITPATGESSRQPSTAASLAPAYARGKADGAASKTAHVQGLSFRRVQD
                     GEANGKKRLLAGGAEGCDDEENSSDEDVGLHINKAYAARYEEQKRKQELHTLTEKYKG
                     KLGKAAALGFDGDDDEKGEEDSSDDEEFEEDDDAVLLTHENNLSFAKALLAVRKATVP
                     LRVSSSAKKGKTAAAASAAHDEDSPSSPADSEPTAEALLPKEELLKQRFFPPAEEQIR
                     VNTDVFERRVAQKRSKAAGKSKFTLADEYKRALEATAGSEDAVVDDSNAAGERDGLRK
                     LRPQNAEEARLRAAFLRDVEDSTSTFEVVRGAAPAYASAPAASDSDEDGADEDEQQRG
                     ASEEEKRLLVEAFALSMSAAAAKKSGKKQQQGTNGDGNETDSEAFLRDFFIQELWRPG
                     ATRKKSRAHKASADSGEEAEDSDGDAEGDESAGSYYNRLAQLAREEEDEAFFNNAEVW
                     EREYQEKKYRHQESEEGAANGGASAAHVQTFPRPIGDAATGLLRKPDTTRKDARQRRR
                     ERAEAARAQQVEELKRLKHLKRKEIEDQRALIASVAGLKAATAARFGGDENEEAQLAK
                     LKAVWSDKDLDAPFDPAEFDRKMAQLFDGDYYDERNVDEDEIAYFDEELDKESGEDDN
                     GTAEVIRSGEAPALFAANSLEEAQSLMPAVSAAKAKKKGKSTEAFFHDNFGPSSEAGA
                     TDALYLLYPSEALQQLEKERQQLNDLIASSTGKSETDAELMERLQASLKQKEEEYYQL
                     HRNAGATASDGAGAGVSGGFRYREVPAEDFTLSVEEILALDDRQLNMIAPMNCYAAYL
                     DKDSNERDRRCIERRRQKGFRQVDSDRTSRRYGNVKSTSLLNPEQINDEEGKAIAANL
                     SKRLREEGEDPDAPLEMPNYARGRGRGRGGAPVDSSRDASSSRGKWPRTEGRGRGSGR
                     GGFFPSARGGRGGRGRGRH"
     gene            <503861..>505906
                     /locus_tag="LMJF_35_1100"
                     /db_xref="GeneID:12982293"
     mRNA            <503861..>505906
                     /locus_tag="LMJF_35_1100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722456.1"
                     /db_xref="GeneID:12982293"
     CDS             503861..505906
                     /locus_tag="LMJF_35_1100"
                     /note="previous protein_id=AAZ14336.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722504.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982293"
                     /db_xref="UniProtKB/TrEMBL:E9AET4"
                     /translation="MPPPRSVNTKRRTVGAKPHHENVVAVSPCETESMALTSASTGSG
                     KGRGSAKALSETSTIDSSMGPPSPTTVMTATSPSLASATNSATGARKRARESAERGST
                     IRHSQDGRSPSVPAITGGLAQHPLQRPRRSGSFGSDGSRVRGTPQLMRDPKMCAELDE
                     EGVFFETTMTRASPAHLQRTPTSQLLSQQQAPPYSALSEGRGASPQEPAVEQALFTPA
                     TVARRPQPQTVFGEALRSSPSSTAPAPSAVSPAASSASRLSSHDEAVQAILRANPPTM
                     TRPVQLKPGYTVPSPQTPLWAALDADEDDDHQTSRGSGQGSKEPLLSNTQVSLFRLGD
                     EEEANTSGAVTTTTLAGALPRSGHTSTTTIATVSTSGVHVPTTTHECRRLGTRAAANG
                     SISLPAPGRSLNLLDEDGLHDDERLPVFIGMDGDSQGDDTDGRAFSLTQEAILQERAQ
                     DMQAVLPRSRAYRGAAATRASATAMLHADKLGSADMSTPSPTRQRAARTSLSTAQQRA
                     SPYSQLQRDVESTMAAAAARAASERHTATPAADVKPAGVLSQKELRRRADMLKWAEHT
                     RAFFHFIDARPLHVTASPLKPPPSTSSQPRRGHPSQGGVTGYHRGSIGTVQPRKSRVA
                     AASMSLVRRSRSASAVAAVLSPSVAARRSSSAFEAVISRVKQEAAAAAKTTRSASAK"
     gene            <507588..>508577
                     /locus_tag="LMJF_35_1110"
                     /db_xref="GeneID:12982294"
     mRNA            <507588..>508577
                     /locus_tag="LMJF_35_1110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722457.1"
                     /db_xref="GeneID:12982294"
     CDS             507588..508577
                     /locus_tag="LMJF_35_1110"
                     /note="previous protein_id=AAZ14337.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722505.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982294"
                     /db_xref="GOA:E9AET5"
                     /db_xref="InterPro:IPR011893"
                     /db_xref="InterPro:IPR019389"
                     /db_xref="UniProtKB/TrEMBL:E9AET5"
                     /translation="MATAVPGEAPSTGGQRAGNVVDAAEPAECAMSEASEAHPMNEQY
                     DCKNEEEAEAVAAATGADASTKSPTAHLDGLNVEELKALLVEKKKGWVNLDRFKDREA
                     LVNAIFGMEQKEAAQIAFRAEVAAAARWYAEHQSQLKAAHHRAKGSRTRRNSAEPAAA
                     GGSDGDEAQHEVLVLYNEANGYGSKFEVLRKELQESEVVSLPNLADLQIVGQAYPMSP
                     RRVLISKALQGAFFGTLGLALMGDQLKFIPESVLAVLRARRGLITSTGFLLNVLSRAA
                     LQNNAFEVFLDGELIYSALNASGRVPTAELLSNLLLERTLLKDYYAAAKTARA"
     gene            509681..510790
                     /locus_tag="LMJF_35_1120"
                     /pseudo
                     /db_xref="GeneID:12982295"
     misc_feature    509681..510790
                     /locus_tag="LMJF_35_1120"
                     /pseudo
                     /db_xref="GeneID:12982295"
     gene            <513632..>516190
                     /locus_tag="LMJF_35_1130"
                     /db_xref="GeneID:12982296"
     mRNA            <513632..>516190
                     /locus_tag="LMJF_35_1130"
                     /product="oligosaccharyl transferase-like protein"
                     /transcript_id="XM_003722458.1"
                     /db_xref="GeneID:12982296"
     CDS             513632..516190
                     /locus_tag="LMJF_35_1130"
                     /note="previous protein_id=AAZ14338.1"
                     /codon_start=1
                     /product="oligosaccharyl transferase-like protein"
                     /protein_id="XP_003722506.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982296"
                     /db_xref="GOA:E9AET6"
                     /db_xref="InterPro:IPR003674"
                     /db_xref="UniProtKB/TrEMBL:E9AET6"
                     /translation="MPAKNQHKGGGDGDPDPTSTPAAESTKVTNTSDGAAVDSTLPPS
                     DETYLFHCRAAPYSKLSYAFKGIMTVLILCAIRSAYQVRLISVQIYGYLIHEFDPWFN
                     YRAAEYMSTHGWSAFFSWFDYMSWYPLGRPVGSTTYPGLQLTAVAIHRALAAAGMPMS
                     LNNVCVLMPAWFGAIATATLALIAFEVSESICMAAWAALSFSIIPAHLMRSMAGEFDN
                     ECIAVAAMLLTFYCWVRSLRTRSSWPIGVLTGVAYGYMAAAWGGYIFVLNMVAMHAGI
                     SSMVDWARNTYNPSLLRAYTLFYVVGTAIAVCVPPVGMSPFKSLEQLGALLVLVFLCG
                     LQVCEVLRARAGVEVRSRANFKIRVRVFSVMAGVAALAISVLAPTGYFGPLSVRVRAL
                     FVEHTRTGNPLVDSVAEHHPADALAYLNYLHIVHLMWICSLPVQLILPSRNQYAVLFV
                     LVYSFMAYYFSTRMVRLLILAGPVACLGASEVGGTLMEWCFQQLFWDNGMRTADMVAA
                     GDMPYQKDDHTSRGAGARQKQQKQKPGQVSARGSSTSSEERPYRTLIPVDFRRDAQMN
                     RWSAGKTNAALIVALTIGVLLPLAFVFHLSCISSAYSFAGPRIVFQTQLHTGEQVIVK
                     DYLEAYEWLRDSTPEDARVLAWWDYGYQITGIGNRTSLADGNTWNHEHIATIGKMLTS
                     PVAEAHSLVRHMADYVLIWAGQSGDLMKSPHMARIGNSVYHDICPDDPLCQQFGFHRN
                     DYSRPTPMMRASLLYNLHEAGKTKGVKVNPSLFQEVYSSKYGLVRIFKVMNVSAESKK
                     WVADPANRVCHPPGSWICPGQYPPAKEIQEMLAHRVPFDQMDKHKQHKETHHKA"
     gene            <518930..>521251
                     /locus_tag="LMJF_35_1140"
                     /db_xref="GeneID:12982297"
     mRNA            <518930..>521251
                     /locus_tag="LMJF_35_1140"
                     /product="oligosaccharyl transferase-like protein"
                     /transcript_id="XM_003722459.1"
                     /db_xref="GeneID:12982297"
     CDS             518930..521251
                     /locus_tag="LMJF_35_1140"
                     /note="previous protein_id=AAZ14339.1"
                     /codon_start=1
                     /product="oligosaccharyl transferase-like protein"
                     /protein_id="XP_003722507.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982297"
                     /db_xref="GOA:E9AET7"
                     /db_xref="InterPro:IPR003674"
                     /db_xref="UniProtKB/TrEMBL:E9AET7"
                     /translation="MLLLFFSFLYCLKNAYGLRMISVQIYGYLIHEFDPWFNYRAAEY
                     MSTHGWSAFFSWFDYMSWYPLGRPVGSTTYPGLQLTAVAIHRALAAAGMPMSLNNVCV
                     LMPAWFGAIATATLALMTYEMSGSGIAAAIAAFIFSIIPAHLMRSMAGEFDNECIAVA
                     AMLLTFYCWVRSLRTRSSWPIGVLTGVAYGYMAAAWGGYIFVLNMVAMHAGISSMVDW
                     ARNTYNPSLLRAYTLFYVVGTAIAVCVPPVGMSPFKSLEQLGALLVLVFLCGLQVCEV
                     LRARAGVEVRSRANFKIRVRVFSVMAGVAALAISVLAPTGYFGPLSVRVRALFVEHTR
                     TGNPLVDSVAEHRMTSPKAYAFFLDFTYPVWLLGTVLQLLGAFMGSRKEARLFMGLHS
                     LATYYFADRMSRLIVLAGPAAAAMTAGILGLVYEWCWAQLTGWASPGLSAAGSGGMDD
                     FDNKRGQTQIQSSTANRNRGVRAHAIAAVKSIKAGVNLLPLVLRVGVAVAILAVTVGT
                     PYVSQFQARCIQSAYSFAGPRIVFQAQLHTGEQVIVKDYLEAYEWLRDSTPEDARVLA
                     WWDYGYQITGIGNRTSLADGNTWNHEHIATIGKMLTSPVAEAHSLVRHMADYVLIWAG
                     QSGDLMKSPHMARIGNSVYHDICPDDPLCQQFGFHRNDYSRPTPMMRASLLYNLHEAG
                     KTKGVKVNPSLFQEVYSSKYGLVRIFKVMNVSAESKKWVADPANRVCHPPGSWICPGQ
                     YPPAKEIQEMLAHRVPFDQMDKHKQHKETHHKA"
     gene            <525835..>528207
                     /locus_tag="LMJF_35_1150"
                     /db_xref="GeneID:12982298"
     mRNA            <525835..>528207
                     /locus_tag="LMJF_35_1150"
                     /product="oligosaccharyl transferase-like protein"
                     /transcript_id="XM_003722460.1"
                     /db_xref="GeneID:12982298"
     CDS             525835..528207
                     /locus_tag="LMJF_35_1150"
                     /note="previous protein_id=AAZ14340.1"
                     /codon_start=1
                     /product="oligosaccharyl transferase-like protein"
                     /protein_id="XP_003722508.1"
                     /db_xref="GeneID:12982298"
                     /db_xref="GOA:E9AET8"
                     /db_xref="InterPro:IPR003674"
                     /db_xref="UniProtKB/TrEMBL:E9AET8"
                     /translation="MPSQTRSLIYSSCFAVAMAIALPIAYDMRVRSIGVYGYLFHSSD
                     PWFNYRAAEYMSTHGWSAFFSWFDYMSWYPLGRPVGSTTYPGLQLTAVAIHRALAAAG
                     MPMSLNNVCVLMPAWFSLVSSAMAALLAHEMSGNMAVASISSILFSVVPAHLMRSMAG
                     EFDNECIAVAAMLLTFYCWVRSLRTRSSWPIGVLTGVAYGYMAAAWGGYIFVLNMVAM
                     HAGISSMVDWARNTYNPSLLRAYTLFYVVGTAIAVCVPPVGMSPFKSLEQLGALLVLV
                     FIFGQSVCEAQRRRLGIARLSKEGVALLIRIDAAFFVGIVAVATIAPAGFFKPLSLQA
                     NAIITGVSRTGNTLVDILLAQDASNLLMVWQLFLFPFLGWVAGMSAFLRELIRNYTYA
                     KSFILMYGVVGMYFASQSVRMMVMMAPVACIFTALLFRWALDYLLGSLFWAEMPPSFD
                     TDAQRGRQQQTAEESEAETKRKEEEYNTMQVKKMSVRMLPFMLLLLLFRLSGFIEDVA
                     AISRKMEAPGIVFPSEQVQGVSEKKVDDYYAGYLYLRDSTPEDARVLAWWDYGYQITG
                     IGNRTSLADGNTWNHEHIATIGKMLTSPVAEAHSLVRHMADYVLISAGDTYFSDLNRS
                     PMMARIGNSVYHDICPDDPLCSQFVLQKRPKAAAAKRSRHVSVDALEEDDTAEHMVYE
                     PSSLIAKSLIYHLHSTGVVTGVTLNETLFQHVFTSPQGLMRIFKVMNVSTESKKWVAD
                     SANRVCHPPGSWICPGQYPPAKEIQEMLAHQHTNFKDLLDPRTTWSGSRR"
     gene            <529818..>532391
                     /locus_tag="LMJF_35_1160"
                     /db_xref="GeneID:12982299"
     mRNA            <529818..>532391
                     /locus_tag="LMJF_35_1160"
                     /product="putative oligosaccharyl transferase subunit"
                     /transcript_id="XM_003722461.1"
                     /db_xref="GeneID:12982299"
     CDS             529818..532391
                     /locus_tag="LMJF_35_1160"
                     /note="previous protein_id=AAZ14341.1"
                     /codon_start=1
                     /product="putative oligosaccharyl transferase subunit"
                     /protein_id="XP_003722509.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982299"
                     /db_xref="GOA:E9AET9"
                     /db_xref="InterPro:IPR003674"
                     /db_xref="UniProtKB/TrEMBL:E9AET9"
                     /translation="MGKRKGNSLGDSGSAATASREASAQAEDAASQTKTASPPAKVIL
                     LPKTLTDEKDFIGIFPFPFWPVHFVLTVVALFVLAASCFQAFTVRMISVQIYGYLIHE
                     FDPWFNYRAAEYMSTHGWSAFFSWFDYMSWYPLGRPVGSTTYPGLQLTAVAIHRALAA
                     AGMPMSLNNVCVLMPAWFGAIATATLAFCTYEASGSTVAAAAAALSFSIIPAHLMRSM
                     AGEFDNECIAVAAMLLTFYCWVRSLRTRSSWPIGVLTGVAYGYMAAAWGGYIFVLNMV
                     AMHAGISSMVDWARNTYNPSLLRAYTLFYVVGTAIAVCVPPVGMSPFKSLEQLGALLV
                     LVFLCGLQVCEVLRARAGVEVRSRANFKIRVRVFSVMAGVAALAISVLAPTGYFGPLS
                     VRVRALFVEHTRTGNPLVDSVAEHQPASPEAMWAFLHVCGVTWGLGSIVLAVSTFVHY
                     SPSKVFWLLNSGAVYYFSTRMARLLLLSGPAACLSTGIFVGTILEAAVQLSFWDSDAT
                     KAKKQQKQAQRHQRGAGKGSGRDDAKNATTARAFCDVFAGSSLAWGHRMVLSIAMWAL
                     VTTTAVSFFSSEFASHSTKFAEQSSNPMIVFAAVVQNRATGKPMNLLVDDYLKAYEWL
                     RDSTPEDARVLAWWDYGYQITGIGNRTSLADGNTWNHEHIATIGKMLTSPVVEAHSLV
                     RHMADYVLIWAGQSGDLMKSPHMARIGNSVYHDICPDDPLCQQFGFHRNDYSRPTPMM
                     RASLLYNLHEAGKRKGVKVNPSLFQEVYSSKYGLVRIFKVMNVSAESKKWVADPANRV
                     CHPPGSWICPGQYPPAKEIQEMLAHRVPFDQVTNADRKNNVGSYQEEYMRRMRESENR
                     R"
     gene            <533382..>535205
                     /locus_tag="LMJF_35_1170"
                     /db_xref="GeneID:12982300"
     mRNA            <533382..>535205
                     /locus_tag="LMJF_35_1170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722462.1"
                     /db_xref="GeneID:12982300"
     CDS             533382..535205
                     /locus_tag="LMJF_35_1170"
                     /note="previous protein_id=AAZ14342.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722510.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982300"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:E9AEU0"
                     /translation="MLRTGTATARSAAVSSRGVRQRSHGLSPRQVDMRVGKTTTKPVA
                     GLPSAGALPLFVQAPFQRWCNAGGDRTSHGVRRFRPSTSALHSGHLRCSERCLSVCSK
                     DEAPSTASRNVSVSTIGARLAAKDLADAEEELRRLQENVDAFAGSSSFRQEERHPSGG
                     VAPSAAPLTSSSPVPREAVASTTTADVEGNATIADGNDDRSGGDAVPEWPEPTLEDID
                     RSIPQVDCEFIASLIRSRNLRRDEFLTKKEAVKQRVEELTKKMTPTVNEAVKLPFVGG
                     LRLGWLSKLRGGDEAEGSESGLVATSTEAPVVASAAVLETLSAEEKNLLHTTRPEYDD
                     GFVLLDCRTVNEVTSWGIIEGAKVLPAHELFEAFHATPEEFVQDYGFAKPRPEDIIIC
                     YCQYGPRSLMAAQILSWMGYLKVMHFRDGYYEWSKQYNLLLRRWMEHDKESGNELRRL
                     ATFRAGLELQREIAPEFNALPMQEARQYLRDTTRSPGKLVVGDGLRLEAYKMVAKLKE
                     GQAPPSLPHVLDNGIAPSGSRGAAESQTTRTRRLGEQQLTRFLEQATGLDPEKELRRP
                     ALSMNMSEAQATVLDSLAYGHELGASPDAKTSPVSPPPRRN"
     gene            <536100..>539543
                     /locus_tag="LMJF_35_1180"
                     /db_xref="GeneID:12982345"
     mRNA            <536100..>539543
                     /locus_tag="LMJF_35_1180"
                     /product="putative NADH-dependent fumarate reductase"
                     /transcript_id="XM_003722463.1"
                     /db_xref="GeneID:12982345"
     CDS             536100..539543
                     /locus_tag="LMJF_35_1180"
                     /EC_number="1.3.1.6"
                     /note="previous protein_id=AAZ14343.1"
                     /codon_start=1
                     /product="putative NADH-dependent fumarate reductase"
                     /protein_id="XP_003722511.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982345"
                     /db_xref="GOA:E9AEU1"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001834"
                     /db_xref="InterPro:IPR003374"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR010960"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR027477"
                     /db_xref="UniProtKB/TrEMBL:E9AEU1"
                     /translation="MADGKTSASVVAVDAESAAKERDAAARAMLQDGGVSPVGKAQLL
                     KKGLVHTVPYTLKVVVADPKEMEKATADAEEVLQSAFQVVDTLLNSFNENSEVSRINR
                     MPVGEEHQMSAALKHVMACCQKVYNSSRGAFDPAVGPLVRELREAAHKGKTVPAERVN
                     DLLSKCTLNASFSIDMNRGMIARKHADAMLDLGGVNKGYGIDYTVERLNSLGYDDVFF
                     EWGGDVRASGKNQSIQPWAVGIVRPPALADIRTVVPKDKRSFIRVVHLNNEAIATSGD
                     YENLIETPASKVYSSTFDRASKNLLEPTEAGMAQVSVKCYSCMYADALATAALLKNDP
                     AAVRRMLDNWRYVRDTVTDYTTYTREGERVAKMLEIATEDAEMRAKRIKGSLPARVII
                     VGGGLAGCSAAIEAANCGAQVILLEKEPKLGGNSAKATSGINAWGTRAQAKQGIMDGG
                     KFFERDTHRSGKGGNCDPCLVKTLSVKSSDAVKWLSELGVPLTVLSQLGGASRKRCHR
                     APDKSDGTPVPVGFTIMKTLENHIVNNLSRHVTVMTGITVTALESTSHVRPDGVLVKH
                     VTGVRLIQASGQSMVLNADAVILATGGFSNDHTPNSLLQQYAPQLSSFPTTNGVWATG
                     DGVKMASKLGVALVDMDKVQLHPTGLIDPKDPSNRTKYLGPEALRGSGGVLLNKNGER
                     FVNELDLRSVVSQAIIAQDNVYPGSGGSKFAYCVLNETAAKLFGKNFLGFYWNRLGLF
                     QKSDSVAGLAKLIGCPEANVMATLKQYEELSSKKLNPCPLTGKNVFPCVLGTQGPYYV
                     ALITPSIHYTMGGCLISPSAEMQTKDNSGVTPVRRPILGLFGAGEVTGGVHGGNRLGG
                     NSLLECVVFGKIAGDRAATILQKKNTGLSMTEWSTVVLREVREGGVYGAGSRVLRFNM
                     PGALQKTGLALGQFIGIRGDWDGHRLIGYYSPITLPDDVGVIGILARADKGRLAEWIS
                     ALQPGDAVEMKACGGLIIERRFADRHFFFRGHKIRKLALIGGGTGVAPMLQIVRAAVK
                     KPFVDSIESIQFIYAAEDVSELTYRTLLESYEKEYGSEKFKCHFVLNNPPAQWTDGVG
                     FVDTALLRSAVQAPSNDLLVAICGPPIMQRAVKGALKSLGYNMNLVRTVDETEPTSAK
                     I"
     gene            <544745..>546232
                     /locus_tag="LMJF_35_1190"
                     /db_xref="GeneID:12982346"
     mRNA            <544745..>546232
                     /locus_tag="LMJF_35_1190"
                     /product="putative NADH-dependent fumarate reductase"
                     /transcript_id="XM_003722464.1"
                     /db_xref="GeneID:12982346"
     CDS             544745..546232
                     /locus_tag="LMJF_35_1190"
                     /EC_number="1.3.1.6"
                     /note="previous protein_id=AAZ14344.1"
                     /codon_start=1
                     /product="putative NADH-dependent fumarate reductase"
                     /protein_id="XP_003722512.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982346"
                     /db_xref="GOA:E9AEU2"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="InterPro:IPR010960"
                     /db_xref="InterPro:IPR027477"
                     /db_xref="UniProtKB/TrEMBL:E9AEU2"
                     /translation="MSRVAPSVNRVVIVGSGLAGQSAAIEAAREGAKEVVLIEKEGRL
                     GGNSAKATSGINGWGTAVQKAAGVHDSGELFEKDTFVSGKGGTCQPELVRTLSDHSAE
                     AIEWLSSFGIPLTAITQLGGASRKRCHRAPDKPDGTPLPIGFTIVRALENYIRTNLSG
                     TVLIESNARLISLIHRKESDVEVVQGITYATQTGSGEEQTRELQARAVILATGGFSND
                     HTPNSLLQQYAPQLSSFPTTNGVWATGDGVKAARELGVALVDMDKVQLHPTGLLNPKD
                     PNAKTLFLGPEALRGSGGVLLNKNGERFVNELDLRSVVSQAIIAQDNVYPGTESRRYA
                     YCVLNDAAADAFGRSSLNFYWKKMGLFAEAADVAALAALIGCPEETLKHTLSEYEKIS
                     SGQKPCPKTGKEVFPCVLGTQGPYYVALVTPSIHYTMGGCLISPAAEILDEQMHPIPG
                     LFGAGEVTGGVHGGNRLGGNSLLECVVFGRIAGRQAARHLGTPVS"
     gene            <550907..>553021
                     /locus_tag="LMJF_35_1200"
                     /db_xref="GeneID:12982347"
     mRNA            <550907..>553021
                     /locus_tag="LMJF_35_1200"
                     /product="putative pre-mRNA splicing factor ATP-dependent
                     RNA helicase"
                     /transcript_id="XM_003722465.1"
                     /db_xref="GeneID:12982347"
     CDS             550907..553021
                     /locus_tag="LMJF_35_1200"
                     /note="previous protein_id=AAZ14345.1"
                     /codon_start=1
                     /product="putative pre-mRNA splicing factor ATP-dependent
                     RNA helicase"
                     /protein_id="XP_003722513.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982347"
                     /db_xref="GOA:E9AEU3"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9AEU3"
                     /translation="MEAKHSSRNPLTGKEYSSRYFTLLKGREHLPIFAAKSRIQKLVS
                     QYQTLLLVGETGSGKTTQVPQYILELNPEHGIACTQPRRVAATSVSERVAEEMDVELG
                     EEVGYSIRFDDKSSEKTRLKYLTDGMLLREAMTDPLLSRYSVIVLDEAHERTVSTDIL
                     IGTLKELLPKRPDLRIVVMSATLEEKRFQEYFSEAPLVHISGRMYGVEVYNSKAPEAN
                     YVEAAIRTATQIHLYEGEGDILIFLTGEDEIETTVERLQNGIRMAEHSSANCHHGPVA
                     VLPLYSALPPSQQRKVFQTVVEGTRKIVVATNVAETSLTIDGVVFVIDCGFSKQKVFN
                     PKLRVESLLVTPISQASARQRCGRAGRTRPGKCFRLYTAKSFHSALQPNTYPEILRCN
                     LGSIVLHMKKMGIEDLVNFDFVEPPAPETLMRALELLNYLGALDDDGNLTEEGNSMSE
                     FPVDPEMASMLFHSPKFGCSEDIARICAMLSVQNPFITPSNDQRGRAMRCREQFYHPT
                     GDHISYLNTFNVFYEMKNQSSSWCTENYINPRVMKQAVNIYRQLVGILRRLNLPICST
                     YTAQQCRLRGDAAPAELEFANEVRRAIVKGYFTKVALSLPTKHQFMTLKDDVKCLLFP
                     STYLNRRPKFVVFNELVLTSNTYIRTVTAVSEDWLLESSPSYFAQDEFEGITKQVFDE
                     VFRRQSKERERRSKRARTPSDD"
     gene            <553466..>554125
                     /locus_tag="LMJF_35_1210"
                     /db_xref="GeneID:12982348"
     mRNA            <553466..>554125
                     /locus_tag="LMJF_35_1210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722466.1"
                     /db_xref="GeneID:12982348"
     CDS             553466..554125
                     /locus_tag="LMJF_35_1210"
                     /note="previous protein_id=AAZ14346.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722514.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982348"
                     /db_xref="InterPro:IPR019345"
                     /db_xref="UniProtKB/TrEMBL:E9AEU4"
                     /translation="MKLFFAAVLIAVFAVILVSAGMTESDFKRMKVKDLRAFLQDRGL
                     ECAGCQEKSDFVRMAYQHRDTNPVGSAVKREIPNKKFWEAWGDIAKNECQNAVRRRGN
                     DEGTEPFSTICDTIHSAVDSYLMQHGRRVANQLKKTPQDLLRTSFKDVYFEAGSHLFQ
                     MLADYCLGSPSLQKACQSLGSVMSAMDGSSGADFRIWTTNVGIENTNPMYEIIDGRDD
                     L"
     gene            <554742..>555443
                     /locus_tag="LMJF_35_1220"
                     /db_xref="GeneID:12982349"
     mRNA            <554742..>555443
                     /locus_tag="LMJF_35_1220"
                     /product="putative short chain dehydrogenase"
                     /transcript_id="XM_003722467.1"
                     /db_xref="GeneID:12982349"
     CDS             554742..555443
                     /locus_tag="LMJF_35_1220"
                     /note="previous protein_id=AAZ14347.1"
                     /codon_start=1
                     /product="putative short chain dehydrogenase"
                     /protein_id="XP_003722515.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982349"
                     /db_xref="GOA:E9AEU5"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:E9AEU5"
                     /translation="MKSVFITGGNRGIGLETARQMGKLGYYVIISCRDEEKAKAAIEK
                     VSAEGVKADYVIMDVVDESSVAKAAAEVSKKVNGVLDALINNAGKAAPSGDMSRVNLD
                     EMRRCYEVNVIGTVCVTNHFLEMVKKSSAGRIVNVGSIKGSCQLEVTALSHTPYNCSK
                     AALNMYTVNLASSLKDTNVKVNCAHPGWVKTDMGGPQAPLEVTEGAETSVYLATLPAD
                     GPTGGFFHKRDRLPW"
     gene            <556065..>556829
                     /locus_tag="LMJF_35_1230"
                     /db_xref="GeneID:12982350"
     mRNA            <556065..>556829
                     /locus_tag="LMJF_35_1230"
                     /product="putative short chain dehydrogenase"
                     /transcript_id="XM_003722468.1"
                     /db_xref="GeneID:12982350"
     CDS             556065..556829
                     /locus_tag="LMJF_35_1230"
                     /note="previous protein_id=AAZ14348.1"
                     /codon_start=1
                     /product="putative short chain dehydrogenase"
                     /protein_id="XP_003722516.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982350"
                     /db_xref="GOA:E9AEU6"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:E9AEU6"
                     /translation="MSAPKKVALVTGANRGIGFATARRLGELGFKVLLGARDAKRGEE
                     AVDTLRNDKLDVDLLLMTPTEHTSVEAAVQKVEADYKRLDVLINNAALMDFDNKVFPL
                     NIQRMRDEFEINFFATVDITNSFLPLMLRSSEAPRLVFVSTPLGTHETVDRPQNKYAH
                     PNLTAYKCTKSAVNMYAHNLAKYLENYAEEAGGSAASAKVNCCYPGYVQTDMCFNSTE
                     AHFTPYEGAETSVWLATLPADGPTGGFYHRAQKLPW"
     gene            <559118..>561661
                     /locus_tag="LMJF_35_1240"
                     /db_xref="GeneID:12982351"
     mRNA            <559118..>561661
                     /locus_tag="LMJF_35_1240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722469.1"
                     /db_xref="GeneID:12982351"
     CDS             559118..561661
                     /locus_tag="LMJF_35_1240"
                     /note="previous protein_id=AAZ14349.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722517.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982351"
                     /db_xref="UniProtKB/TrEMBL:E9AEU7"
                     /translation="MSSRWPSSLLNATNKRLTERIEQLTFDLNTKRNSVAEQREVVAL
                     LKKHQHEAQQQVKIAAEALECERAAVENDEGKLKQLQLEAEADARRARQSKEAETQLS
                     QAVSALESTLDQRCRALSGQREIAVELEKEARELVSAHLSRQRVGDELTAAQRELSST
                     VWSTLGRLNEQVCVATRRLEEVRGERLHVLQEVDAMHLALQYAVKDQAESLRALELVY
                     VQTSQLDAQVLANAKSMEVLVAAARERKKLRGELQATLERLRGDSQRQALAHDLKRER
                     YDKQVHALQKAVAALREDEEHSVILRRCEQAEVQQLCQQRRELEHVILLCEEKRQLLT
                     QKQARRDALEGARALMQRQESTGQPSPAALCDMILALEQQEALLEDRVERTCAKLTGA
                     IQTFMDEGRRGEHFNAAVADKMKAKLSLVSDQEASEGHVQLLRERGRKVEEALTERQA
                     LLSSMQALALEQRAQRQASWLREIEQLRGTLLRVQRDHQQLLHGTTTLRSSWHHTRKA
                     LEEKGMSQVKVLSDLRLLEAEVSRLDQEMSAAVEEHNSRLLQHEQAGVTLQSLMKAAD
                     AQVGALKEAAGAEAYIRAEVQIVEERIQADMQGALVELHLNENEVHELSEELQRHRKK
                     LNLLRLRYEEVVTSMARAAQKPLNEEEGVGIPLPLLNSASDTCTPEAVHAHLLLRRSY
                     EREQLMQRGNYLDLRLVALDKETSTLRHMLDGLRSSRRVTSEHVNALGEVFSTAKRAG
                     ASSIKNCSSQLAPSAPSCSPALIKKELLSSAKTSEHYLTAELQLLDETLAAMSQQRDD
                     SRVRLHEMRATLKELQDTERQKRMQVQKLRESAQRSRKLANVVSVKCSR"
     gene            <562488..>563174
                     /locus_tag="LMJF_35_1250"
                     /db_xref="GeneID:12982352"
     mRNA            <562488..>563174
                     /locus_tag="LMJF_35_1250"
                     /product="thioredoxin-like protein"
                     /transcript_id="XM_003722470.1"
                     /db_xref="GeneID:12982352"
     CDS             562488..563174
                     /locus_tag="LMJF_35_1250"
                     /note="previous protein_id=AAZ14350.1"
                     /codon_start=1
                     /product="thioredoxin-like protein"
                     /protein_id="XP_003722518.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982352"
                     /db_xref="GOA:E9AEU8"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR004480"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="UniProtKB/TrEMBL:E9AEU8"
                     /translation="MLKVSSKEHYAEIKKKAEDSLGLVVHFSATWCEPCTAVNEHLTK
                     QAAEYGDNVVFAEVDCGELGDVCEAEGVESVPFVAYFRTPLVGDDRRVERVADVAGAK
                     FDQIDMNTHSLFGEKGGNGVQQKDFATVDDYLHYLTKRPGVVMFITGTPSRPRCGFTG
                     RLCELVHQLGVPFIYYDVMTSDAVCERLKIYANWPTYPQVYVDGELIGGWDICRELNE
                     EGELKSTLKH"
     gene            <564396..>565481
                     /locus_tag="LMJF_35_1260"
                     /db_xref="GeneID:12982353"
     mRNA            <564396..>565481
                     /locus_tag="LMJF_35_1260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722471.1"
                     /db_xref="GeneID:12982353"
     CDS             564396..565481
                     /locus_tag="LMJF_35_1260"
                     /note="previous protein_id=AAZ14351.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722519.1"
                     /db_xref="GeneID:12982353"
                     /db_xref="GOA:E9AEU9"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9AEU9"
                     /translation="MMAIARGMPATTAVQANVMSRVGRTVLSWLEKLKNSIADTPLYF
                     WVYIGALVWITRQLTNRTSKATRRITVAGRQVHLNEPEAQMASNVVDIDKIDVDFSDV
                     GGLEDVKDALTEHIKWPFQHQELFSGKTVRSHPKGVLLYGPPGTGKTLLARALAKELG
                     CSFINVNTESIFSKWVGDTERNAAAVFTLAAKISPCVIFVDEIDSLLSSRSAMDATPH
                     MHAKTIFMTHWDGLEKDSDARIIVVGATNRRFTIDDAIRRRLPLQLEVPPPDAKAREK
                     ILSILLAHDLEYNPKKDGLIRYVALKTAEYTGSDLSELCKAAALMPLREMESMKAGGA
                     SSAAPETVPPLTQQHFDKAMERVKASK"
     gene            <566651..>567727
                     /locus_tag="LMJF_35_1270"
                     /db_xref="GeneID:12982354"
     mRNA            <566651..>567727
                     /locus_tag="LMJF_35_1270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722472.1"
                     /db_xref="GeneID:12982354"
     CDS             566651..567727
                     /locus_tag="LMJF_35_1270"
                     /note="previous protein_id=AAZ14352.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722520.1"
                     /db_xref="GeneID:12982354"
                     /db_xref="UniProtKB/TrEMBL:E9AEV0"
                     /translation="MQELAQQFEQQGIRCSADAPQRLWCSFCTTYREDLAKFNDPLSE
                     REGGVGVKAEEGETGTLDEAARADSDSGSSPSTPGPTRARHTRTPSPSLCTLEATKEA
                     VLAHCATRTHLYLYECHVQNGLQHWCGVELHGYRMLLSHHCIYPSRMFGDGRLLMDTS
                     ISGGMLLGLDVCGGVKLWPQHQYTAVELILPSALSGVREVLVPPVSMSGAGEESQRAS
                     EAGSGKQRASSPPLPRNLPGSRVIRIIHEASEIPAEVAGSYNSALNGSRRKGSKAMRS
                     LDRGPAGTSGGRASSSIVPRYFDEFHRLRSQRVMEGSLKTVLEATNASIIGEARLRRQ
                     RRRYAVKHNKTIFIKGKTAAGDEQ"
     gene            <568376..>569332
                     /locus_tag="LMJF_35_1280"
                     /db_xref="GeneID:12982355"
     mRNA            <568376..>569332
                     /locus_tag="LMJF_35_1280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722473.1"
                     /db_xref="GeneID:12982355"
     CDS             568376..569332
                     /locus_tag="LMJF_35_1280"
                     /note="previous protein_id=AAZ14353.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722521.1"
                     /db_xref="GeneID:12982355"
                     /db_xref="GOA:Q9GNH7"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR027450"
                     /db_xref="UniProtKB/TrEMBL:Q9GNH7"
                     /translation="MSITSRFIGGVKHLLKGGSMKYLAAGEPYCPFGEAFGLTILPEY
                     ILEDDASNLRKGYVDVYTRASDRIILNDGRFQLPPLPPASFMPLLERLEQDNVVPKSW
                     LNNQTANLYEPGDFIRAHIDNLFVYDDIFAICSLGSNCLLRFVHVQNGEELDVMVPDR
                     SVYIMSGPARYVYFHMVLPVEAQRFSLVFRRSIMESDGGFRPVKTPFKEIMPYRATQI
                     LNALYSKQVGGVRVSVDDDFLESADIGAFDTSRWVKRLHPLRDWSLLRQLDEDEARVE
                     ALREKRFIDVDFSWRYRELRSYYKAMEESLVSPHVAHVTPQA"
     gene            <570222..>570971
                     /locus_tag="LMJF_35_1290"
                     /db_xref="GeneID:12982356"
     mRNA            <570222..>570971
                     /locus_tag="LMJF_35_1290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722474.1"
                     /db_xref="GeneID:12982356"
     CDS             570222..570971
                     /locus_tag="LMJF_35_1290"
                     /note="previous protein_id=AAZ14354.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722522.1"
                     /db_xref="GeneID:12982356"
                     /db_xref="UniProtKB/TrEMBL:Q9GN98"
                     /translation="MTVSPSAASTAAPTIFIRCATLHSRGELLNGFFFAHRATLGIQD
                     WYETARTPVSGGTGNAEEKFSSAEDSAAVGDTPHSASSPRLPPHFPVEVLYMRNSRKP
                     YFLVEWRYPTSEEENKRKDPSDGSSGVKEGVSEVHEARAGSSQNRVTEEFLLQVAERT
                     LALGKQELPDNGATWKGQPVFISAALPGMTVMAERRKLELRDAQLKIQRSAEKRERAE
                     DDSAAQTAGTKQRDSGVVASTFIPRCVRRRT"
     gene            <572946..>573392
                     /locus_tag="LMJF_35_1300"
                     /db_xref="GeneID:12982357"
     mRNA            <572946..>573392
                     /locus_tag="LMJF_35_1300"
                     /product="putative ubiquitin-conjugating enzyme e2"
                     /transcript_id="XM_003722475.1"
                     /db_xref="GeneID:12982357"
     CDS             572946..573392
                     /locus_tag="LMJF_35_1300"
                     /EC_number="6.3.2.19"
                     /note="previous protein_id=AAZ14355.1"
                     /codon_start=1
                     /product="putative ubiquitin-conjugating enzyme e2"
                     /protein_id="XP_003722523.1"
                     /db_xref="GeneID:12982357"
                     /db_xref="GOA:Q9GNC1"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:Q9GNC1"
                     /translation="MALRRIQKELKDLEKDPPANTSGGPVSESDLFNWKATIIGPEDS
                     PYAGGLFFLNIHFPSDYPFKPPKLQFTTKIYHPNINNNGGICLDILKDQWSPALTISK
                     VLLSVCSLLTDPNPDDPLVPDIARQYKTDRNAFNKTAAEWTRQYAM"
     gene            <575869..>576171
                     /locus_tag="LMJF_35_1310"
                     /db_xref="GeneID:12982358"
     mRNA            <575869..>576171
                     /locus_tag="LMJF_35_1310"
                     /product="histone H4"
                     /transcript_id="XM_003722476.1"
                     /db_xref="GeneID:12982358"
     CDS             575869..576171
                     /locus_tag="LMJF_35_1310"
                     /note="previous protein_id=AAZ14356.1"
                     /codon_start=1
                     /product="histone H4"
                     /protein_id="XP_003722524.1"
                     /db_xref="GeneID:12982358"
                     /db_xref="GOA:Q4Q277"
                     /db_xref="InterPro:IPR001951"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:Q4Q277"
                     /translation="MAKGKRSTDAKGSQRRQKKVLRDNIRGITRGCVRRMARRGGVKR
                     ISSEVYEEVRRVLKAYVEDIVRCSTAYTEYARKKTVTACDVVTALRKQGHILYGYA"
     gene            <577316..>582391
                     /locus_tag="LMJF_35_1320"
                     /db_xref="GeneID:12982359"
     mRNA            <577316..>582391
                     /locus_tag="LMJF_35_1320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722477.1"
                     /db_xref="GeneID:12982359"
     CDS             577316..582391
                     /locus_tag="LMJF_35_1320"
                     /note="previous protein_id=AAZ14357.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722525.1"
                     /db_xref="GeneID:12982359"
                     /db_xref="UniProtKB/TrEMBL:Q9GRP7"
                     /translation="MATTTATDVNAVHHAPPPTPPPSQEIPASALALDRKVVQALFVS
                     LRMSIPHDVQRRLLCNAAEELEFLIARQPRVSAFHHRRRESLRHPALAMAAKKYYREC
                     RRRRFELELQQMVVVEGRPLSQSTSSPAAQVRSGVSAAQRESVLVDLLFSEYAQQSSI
                     YSKDQDRQGDHYGTSTGNGAAGFGGFAASHTSTLLNTYAGSTPPRLLGRISREADSET
                     RLQSPTTPRGGHAVELSSTMASGKSGILVRRSATLRHPKSSNEDSVSALSEALNTGSL
                     SRFAFSVSAAENAENGGSARARGVGVGVSTAAAADGTRFFARRMGCNDNAAVRRGGGS
                     GGSGGGAGDKFASGWTGEMRVLLQRRMEEEREAGTGNDPYLFISARPVEHLLCCYGGV
                     SREPAAMALGAASMLLQCDSTNTADADPFRNAIVEEDMRWDQLAGCHRQLLRAAYGPC
                     RAAAAAVADDHLVNDVIRRFWDRLTVSMAAQHAHKAQEARKSRAAADADIAAAVSALR
                     GRRDAEADEDDLNEISDSDDKDEGVAVGRGAGTGDDDVGRRKAADISLRRAKPSASKS
                     SRTRKTVSKLSRKKKKGCSAVSSGVGGGSEQHSSVAYYMTPLQYVYLHTRIAHVLLPE
                     CDAVEVELLPYIQEDLLVDAAYDEGDAAQPFYFGEAPRLVGDFGRQNRRSTAAVGAGP
                     MLRASLADSKLQGVGYEDAGDDRMSATGVETQRDALHLQRRFLSVRRNGYGLSRSTGG
                     GTSDGGGMREIGLGEDGMSIGPASSMAVTIDDGTVMRRADGCDRGVGRSYAMASLSLV
                     PMSFTVAQLPSLTYPQFWCSMMELADNWTCCAGNPVETAIFMWELYAEVFGHNWDEED
                     KLLASAVESRAAKSAMSAAEKEKLAKVEAETMESFQALLREVSGQLSQPPSRCRSLNS
                     ITSITEAIQAAADRYRSRRLQSETKRDMHICSQSTQSIDTDDDELLLLASYLDLSLSE
                     LKRLAEAKAEGNDRWVYSERVGEDGVTRRYRRRVCDGESHSSSRSISGLGSRNGSYIL
                     EEELDKDGAVVSRRKLRWNVALLSDGSLYTADERAPGFLRRKYYEDRPKKLRHLESWR
                     RVSAGHSGSNSRSSSMTSWSSIDDCDSDDRRNRRRRRRRTRHTGLRRDHPRYSRKDDR
                     YGDKKFGLMLNWRFPSEDDVADGGDGGPRAQGSSKSGLNQEEREHLLARKEWLCSVLE
                     AQGIHLPPHMLEDPAEQMLLYDFLRLAEERERAGDQSNYRGGSDDDYHLEDGEAGDTD
                     NLSRLAGLVAKLQGFTLDDLANSSLMRRLLGESEAEGAVNRHLTPQQVQDILTALTKG
                     QRAGGARADAGRAEQESVRERRLRLLRMLEENRALQQQRREDSAASGPKESPLTKETF
                     DLTEVPQPPPRPLPSKEPPKPASPTNLPKRIASPHPPSAQSPPSFAKSGSPIGFSCAS
                     LDLPERQKASSRESSAVSSARLLANPIAWKISPTTLAERKELERLFRELEAYWADRAS
                     QGGRFRVDIVDYTPEQLEEFFAHLHLGPRQRALLRGRAPLAAATSLVGGAMHQDGSCL
                     AFKAAVAAPAQQQHGHAGCGQPAHSLVPSPTPLAPAPVKLFTLTTEGSLDGALRRSYQ
                     SYMEDKLFSEALHGNVKLDTARPARVSTAAQSLRPPPLPRLKLRDSRWRASGERAGGV
                     PTTSAAPRPPPKSSPPSSSLPRL"
     gene            <583413..>585101
                     /locus_tag="LMJF_35_1330"
                     /db_xref="GeneID:12982360"
     mRNA            <583413..>585101
                     /locus_tag="LMJF_35_1330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722478.1"
                     /db_xref="GeneID:12982360"
     CDS             583413..585101
                     /locus_tag="LMJF_35_1330"
                     /note="previous protein_id=AAZ14358.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722526.1"
                     /db_xref="GeneID:12982360"
                     /db_xref="GOA:Q9GRP8"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="UniProtKB/TrEMBL:Q9GRP8"
                     /translation="MKPALHRALRQTPLFVLVVFVATLCLSHALAEGNVGEDASEVLE
                     LISEGTITTYKLPDSMVVLNNANFESYLFPSKRATPRAFLVLCYSPWCPHCKSLLPQF
                     LNASMQLDLMKVPHSNFAVVDVQKNTAVSEYFDVERFPTLLYTTGKGRQWHLYEGGNT
                     QQGFMQFSTYLQNAVDTGSFSEDVTDVSHFNEVEEKGGTTRVPCYVYVPATSSSAPES
                     QRTAHWSHAIDGAASVSNIRFAVIYEKSQAEGWAEHASDKYKKVVEKAKACVAAGKAS
                     GPGGEALVVFSDRYREPHCYTGPWVEERSVARSSKHRTRRVDADTLTMSTSLENFLAL
                     HGFHAVEDASSAMFATLAYYPKNYLGVVMTNRPIDDKDMDFVPVLREITQAENAALER
                     KHGSDWSIEEMRTPRVSWSYIDVVEYEVWRSRYDIELDQLPAVMIIDTKRDRFFKMRT
                     HVPRFEAIKMDTPWKVGGEQHQLIAQFAQDVLAGVYKAQKLSVAGAVAEYLSHYPGFA
                     LMYEALNYEDFVFDIAVLALGFFSFLLFLAIVMEPLMEWYDARSRKKADKVKRD"
     gene            <586081..>586746
                     /locus_tag="LMJF_35_1350"
                     /db_xref="GeneID:12982361"
     mRNA            <586081..>586746
                     /locus_tag="LMJF_35_1350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722479.1"
                     /db_xref="GeneID:12982361"
     CDS             586081..586746
                     /locus_tag="LMJF_35_1350"
                     /note="previous protein_id=AAZ14359.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722527.1"
                     /db_xref="GeneID:12982361"
                     /db_xref="InterPro:IPR000361"
                     /db_xref="UniProtKB/TrEMBL:Q9GRP9"
                     /translation="MLRLSLRRWCAAAASGSSTSTAHGSPPATTLPDFYGKSFSVSPR
                     AWAQITRKNSEEGFTNDARYLRLAIDSGGCHGYVYKFSFEKNDEFSCEGDVAIAEVDA
                     VSPSDEAFTGAQPSPRVVVDTLSASKLANATLDYHSELKGSAFVVVGNELVDESCACA
                     MSFSMRKTTRQSVASSSSARGASSGDGGGHGGSGAAAPPAGSSLAANARPISRRSTTR
                     ATS"
     gene            <587520..>588509
                     /locus_tag="LMJF_35_1355"
                     /db_xref="GeneID:12982362"
     mRNA            <587520..>588509
                     /locus_tag="LMJF_35_1355"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722480.1"
                     /db_xref="GeneID:12982362"
     CDS             587520..588509
                     /locus_tag="LMJF_35_1355"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722528.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1355"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1355"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982362"
                     /db_xref="UniProtKB/TrEMBL:E9AEV8"
                     /translation="MADSHSTSAAPAALSPCSVYRLKHNPSWTKFGMHPAMLADINAR
                     SDRPTSRRASSRGSSAASSAVPSANASRLSTASARQPASSSSLAAVGAQAALRHEHKQ
                     AHAASRSMNLRATAFSACGTRGASQSLVSDSVLLAPRARGGSDVKACAPESASLGQPA
                     ATRGESLTASTPVPTPFRDRGGSCDHGSETPRTPNDARSSDFTDSSWRAETTRDPSLQ
                     PSVLSLRAASSSRAKDSHLMGSAALVEVAGPLDALYVPLRRPAPRGCVATHQHFSIFE
                     RTHCQRVPGRSATEARAAVAAHREAHIGHRGVVGGSPETDTYRTTNSAYGRGC"
     gene            <590548..>591897
                     /locus_tag="LMJF_35_1360"
                     /db_xref="GeneID:12982363"
     mRNA            <590548..>591897
                     /locus_tag="LMJF_35_1360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722481.1"
                     /db_xref="GeneID:12982363"
     CDS             590548..591897
                     /locus_tag="LMJF_35_1360"
                     /note="previous protein_id=AAZ14360.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722529.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982363"
                     /db_xref="UniProtKB/TrEMBL:E9AEV9"
                     /translation="MQNSIYVGTDTCMDCGFTRGSSVCCPVTRRHHGTDELITSGRHR
                     TSHSRFSSASKGIFAKVWSKHPMPHARQPAHFTRVNDGGIIPTSEALHPLAPGVEDAT
                     AEGTNEDSRAADTSRVGGADDIVSLKNGIEDRENGDSAHQHNGIDAREDSAGVDEAVG
                     QGGGEMQYYCYTDEKGDMYWYVQELQDSMQQQQPAADAETAHTSSQATTYYYESQAGQ
                     YWIDGSVPEGSYVCEYVDENGQTVYYLYTPEMDGAQDNTASTPQQTQDTNSGGTTSTS
                     AIAATGSHVASEEAGNAAAPSKRKTPGAFFAAIKGVFKPHRSRHTLYVNDDLAAHYGE
                     DANPSFFVTGSDTEPPAPLGTVISETLMTPRNSEVSLSENDRGELLDILDAAERKRLR
                     NERKRFIKELTASEKKEREIIMKERRDGMATLGREKRAEAFVLRNFESVITKRPKRV"
     gene            <594682..>595044
                     /locus_tag="LMJF_35_1370"
                     /db_xref="GeneID:12982364"
     mRNA            <594682..>595044
                     /locus_tag="LMJF_35_1370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722482.1"
                     /db_xref="GeneID:12982364"
     CDS             594682..595044
                     /locus_tag="LMJF_35_1370"
                     /note="previous protein_id=AAZ14361.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722530.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982364"
                     /db_xref="GOA:E9AEW0"
                     /db_xref="InterPro:IPR006622"
                     /db_xref="InterPro:IPR018967"
                     /db_xref="UniProtKB/TrEMBL:E9AEW0"
                     /translation="MQRCHLLAASWKTKVDPKNPRRIVHLPNRTPCMVKLEAGTKYYW
                     CSCGLSKTQPFCDGAHRAYNEEHNTDLKPKEFTVDTSKKYLLCRCKHTDNSPFCDLSH
                     VGVLFRTMVGIEKIPGGK"
     gene            <596163..>597635
                     /locus_tag="LMJF_35_1380"
                     /db_xref="GeneID:12982365"
     mRNA            <596163..>597635
                     /locus_tag="LMJF_35_1380"
                     /product="metallo-peptidase, Clan ME, Family M16"
                     /transcript_id="XM_003722483.1"
                     /db_xref="GeneID:12982365"
     CDS             596163..597635
                     /locus_tag="LMJF_35_1380"
                     /EC_number="1.10.2.2"
                     /note="previous protein_id=AAZ14362.1"
                     /codon_start=1
                     /product="metallo-peptidase, Clan ME, Family M16"
                     /protein_id="XP_003722531.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982365"
                     /db_xref="GOA:E9AEW1"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:E9AEW1"
                     /translation="MSVSFSTLVQRARPASNHATSAAFREVLSKIPPTNVSTLGNGVR
                     VACEENPLSKLATVGVWMDAGSRYEPIAYAGTARVLEKCGFLGTSNQSCEQIAKAVEE
                     LGGQLEVSVGREQTYLYMKVTKENTDRAVSLLADVVRNARMEDADIVKARAMVHQDQH
                     LFEERPDDLVMDNLHRCAFDSTPYGVGTPLYGTEEGVNKVTAEQMRNYRASTLGGNRV
                     VVVGSGGVDHTVLEKAAKSYFGDLPRAPEKVATVIPESRYVGGEYRLWNLRYKTVNVA
                     WGFETCGAACEDNVPLALACEIPGSFHRSQHELGQHAMHRVLKTFSSLDHSTPTNTHF
                     NEKSIETANPFLHSYKDVGLCGMYVVGRQAMGGPGDGGVIVEVLQYTIAEWCRIAQKM
                     LHDNELAQAKVNMKAQLLFNMDGSANSAKDIGRQVLHYGRRVPLTEMYDRIDDTTASN
                     VQEVLQHYFYGRKPVYSYLGYISSIPNYDWTQHWSYKYWY"
     gene            <600998..>603040
                     /locus_tag="LMJF_35_1390"
                     /db_xref="GeneID:12982366"
     mRNA            <600998..>603040
                     /locus_tag="LMJF_35_1390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722484.1"
                     /db_xref="GeneID:12982366"
     CDS             600998..603040
                     /locus_tag="LMJF_35_1390"
                     /note="previous protein_id=AAZ14363.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722532.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982366"
                     /db_xref="GOA:E9AEW2"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="InterPro:IPR003323"
                     /db_xref="UniProtKB/TrEMBL:E9AEW2"
                     /translation="MEYVDNLLNKKIERERLGAGGADVSSSSAASAAGTSSKHDDGHG
                     TTGDRQLKSAALRLCWLCNRASPLRFRLQGGIHLCFTCFRASYLSLLLPIINTPARRA
                     SDARFLKLIGSIENERGGSVSSPTAELLTSMYGEVIEPQQASFVMSSAMMRLRREEEE
                     QRLLSATRRSHSGGAASLTKSVKSFWNCPLCTFLNAAAARECEACGFVNPGEVTCPVC
                     KARCSLGIIGAPSAEENPASRCKTGEPHCIWNCRECGGLNTLDGDRCTSCRQPRYWAC
                     SQCTALHHMARGEDGLRYCPTCGAYNTPNDILVGQAKIDKETRNAGMVTAQQSAVQRR
                     KGGSKDRDHNCGDSRAAAGGAAMAKPDDQILFGVNDAHTLEELERQKQIENNEKRLLS
                     RLNRLHISRNLQKTDGNCLFRALANQLFGQPRLHYLVRSLATAYMSEHSEDYAILFDG
                     TAEWKKYLTAMKEQGTWGDELCLNAAARCFRVNIHVITSDQERWHIVFQHDQLGRTRT
                     ARSDEAARTNDVAQTLTSYEGVSLFLAYLSPVHYDDITPLPVAHLQLGELLSGELNKR
                     MKRNQTTHSPSDSGSSTSALVSAGPSTGGRWADASNFSHLPSRPLPVDPAKSHTRSSD
                     DLVKSCLESPTVSNAAVPPVPRSRPHSCKSVTYKSSEPPSRPPPTSPTSLPSEYTC"
     gene            <605126..>605824
                     /locus_tag="LMJF_35_1400"
                     /db_xref="GeneID:12982367"
     mRNA            <605126..>605824
                     /locus_tag="LMJF_35_1400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722485.1"
                     /db_xref="GeneID:12982367"
     CDS             605126..605824
                     /locus_tag="LMJF_35_1400"
                     /note="previous protein_id=AAZ14364.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722533.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982367"
                     /db_xref="GOA:E9AEW3"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9AEW3"
                     /translation="MSLLEERYAPPSQRGVLYFNTIPRDMRPQEIRLHFNRYGEIRRM
                     KFIPFPKKARRPGGPLLPLQYKEGWMEFTSASDAQHAALCMNGQAIDVKRQRRCYGQL
                     WTVRFMDGFTWDLLVEEAEGKRRARRAAEVEARRAERSMNETYRRMVMQAEQQRKAKR
                     RPREKVEAASHSDADAEGDASNPSVATDSGASRVRGGTGRRTAAKSFTKLKAHSAKKS
                     ELDPTKKVKRRRDA"
     gene            <607112..>609475
                     /locus_tag="LMJF_35_1410"
                     /db_xref="GeneID:12982368"
     mRNA            <607112..>609475
                     /locus_tag="LMJF_35_1410"
                     /product="putative threonyl-tRNA synthetase"
                     /transcript_id="XM_003722486.1"
                     /db_xref="GeneID:12982368"
     CDS             607112..609475
                     /locus_tag="LMJF_35_1410"
                     /EC_number="6.1.1.3"
                     /note="previous protein_id=AAZ14365.1"
                     /codon_start=1
                     /product="putative threonyl-tRNA synthetase"
                     /protein_id="XP_003722534.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982368"
                     /db_xref="GOA:E9AEW4"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002320"
                     /db_xref="InterPro:IPR004095"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR012676"
                     /db_xref="InterPro:IPR012947"
                     /db_xref="InterPro:IPR018163"
                     /db_xref="UniProtKB/TrEMBL:E9AEW4"
                     /translation="MSGKKASEATVELATLAEPGFWRRRVEIFEQLWQQQQNRYESMK
                     APIKVSLPDGKVMDAESWVTCPLDIAKRLSNSLPDKVIVARVNEALWDLTRPFEADCQ
                     LELLDWAEKDAREVFWHSSSHVLGYALERIFDTKLSVGPALEEGGFFYEGLTNRPVSE
                     SDYKAIESAMQELVKQKMPYQRLEVSKEDALRLFGYTEFKSKILASKVPDGGSCTVYR
                     CGMLIDPCRGPHLPDTGRVKAFAVTKNSSSYFEGKAENEVLQRVYGISFPKNPMLTEW
                     KTIQEEAAKRDHRVIGRQQNLFNFHEVSPGSAFWLPHGARIYNTLVEFLRKKYRRCGF
                     QEVISPNMYSSKLWMVSGHWEKYADSMFCTKCEKEDFGLKPMNCPGHCIMFASQPHSY
                     KELPIRYADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCRMDQITDEMEGQMQFLSD
                     VYGVLGFKFYFYHSTRPANKLGSDALWDQSESYLRTALNRFCGIPEELPDPLHPDQRF
                     HYDGKPDSVKKMKALMKKAERSEDPNAWKGPTNGGDGWIENVGDGAFYGPKIDIVVED
                     ALRRRHQCATIQLDFNLPSRFGLKYTLPAAEKDETTVGPTEKQRHADPAPTASSPAVA
                     EGESKPKPGKYEAAVRDLGIDLELDANQARPVMIHRAILGSLERSIAILCEHFGGDWP
                     FWLSPRQVMVVPVSASNYEYSQQVRDTIHDAGFHVDVDNGAATLDKKIRNAEKARYNF
                     ILVVGQQEQDATGVSIRARGEKRLGNKSLVEAVQWFKELADTHNREY"
     gene            <611197..>613092
                     /locus_tag="LMJF_35_1420"
                     /db_xref="GeneID:12982369"
     mRNA            <611197..>613092
                     /locus_tag="LMJF_35_1420"
                     /product="putative peroxisome targeting signal 1 receptor"
                     /transcript_id="XM_003722487.1"
                     /db_xref="GeneID:12982369"
     CDS             611197..613092
                     /locus_tag="LMJF_35_1420"
                     /note="previous protein_id=AAZ14366.1"
                     /codon_start=1
                     /product="putative peroxisome targeting signal 1 receptor"
                     /protein_id="XP_003722535.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982369"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR024111"
                     /db_xref="UniProtKB/TrEMBL:E9AEW5"
                     /translation="MDCNTGMQLGQQFSKDVTMMHGGVPMSGAMSEQDALMVSAQVGG
                     ASPMMAAQWAQNFQQQQAMQAMRQQHEMEQAFQNSQQQQHAAVAQSGQMLGMAGPQQQ
                     QFMVQQQQQASMMNAAMMSQGMMTANMGFGMMMPRTQYQPLPNLSVLQPNQQQQQQQQ
                     LVNLAPAVQDSAWADQLSQQQWSTDYSQVQTFSAPGMEDKTVEERIKDSEFYKFMDQV
                     KNKEVLIDEEKGELVQGPGPEVGVPEDAEYLRHWAEMEGLNMPEGVFQPPPPASAMMT
                     PENGDPDTYIKEMDMAENDVEDWAQEYAEMQERLQKVTNNTDYPFEPNNPYMFHDFPF
                     DEGMEMLQLGNLAEAALAFEAVCHKDSSNEKAWQILGTTQAENEKDGLAIIALNNARK
                     LNIRNLEVHAALSVSHTNERNADAAMDSLKAWLVNHPEYEQLASVSIPPDAELDVQET
                     FFFADPSRMREARTLYEAAIEMNPSDSQLFTNLGVLHNVAHEFDEAAECFRKAVALHP
                     DDPKMWNKLGATLANGGHPDQALEAYNRALDINPGYVRAMYNMAVAYSNMSQYNMAAR
                     QIVKAIASQQGGTKPSGEGSIMATRNMWDLLRMTLNLMDRDDLVQLTYNEQLEPFVKE
                     FGLEGHV"
     gene            <616302..>617084
                     /locus_tag="LMJF_35_1430"
                     /db_xref="GeneID:12982370"
     mRNA            <616302..>617084
                     /locus_tag="LMJF_35_1430"
                     /product="putative 60S ribosomal protein L2"
                     /transcript_id="XM_003722488.1"
                     /db_xref="GeneID:12982370"
     CDS             616302..617084
                     /locus_tag="LMJF_35_1430"
                     /note="previous protein_id=AAZ14367.1"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L2"
                     /protein_id="XP_003722536.1"
                     /db_xref="GeneID:12982370"
                     /db_xref="GOA:Q4FWX5"
                     /db_xref="InterPro:IPR002171"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR014726"
                     /db_xref="InterPro:IPR022666"
                     /db_xref="InterPro:IPR022669"
                     /db_xref="InterPro:IPR022671"
                     /db_xref="UniProtKB/TrEMBL:Q4FWX5"
                     /translation="MGKTVLSCRKGNGSVYQVHGHKRLGPAKLRILDYAERHGYMRGV
                     VKSIEHEAGRGAALARVEFRHPYKFRRVKELMVAPEGMFTGQSVFCGQKAPLAIGNVL
                     PLGQITEGCIVCNVEAKPGDRGTLARASGDYCIIISHNHETGRTRLKLPSGQKKSVPS
                     TSRAMIGIISGGGRIEKPVLKAGNSFYRFRGKRNCWPKVRGVARNPVEHPHGGGNHQH
                     IGHPSTVSRHSPPGQKVGLIAARRTGRIRGGKAVKGAWHPEE"
     gene            <618687..>619469
                     /locus_tag="LMJF_35_1440"
                     /db_xref="GeneID:12982371"
     mRNA            <618687..>619469
                     /locus_tag="LMJF_35_1440"
                     /product="putative 60S ribosomal protein L2"
                     /transcript_id="XM_003722489.1"
                     /db_xref="GeneID:12982371"
     CDS             618687..619469
                     /locus_tag="LMJF_35_1440"
                     /note="previous protein_id=AAZ14368.1"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L2"
                     /protein_id="XP_003722537.1"
                     /db_xref="GeneID:12982371"
                     /db_xref="GOA:Q4FWX5"
                     /db_xref="InterPro:IPR002171"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR014726"
                     /db_xref="InterPro:IPR022666"
                     /db_xref="InterPro:IPR022669"
                     /db_xref="InterPro:IPR022671"
                     /db_xref="UniProtKB/TrEMBL:Q4FWX5"
                     /translation="MGKTVLSCRKGNGSVYQVHGHKRLGPAKLRILDYAERHGYMRGV
                     VKSIEHEAGRGAALARVEFRHPYKFRRVKELMVAPEGMFTGQSVFCGQKAPLAIGNVL
                     PLGQITEGCIVCNVEAKPGDRGTLARASGDYCIIISHNHETGRTRLKLPSGQKKSVPS
                     TSRAMIGIISGGGRIEKPVLKAGNSFYRFRGKRNCWPKVRGVARNPVEHPHGGGNHQH
                     IGHPSTVSRHSPPGQKVGLIAARRTGRIRGGKAVKGAWHPEE"
     gene            <622736..>632374
                     /locus_tag="LMJF_35_1450"
                     /db_xref="GeneID:12982372"
     mRNA            <622736..>632374
                     /locus_tag="LMJF_35_1450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722490.1"
                     /db_xref="GeneID:12982372"
     CDS             622736..632374
                     /locus_tag="LMJF_35_1450"
                     /note="previous protein_id=AAZ14369.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722538.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982372"
                     /db_xref="UniProtKB/TrEMBL:E9AEW8"
                     /translation="MLSTLRIPVHEEPEEEAPASPDPYATSPFRGASPSIVSMVRAGS
                     ISSENMPPPPDIQHIEGQLWFVTGKNGPGKKHASAQWVVCEDQRLSVYSSWANSRRLV
                     EEARFERVRIMFDFLHPHMHPEVMGSGAPQTRRMTIHRNEPRTTAESRCAFHIRDPCD
                     AQTLAGYYYFGVECVMRDPLTVRLRRSLAVFCTDHPDDHRKWLDFWEEMQVRYPMLRN
                     RNAAAMSMDISSELMSEFVFPAQAVKPAVGGKSEEDTDAVSSPGLPSPIGRDEDSLAT
                     TRAPKWTDSEHGQPHWKGDTRPLPFALLGSTSAGGVRGSLLSDVATGGEDAEAGGSEQ
                     WLALLVDAERQAREGIELIEAATRSMLEANQALRDLFHHVTPTATVPSPVAVVCRKDE
                     GSAGDDAVSGVPMRNGDMMRALQAELRALCAALERAKSEVFTSAPAPEALTSAESAAV
                     SNQVLLAAHERELTELRVQNATLRRELDTHAATAAARVERALDEWTLTGTVDIVVSDA
                     ENGGSGQVADAFADRQRYLAADKALVRALVEAALVQESSTAALDSSGGAASPAQVNTQ
                     GESASTPQAFHATLSTDADGYDGVISAGRLLGTASDSRQLCRAHSGEVQLSDATSAAG
                     DLTASLPALVRQHLSTFATEHDRRLGSTDLARSLSTDRDSLLYHVVDEVVTAFKDLMD
                     APHIATGISKADGNVTASAPTATAVSSWLSVLHRCLLHRLGVVGVVCSAGASIQSPVA
                     AAEAGGPATDAASAVEAAAAGDDVTGCGPPAETSSNARQCSSLPPLTDEEIAIVGDLH
                     QSVHDVVAWILNLLGERQRYAAYMTALDSLTCRHDVFRPLKEVQGELERATARFEAAA
                     AAASPSSAACGHGEATNPDTFPLEAAAASSAAYDGPEDSEKHTSDGSDGLRVECRLTA
                     RLQHATAAFDSKCEEAAALRRLLTAILYGSEMALQKADSTDEVVPAATTSAAAACEAF
                     RAAQEAGVGEVDKLRGAAEACVAARAREEVWASTLTPAVLQACADAFIGAPCIQDMVH
                     ALQLTLGRCPEIHGRPRLVGDAAYVPPLPQESIWSLAQELHQRLAVEQARCNGLLGEV
                     MLISSSLACVGSEPLTAAYSTAMTATANASAMTNEALKAWAAYTKHAHEVVPGQQRDL
                     HEPVETKADRCLSAAPAETTAETAPHEVVHARLVAALSRADGARGLRSAAFDVTNSLL
                     PNLLASIAGTQTALWRLVGVLLRHGAGAGVPSPEVVLALPIVNHIAAPHAIGDSATDV
                     SSLGAHIGVAGSAAEELLSECEKAASERREWMQQFLQWLKDVPLTPVQVRRHSYTPGL
                     RYDASTAHEVYAQLLEELAAAESEHMSRVGAVEALLWKTSCVRTIFVPEMSDGAGDAD
                     IAALAAAAAADIAETLRVAEAHVSVTAASADPVQRAAHVSATIAHDPRGRTRASVLGT
                     VHACPFARLQEALKGAPVDSAATASDTGERSTAHPATVDSPEGIDAVSRLARSLQHRA
                     AKMAAVVEFEKRVLALLPSPHDIAMANAGMPTIDGTPACKAVQALAAMLADELDIPIP
                     EANFKRPSTAPAALLDTLASYLEQLHDAALSALHHRQIESGYASLEKLRAAVDTLHDA
                     ALEKVADVALEQIPSLHDIVDMPWPEALKTADLRHIHLIIEHLASGADRAASPDSTND
                     QLNDLRAIAQALGVPPDAYAGERDGECVPTIGQLAERAGAVVSARAEEAAGLRAIAQA
                     LAVPPDAYAGERDGECAPTTGQLAERAGAVVSARAEEAAGLRAIAQALAVPPDAYAGE
                     RDGECAPTTGQLAERAGAVVSARAEEAAGLRAIAQALGVPPDAYAGERDGECVPTTGQ
                     LAERAGAVVSARAEEAAGLRAIAQALGVPPDAYAGERDGECVPTTGQLAERAGAVVSA
                     RAEEAAGLRAIAQALGVPPDAYGGEWTEEMTPRCSEVLSAVDALVKRSKMACEAARMD
                     AGEGEAAVGVLVALWEAVEEAGVLTANLEDGWWSVEGRSRWEAAASLVGALSAAVEVS
                     HEELADVSGRIKFFEEELVDVERDHNESRETITAAVKKLRGGLEEVIIEDPGETSPPS
                     SRGSTVCGPLFTSLRQLTSEVSDVASVLRRVKQVLEEHNAEEKCMPELEEVSFPVSQK
                     DGCDVLEEGKVLTYEDVVAGVRAKVVALRKERARRIETDAALKNFLSAVTDRRAFSEE
                     QPVSRPSSLLSRRCVKPKAKPQPADLDSSASEEFFLPRTPLLLPTNNGNTDVPLGCSG
                     SISVPVSRWAASEALEKVRHQMNQAENAIGTLRTAVAAAYEALGGEDDAVHASDNEAA
                     RLLVELARNTAESIEFVKRLLEPLDESEASTRRREQLAHLVDRIKEKLGSSSGASMPT
                     LLQVEEGMHSLYNDSTSSRRSPGSSVNRHLPRKQKPVAPEVEFTKGFHLTQQVVRNRD
                     SSASSLTSTLKVLVPPPPGTRDSTEDVEKEIGYRMQELDALRRGCSVALRTLDSSLNV
                     SDMDCNAMITHLVECCSDVQTAMQITAAVFEDDNMISEVSAAASSYRASNPSASEHPL
                     PMRCSVLVRTVKSLDNLCEAMRHTQANMAKQQRFLMQNEAQNTGELRRALVELEQQLL
                     NGNAERLKLQKAKEAAEKNAAELSHALEMAHNELTNLQNIRDDLEKSLVQLKQQHGKD
                     DDELDRAGEKLNSLSNHATTLQAVLEAATDAVRKEVLGPCQQLHLAVVGREMPKPEML
                     AEGKSQEVLLPALHAIAKALQNAVEEMTRFATGDTGIAAVFAEERKHAAQRAAVLKSE
                     LASVAEAKEEAEARAKAAAKHLKQTEDAFEDEVAKLKRALRNSEAMLEEKEANHQRRL
                     RQAQAAAEDQLALVQQRLDRVTRAQTEEERLRAASEENVQKLRGALAEAEAELARQQR
                     YAAEDTMTQRKGSMHRIDSLEADLAAARLHSSELAQTLGRARRDSAEAARTLETEARE
                     KAKLAEELADTRAQLRAVNNELASICASIASTGLTSSIKSSAFSPASPERATELLAGL
                     VDHVAVLQRALEAQETARQQHRTKGTQSEDAVAETLAAFAAIWAAAVKTGCTPARLNE
                     ACLTPTDKAEVLSNALTRDVSLKLDDLAATRQRLLDLLCHPRVRHLARPAALGPLEKT
                     TTAALVQTYHDAMERCHEAQQAALERELRDAQCRAQNLLARLQEQEEQHAIEAEEVEI
                     RIGRMREMVQSKLMADEIAEQHMQETDAAMRAHFLL"
     gene            <633311..>634300
                     /locus_tag="LMJF_35_1460"
                     /db_xref="GeneID:12982373"
     mRNA            <633311..>634300
                     /locus_tag="LMJF_35_1460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722491.1"
                     /db_xref="GeneID:12982373"
     CDS             633311..634300
                     /locus_tag="LMJF_35_1460"
                     /note="previous protein_id=AAZ14370.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722539.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982373"
                     /db_xref="UniProtKB/TrEMBL:E9AEW9"
                     /translation="MAMPDAAAATSPALVMTEAELRKALQPAPLHKVKNFSGATIAAD
                     CSTAVAVALTAAIPISIIDYSIMARVAGVSPSSTQELFKGVTTVLFRPHKFFFPCAEN
                     KCSLVYRVCATTYGFTYMGSNLAKSYCESHGMEKDANLAAGIVSGVMNTVFTIWKDSI
                     ILRALPPVNPKDLSSAKKPVPFLTRALFCGRDTLTCVAAFTFVPIVASWISGYAYHQK
                     RLPQASDAILPENEGKVRLPISCVDTAQMLTPALLQFVTTLMHITAIRYRQMYPHFSM
                     KDLSDSMRSTYISSTLLRICRIMPAFGIGGIMNRELRSSLLDKADPLERPTVA"
     gene            <638550..>640556
                     /locus_tag="LMJF_35_1470"
                     /db_xref="GeneID:12982374"
     mRNA            <638550..>640556
                     /locus_tag="LMJF_35_1470"
                     /product="putative choline/ethanolamine kinase"
                     /transcript_id="XM_003722492.1"
                     /db_xref="GeneID:12982374"
     CDS             638550..640556
                     /locus_tag="LMJF_35_1470"
                     /note="previous protein_id=AAZ14371.1"
                     /codon_start=1
                     /product="putative choline/ethanolamine kinase"
                     /protein_id="XP_003722540.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982374"
                     /db_xref="GOA:E9AEX0"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR026712"
                     /db_xref="UniProtKB/TrEMBL:E9AEX0"
                     /translation="MMSVDNSENLFRNVNMRDLITRTTREPPRSALYEYVKSLRSEQS
                     QSAPLSLASDDSWDSTTHSTYNSMADNLSELGGVTEDAETRDLIYKLCHSLHKKAVQK
                     IEGSRQHRQRSVEVNAEHEKNMSHIGDWMPLLHLFDPQTFYAVRDTPMTLAATAERPF
                     SLNVAENAKEASQLLLGELDVEKLSGGNSNHVYRLAHPDFPGKTVLLRVYGSGGSEAI
                     DRFRDVMAMLEMSRARLSPAVLHSFKWGRVEEFMEGVATCSTDMLLRSPTLLAEVWLL
                     VRKMHSLPYASFLPQNVNNEKIRHLLHPALAHCEYATPEAYCDVLSKRLKKVVLAKKS
                     DYYLDNTSQKLMEDACPSSFERTCFRFLRLTSNLILESYRASFVSFISAEVMLLRKLL
                     MKRAVPLVFSHNDLNPGNILLAWRKVPKEMRRQAANDEDEEDEVMPVTSDQSTAFSRK
                     FLSRKGHHRNLVDVKGIIFIDFEYTDVNYRCFDLGNTICELDYDYTRGGAAGEPGFIK
                     YHYTFPPEEYREQWKGHPMTYPRCQELIYTTWQKNEQHRQRHGGEAPPEPAPSEMHLG
                     HICLKGLQAYFAAAAPAGTARDASTPITRDELTEVFIGTMCSHLSWSLWSFVMCANPD
                     VCTNNANDDVFAKGSSGLDYICYGNCRLQEYVALKQWMRDEQLI"
     gene            complement(<646832..>647821)
                     /locus_tag="LMJF_35_1480"
                     /db_xref="GeneID:12982375"
     mRNA            complement(<646832..>647821)
                     /locus_tag="LMJF_35_1480"
                     /product="arginase"
                     /transcript_id="XM_003722493.1"
                     /db_xref="GeneID:12982375"
     CDS             complement(646832..647821)
                     /locus_tag="LMJF_35_1480"
                     /EC_number="3.5.3.1"
                     /note="previous protein_id=AAZ14372.1"
                     /codon_start=1
                     /product="arginase"
                     /protein_id="XP_003722541.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982375"
                     /db_xref="GOA:E9AEX1"
                     /db_xref="InterPro:IPR006035"
                     /db_xref="InterPro:IPR014033"
                     /db_xref="InterPro:IPR020855"
                     /db_xref="InterPro:IPR023696"
                     /db_xref="UniProtKB/TrEMBL:E9AEX1"
                     /translation="MEHVQQYKFYKEKKMSIVLAPFSGGQPHGGVELGPDYLLKQGLQ
                     QDMEKLGWNTRLERVFDGKAVEARKANDNGDRIGRVKRPRLTAECTEKIYKCVRRVAE
                     QGRFPLTIGGDHSIALGTVAGVLSVYPDAGVIWVDAHADINTMSGTVSGNLHGCPLSI
                     LLGLDRENIPECFSWVPQVLKPNKIAYIGLRAVDEEEKKILHDLNIAAFSMHHVDRYG
                     INKVVSMAIEAISPKGTEPVMVSYDVDTIDPLYVPATGTPVRGGLSFREALFLCELIA
                     ECGRLVALDVVECNPLLAATESHVKDTISVGCAIARCMMGETLLYTPRKDAKL"
     gene            complement(<652098..>652523)
                     /locus_tag="LMJF_35_1490"
                     /db_xref="GeneID:12982376"
     mRNA            complement(<652098..>652523)
                     /locus_tag="LMJF_35_1490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722494.1"
                     /db_xref="GeneID:12982376"
     CDS             complement(652098..652523)
                     /locus_tag="LMJF_35_1490"
                     /note="previous protein_id=AAZ14373.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722542.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982376"
                     /db_xref="UniProtKB/TrEMBL:E9AEX2"
                     /translation="MTHIGQLYVDRAADAARVDQVYRGQRTSLLLGNHHLRGFFFFDA
                     SSGAAAVQAGDGKDNDDEGPRQRCHVFYLSHKVAPFCVPRRYTASSRESVVHGVLVAR
                     FSGMERYDHTPLVEQSFYVLNSTDADADAAVPRGQLRGG"
     gene            complement(<655979..>657730)
                     /locus_tag="LMJF_35_1510"
                     /db_xref="GeneID:12982377"
     mRNA            complement(<655979..>657730)
                     /locus_tag="LMJF_35_1510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722495.1"
                     /db_xref="GeneID:12982377"
     CDS             complement(655979..657730)
                     /locus_tag="LMJF_35_1510"
                     /note="previous protein_id=AAZ14374.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722543.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982377"
                     /db_xref="GOA:E9AEX3"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:E9AEX3"
                     /translation="MRRERFEIDQYVRVRVTDTRYSIGVVTDIDEDQDRATVETRNGY
                     EVTVPTSALRRAFLLVLDLNGVLVARGRGSFILRPNVSDFLKFVFSNFVVAVWTSGLQ
                     RSSNPIIDHVFGNYRDLLLFMLFRDACVPKPSAENPYGTEKNLQVIFDRYPHSFHSVN
                     TIIIDDSPDKCSHPDIALCPIPFKDPVAQMQDEGLLQTMEVLKEVLLLDSGVPLILAA
                     ERRLEQLAKQQQQQDHPSGEEKTQEQAPSKVSTPTAAASASATASAGPVVRASVFGSH
                     EAPSDMEEVELWKTRLCCDQLQGKCLRGDQCPFSHDADDGRPCSRKSGCRQHGSRWPK
                     TREEVQLEEQRREARNAMRQRYEKTQQQREAHIRQPQKPPRQSNRANNRRRGGADDGA
                     EWATETIGCSHTGDPMYDNMIDQQRRQSAPAAKATAATLPMGASGAALRNARGGSSAT
                     NAAAPPQAQPHSSQASSSMLLFFQTAASSSAAAPPLVPFSTRPIAPVVSVTDMNTLPR
                     QQQQQPTSTDSARDNASSRRANNSNDHQHQRGGGARQQQQRRQAARPSQQPIHITGEQ
                     GDSTAVVNQLQALMGQR"
     gene            complement(<660235..>662091)
                     /locus_tag="LMJF_35_1520"
                     /db_xref="GeneID:12982378"
     mRNA            complement(<660235..>662091)
                     /locus_tag="LMJF_35_1520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722496.1"
                     /db_xref="GeneID:12982378"
     CDS             complement(660235..662091)
                     /locus_tag="LMJF_35_1520"
                     /note="previous protein_id=AAZ14375.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722544.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982378"
                     /db_xref="UniProtKB/TrEMBL:E9AEX4"
                     /translation="MGMWSRIDRLASCPSTGFSTVLDDIRLSREARTSGGALLSELWR
                     RARGIREESLFYENAAEFIALETEIKRFVRANHTLGMHPPHYGDVLSSVADILGLNLT
                     ADLLPPHGDGPLPIMADGPGMESVDHECESDPNCLRRGALNTYRRHANRTLEASPHLI
                     VSDATFEQAMAYYQKNLVPSIVVRAYDLMSGPSNSFEHDLAGFLRTVQQMWDAATREV
                     EREEEDAAAKDETVALRGANITDSSKGRSASPSLSKPFLPFIKVTDFTGPPMLSRAHS
                     LFHDRPEPPLRGSGSTRQRPLHRVLPAAIVYHTSPSCASCEVYDRAFDLLPSLFKGLC
                     SRPHVSMVSCSPLTLFLRTTQISAFDLVPSMDIYARLVYSREAVLRTADASGFFFSGG
                     SADAVDDDDAADDARFYSLKSKYGSHRHGIEREVLPRDQFTPNYVSLRQISDGTSVEE
                     VLTSMFAELVEHGVVQFAFIGKSQLNRILKKNQEVLEKLEQRRREKEGNAKNGTDAGA
                     ASSPPTPNPEVDPEYQKVVTFHDLAAELVSSYIKSHFGDVTPSMTNQVWPRPSAWPTA
                     SSWWLLSWLINAVAALWDGVWFELERPLVPILFMLVFTAQLLWNRVEQVTYW"
     gene            complement(<663183..>664247)
                     /locus_tag="LMJF_35_1530"
                     /db_xref="GeneID:12982379"
     mRNA            complement(<663183..>664247)
                     /locus_tag="LMJF_35_1530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722497.1"
                     /db_xref="GeneID:12982379"
     CDS             complement(663183..664247)
                     /locus_tag="LMJF_35_1530"
                     /note="previous protein_id=AAZ14376.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722545.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982379"
                     /db_xref="UniProtKB/TrEMBL:E9AEX5"
                     /translation="MQLQCDGQPLHRCSRTDAWSFEISGGLSYAADHGGRADAERART
                     DDYIRVPSSPSSSSIRGIHESSITTSTDCHLCPYAASAHRLSATAALSSAKLSPWCRL
                     SRSAHNDSKMTLTLRSIRVSVVRGDSGRQCSFLIQPTFAYTWHRRNTSNDSVDGAQAG
                     IELQETVRCRVSSSAVTRSNSATVGSATAKSRTASSTSGSTTAPGAATTVSLFERSPG
                     HLCRNEEVSSSALRSDVSGDVFGDGYTYEATQISRCRSIPMCLAGLEESASSLGNCSA
                     ALFVDCLIKCAQDEAAVALDDRHGWVHLYHGRHIATEVGRTRLLTDVLALGYFGAASA
                     GPMPSCSEPPSLTICVFRKC"
     gene            complement(<666887..>667780)
                     /locus_tag="LMJF_35_1540"
                     /db_xref="GeneID:12982380"
     mRNA            complement(<666887..>667780)
                     /locus_tag="LMJF_35_1540"
                     /product="putative reiske iron-sulfur protein precursor"
                     /transcript_id="XM_003722498.1"
                     /db_xref="GeneID:12982380"
     CDS             complement(666887..667780)
                     /locus_tag="LMJF_35_1540"
                     /EC_number="1.10.2.2"
                     /note="previous protein_id=AAZ14377.1"
                     /codon_start=1
                     /product="putative reiske iron-sulfur protein precursor"
                     /protein_id="XP_003722546.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982380"
                     /db_xref="GOA:E9AEX6"
                     /db_xref="InterPro:IPR005805"
                     /db_xref="InterPro:IPR006317"
                     /db_xref="InterPro:IPR014349"
                     /db_xref="InterPro:IPR017941"
                     /db_xref="UniProtKB/TrEMBL:E9AEX6"
                     /translation="MFRRSFISAFQATRPARVSLVFKQLEGNMPLTKKDKPVDSWSDE
                     FMKPPQSAEMTKKYGRYAKYSDPALCDVDTSDEVVLNTYPEGAPQGRIEATAGVALKD
                     YDASMWDEEFFRKHILKPKLADDMEDRARVTDYALNSAMLGFVILMARYAVLPLWYVG
                     QPAMSMVGQMNIEAEVGELDERQCTTVVWRGKPVFVYRRSARQMKEVMETPLSALKDP
                     ETDEARFPDHRDKAVVIAICTHLGCVPIPNEGLFNGFFCPCHGSHYDPSGRIRQGPAP
                     LNLEVPPYRWIDDHTIYMGKL"
     gene            complement(<668653..>670695)
                     /locus_tag="LMJF_35_1550"
                     /db_xref="GeneID:12982381"
     mRNA            complement(<668653..>670695)
                     /locus_tag="LMJF_35_1550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722499.1"
                     /db_xref="GeneID:12982381"
     CDS             complement(668653..670695)
                     /locus_tag="LMJF_35_1550"
                     /note="previous protein_id=AAZ14378.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722547.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982381"
                     /db_xref="UniProtKB/TrEMBL:E9AEX7"
                     /translation="MWVSVVGAFYDEFLLYTQHCSSEVRLKHAAEAAMLRCLDEERAS
                     EALEVYEAMCRCGLVGMSRTLGRSSCRTSPTTTVPRTCTSQASVSLDQLARRALTHVP
                     HRQRQNSMLALLMAAELDAPSPTTDHSDDRRDAGSPHDSRDLNASSCNAYATSIATDD
                     ERGVSGEVTLLSQARAPSAAEQARIRVQQRLHALRITQQLRQPLGKECCLVEMLQLCA
                     PSDVGSRAFTAVRKVTDEVEVGPLHTLSHVVLHHPFTHMQPSVPWAQQEVHWEEISSR
                     ACARSLTPADAARLTKIEDAVSPYRPFCKSSLMFLARMVPNWDAVLVRRVAETLVLPA
                     AAHSVFPESYRRLRSTAAQRRRYSARAALSTPGAAGDQLAAPGCCASWTDSATHQLFG
                     EESCDGHVSPLLRVECLVKRRVHHDVVVPDTAYVLQCFQQLKQLARHREVIVTHGVFL
                     GLVAAASLPTHPTRFHARRVLRDIMCATTTAVTGKASAEAGGQLGVQGLASTGRRRHQ
                     QQQSGFTLLGLQDELALLERCPERFYLSELSSASSLSDWALMGQRTSLDSAARVGDIE
                     YGGCLSVVLVAKQLKRMIAAHDRGEDFLANNAATVPTSTCVGIDSLVQHILQGNSNAA
                     SPKIPSSKQWTSPLFKNRSCGLRAHMPIVVATTHESTRAAAFTVGLNMHPPAGVAP"
     gene            complement(<671404..>676989)
                     /locus_tag="LMJF_35_1560"
                     /db_xref="GeneID:12982382"
     mRNA            complement(<671404..>676989)
                     /locus_tag="LMJF_35_1560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722500.1"
                     /db_xref="GeneID:12982382"
     CDS             complement(671404..676989)
                     /locus_tag="LMJF_35_1560"
                     /note="previous protein_id=AAZ14379.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722548.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982382"
                     /db_xref="UniProtKB/TrEMBL:E9AEX8"
                     /translation="MEALVHNCPASEDGEGALLAWTSDWLTFDRDTDPCAILAFSGEV
                     RALHPRRMGSTLADVLVALYAYVVRHGGRVSGGRSVAATDKTGGRTTLGTAAGSLHSL
                     GRDVEDGWWVVLVDLAQFLFSCWDLLLVGLPTPLSQQVPPLHTNMAILTSHEASLQCR
                     SAVCDCSPAGPLSSLILLGETGDGVPEEDARQCCYWEGEEKEPVQRSGSHESVAQVTA
                     ESVHDVVRRVISEIFSVADDDAATIEAGHSGGPLRSPAAAATFLKLVQASPLLRRLVC
                     SSPLLIRSLARYLLPRLVSLHHRQQQQQLHHHAPGELGGKSAVAATAIEALLSTLYAV
                     SSSAALSTSMWSAQPLLVVASQLSCRCRSSDCEMSPASSLADSDGATLLKTLCAVLQS
                     CCGAYPSPLRLQTLRLLHLLSSSPTTRHALFSSCHRDEVPSMFSMHEEKPEPEDAAAA
                     AAAVSSSQRRSVLDVAPHLLPLLLSGEGEEESVQLSCSTLQLILLHVQSPRLYAPLSD
                     HHNNTAHTTTTAAAGVTATFTEDGIVGTADDVSGIKAAAHLAHHIKDYAMQALYSCTC
                     KTGYALVGLLDSAACVVTGARALLQCASIGAEASAQYDDAAVRWEQRQDWRIIFHVAE
                     VDMALFGVLLQGTALHDALAQCNGACVGDDGSETRLVWDEVASSIVAVASQERGAQLS
                     LYSFLRCLDALAAGMRGNVQALWSNRLRQLAHELLERVDGHVQDARWRPADSAAAMRT
                     FSALVMVGALHCNSNDGSLATTAAPHVRDAADTLLLRRMVDPQTLHLLTRVTAAYLPA
                     LCDLLLPLGVQLLDDAACTGELIAIHCPVPSGYPTVTSASVEESRCLLRIATLLMRNQ
                     RESWATPTPTFTSKEGRTRRASDDHSPAGQKPTIPPYPMRGQPHMSSYTSCGTGRSNG
                     GADRAGLLDVLLGFYPEAPELLAARTELIHAVARGPGAADAQPELLVARASAFVGAAS
                     LTEVAMCASDLQASLLLSLATLGCRPCVGRQELRAMLEGQCRVLCSRLQQAGFSDSTR
                     APVALWSAEAAEEEGDVLGPAISETASGRDGDDDAGLLLDTLQEVFILFVVRMLWHGG
                     AESGPSQPLPSPSSQASTTDAAADRFFSEAHAHALMMCVEDSVGLREGVRQLLFDLHT
                     QYRVDVRGFLTLLQSEKDDVPRQRPQQAQAPSSALFAAAVLSVILYDGDEPGLSTAQA
                     GAASPLGTYMHSLRSVHWLTDTSSQEAGVPFSVGLLLRSVFRVARRELLSLDGLQHPQ
                     EQPADAALATTATFPAVIGGLHFVCDELAFQQRGLQGGTLPVRRVGEELAAREDVPVS
                     APDSSPGVALSICVLREHLVPLLLRTNSSSVAHRKNLSMAVAALQYSTVLLRLMSLAL
                     WPLAPATCTSVDAVLTEYAMSRARQLLALTTAELTRADGAARKLLYPLLQLLYLLLMR
                     AHKVDVVRRYGTDLLFFAFRARHAAITRAHLIVFGEVEQGALTDSDEDSAQVCVIASI
                     VYIMAQQIAAPRRKGATGDNEVRSVEDVARAASGGAAAVGGGGLEPPSRKDMPWHVWV
                     PVLRYYWCFRTAVSRTANDHVVREQRRSVLRILVSGVEYVIRLCGVSHLACCSHSAAH
                     VGKDPDRDERQAATILIDWCTELIFTSWRSGDDFNDAHPNGTIVAARLLYLLFYRFRA
                     LAANSVWFNALALSCMRQTAPSRLLRLPLAAEGWLLAAIIQVLPYVQHSRAYGNYVKG
                     SAAKFFEKPEIAVRVKLLPHPPPKEAATAGAARLVDTSGGWADVSAAEPELSCVLRIL
                     VTACRQYELSQHRLRSSSSSSSLEVIVPLGLQFVEEAPIRDCPSVLEYAFPYTVPFTT
                     TAAPPLLLVFRCFADQIHA"
     gene            complement(<679016..>680056)
                     /locus_tag="LMJF_35_1570"
                     /db_xref="GeneID:12982383"
     mRNA            complement(<679016..>680056)
                     /locus_tag="LMJF_35_1570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722501.1"
                     /db_xref="GeneID:12982383"
     CDS             complement(679016..680056)
                     /locus_tag="LMJF_35_1570"
                     /note="previous protein_id=AAZ14380.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722549.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982383"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9AEX9"
                     /translation="MPGDAAERASGSAVVNGAPSGHSATSEIQQRHKGFIEPSDDVVM
                     ETARKALAREGRDAIPEAIVWSWETTAPPILARGKQNIYDLTDDIPKHVKPFWYHEYY
                     QQREYFRLQREKRPLKERMKLWAGVLTAMAVAGAVLTFFRVWVEQPREIRQLREELLQ
                     RTYGRVLELAAGHGQNIGAYPYAVHEVVLTDSNPQQLQAMRYRIPHTAYPKYDVKRVR
                     SETLDNFKDGEFDCVVDMFGLCHLRDPVMALRQMQRVVKPSGMILLLEHGASPYPPVN
                     WFLDYFAQQHRVNTHGCKWNSPIRQYLQESRLEVKEIRNMHYGTTYYVVAYPEVLEAY
                     KDHETKAEQVKE"
     gene            complement(<681364..>682671)
                     /gene="MCA5"
                     /locus_tag="LMJF_35_1580"
                     /db_xref="GeneID:12982384"
     mRNA            complement(<681364..>682671)
                     /gene="MCA5"
                     /locus_tag="LMJF_35_1580"
                     /product="putative metacaspase"
                     /transcript_id="XM_003722502.1"
                     /db_xref="GeneID:12982384"
     CDS             complement(681364..682671)
                     /gene="MCA5"
                     /locus_tag="LMJF_35_1580"
                     /note="previous protein_id=AAZ14381.1"
                     /codon_start=1
                     /product="putative metacaspase"
                     /protein_id="XP_003722550.1"
                     /db_xref="GeneID:12982384"
                     /db_xref="GOA:E9AEY0"
                     /db_xref="InterPro:IPR011600"
                     /db_xref="InterPro:IPR029030"
                     /db_xref="UniProtKB/TrEMBL:E9AEY0"
                     /translation="MADLFDIWGIGAVASLIPMLANGLLLVDRPKRVDINAGRRLIHT
                     VRPIIPYRAPVPYTGGRVRALFIGINYTGMRNALRGCVNDVSSMLGTLQQISFPISEC
                     CILVDDPSFPGFCGMPTRDNIIKHMLWLTGDVRPGDVLFFHFSGHGGQAKATRDSEEK
                     YDQCLIPLDHVKNGSILDDDLFLMLVAPLPSGVRMTCVFDCCHSASMLDLPFSYVAPR
                     VGGGGACEYMQQVRRGNFSNGDVVMFSGCTDRGTSADVQNGGHANGAATLAFTWSLLN
                     THGLSYLNILLKTREELRKKGRVQVPQLTSSKPIDLYKPFSLFGMITVNASMMHCVPQ
                     QYQQRPQSLPPQVMPPATGYPVHVPPPPQGYYPPPQSPGWGLGYPVQGIPVQQATLGV
                     SRCPPSQYLPAPPPAVYAPPPPGQRGPPQPPPAQYTFSPLPPG"
     gene            complement(<683952..>685688)
                     /locus_tag="LMJF_35_1590"
                     /db_xref="GeneID:12980785"
     mRNA            complement(<683952..>685688)
                     /locus_tag="LMJF_35_1590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722503.1"
                     /db_xref="GeneID:12980785"
     CDS             complement(683952..685688)
                     /locus_tag="LMJF_35_1590"
                     /note="previous protein_id=AAZ14382.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722551.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980785"
                     /db_xref="UniProtKB/TrEMBL:E9AEY1"
                     /translation="MRSKPRHSSRLALHPIRVACAIAFIVVFLAFGYHMGVRNTERGF
                     QSRLVELRTLESELKVALRVCKSETQKLIDSERLNNNRVHAMIEAVAALEADQKTEEN
                     AYRAIEIKRENCTATLAQVRRRVEEPNEKDTLVRLEVEELKRDIDALHVFIQKITRGE
                     GMHIVMLNQGLQRLRSFYTNWCSRTPGCVELTDSELIERWGNATADEAIMKEFVARDE
                     EAQRTMASNAFPGLSANATDIVFQPTLAEEGDALTVPEAPVFFNRSIHDKPLRGMDKA
                     TMPLSPMRVTTAFERFTDYGLCAYRHHNPNFTFQSDFKYLSETMPLQVMQLSEKRKDV
                     AYLHELVASPLLRFCVDCNAATWAEHYKVACLKDRVQLHYGTHDFWAARSLIQASPSV
                     REAAFLYYKARDWHKKKILAVVLHQTFNHDRFQCDNLVDRKYGLHYQYLRANYPNITG
                     LRQHVSDDRHAQCSPLLDMVIEHIQKVRDQAPYIFDHVYLSMAEDQRSTLESLLSVND
                     VTQLRPLLLPAYTNAEAETATPGFTELVDLEIAGRATDILVNPFLSSSRYVTECFLLR
                     NKLAPGDHVWTF"
     gene            complement(<686621..>688960)
                     /locus_tag="LMJF_35_1600"
                     /db_xref="GeneID:12982385"
     mRNA            complement(<686621..>688960)
                     /locus_tag="LMJF_35_1600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722504.1"
                     /db_xref="GeneID:12982385"
     CDS             complement(686621..688960)
                     /locus_tag="LMJF_35_1600"
                     /note="previous protein_id=AAZ14383.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722552.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982385"
                     /db_xref="UniProtKB/TrEMBL:E9AEY2"
                     /translation="MQHPSYGVSLSDALVRAIRAASKPFFQIQASRYAQEANSKSDLG
                     LVSLVMKTKALVPQEKFDSSHLLPSAWSELYRTAVKELADADATELWGLVSAVLRVVE
                     QGAVDCVNASAAIVEWHSWFDDELADAGAVIRQLQREDPHADMDVVEELGSSVLGRIE
                     GAFLTGHFHAAASLMDALLLYLRRGGSALLTAEVETALANVKRLLTVTFHDPVSHQQW
                     VDAANDELQDSRLTLLAASRGSQSGNDNDSGSSAGGATVMDRLVEDLCAASLDILLLI
                     TKDAKRMCDRCLDSHRTATDFLVAVCAIMEPYAGLQRVYSLFAKYVDDWDNADGRQWY
                     YECVLAILGVGSVADMVVAMHEVATIGAETFPQAADVSSTISSEEAYDCDNDDADEVS
                     DTVSLDAVTAAAKPPSTATTRRFMLACMTAHIADLCAPAVVATSAADIHLTFCRNELV
                     TAYARLFAMHPRTWRIAGLYACYSPLNDPLFLSEIVLAIAPAAAADESVYRSLRAFFH
                     TTWSASSDHQQAVRAKLEAALPGHAAVAKWWSVMEYYYSESYRDAHRHIIMTQLNSGN
                     CVRAVWLAVQTQLTEVIESELRRQLKSNDALENAQLYAVGSAVQNGFVAVGACANMEL
                     GRYLCAAAALSAYRQAATAADASLKMLAQGQPSSLQPSRSSSGNFEFALAAAATCLQT
                     IETALKSVAECHAMVHPSTIFTLVEHGTSLLLSLRQLMRVPRTGESTGSAHVSSCVLP
                     LLIESYELASIHNVHHDPNLADRSRALAEKLAHVHQTSI"
     gene            complement(<689812..>692637)
                     /locus_tag="LMJF_35_1610"
                     /db_xref="GeneID:12982386"
     mRNA            complement(<689812..>692637)
                     /locus_tag="LMJF_35_1610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722505.1"
                     /db_xref="GeneID:12982386"
     CDS             complement(689812..692637)
                     /locus_tag="LMJF_35_1610"
                     /note="previous protein_id=AAZ14384.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722553.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982386"
                     /db_xref="UniProtKB/TrEMBL:E9AEY3"
                     /translation="MFRCEEATFYVGVALLCGVVAVFAVSRAFLYALGVLVSHVVRSG
                     CFPPSVERSVCAAALITAVVLFGNVSALLSWVVLLATVTSGALCWSRRSFRWIGVSSF
                     VFYSLALMHVVGPAFVEEVNLTRLEVSALVQGQRVLIPSLHPPRTADASPLSLPPLPA
                     LRVYSYYDKVKIEGSASPLVTSTVSAASPRLPLELPPWWTHGVRGVSVFNGSVKKCSR
                     GDRITQGAELPFPTHHIIASGDSTQLLHYTRDIDITASALAGSDSIHLVGRRGAIRHS
                     HVYCIIPDKGADPMPPPAATVPSLVDVRCLRLRDSILLRNVTIHWTAYPSLSSPPPTL
                     AEAERRADSSSSAPYAWRSLHVGVDSAQTCVEVQAQLQGELGMAVSSSLIECVDEVNT
                     AMLPPSFVAKAPLPVWLGWQLPGYVHRMHDMFLFFSSHVAAPASALVVAVCRMSYEAA
                     SALGQQCGVWLVQMAPYVKYGAEQVAVFAGGALCGSSARREALIGAEEGAVDARRAVL
                     LAMATPSSGCAAFARAHATRSAFRAGAQTRMSVVAAVSAAVDGLDLVPGVWSVYAWAW
                     RAEYRVTLWIVAALQKAFCITLCVTLQSIARLLIIAAEDWAALAPKLVVLLRCLGRGI
                     SQLRILTYFARCCTFMWALEKRVWHYEWAALQLVLTFLAVQCETVACVFAKHAVVCVG
                     WANSLVRHYNATSFSIHIAVTFLQTALLGIAMRNELHTFVVAEQQQAPARNLFSRYMP
                     SSLATWLPPSSFANHVNGLWMLVRAHLAECVRYFLLHAVAALVLIGLSVLPFASKLYA
                     LSLRYLFPWLSCQYFLTFFSPDLPAVRRVAVYFVGRMAVATVLQDTIGDFVYRVLKDL
                     VVAVGLTGGLALLLWGWPQRATLAKVATAITDSLQNTPIPPRVSVTAAADCSDAESRA
                     EEEAAEDEKARQRDVSVAKRIDLSDAA"
     gene            complement(<695208..>701063)
                     /locus_tag="LMJF_35_1620"
                     /db_xref="GeneID:12982387"
     mRNA            complement(<695208..>701063)
                     /locus_tag="LMJF_35_1620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722506.1"
                     /db_xref="GeneID:12982387"
     CDS             complement(695208..701063)
                     /locus_tag="LMJF_35_1620"
                     /note="previous protein_id=AAZ14385.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722554.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982387"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:E9AEY4"
                     /translation="MFSKENFIDLAHQAVSAVRRIVGSSESWNVRDALSATSQVVITV
                     CKANTTLDAAILEAWVNDLVRELELQSTQSAAVTETAAAGETGVAASSVKGEALKPLS
                     EPALIESLEVARELIYSCNAEEAVKAYLKKKLVAAIVQLYGNAALTQKLRDCCAYVIV
                     GVCSSQRLLMRDFMFACTDRLRSLPQDHNGRVLQILLASLLVEVFHQFQLCCYGRLKT
                     DLDAETEAHCTSLIDYLFETAYSLMVQDAAVASRTATASRTASGEAEESLESGSPSPP
                     PATHDETSTTTAAASNEDGNSGEATGSPAAPTTTVACNGNTPAASPANASLDMAARGA
                     SLNITTSVVFLAVVAGVYRARPALKTYLVRHCGAEYARVWVKVASHLTKMRTNLLLSL
                     SSRSPVSGMLEPVEYWRAEMLEGLVELCTSDSFTTQRAMVMASIAGSGRNNGSSSNRA
                     NQHGVASSTTIGASSAARAPASSSSGATGAPAGSGLSLNSAGRYQFVPIPADWETYLS
                     RSTSAVWRLASALFPCTVTSEGVNILKAVLLLLNTRHASAEALYRSTISTLTLLCVAN
                     PRNAVLLSEHQFLRTITALVNCNQPSVFPASQQVTLHFRHDEPSTSAPVAALPQTLTL
                     TPVSTLNVNTTQLTFCFLNTLTSTTFSEATVELLMQGIKDMCSMPSSQTDVDIIENFL
                     HGLSRAFIPHPLLFFPGDGCVSWRLKQMFPRGTGYTFTAWIYPTCVWTGGSCLYSFMD
                     PNDTRVSLLIVADGRQCALAVRVNKGGDDPAELVLSRSTFAATTWTHVVVNHGVALNV
                     YINGQRLEGVHDVPYPKEKHFIMFNIGGAAELPGFLGFMSGMNISVTLSEKEIAKLHA
                     AGPAFYDPSRDCASFLMPFFEDKPSAPSEPQTPSLLQQNDMITKKSAEFRWSRIELYV
                     PTDIEEMIAPSKVAEWVLGVLKGRRTASVQSTSTFLNVAKLSLSLLSTSMQLATTEQL
                     TQLMLKNYLDQLRTEVLSWKVTFPEFASLMLQSVTPRGGGKVLQHHACTQRIFDILLS
                     CVLRTRAHGSGGANGIVHHRVCASRDAIDPSDESAAGSTVASSVSVASSPCSDAAQEA
                     NAANIILRELSDCLLVKENMEMFQEDSSRFQCILNLSLYLPKECIKSVVILIEKLCRR
                     EAELRRVLLFLFTPSSVTPTADTAKVWVLRMLFDIAREEMAMCEMIQESFKSRGVTLM
                     LLLINGENHSSEAIRLLALGLLSLLMPLKSCAKLFKKSDGFDILSLALTEPRNDIPLG
                     IRTFDALFQIAFDGFRRHREKKPEADSIAARLMATAHILHRQKQRDPSSSAAAGGGGG
                     SSTSVTVASALQKGCVQRRIADFLGHTPSIMVNHLGTRRGYSFEHTHDYGRVSEDFGE
                     LVLLHKGSRYHNLHLPMALKTVLCALDYLIRVLLYRLSSAPPLVISPAAAATATAINC
                     NNITGSSTDYLATTDEYPVVPTQRHESGLLSVSARAAQMDEERVVVEVLNYLDKLIEW
                     PKHALKVMDIPWLGGLWAAVRVFFERPVDPNGTTGAVTPVQFSEPGTAPLTPSVAGTS
                     HPPSLSTLQPFEAAIRRLHQDRSEFVAEVTQRCRTVIRKMVILDISMNERAQIRSIRD
                     GEHPPRLVRIVLEEVARYFSVQKNGELLENAGTIIRNLNSLFKDVHTALHPFPPTLGV
                     AIVIAITNISVSSSMQVRRRMKNSSNLLTIRDQLAFYVLRESRRFLRLRKRSLNQLIH
                     MNVNNTNSITVLLLHLSNSIKENNVNEVEVLMPLIRHLAGSDSARLRELHTLLGDSKA
                     ARTLEELLSNSGGAIATVQSPLLLSTQTSQPTLSDHCASDVFIDADFSTGGGERTAWG
                     PSHGIGSNRLEEEGGELSPGAYTVQLLEWCKMHKEVWAAIQRNVHAAMASMGLEKSDD
                     KAQQQQVSSASGSPKASACAHVGLSDRSKREFQQLREELESELVKRKAGSK"
     gene            complement(<703636..>705012)
                     /locus_tag="LMJF_35_1630"
                     /db_xref="GeneID:12982388"
     mRNA            complement(<703636..>705012)
                     /locus_tag="LMJF_35_1630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722507.1"
                     /db_xref="GeneID:12982388"
     CDS             complement(703636..705012)
                     /locus_tag="LMJF_35_1630"
                     /note="previous protein_id=AAZ14386.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722555.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982388"
                     /db_xref="GOA:E9AEY5"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:E9AEY5"
                     /translation="MAPVNVERVCSVFHLFAVNAADAAAARDEIREPYIPVCLLAAAA
                     REMGYYPTPTTIHQFTETVPGAAAGAVTFAGFLQFCEDVAHTNQPGRSVIHRMVESMD
                     PSGSGVISRCELFLILTSGSATISDGEIDAAMKLLDPTNSGSVRLSDLEAVLIDSCER
                     QWSAFESRSSSKNQHQQKEQRQHESSVACATVAEKSHKPLHSTDITTAAVIPQAGSPA
                     PHSGHMPAQPGDQKQHPKWRRRAFNRRRYEAPPSPPPATTATEGRRPQGQGQHWCPAA
                     VSECDSFSQHTYTGSAGETVFPCHQRLCDRQDTFERTQTAMTVDVVVQLSPCQPTAEV
                     RRRKFARNSSATASNFAAQTPRGPPRCAASATAAKEAPSDKGAEDSNELCPHHSNSAD
                     ANGGARCNGGQGCESKQQKSSDAASDARGRSVLADADSPSAAEREWAMIDTIPTRKTS
                     GSKCCIMF"
     gene            complement(<706194..>707264)
                     /locus_tag="LMJF_35_1640"
                     /db_xref="GeneID:12982389"
     mRNA            complement(<706194..>707264)
                     /locus_tag="LMJF_35_1640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722508.1"
                     /db_xref="GeneID:12982389"
     CDS             complement(706194..707264)
                     /locus_tag="LMJF_35_1640"
                     /note="previous protein_id=AAZ14387.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722556.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982389"
                     /db_xref="UniProtKB/TrEMBL:E9AEY6"
                     /translation="MRSRIVRDPGVPPTLVARPEDVFEDNGSGNSSMCAHALNGFAVG
                     ERYDTAKSNAAATLPVKWDRDEALWQLKIALGVSPVLRERDVPNLANPALRAHNSAQL
                     PLQLNAGDEAAATVAQKASASDKQPPSAQEGAPRKGNRIDHFIPPVYRFSSASSAFSS
                     PLSQAHVQTALARIQDECNALMQRLGVGAATSGAEVHQANTDVPDDELQAAQLMHLLA
                     EPSTLTQLQRRADAAILEKECVFRIRDLLAAELQRRHVPLEAAQDDFHPFFEQVDRTK
                     MALEDYYHVQSAMHTMAPMMEAAVAVAECLRDVDATTSMQGMQRINAVEAAMSSLLAQ
                     VQEDMVMLPKNLEALQCRFEAL"
     gene            complement(<708548..>710467)
                     /locus_tag="LMJF_35_1650"
                     /db_xref="GeneID:12982390"
     mRNA            complement(<708548..>710467)
                     /locus_tag="LMJF_35_1650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722509.1"
                     /db_xref="GeneID:12982390"
     CDS             complement(708548..710467)
                     /locus_tag="LMJF_35_1650"
                     /note="previous protein_id=AAZ14388.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722557.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982390"
                     /db_xref="UniProtKB/TrEMBL:E9AEY7"
                     /translation="MNEAKVANILSYLDSAAVTQCEARSLRDCTLATSFSSVVPLTPS
                     VLQHVTTSSPAPSSINASPNDTPTHRHAPPRRSASPPSVGVPAVSVSWITGGGAESAQ
                     NTYLGIKKRIEGMQFENEQLRRDNAELRSRLQQWRAEEASRKEEMREAVQGEVDELRN
                     SHVQERKRAKAEKEKLEKAKEELTHQVDTLTVRLREVAAKNAEDVRRLEGTHAAALSS
                     LRTKWAAQEKVSREKWRLAEARRIKESTLQSLEPDIVLLLNRHKAEKARLREEYENEL
                     RQRDEVIAAKDASVEELKSKVRREADELLSREQEAVRDRLRDESERIHRQLEEERRLE
                     HQRREQLEHHYEDQKRTLQREIERLGKEVLRLQSEQTSEQASFHEAVTVEVARVTGEV
                     NERMKCLKEKLMLEFADREKDAKEENQRYLQSKEAEMRKKCELERDAAVTKVVQRLEE
                     EHLRALESARGSDGMLRERYIQVTREKERLQVELDLVQEQLSTALEANRSKAEELQRI
                     QDMANLSEQHISAIEDKVRSEYTKRMSILDHEWQKKLHEFETQHVKEVWELQQRHGAA
                     MQEVARLKSEFEMEKKTLEQRHHAELSQINERVLVAITKKENTIRHQSEQLLSLQEAV
                     SVRDQELQRHRQLLL"
     gene            complement(<711734..>714256)
                     /locus_tag="LMJF_35_1660"
                     /db_xref="GeneID:12982391"
     mRNA            complement(<711734..>714256)
                     /locus_tag="LMJF_35_1660"
                     /product="mismatch repair protein"
                     /transcript_id="XM_003722510.1"
                     /db_xref="GeneID:12982391"
     CDS             complement(711734..714256)
                     /locus_tag="LMJF_35_1660"
                     /note="previous protein_id=AAZ14389.1"
                     /codon_start=1
                     /product="mismatch repair protein"
                     /protein_id="XP_003722558.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982391"
                     /db_xref="GOA:E9AEY8"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR013507"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR014762"
                     /db_xref="InterPro:IPR014790"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR028831"
                     /db_xref="UniProtKB/TrEMBL:E9AEY8"
                     /translation="MITRLDGASARKLAAGQVITDLTSVVKELSENALDAKATTVTIR
                     LINYGLDEIVVDDDGTGISMGQLVNTAANELLDGASTPLLSSRATTKQRRHDLDGCTH
                     ATAKDEADEGRTSQDESACVAEAEGDSSDPSLGFRGEALHSLAHMSDVTVETRSADTG
                     ALTVRISYDHTSHTSRLEAVRLRDVCGTTVTARHLFKHFPVRHREYVKNCRKQLSKAT
                     STMKQYAVSHPHIRLLMQHQETPNSAVVTLVSLTGSGDATRSVTEAYGGLCTSHMQRV
                     HWSLSFGTFTGLVSKVSGGGRLSSDHQVFALDGRLVDLPRLGKALNDAFIQCLPNASQ
                     RLYVAFFLQVKRNASLQYDVNLTPNKRKVLLAQEERLADEVYQCALQEFGSALQEVDL
                     DRGQRIAQTRAADVRATELTRLTRTPVSATSLTQLTFKRAKMEETYTGGRVAAGALDA
                     HSGESHLSPTAGSSSVIDLPKLGSFLYANDAADNNGAGTDGDGERDESTPLLLPSSPS
                     SISGGDGDDEDSKESSRSAVEDKGKGSDPPALKSTADVDDHGDCCCGRYLADNAEGMR
                     SDSVAVEVTRLCDEGSQRRGGGSCYQCTYPDLGELVREPFSADPADAVVLSASTQTCD
                     RPSSRTLGAQTADDLNHYFTKNSFKEMRVIGQFNHGFIIAVLPNGDVFVVDQHASDEK
                     YNYERLVRAYEATPQPLVMPVSVAMSAHEVDLAVEHKLALQHHGFKVSRGSDDTKLLV
                     YSLPVLPYDVVSASDVMELVQQLVQYGTITKPLRAVWHSMATKACRSSIMIGTPLTVK
                     RMKLILERLSQLDQPWNCPHGRPTLRLLCNIVDLSRGGALLR"
     gene            complement(<715444..>715875)
                     /locus_tag="LMJF_35_1670"
                     /db_xref="GeneID:12982392"
     mRNA            complement(<715444..>715875)
                     /locus_tag="LMJF_35_1670"
                     /product="putative 60S ribosomal protein L26"
                     /transcript_id="XM_003722511.1"
                     /db_xref="GeneID:12982392"
     CDS             complement(715444..715875)
                     /locus_tag="LMJF_35_1670"
                     /note="previous protein_id=AAZ14390.1"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L26"
                     /protein_id="XP_003722559.1"
                     /db_xref="GeneID:12982392"
                     /db_xref="GOA:Q4QAC5"
                     /db_xref="InterPro:IPR005756"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="UniProtKB/TrEMBL:Q4QAC5"
                     /translation="MASIKCGSRRKARRAHFQAPSHVRRVLMSAPLSKELRAKYNVRA
                     MPVRKDDEVIVKRGTFKGREGKVTACYRLKWVILIDKVNREKANGSTVAVGIHPSNVE
                     ITKLKLTHHRKSILERKDRSSKSDKGKGKISAADKAMQQMD"
     gene            complement(<716834..>717670)
                     /locus_tag="LMJF_35_1680"
                     /db_xref="GeneID:12982393"
     mRNA            complement(<716834..>717670)
                     /locus_tag="LMJF_35_1680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722512.1"
                     /db_xref="GeneID:12982393"
     CDS             complement(716834..717670)
                     /locus_tag="LMJF_35_1680"
                     /note="previous protein_id=AAZ14391.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722560.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982393"
                     /db_xref="UniProtKB/TrEMBL:E9AEZ0"
                     /translation="MGLQIIEGLGGSSRCVTLLTFVIHFLHSLFSLVSFLSWVQTPES
                     QLTHSTQMAYLSLTIVCCLFYFLGASVFYMWAWRFPEPEEVAKRRRVYGVGIHLFFCD
                     LPIFVIETRIVWRVQFPAAIMGFNYVLTCVSLSYSTLRVWFFLMVRLIKLHLSTARSV
                     GANHTTQTALAVRRAMDEPDYTGDLGATPPSTAADHTIFLNRNAGLHSNDRVSATRLY
                     ATPDTDRDRRDVYYGSSPSRYYSPSSDDLSISQRPSQHGYRRSPGTNVFSPRSAAPPF
                     RI"
     gene            complement(<718343..>719479)
                     /locus_tag="LMJF_35_1690"
                     /db_xref="GeneID:12982394"
     mRNA            complement(<718343..>719479)
                     /locus_tag="LMJF_35_1690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722513.1"
                     /db_xref="GeneID:12982394"
     CDS             complement(718343..719479)
                     /locus_tag="LMJF_35_1690"
                     /note="previous protein_id=AAZ14392.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722561.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982394"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:E9AEZ1"
                     /translation="MGAPLAALQTALSTTSTDGGDAPGAAPPLSALPTVRLLNLSYNS
                     LHLFTGGETLKGLTVLDLSHNTLTQVHSQSMPPTLVRLSIAHNKLAHLCDLAEYTPRL
                     QVLEAGHNQLSTAALRGLPTSLTHLSVENNTIESLTPLGALLHLTHLNVAQNQLESRD
                     TLCALRPLVSLRHLDVRGNPMCETGRRSSEGENEGVTQLLHDVLPRLSRFNGVPLSQV
                     PENRMWKKAHRRQQQQQNTKFSAAKSRGMSHDARGGSGSSSSSSLLSSSQRQQQRLQE
                     PALEVRLMQAKVNELRRLLLASQDAEGKARQKRALLIENVKSTAKVIGQQETELERLQ
                     GEVDSLRSVNQKLQSSVAAAEQSFEHVHASLLASKANLSAAGVK"
     gene            complement(<720580..>721668)
                     /locus_tag="LMJF_35_1700"
                     /db_xref="GeneID:12982395"
     mRNA            complement(<720580..>721668)
                     /locus_tag="LMJF_35_1700"
                     /product="putative RNA 3'-terminal phosphate cyclase"
                     /transcript_id="XM_003722514.1"
                     /db_xref="GeneID:12982395"
     CDS             complement(720580..721668)
                     /locus_tag="LMJF_35_1700"
                     /EC_number="6.5.1.4"
                     /note="previous protein_id=AAZ14393.1"
                     /codon_start=1
                     /product="putative RNA 3'-terminal phosphate cyclase"
                     /protein_id="XP_003722562.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982395"
                     /db_xref="GOA:E9AEZ2"
                     /db_xref="InterPro:IPR000228"
                     /db_xref="InterPro:IPR013791"
                     /db_xref="InterPro:IPR013792"
                     /db_xref="InterPro:IPR016443"
                     /db_xref="InterPro:IPR020719"
                     /db_xref="InterPro:IPR023797"
                     /db_xref="UniProtKB/TrEMBL:E9AEZ2"
                     /translation="MLHFEGSSLLRHHIVCSILSKRPVRITNIHDDEDPMGIQAHEAN
                     FLKFIDRVTSGSSLQCTDHNTTLQFTPGMILGGSFSHEVPSQRCVTYVIEAALLLLPF
                     AKFDSRITFVGATQGELDLSVDTVRTVTMRWVQLFGVQGSLRIIRRGAAPGGGGAVEL
                     DIKAIRRLTSATTKERGRVRRVRGIAFASRTAADLPQRTATAAKGELLKLLPDVYVVT
                     DVDNSKANRNDRVSGYGVVLVAETTSKLCVISQESVAMPQESPEDVGKRAAQLLFDQI
                     YEGGCVDAHHQMLVLLLMALSPDEISTVRFGQLSASGVSALMLMDSYFGVSCAVKPDS
                     SFAGPNLPLTTLVTCLGSNAVNVWKKSS"
     gene            complement(<723951..>725285)
                     /gene="CYP14"
                     /locus_tag="LMJF_35_1720"
                     /db_xref="GeneID:12982396"
     mRNA            complement(<723951..>725285)
                     /gene="CYP14"
                     /locus_tag="LMJF_35_1720"
                     /product="putative cyclophilin 14"
                     /transcript_id="XM_003722515.1"
                     /db_xref="GeneID:12982396"
     CDS             complement(723951..725285)
                     /gene="CYP14"
                     /locus_tag="LMJF_35_1720"
                     /note="previous protein_id=AAZ14394.1"
                     /codon_start=1
                     /product="putative cyclophilin 14"
                     /protein_id="XP_003722563.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982396"
                     /db_xref="GOA:E9AEZ3"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:E9AEZ3"
                     /translation="MLRSNVGVCSRVGVARVRFRVCQLLPSVSVASVRPFGTSTSPLL
                     AGLRLSALRFDSRSIGSKLPANIDRVSSDDGEKGDGGGAAVDGNDMSKPASAEDGAEM
                     AVVQKDYGEENSDEGFHEDAIIVKDEKGNSITRIRRLPLTLIEEVPLPQRILTDLELV
                     MMAWCEEHARQYALFMTAIRIGVFVLLLIILYVFYQTTLSSERVVRGVDKMPADLRIG
                     SVVYFDVTENGTDIGRIVIGLLNEDCPLYCEYFHRRCTGNGGKGNSFRGMPLAAIVPR
                     HCLIFGDGQEMEHDVPGFNSHYLPTEHLSNGAWRGALSSIAYGPNRESPNFALHISSG
                     DYKPQVFAIVIGGYNVIERMNNAGSKHGNAPKRNYVIEGCGELCTLAKSHIAPMPWKL
                     YESVSVGYDDEKFGPRLSADVLKHSDEIGAAAVETQQGGGSAQVRKRKWCFF"
     gene            complement(<727034..>728152)
                     /locus_tag="LMJF_35_1730"
                     /db_xref="GeneID:12980701"
     mRNA            complement(<727034..>728152)
                     /locus_tag="LMJF_35_1730"
                     /product="putative casein kinase II"
                     /transcript_id="XM_003722516.1"
                     /db_xref="GeneID:12980701"
     CDS             complement(727034..728152)
                     /locus_tag="LMJF_35_1730"
                     /note="previous protein_id=AAZ14395.1"
                     /codon_start=1
                     /product="putative casein kinase II"
                     /protein_id="XP_003722564.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980701"
                     /db_xref="GOA:E9AEZ4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9AEZ4"
                     /translation="MSSKSSPKSPASDGAHRYAHVNVNKPSSYWDYDSLRVQWNSPDR
                     YEVVQKIGRGKYSDVFLGVDTKVPRQVVIKVLKPVKKKKILRELMVLQTLKGGPNIVD
                     LFDVVREPNSKTPSFVFEYVKSCDFRTVFPTFTDLEVRSYIFQVLMALEYAHSHGIMH
                     RDVKPNNVCLDYKTGKLKLIDWGLAEFYHPATSYNARVASRYFKGPELLIELPMYDYR
                     LDMWSLGCMLAAMIFIREPFFRGKDNTDQLVRIVKVLGTDDLQVYLKKHNASLPPVLE
                     ATLGYHAKKPWRSFVNGQNEHLCPPEALAFLDKLLQYDHMKRIQAAEAMMDPYFDPVR
                     PKDFTLDGITVADENGGGGASICNEESEHEKRAPRIES"
     gene            complement(<730400..>733894)
                     /locus_tag="LMJF_35_1740"
                     /db_xref="GeneID:12982397"
     mRNA            complement(<730400..>733894)
                     /locus_tag="LMJF_35_1740"
                     /product="putative ubiquitin hydrolase"
                     /transcript_id="XM_003722517.1"
                     /db_xref="GeneID:12982397"
     CDS             complement(730400..733894)
                     /locus_tag="LMJF_35_1740"
                     /note="previous protein_id=AAZ14396.1"
                     /codon_start=1
                     /product="putative ubiquitin hydrolase"
                     /protein_id="XP_003722565.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982397"
                     /db_xref="GOA:E9AEZ5"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR024729"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:E9AEZ5"
                     /translation="MLAVLDVAKHVFWNDTAFNRKLLPSEAALEKCSYTIADLTTMTG
                     KERISVFKQCGVDPSLFPLFLRSLQHITALHGAGKIEGNYMIHRHLSARQWSPLYANT
                     PLLGYASVNSLSYREQCSSAAKETKRDDVADLERGRTCHSHYNGLLNQGATCYLNSLL
                     QALFHITAFRAIIYHMPTKDEAEQHADLESTVSRSIPYALQRLFCHLQMSTRAVGTRE
                     LTESFGWGASDSFIQHDVHELTRVLLDNLEEKLNAQQAETGNPTPKENAIHRLFTGSL
                     ESYVKVEEANYYGSREEPFYDLQLVVKNKKNIYSSFDAFCQVEVLDGKNKYCLECNGK
                     KSYHRAEKGVRFKTIPPILLLHLARFDYDIQQGETKVLTRWDYYNTLDLSRYMPESPS
                     TDTHYTLCSVLVHSGSNTGFGHYFCFLLCSGAWYKFNDEAVTPAKLKEVFGDNFGGFK
                     LNYWGSEIPNTANAYMLVYIRTSQLSSILCPIGSNDVPQHVVQQLERERVEHERRVKE
                     QAEDYLYGRVHFILPNEIADQEEYLTSRRPAAQKFSSHKTLRILLDDEALPAFEGFVK
                     RQLGVDAEQLLLWFASSRTGGSEIRLSQQVRANMKVRQLLQNAKECCVLVTTPATATV
                     IELDQGCASREYQVFHHKLYDPLQLKVLFLGCTVLHRDPNGDAKQALESMELHVRALI
                     ADLPDLTKQLHGHHLTKPPKAKQTLPSKPRSAASLEAYRSNQDLSSRDEAETTEVKRG
                     MPQEALGVVRETEASEFLPCTELHSGDILIWKLDTPNEDPANIFYPDIQSYQNFLLHR
                     IPVELKLNRYPDYPLLIATELAEDMTYEQLQRYVARLIGDMENYDRVRFTRHNPETEL
                     PYFMKGKKHDRATLARLLMPASSRVPALSKYLYYEYCKYTVTEIENAHSLQFKLYGDN
                     VKVVSTHWILLPHDLPITADLLFPACVREIQKDYAAGACPAVAALLKEDPQNTSNNSS
                     IAFVKRLMQMDCKSAHEWLRLVDVWRGRVYNILDKNHTLVFEHNTFEESAEYRIEHLP
                     APIPGVPSSDQAVFQVHHFTMVRQRRDAIETHSEPFSMYINFYETSNQLLRRIAAKLE
                     MIYAAVQDWKVCLVKESRVEVIAPDALMGAHITNFCLPECYQPNQIEPSKAAFIGLEH
                     APLSKRTGKREEKVLILN"
     gene            complement(<734435..>734794)
                     /locus_tag="LMJF_35_1750"
                     /db_xref="GeneID:12982398"
     mRNA            complement(<734435..>734794)
                     /locus_tag="LMJF_35_1750"
                     /product="dynein-associated roadblock protein-like
                     protein"
                     /transcript_id="XM_003722518.1"
                     /db_xref="GeneID:12982398"
     CDS             complement(734435..734794)
                     /locus_tag="LMJF_35_1750"
                     /note="previous protein_id=AAZ14397.1"
                     /codon_start=1
                     /product="dynein-associated roadblock protein-like
                     protein"
                     /protein_id="XP_003722566.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982398"
                     /db_xref="InterPro:IPR004942"
                     /db_xref="InterPro:IPR016561"
                     /db_xref="UniProtKB/TrEMBL:E9AEZ6"
                     /translation="MDLFSNCRVTGHRSSFHSTRKAMSEIAEMFQRISQRPNVTGIIV
                     VDSEGTPIRSTIEDTTVQNQYAHLITSLAAKARHCVRDLDPTNDLCFLRIRSKKNEIM
                     VAPDKDFILIVIQNIVE"
     gene            <737822..>738244
                     /locus_tag="LMJF_35_1755"
                     /db_xref="GeneID:12982399"
     mRNA            <737822..>738244
                     /locus_tag="LMJF_35_1755"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722519.1"
                     /db_xref="GeneID:12982399"
     CDS             737822..738244
                     /locus_tag="LMJF_35_1755"
                     /note="previous protein_id=AAZ14398.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722567.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1755"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1755"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982399"
                     /db_xref="UniProtKB/TrEMBL:E9AEZ7"
                     /translation="MLRTRLSLAPMLSKATRLQLGNIKTEYGTVSTAAGSVEKWGFLF
                     GGNMYPIISISFSIFMVCATVVVVATYQQYRDMAMATEHISYEDVKDRCLTPMPGWAR
                     LRSFSMATPQGPATFRDPTPLDWLPFELKLGYVKQSSY"
     gene            <738965..>739705
                     /locus_tag="LMJF_35_1760"
                     /db_xref="GeneID:12982400"
     mRNA            <738965..>739705
                     /locus_tag="LMJF_35_1760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722520.1"
                     /db_xref="GeneID:12982400"
     CDS             738965..739705
                     /locus_tag="LMJF_35_1760"
                     /note="previous protein_id=AAZ14399.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722568.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982400"
                     /db_xref="GOA:E9AEZ8"
                     /db_xref="InterPro:IPR006773"
                     /db_xref="UniProtKB/TrEMBL:E9AEZ8"
                     /translation="MIPPPVFSKPPELQFRAGKMKYTGGMVTADKRKGYLSFFSSAST
                     VEMIWASESEKSAPIVLPRGKTTVSFVTQCKTGRVFLFEVKENDEKKQYFFWLQDKSE
                     QKDSTYLAGLESMLAERMANNRPKTTVNLEDFKKILASVSKSKKDVKLTDVLSSSIVA
                     EELSSDPAYYKAKLMDYLPRDGGELDDILFQVKNPQVSQATALLEAALQDPTTYKQLC
                     TLFGVPDTDPNGGVLAFLNGIIAAAKKP"
     gene            <740154..>740789
                     /locus_tag="LMJF_35_1770"
                     /db_xref="GeneID:12982401"
     mRNA            <740154..>740789
                     /locus_tag="LMJF_35_1770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722521.1"
                     /db_xref="GeneID:12982401"
     CDS             740154..740789
                     /locus_tag="LMJF_35_1770"
                     /note="previous protein_id=AAZ14400.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722569.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982401"
                     /db_xref="UniProtKB/TrEMBL:E9AEZ9"
                     /translation="MMRQSTRLWQGIQPELHRYSHATFHEGTHRQAPGDSTPWRDVSS
                     PVNRFRAWWLAPAAKGSVIAAWCLTCVISAYCFSIQQDAKGTYLLNNVLLRNLHEESQ
                     RANANEGRAGELQEAMRQYLSEEKSRKRSAAKLEEYVASSEKMKAGIVNYELELVRER
                     GRADATHERNQQLLKELMSVRREMAQVQKDNATLVIEVEKLQRLLKRFGQL"
     gene            <741222..>742880
                     /locus_tag="LMJF_35_1790"
                     /db_xref="GeneID:12982402"
     mRNA            <741222..>742880
                     /locus_tag="LMJF_35_1790"
                     /product="putative DNA polymerase epsilon subunit b"
                     /transcript_id="XM_003722522.1"
                     /db_xref="GeneID:12982402"
     CDS             741222..742880
                     /locus_tag="LMJF_35_1790"
                     /EC_number="2.7.7.7"
                     /note="previous protein_id=AAZ14401.1"
                     /codon_start=1
                     /product="putative DNA polymerase epsilon subunit b"
                     /protein_id="XP_003722570.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982402"
                     /db_xref="GOA:E9AF00"
                     /db_xref="InterPro:IPR007185"
                     /db_xref="InterPro:IPR016266"
                     /db_xref="UniProtKB/TrEMBL:E9AF00"
                     /translation="MREPKDEIRKFAQAYKYNLKPLAVSRFASFLKRYGTGEEHRRDL
                     LRDLFSLIGEQCCDNRLVDELKADAVISLQEAKIKGCLGTDGSSSVQVVSLGAVPKVF
                     VDEVSNELRVSSSSAALNRLQCLNQRYTLARRRCLRCGLYQKSVDQRSPHDGSLALLP
                     TSALEGLDPGLQVAVLGLLVVRDDEVFLEDLRGQIKLKFSEQSRVTQHCFVGNGFLTV
                     VSGLWVNGILQVTRVDLPPAERREVTLRDAGSGMDLFGLAPRNPMEALREEKKRVQSV
                     IIVMAHVHLDKAGTMSKLARFFERMQGLSESELRDVTFVFTGDFSSVPLHFGDASHLP
                     DIFDNSDRLQILLDGLGRCIAANAPTAAQHSHFVLIPGPSDMTLLQGFQPQTPIATQF
                     AKGVESRTKKLTVAPNPCRLRFYTHEVIIARRDFLRDLQRGELLYPWDRYRTKERTDA
                     ALDRGAPSGAGAAATTSFERVTKTLLDEAHLSPSIDEAVLWGADDALRIPVLPHTMLL
                     CDSTEQWECHYKGVHVVNPGSFAVNGTFLWYTPADGQCSLNKLE"
     gene            <744312..>745310
                     /locus_tag="LMJF_35_1800"
                     /db_xref="GeneID:12982403"
     mRNA            <744312..>745310
                     /locus_tag="LMJF_35_1800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722523.1"
                     /db_xref="GeneID:12982403"
     CDS             744312..745310
                     /locus_tag="LMJF_35_1800"
                     /note="previous protein_id=AAZ14402.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722571.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982403"
                     /db_xref="InterPro:IPR005636"
                     /db_xref="UniProtKB/TrEMBL:E9AF01"
                     /translation="MKRPRGGYTDSNDERADKVHAFIKSLHFSVPLYRLREQQDRREC
                     PKCHKRRLFYCYDCLTTVHPESHPPPLALPLNVYVVLHPNELRGKSTSLAASTISPDL
                     HIAEYPAVPEQLEPELTLVLYPSEQSVELHEVEHLDQYKNVVFIDSTWQQSKAIARDE
                     RVSKFKHVRIKSQTSLFWRFQNNDPTYLATVEAIYYFLREYITQVNRLKAQLEHSSGS
                     LSPPPPAHQVESKDSKTSTSASSEMTPKTTDGLASSADATAFYHGEVDDLLFYYINQY
                     IGVQQRYTSGNLNKYTDRHFSGYIIQNTSWDELVAPPPADSNTSEKVTEPPRETVE"
     gene            <746367..>747752
                     /locus_tag="LMJF_35_1810"
                     /db_xref="GeneID:12982404"
     mRNA            <746367..>747752
                     /locus_tag="LMJF_35_1810"
                     /product="trypanin-like protein"
                     /transcript_id="XM_003722524.1"
                     /db_xref="GeneID:12982404"
     CDS             746367..747752
                     /locus_tag="LMJF_35_1810"
                     /note="previous protein_id=AAZ14403.1"
                     /codon_start=1
                     /product="trypanin-like protein"
                     /protein_id="XP_003722572.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982404"
                     /db_xref="GOA:E9AF02"
                     /db_xref="InterPro:IPR025593"
                     /db_xref="UniProtKB/TrEMBL:E9AF02"
                     /translation="MPPKRKSAMRSGGAAASASPMAAPHVDGKDIWLATDALQKTNAM
                     RNYFQLERDRIIAFWNISKRELEGIKESIREKEQEKAEQAERHEVEKQIFKQKIRHLL
                     YENQVQLSTMKEETQRALTSREEEYRTKESTAARNLRDTKLADRELEVRHLEQQRALL
                     TQQDKEIAEQQSNFEREIKEMHLRYEDLLKSVREEMDEARKEELGRIEERKEKHIAEL
                     RETHERTFNEIRDYFSEITSNNLETIRTLKDEVHARKRTETHNERAMYEVAQRNKRLT
                     EPLAKLENQKKVLGLELENYLADKEALAEVKRSVKDTQQEIQTVSWEHEVLSQRYAKL
                     VEDRDIILKKYNAMLQDIQRKSAFRRVLIQKKLELVQTQLEGRDAKLTELLKRANVNP
                     DDLKELEQKVHDLISEKDKTIEDLKQLLFRLTTQSERVVATYESYMENNGVSGWVGTS
                     GAASGAASIRA"
     gene            <749127..>749948
                     /locus_tag="LMJF_35_1820"
                     /db_xref="GeneID:12982405"
     mRNA            <749127..>749948
                     /locus_tag="LMJF_35_1820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722525.1"
                     /db_xref="GeneID:12982405"
     CDS             749127..749948
                     /locus_tag="LMJF_35_1820"
                     /note="previous protein_id=AAZ14404.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722573.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982405"
                     /db_xref="InterPro:IPR008610"
                     /db_xref="UniProtKB/TrEMBL:E9AF03"
                     /translation="MPVYDIAARKRKNLLRRREEEAAHAEDDKDHSPDEDEEKEDFED
                     DEYVDSDEEVEEMEEVPPKAPAASKKEAADAASKPAATAACATRVEFSEPAQWVERMA
                     LTSTRSLPSDLNADDDPKREEAFIQQTLLSVTRGISLLEEANVPWKRPDDYYAEMYKS
                     DVHMNDVRQAMEASKARIEAQAHRRSMKEQKKYGKEVQAEVLRQRARYKRDMQESLSD
                     WRKKRRGNGSLQDMLNDDDDVDRDAKRSKAQRTPRVRNLRPGGNKRPGKNARRRR"
     gene            <751835..>754054
                     /locus_tag="LMJF_35_1830"
                     /db_xref="GeneID:12982406"
     mRNA            <751835..>754054
                     /locus_tag="LMJF_35_1830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722526.1"
                     /db_xref="GeneID:12982406"
     CDS             751835..754054
                     /locus_tag="LMJF_35_1830"
                     /note="previous protein_id=AAZ14405.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722574.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982406"
                     /db_xref="UniProtKB/TrEMBL:E9AF04"
                     /translation="MPSESCRWYPDTVTHHKQGDSYTVSRGRNCNPFDLATCDARITE
                     YARANCHEAKATAVINALHPQFRGLTHGVSCEFLLRSSITQLGVNAVNVEIEIDPKQR
                     RAVVKMDLVALTPLAVLMLDYIVVGAHVGKLFALESNRVVRNTDYITRLLHAVNQRGQ
                     PLLVYGTDEAPNWDLKIVDGRVVAYLPVLPGTFTYSGEIHGLLPTIGMALRKGTAYKD
                     LIRLHQEFHEGYTRVAASSGVLMVRGYAMHFRTVFGRVVDSLLPKGLHSMSSRLIEPE
                     EGLADASARERVLVFYGDSIDDLTHVPIEFYTLESYREQVPFSLRKTLADRCSTTSSI
                     LRAFKSAPKGDLPCCAYVCKGGQFTEMHADDWIVTDPKQTTYVGIENPVVQQELVQRY
                     TYQQCEYAILSAIAIGDITSDGVLFTRYFPSPCLKSLILSRAVCKKLRAIFFTKASRH
                     YGSFFSQDDAAMLGDLNTFGIAVFEVNEQKGEVYQYIRRPGRDAGAFVPLERRQEYVN
                     ATFFGVYGSNLVAGDFEAELMTLLSGILHIKKTCQHPLLKDTKPVALVTGGGPGAMEV
                     GNRVARSLGILSCGLIVDFGSVAAKPGSTINEQNQNPYVEAHFTYRADKLVERQSDFN
                     LDFPIFLTGGIGTDFEYALEEVRRKVATVPPNPVILFGTPEHWGAKISGRFQANLHSG
                     TIRGSEWICTVPWVVSTGAEALEVYRHFFEGKLPVGPNKPTNDRGFMVAAEYLAKAK"
     gene            <755337..>755801
                     /locus_tag="LMJF_35_1840"
                     /db_xref="GeneID:12982407"
     mRNA            <755337..>755801
                     /locus_tag="LMJF_35_1840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722527.1"
                     /db_xref="GeneID:12982407"
     CDS             755337..755801
                     /locus_tag="LMJF_35_1840"
                     /note="previous protein_id=AAZ14406.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722575.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982407"
                     /db_xref="UniProtKB/TrEMBL:E9AF05"
                     /translation="MKSIMLSGLHFRGWIVMSSISVLVFTAVAVPAAYIPKTFWRTIY
                     VAVVTPVVWVVYNVALYFVLCRPMVHCTSMFSRGECCKTKHADDTGDATLLTKEMYQL
                     SNVLHSLKCETAEMNAATTLINNQLDGKTAEQSPQKDAYSSITALTPTMRSP"
     gene            <757120..>757770
                     /locus_tag="LMJF_35_1850"
                     /db_xref="GeneID:12982408"
     mRNA            <757120..>757770
                     /locus_tag="LMJF_35_1850"
                     /product="putative ER--golgi transport protein gp25L"
                     /transcript_id="XM_003722528.1"
                     /db_xref="GeneID:12982408"
     CDS             757120..757770
                     /locus_tag="LMJF_35_1850"
                     /note="previous protein_id=AAZ14407.1"
                     /codon_start=1
                     /product="putative ER--golgi transport protein gp25L"
                     /protein_id="XP_003722576.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982408"
                     /db_xref="GOA:E9AF06"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR015720"
                     /db_xref="UniProtKB/TrEMBL:E9AF06"
                     /translation="MGRRGSTSGAAALTAALLVLVLVLSSTVNGFVFQLESGKSRCFL
                     QEVASGTDLRVVYKADDTYGDFLDVVLTNANGHALYRELGKSSGAFLERITNGGEYSL
                     CFTSRQGAQSAKMTRSLLLVMQLGADTKDYDTMATKEKMRPMEVQMRMMEDTVQEVHN
                     EFIYFRAREAEMRNTNEHMTAKVMWMSVGLIILFGVFWYLQMRHLKRYFKKKRMID"
     gene            <761465..>763192
                     /locus_tag="LMJF_35_1860"
                     /db_xref="GeneID:12982409"
     mRNA            <761465..>763192
                     /locus_tag="LMJF_35_1860"
                     /product="protein kinase-like protein"
                     /transcript_id="XM_003722529.1"
                     /db_xref="GeneID:12982409"
     CDS             761465..763192
                     /locus_tag="LMJF_35_1860"
                     /note="previous protein_id=AAZ14408.1"
                     /codon_start=1
                     /product="protein kinase-like protein"
                     /protein_id="XP_003722577.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982409"
                     /db_xref="GOA:E9AF07"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9AF07"
                     /translation="MPTGASASGGPFFQNGVNRTGNGTTRKNGMTINGIQNSSMMGGR
                     NEVTVKSAGNSVTQRVANLPTLPSTSASMQGLQSDFYSMPPPPMIHAGFQNGMMMPAY
                     SGGYRQLSANGVRGTYRELNETGESGKVSTVHADDGKMRDADSVTPSLSPNSNAQNRC
                     NVNTPPLAQADECTGLTPTPPSLRFLTSYEEEEVKDYLPSVYFGGTEHCKKIHGVRGT
                     EKNDGYDDDNFHYRVVVGDHLLYRYEVVKVLGQGTFGIVVRALDHKYHRLVAVKVIKN
                     KPNYTKQAREEIKTLELLNRDDPDGETNIVRLLGSHIFRKHYILVFELLPSDLYAIIQ
                     ANKFRPMSHDFIYELSEQLLTALVHVRDHKIVHCDLKPENIMISRRGGNSNSLSELSD
                     FSLKLIDFGSACEESRPLFTYIQSRYYRAPEIVLGIPYTTAIDMWSFGCVLCELANGY
                     PIFPASSEGELLERIVEYFGTIPSYLVRQSRRADRFFEDGQMKHNLSKKRVPHVPHSR
                     TLRNFLKIGRSHEDQLFEDFVSKCLHLDARQRLTPEAALEHPWMEFWRGTSSGGSTAS
                     LSDSCSLSR"
     gene            <769871..>772090
                     /locus_tag="LMJF_35_1870"
                     /db_xref="GeneID:12982410"
     mRNA            <769871..>772090
                     /locus_tag="LMJF_35_1870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722530.1"
                     /db_xref="GeneID:12982410"
     CDS             769871..772090
                     /locus_tag="LMJF_35_1870"
                     /note="previous protein_id=AAZ14409.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722578.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982410"
                     /db_xref="UniProtKB/TrEMBL:E9AF08"
                     /translation="MLLQDDLIAQQFAVIFRVAQLLQQAAFSTAVSKRTYSIGAVREV
                     GGAEVSALVPLPGLKIDVSDGGLAAAQARTTSHARLRSGARTNAADRPALQKPLQLPL
                     VNTDESVATLRQLGGILNEVARQLQASVDAQLVDFYVHLGKKANATLPAGAGGPKEWA
                     TPARGSPQERLASPLILRPSSRQVPQSQRGDIGSPFRLNDEKGGASGTESAQPCATFL
                     LDADGAQKASCAKDAAAGAVVSVTATPGVDTGRVEGPVIPSISMSAPRSLTAQQPQRG
                     AHSRVGTPSGLQNAPMTRRLEEERAAASELQSFFSLLLEAALRLTGASAAAVYMDDAP
                     QFAAGGTVGPSSRPATSTAAVSATASSGRAQFLHCVAHSQGHFPSSISYAVSNVLTTV
                     VTTGVAVNVHYSESSLLRLGIGRSSGPGDLDSARHSTAAGGGGITATDGARTRPRSDS
                     SGCSHRTLLDMYNGIVVPIKGIGCLVLANKAKTTAFDVTAPRFSIFDEHVAWSAALLS
                     EAVLHRYERQLLLRVAWSPSCASALRPYIQENWPLHKSASPLSSRNGLPTMRERRGLQ
                     RRMSSNHLFSRASNAATKLSAADVDNAAVSALVFDPQNDIFSKTLTMVRTGDPKVLKA
                     LPPELRASSSVPSCRRPVNSVISAVAAEAAASGPSAKLNDEEVFHAAAEYITNLESLW
                     RRTISESNTMHTMVERYNKEMRKQEKTIALLEAKVRELSLHMTQLERRGNFARLNAV"
     gene            <773948..>774865
                     /locus_tag="LMJF_35_1880"
                     /db_xref="GeneID:12982411"
     mRNA            <773948..>774865
                     /locus_tag="LMJF_35_1880"
                     /product="putative 60S ribosomal protein L5"
                     /transcript_id="XM_003722531.1"
                     /db_xref="GeneID:12982411"
     CDS             773948..774865
                     /locus_tag="LMJF_35_1880"
                     /note="previous protein_id=AAZ14410.1"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L5"
                     /protein_id="XP_003722579.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1880"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1890"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982411"
                     /db_xref="GOA:E9AF09"
                     /db_xref="InterPro:IPR005484"
                     /db_xref="InterPro:IPR005485"
                     /db_xref="InterPro:IPR025607"
                     /db_xref="UniProtKB/TrEMBL:E9AF09"
                     /translation="MPFVKVVKNKAYFKRFQVKYRRRREGKTDYHARRQMVLQDKTKF
                     GSPKYRLVVRITNKDIIAQIVQAKIVGDEVVMAAYAHELPAFGIEHGLTNYAAAYATG
                     LLLARRTLAKLGIADKFQGAKEADGSYSAVRTKKDDEGDDEERFPFKAILDVGLARTT
                     TGARVFGVLKGAVDGGMAVPHRPNRFPGYNKEKSSLDAKVHRDRIFGKHVADYLKQVK
                     EEASSNPDEKCVQFSKYMAAKVLPESIEGMYKKAHAAIRADPSKSLPKKAKKEGVAHK
                     SYKTKKLSGAEKRAAAKAKVAAIRERLGK"
     gene            <776043..>777029
                     /locus_tag="LMJF_35_1890"
                     /db_xref="GeneID:12982412"
     mRNA            <776043..>777029
                     /locus_tag="LMJF_35_1890"
                     /product="putative 60S ribosomal protein L5"
                     /transcript_id="XM_003722532.1"
                     /db_xref="GeneID:12982412"
     CDS             776043..777029
                     /locus_tag="LMJF_35_1890"
                     /note="previous protein_id=AAZ14411.1"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L5"
                     /protein_id="XP_003722580.1"
                     /db_xref="GeneID:12982412"
                     /db_xref="GOA:E9AF10"
                     /db_xref="InterPro:IPR005484"
                     /db_xref="InterPro:IPR005485"
                     /db_xref="InterPro:IPR025607"
                     /db_xref="UniProtKB/TrEMBL:E9AF10"
                     /translation="MCTLANWVRAIIKKHSTLAHTLEMPFVKVVKNKAYFKRFQVKYR
                     RRREGKTDYHARRQMVLQDKTKFGSPKYRLVVRITNKDIIAQIVQAKIVGDEVVMAAY
                     AHELPAFGIEHGLTNYAAAYATGLLLARRTLAKLGIADKFQGAKEADGSYSAVRTKKD
                     DEGDDEERFPFKAILDVGLARTTTGARVFGVLKGAVDGGMAVPHRPNRFPGYNKEKSS
                     LDAKVHRDRIFGKHVADYLKQVKEEASSNPDEKCVQFSKYMAAKVLPESIEGMYKKAH
                     AAIRADPSKSLPKKAKKEGVAHKSYKTKKLSGAEKRAAAKAKVAAIRERLGK"
     gene            <777989..>778906
                     /locus_tag="LMJF_35_1900"
                     /db_xref="GeneID:12982413"
     mRNA            <777989..>778906
                     /locus_tag="LMJF_35_1900"
                     /product="putative 60S ribosomal protein L5"
                     /transcript_id="XM_003722533.1"
                     /db_xref="GeneID:12982413"
     CDS             777989..778906
                     /locus_tag="LMJF_35_1900"
                     /note="previous protein_id=AAZ14412.1"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L5"
                     /protein_id="XP_003722581.1"
                     /db_xref="GeneID:12982413"
                     /db_xref="GOA:E9AF09"
                     /db_xref="InterPro:IPR005484"
                     /db_xref="InterPro:IPR005485"
                     /db_xref="InterPro:IPR025607"
                     /db_xref="UniProtKB/TrEMBL:E9AF09"
                     /translation="MPFVKVVKNKAYFKRFQVKYRRRREGKTDYHARRQMVLQDKTKF
                     GSPKYRLVVRITNKDIIAQIVQAKIVGDEVVMAAYAHELPAFGIEHGLTNYAAAYATG
                     LLLARRTLAKLGIADKFQGAKEADGSYSAVRTKKDDEGDDEERFPFKAILDVGLARTT
                     TGARVFGVLKGAVDGGMAVPHRPNRFPGYNKEKSSLDAKVHRDRIFGKHVADYLKQVK
                     EEASSNPDEKCVQFSKYMAAKVLPESIEGMYKKAHAAIRADPSKSLPKKAKKEGVAHK
                     SYKTKKLSGAEKRAAAKAKVAAIRERLGK"
     gene            <779757..>780359
                     /locus_tag="LMJF_35_1910"
                     /db_xref="GeneID:12982414"
     mRNA            <779757..>780359
                     /locus_tag="LMJF_35_1910"
                     /product="putative ribosomal protein L15"
                     /transcript_id="XM_003722534.1"
                     /db_xref="GeneID:12982414"
     CDS             779757..780359
                     /locus_tag="LMJF_35_1910"
                     /note="previous protein_id=AAZ14413.1"
                     /codon_start=1
                     /product="putative ribosomal protein L15"
                     /protein_id="XP_003722582.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982414"
                     /db_xref="GOA:E9AF12"
                     /db_xref="InterPro:IPR000439"
                     /db_xref="InterPro:IPR012678"
                     /db_xref="InterPro:IPR024794"
                     /db_xref="UniProtKB/TrEMBL:E9AF12"
                     /translation="MYLNELWKKKSSDVMRFIQRIRSWEFRHQHTVVRLRRPTRPEKA
                     RMLGYKTKQGFCVFRVRVRRGGRKRPVHKGITYGKPKTSGVLGMKLNKNNQAVAEQRL
                     GKRFGNLRVLNSYWVNMDSTFKWYEVIAVDPMCKTIRRDPRINWIVNSVHKHREQRGL
                     TSAGRKHRGLRHKGHKASKLRPSYRAAWRRNNRIVFLRKR"
     gene            <781365..>781682
                     /locus_tag="LMJF_35_1920"
                     /db_xref="GeneID:12982415"
     mRNA            <781365..>781682
                     /locus_tag="LMJF_35_1920"
                     /product="putative 60S Ribosomal protein L36"
                     /transcript_id="XM_003722535.1"
                     /db_xref="GeneID:12982415"
     CDS             781365..781682
                     /locus_tag="LMJF_35_1920"
                     /note="previous protein_id=AAZ14414.1"
                     /codon_start=1
                     /product="putative 60S Ribosomal protein L36"
                     /protein_id="XP_003722583.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982415"
                     /db_xref="GOA:E9AF13"
                     /db_xref="InterPro:IPR000509"
                     /db_xref="UniProtKB/TrEMBL:E9AF13"
                     /translation="MSAPTPRTGIIAGFNKGHVTTRRPRQPSPNDRLAVPHKHLRAVK
                     AIIADLVGLSPLEKRVQEFLRVGKEKRALKYCKKRLGDFTAAKKKRAKMEEALRHATK
                     KHH"
     gene            <782328..>783347
                     /locus_tag="LMJF_35_1930"
                     /db_xref="GeneID:12982416"
     mRNA            <782328..>783347
                     /locus_tag="LMJF_35_1930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722536.1"
                     /db_xref="GeneID:12982416"
     CDS             782328..783347
                     /locus_tag="LMJF_35_1930"
                     /note="previous protein_id=AAZ14415.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722584.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982416"
                     /db_xref="UniProtKB/TrEMBL:E9AF14"
                     /translation="MRMHQKKAARTHTHMLDPQAADLVDAVARLCVLRTEDYTLLRTV
                     YRRAREHAHLEQPQETTPNPLHSTPESVGEAPDAKECEGDASGAGNEAYIRYLTEEVR
                     VREQRRVTEEGEWLGAVRQWAARFQARQVVATQDKELGAAPDESASLAVPAIWWFWEQ
                     GSEDAFQRVYAAVLQQAYELDRTDLVNTPFAHIDKSKCLYDHGEAAAAAVASVPVSSS
                     QVERVHALFFPSSRAAEPSTSPSRIWAEMHPIEVDASSVHEGRRSRLQASRHVWLVFF
                     FLWSHIVAASMTTSAGAAAAAREVGAEPLFYESVLLGPARDFLTSQSQQLQSLLRKQK
                     TTTYA"
     gene            <784190..>785536
                     /locus_tag="LMJF_35_1940"
                     /db_xref="GeneID:12982417"
     mRNA            <784190..>785536
                     /locus_tag="LMJF_35_1940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722537.1"
                     /db_xref="GeneID:12982417"
     CDS             784190..785536
                     /locus_tag="LMJF_35_1940"
                     /note="previous protein_id=AAZ14416.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722585.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982417"
                     /db_xref="UniProtKB/TrEMBL:E9AF15"
                     /translation="MASTLVSFTPATAGVLGGVHSVDAQLSDTPESASAPCFYCLCSV
                     CGQWLAEVPTVRCDACGSRTHITCARDVYSNEWLYNEVAVASTAATSAGGGTLGLPNA
                     ASVAARNRRTQYIGREPRNSEDTAGSPTPAAVLTAPSGLSVSPPLSRDSSHTSLLPSP
                     QVLRSAAAKIDKEYNYYCHPDCAMGMEVLRNPQFNATLSCTVEHAFAREWARTRESLV
                     AVGVLRDHKHEAGALDDAAAEEQAPLPSYSPVKSSSAPVKVEGAEESTAASSFCPSPP
                     PPNATASSSVPAGDMHGCAPHASEANFPDIAACHPAVALEVLRLYHQLRAEAWAEYFE
                     QERHHFGHPLFYPPPFLDIARDAALGHVVEAASPQGQAARLYLLDRSTHPVGSAVAIP
                     VGVLTRWQQPTEAPLIKENDSNNFVAEALDRLVNDAVAPETVVVYRKCSKEGLVLV"
     gene            <786259..>788121
                     /locus_tag="LMJF_35_1945"
                     /db_xref="GeneID:12982418"
     mRNA            <786259..>788121
                     /locus_tag="LMJF_35_1945"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722538.1"
                     /db_xref="GeneID:12982418"
     CDS             786259..788121
                     /locus_tag="LMJF_35_1945"
                     /note="previous protein_id=AAZ14417.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722586.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1945"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1945"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982418"
                     /db_xref="UniProtKB/TrEMBL:E9AF16"
                     /translation="MSECTVYSPCGRYVVRFASDAEQQLLRLTVTGNTSRPSKGDASA
                     ADGSGCVKTLVAAAAEPLTSSSALHPLRLVASLTETDVLALTTSAGVRKSFAKFAQML
                     YDALIGRSPCVHFFVETVAEMKERIQRDVQRQATPSRTARGAEARPPSRRRAGELDID
                     SAALASLAVTLNDVTANADKGCVRTAVGDTVIELDEDIASEVLEQRFLTLDYDVDFTR
                     AIFPIPLHTGGSEGASSEGAGGVLRARTGTASASPANLAEATLEPFVVSTSLPAAAAE
                     ADTLRHDLLRARSRLAQLESENAKLRRENEALVQLSRHKMNEMQRLCEDFQQQVQLAA
                     DAEKLRARNKELRVQLQEALESQRTARRTLERGRSQRRFSQPASTVTGGGGSAYLSAS
                     GQRRSENPYLRSLSRESDDGYAGVSSRPPHGRQRSAGSAASRASATLRGRMLASPALP
                     PAALRGSHVQCAPSSSSTNWRRSTRFDTPPPPPLDPAASTATAFLQRRSRSHRGDGSS
                     STRDGDGDSPAPYGRTGGRLEKVRKPQRRGSSGSGSHGSRASSTRSLPRRGRSLWGDS
                     SAHASPCGSVASSRCSSASHERLYRTATASSRMHQIPKSHPLDSATALRRAVFH"
     gene            <788865..>789572
                     /locus_tag="LMJF_35_1950"
                     /db_xref="GeneID:12982419"
     mRNA            <788865..>789572
                     /locus_tag="LMJF_35_1950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722539.1"
                     /db_xref="GeneID:12982419"
     CDS             788865..789572
                     /locus_tag="LMJF_35_1950"
                     /note="previous protein_id=AAZ14418.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722587.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982419"
                     /db_xref="GOA:E9AF17"
                     /db_xref="InterPro:IPR010591"
                     /db_xref="UniProtKB/TrEMBL:E9AF17"
                     /translation="MLRASRVPRGYFKRPGRKSLDEVCKQSLFEMSTPQQVATIWNNH
                     HMQFLQYWGRTISSEAYYALEPRLKASPYFVVPVFRDKGLFNVVTNFKDDLVGVTPLA
                     EWQKKQDDAQIHMTIQFFTELARSKQLVLVRCEIKDEVFKRLDCIFITQMLLKYYTFP
                     RLYEAWVETFNKRPGQFDYHAFLRAMKDEAGKDEIRIEDKKSEMRHDAFGPVIDTPPD
                     AVAKQIMNTLDIGVPKA"
     gene            <791149..>791784
                     /locus_tag="LMJF_35_1960"
                     /db_xref="GeneID:12982420"
     mRNA            <791149..>791784
                     /locus_tag="LMJF_35_1960"
                     /product="ribosomal protein L32-like protein"
                     /transcript_id="XM_003722540.1"
                     /db_xref="GeneID:12982420"
     CDS             791149..791784
                     /locus_tag="LMJF_35_1960"
                     /note="previous protein_id=AAZ14419.1"
                     /codon_start=1
                     /product="ribosomal protein L32-like protein"
                     /protein_id="XP_003722588.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982420"
                     /db_xref="GOA:E9AF18"
                     /db_xref="InterPro:IPR005269"
                     /db_xref="UniProtKB/TrEMBL:E9AF18"
                     /translation="MPSLIPDYQRTEKRAVAVFGWSRTEVGTPRWQQAEDVGRLAAQN
                     GFTVITGGYGGSMEAVSKGAREVRDAAAAGSAAASAEVVGIVVSGLFPDRLTEGNKYL
                     TKLLDSTSMLHRIEQLTTQSRYFIVLPGTTGTLQELVTIWVQKTIHPSDLPMPVIVAF
                     RDPWEKCCHGIIESLQLSSRQANAIHFVDTPEEAMEWIVKDATGEIDDSRA"
     gene            <794575..>795573
                     /locus_tag="LMJF_35_1970"
                     /db_xref="GeneID:12982421"
     mRNA            <794575..>795573
                     /locus_tag="LMJF_35_1970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722541.1"
                     /db_xref="GeneID:12982421"
     CDS             794575..795573
                     /locus_tag="LMJF_35_1970"
                     /note="previous protein_id=AAZ14420.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722589.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982421"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR006577"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:E9AF19"
                     /translation="MLVHEVEKTYKLKVPFFQGTLEEAKRHAQQDSRYLVLYLHSPRH
                     ENTEAYLREVLATDEIIALLHESSVLFGVSVADTEGTLLAEELGAHAFPFVAALVGNT
                     VVLRLQGYHSRETFRREWRLCTDDWDGQLAEGIVLAAEREARERARIAEAEADSAMEA
                     ADRAILEELLRKDEEERRAAAEREAAARRAAEERAAAERLKAEDEARQAAEAARQRAL
                     EEERQRQRESAKQAAKSQLHDEPSTDVATSETVQISVRCPSGKHYDRRFLRSDLVDQL
                     TFFVLTLDEVADATDASTVRFVTGFPPAPLVWREGETRFGDVKSLCPRAVVLLRRL"
     gene            <796427..>798196
                     /locus_tag="LMJF_35_1980"
                     /db_xref="GeneID:12982422"
     mRNA            <796427..>798196
                     /locus_tag="LMJF_35_1980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722542.1"
                     /db_xref="GeneID:12982422"
     CDS             796427..798196
                     /locus_tag="LMJF_35_1980"
                     /note="previous protein_id=AAZ14421.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722590.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982422"
                     /db_xref="GOA:E9AF20"
                     /db_xref="InterPro:IPR009003"
                     /db_xref="UniProtKB/TrEMBL:E9AF20"
                     /translation="MLRRSSVVLARFQPYSMAVQTRFKWRHKETDRWRRLMDATCFQV
                     DWLGQTAGPNFAQYSGHWTHVITCAHVITPWDYPNYYPPQGPTRFVSHITLADTMTQI
                     RLVSMQGNAVYKHFTSNQHVFVHSNPRLDLCVLHPEQNLKRSGEMKMMWMQNEGYISR
                     PRLEINETLKVGDYVWVYGMSAHESLFDEEKGPEPLMIPTGVRARVHAVTREHFFLDT
                     TALEDNPDRGRIQMGMCGSVVMRNGKCVGMLTATVHEESDCKELAGTAMCTYSSDVFE
                     FLLEVEKQMKNPVARQSQEETRFEQRRRAEGGVKEHKHWELDESRTARHIPVPVSLWH
                     MEEKWVTEEDYMNSAVFGRSGAFNQETQESALGYDMNTAKTNGDRPGDIDSFMSTTTT
                     GKPVMQGERKDYSPTGVYANVEEFKNKDVWDYNVSSEMRSLFNETVDSKDAESLNMMR
                     KSLENIRAQRAMEKMKETVMNRTEPGFDPLKGYGHYGGSADAGAANFNPEYASAHKGS
                     GDAYSYAQAAQQAAREQPGDHASPASTPPPSPPPPNESVIDRKKRERREAEAKYQEEL
                     RRRHGQRAVPFGDEDLSGFWERR"
     gene            <799366..>802554
                     /locus_tag="LMJF_35_1990"
                     /db_xref="GeneID:12982495"
     mRNA            <799366..>802554
                     /locus_tag="LMJF_35_1990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722543.1"
                     /db_xref="GeneID:12982495"
     CDS             799366..802554
                     /locus_tag="LMJF_35_1990"
                     /note="previous protein_id=AAZ14422.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722591.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.1990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.1990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982495"
                     /db_xref="InterPro:IPR013949"
                     /db_xref="UniProtKB/TrEMBL:E9AF21"
                     /translation="MARARAIETRLEKLVPALDEYYTSGFLTREETVEVSRQRQHWEF
                     RLVAKPLLLLDVRGAITYELGLEKRLREYCIYTKLNLQHRWDIVDRIEGIYKIGLKHL
                     RNKAEHEALRQECVLFMKRFQRNGSLSNLYGELMVMHPRRSDIWVEAAEWQGFSQRNT
                     DNARAIIQQALLTMSSEPVVWACALRVELQFVQRLLEGLLAEHREEVRKARKRAAKAA
                     EDGDEENRADDAVAAAEGEEATSAIAPKLRAENEDMAHVLLDLALAKTVVEEAFDSPA
                     SGAVLLEQLLADAGAYAFAREVVELAVTTAARKMAEACSGSADVTVEAARVCGARGAS
                     ASSSLTIASDQQRLRVRTQWRHRHSIDTVFAHYLALEDLAMNRYTTAIVDTTTYLANG
                     GSGSVLSSKRRDQQGQQQQQPTAGALPLTPSREDRRRAAVKAVVSLLVFSFTPMSALA
                     ELPGIVAADTDSTKRFPAVRRAFAEALRRVAAVSAEGVSRVCTHLLRTPATAAADTAA
                     STTTTNKSKRRDLRQTHTTLDIAVAAQWLLGQLQLDKATLQDCVTEPRERTERLLREV
                     ASAADMHPPAKSRARHEALAGTAGAAALMTWSVVQLEQFLQAEDRDALVQGACGGVGG
                     SASAPPFSPLKTAAAMTTEDVERFIVWWKEEEALLRGQQEEGGDSGDALAASRTRRHL
                     AAMKLLHQHGLLPSVDMPASAEKNSSGNRRRVPKSGSSDAASEDAWAKAKDVLLNRSS
                     ALQFVPVAGTTAPARLPLSLWRVFSALEKLECPTQLRAKAPSAQAAVSRSGRSGSDSD
                     EDCDSETSGKGVAARCKYAASSSSSMQLSSFAAAGLYFLSGVPHSALSREEEWVRLEG
                     VTSLLRCRLFSWLGRRVCTRDTVAETLQRAESNLAEARIADVQGLLTLAQRCQPLPRF
                     AQTHCVLPFLEGVALFRSACAPATAVSTRAGNVSLPDKVARDAVQAAREAYEALLQLY
                     SVSKHPESFLPLVYDGTSAKKLAQQAGTTSSACFKASTAEVQRANAEDWVAYVLFERT
                     VSKDLLRAKTVVEQARRASLAPQVFMARLNAL"
     gene            <803756..>806500
                     /locus_tag="LMJF_35_2000"
                     /db_xref="GeneID:12982496"
     mRNA            <803756..>806500
                     /locus_tag="LMJF_35_2000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722544.1"
                     /db_xref="GeneID:12982496"
     CDS             803756..806500
                     /locus_tag="LMJF_35_2000"
                     /note="previous protein_id=AAZ14423.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722592.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982496"
                     /db_xref="UniProtKB/TrEMBL:E9AF22"
                     /translation="MLGRKGHWQAVLCIRRPRFLTGGFHSSPPSSLQRVQGPCLDLAA
                     APAAHESLAQSPALAEVDIIHSTASLAVVLAAPSANVLATRTKPATPTQETLRHALGT
                     RDAYRIFCALVREQQTSVGASSGELERLLSNIEGEADSFAAAACACVAVALSPSDWPP
                     WVSARFAATGTAAMPIAHSRAPVDTGKVAGADEAAKEVRDVWAAASPLRVTAAGILRR
                     IAARLPTQGACRSASSPSLPLLKWLTLLCGVALAPSSKTALRLAAEASRVSLDAAGVA
                     LAAFCASHSLTAERSKDDCASFAAGHTRETWWLSLWMQLTQPSAQPPSLPLFSLDAVA
                     ASPAVVVWSSGLMPADLREKRVSWHLHCLIASKEVHSAARLLAGACRDTPKALCGATI
                     PVLASTQAELLSSFPPQLLEEGRLGEKLAMNLVEHLKHMQSRPRRPWSGFPQTLSFVP
                     TVAVNAVLYARMLQYLLTSSAQVRSRDSYVHYLHNLSLLLSQSSIYALAASLVPADQP
                     LKTVMVAAKDTYREVHMKQLVGAVRQVVDSLCEEPIPCLPAPAATDAVAENGVASTRR
                     ALKTGAALSSDGVAPAKGKRECKAARLEEEQALLERAAANSSGAASWRWREDALSEVD
                     GTVQAAVRLLTSLLELCSSRKNSLPLRVAEPKWRRELRERTAVRAHKFELLLQELPHA
                     ELRAVLQTLLGHGYIREGSQLGVSLVKGDQVDLRYYTLPLLGSLYLAVCAPPGSPTPA
                     PVVASSTSSPSSSAPPFADAEAVTESEKQAVYRMYRRRLEIYGNADLKVTTPSYAPAR
                     DRHIRGGVEGEHHDGVAAPTRHDSEGSAAAATTALVRTPENKLVQALVLASMRPATSL
                     ASYATAELANCLLNRRVDVAGRGMVVDVGSAGIYQDHSTGRGTGAVFGPWLRTGVVTW
                     "
     gene            <807975..>808724
                     /locus_tag="LMJF_35_2010"
                     /db_xref="GeneID:12982497"
     mRNA            <807975..>808724
                     /locus_tag="LMJF_35_2010"
                     /product="putative 40S ribosomal protein S6"
                     /transcript_id="XM_003722545.1"
                     /db_xref="GeneID:12982497"
     CDS             807975..808724
                     /locus_tag="LMJF_35_2010"
                     /note="previous protein_id=AAZ14424.1"
                     /codon_start=1
                     /product="putative 40S ribosomal protein S6"
                     /protein_id="XP_003722593.1"
                     /db_xref="GeneID:12982497"
                     /db_xref="GOA:E9AF23"
                     /db_xref="InterPro:IPR001377"
                     /db_xref="InterPro:IPR014401"
                     /db_xref="InterPro:IPR018282"
                     /db_xref="UniProtKB/TrEMBL:E9AF23"
                     /translation="MKLNIAYPRNGTVKQFEISDEVLRRVQLQDYRLGNEVDGAIFGS
                     EFKGYIFRLRGGSDKDGFPMVPGVLASSRVSLLVKRGAIGFNTFRGYQGERRRKNVRG
                     CVLASDIALVNVTISKVGDQPIEGVTDTTAPRRLGPKRASKIRKLFNLSRTEDVRKYV
                     VRRRVVKSGKKDRLKAPKIQRLITPRVKARRAKKAKDAIAKVRASAAERREYLRLIAS
                     NRRALRQRDHSKKHTRKVHAQRAEVAAFQKK"
     gene            <810615..>811724
                     /locus_tag="LMJF_35_2020"
                     /db_xref="GeneID:12982498"
     mRNA            <810615..>811724
                     /locus_tag="LMJF_35_2020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722546.1"
                     /db_xref="GeneID:12982498"
     CDS             810615..811724
                     /locus_tag="LMJF_35_2020"
                     /note="previous protein_id=AAZ14425.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722594.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982498"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:E9AF24"
                     /translation="MFVRNMNGELSSTWRYGGAEANTMGVNVATFGATGILGHHIHAV
                     NCYHGYTSILPFRFRSGMPSSVRQMRSSGDGTVGQNFDTDYEVDKEFVVKAILEKVDN
                     VVNVVGAWQEPACYENSQSWFSMEAINVEWPRMLARWCREMGILKLTHMSMVGADLNS
                     PSKLLRQKREAEIAVLEEFPTATIIRGTDIFAENDFSYSKYLKAQRYLKIVPVPNRGQ
                     RIHQPVFAGDLAEAAARSLLLDHTEGRIAELGGPMRFTTNDLLRWCSECNNQRHLTVH
                     LPRIFFDIACHINERYPIHQGALLGTKAPAWNKDWVDRQFIDNCAMPERDPDLLDWED
                     FGIPREDLYRMEEKYFITSVMWSKCAPYLDYGYRM"
     gene            <813678..>817940
                     /locus_tag="LMJF_35_2030"
                     /db_xref="GeneID:12982499"
     mRNA            <813678..>817940
                     /locus_tag="LMJF_35_2030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722547.1"
                     /db_xref="GeneID:12982499"
     CDS             813678..817940
                     /locus_tag="LMJF_35_2030"
                     /note="previous protein_id=AAZ14426.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722595.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982499"
                     /db_xref="GOA:E9AF25"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR007110"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:E9AF25"
                     /translation="MPSCVFTRTQVLESLSDEDARQEAESIPEFIYFFLRDVFLAVDE
                     DGDGYVTGDAVSRLFPALAPVRATKDAASCPAASSLMTPTVHPTWWSPTSYVAPTRCA
                     AASQQRPLDLCGFMQTYWPMVSDKMAHFVGDTWSRHSSDNLSDSRGQRASVNQQPILS
                     PSPFRDVSASPLREQPTSPLAAFVTGGRLAPSPVCGSSPLMERETVSPEQHRLYREAV
                     RCLWTSSCPLSPHALTPSPAPSVPSPMLLPCPQRLLTESDMEELLVAFSYLDRNHSGY
                     VGVADVAAALRSLLRAAACAGQAIVSTDTPAEVSDEVLQLANAMLRMALSSTTTADEA
                     VATQGVPASSAPSSSSGSPAVPSSSRSSPCVSWTAFARSFQCDTGAFPAELIAWCAAC
                     ARASRELPARALATSPQWMSPVECAYVQQLLVSYVDLLCAEKGSVSPHPSSTATEKAQ
                     PVPAAALSPRLSVNTHFTKKPPQSCGSAGTCGDRRHSRYVCQTHATAAALQQWCQCAN
                     AQAKHLAESDMNTVPLTLLEASLRRDLQAFLFPKAFEFSAAAGAALAEVLEHHVQAVC
                     ALAQGAARLPALCHSPNARMEGKASALRGLAGHCWESVHVDLDKLVDVITADPRYLQL
                     EVLVPLESRLTAVVDAARHHPRRLVEEAVRLISVFVHSARLGDSELADVLELRRALST
                     VSPSLARLITGATSFCEGRLRLEECMITISTHVLSVPPPLPVAVFPAFAGSVLPSAPV
                     TKHDDAVMALCDHPCYAMLQDTRLLKASHGWLRYACRRMPPREQRTVIDALRLSCGSS
                     SRGGSLFEAAARGFGVILDARLDNREQQRSLSACDVYSAMLPRVRASCWVCRMDPVVA
                     AHATLVLIAASGSADMTDLTEESVWWAGVHTLLGQWVHAQHSRRCLLESADAWAMDAI
                     KCTAAELGLPCCRAVSQVLSHLPVASSTASRVVVVEEEELTQSLSCVVESLSLWATPP
                     SANPEWQSSSAAACARLVDTLVGSCPRRDSTRVDVSALLRRWLEAYPLPLPVTHVSLC
                     CAVEEVGSVYYTLKRLAASEEAQRRRSETPAGGAAAPPRTVSEGRATATAASRQVSSA
                     PVVTGISPVCLSELLENEDVLLALYAVSPAEAVGVWGGALCHLGALLRPVLLSSTGVR
                     VSLYKLSGRSSESEGAVATAVPSSTSSPRPSKAISHRNGGQSSLADAILSMAVPASLQ
                     HAVAQLFACVDVEGTGAVTEDQLRSHRSRVPASARYGWHRFVTAVCSSSAMTSLPSSS
                     SRTTPCSLISGGLSAGVLRSHWWSRRRRAAVATLSCAGEAQPQAEQASCSSVATQRTD
                     DDVVTTYSLGDMLMRMAELRVCVQAQLLEESSTRAKAEASVFVSRKSGLALTRAITDA
                     DSPLSTAVGQKAAVSSPPTAGTAQWWATYLEELCRSYSPLAL"
     gene            <819239..>830560
                     /locus_tag="LMJF_35_2040"
                     /db_xref="GeneID:12982500"
     mRNA            <819239..>830560
                     /locus_tag="LMJF_35_2040"
                     /product="putative ankyrin repeat protein"
                     /transcript_id="XM_003722548.1"
                     /db_xref="GeneID:12982500"
     CDS             819239..830560
                     /locus_tag="LMJF_35_2040"
                     /note="previous protein_id=AAZ14427.1"
                     /codon_start=1
                     /product="putative ankyrin repeat protein"
                     /protein_id="XP_003722596.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982500"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:E9AF26"
                     /translation="MSAAHQVSSFLEIPTKKETDAALVTMEAPSDFTPARAPILCLVC
                     TATACGSQLIATINVTLDTTLAEVRSVLVSLAAGGDGGPAAVKQPPTNVSAKQAHMIV
                     SSPLHPFNFTETFSFVHCGGCRAYARAKEASLLIEDVLPRYPRFGVPPASLSAREGLS
                     SSTAVLGTATAGSRRRVCTSSCTRWLPDAAPPLVVVAHPRQQKGRRSHRRHQRVSHQA
                     DEKGTSVLDVPRMPRQKRYALAALFVTPGDHAEGGLRAERVVAERLQLQLPDPLRGLG
                     AAVSGPGLFSSATLAANYGRPFRLETWCCGVTRWNGNTEDFLGRTLLHEAAQVGNEAA
                     VHFLASQPYVAVDAAERQSGCTALQLAVLGNHVGVVKVLLEEGGANPLISNRAGDTSL
                     HIALERRRAVLVGLLCARLRALQVPPAALQEESMRNSISYTPVELFRLYSPSLGDLCR
                     DGASLLAVKSLVHHYFFSPDEVTTRDAFSGQSVLHAAVAGSGLDVVRYVAEDLGLAAR
                     LSVPGGPYADLLFDYRRQTPLHVAAATGEPACVQYLLHNLPASCLTQPDVNGSTPLLA
                     AMKARRWRVVELLLAQCPPGTLAAAVQDRSGLSALHFACSLGMTRVAAILLQHHSAVA
                     AQRSVAARPSSSFSSASSMTADEQWGSHWENIALVRHSALRGRLRKLEEREIRRQAQR
                     QQRSAAASGSLTSHSGRSYCPLAEDADPVAAVKAARQYPYGGARRGYTPLRCALLYAV
                     RRGNGPATVPADLLRVLCEYGALTAETADDTRDLLFYLLTHRSDAAAEPLLAWVTERC
                     AAAVAVLRRDNVLLCRFCALGDAIGVRWCVEKQLCDVHATAVNPLVACAAAGDAAAAA
                     FLIKCAGADVNAMAGHESALAVALREGHEEVAQVLILNQAALSSRDGSWTALQQATSS
                     NLESVVRGLLGSCAIDPFHVSRVLLRTLQGLVYERPSRRRERSRLASYLARACDPLAF
                     EVHPTELLHLSAAVGCFDVTLALAERLQALPKTVWAELLATAPPPPPRPTTLIAPTLV
                     PLTIKAPRLLPNRLTGRGGLYCPPKPFYRLVVPTVRRATVVTLLHRVKVRDVYSYAVE
                     AGQIDLVRSLRYSLHLPPWPLRDVRGWTVTDYAMAHHSRSRASLVALFIAAGIAPATR
                     HGRRMLHSSGDDALVAAVHYAQQQRWKTAAALQCVAKTASDAGAEERHAGEQAAMAAL
                     ELVADTLFCLVNASAEKRVSDGGTATVRCVLDAFLETRHLSDFHHVPCAWLGRVVVAC
                     AAAGRLDVLRLLKEHYSVDLAQDWCNGASLSPLSASGTQPTPLLMAVHQRHSDIVTYL
                     LKAGCAVHERSCPTAAMTAHVPLGNIHASLISPLCLAAWKRDYVLLRLLLAGSPPLRA
                     EDTEEEVGRSVGDVLRGLVMSAPPGMQREAEAALADCVRALATAGHPLRFAGTVRVAA
                     AKGLVQVAQALVECYGSAALLADLAVSLDGRDAEAEEDAEDAAAPRVRGQLTALAYFA
                     ADARLVPALRALLVERMVDEYQLESWRPTTLAATVQALCRKAGRRGARVTAAAVDYAL
                     WRGCADGAVVLLALGLVGRGVAPAPRPPCGAGSAVTRVSARALSLCLHLFSVLRLWHK
                     RCGQYKSYTVLHSAAELGYGDVVSALTAEMMGLHLPVVGSDGNGSVLSYSNTRATVTA
                     PSLYALAATHADGWRWFPYFERVELVLDPRTLYIAARDMFALIFSDFGVSQTVDRVCR
                     RAAQHKLLGDVFSVFDSAGTPAAASASLGDMRNPGALKSVADIGGAPAATRGCAVSAS
                     FVSRQLQLRPAAFFLAGGTYVLTSLTSLTCAIAAGSLEWVQYIAVQGPSLVYHRATAT
                     RLSTAADRRATTKERHAQLQATMVAGNRPRPWHLRQGSTRRPHRCEARLDDRRSASAA
                     SAHIADGVCSMGALTLCMAMLAEAHLRRQGSAMAQTYEDILTHLLSWPGATPRKETIN
                     LLAIVAASLRRWPLLMLIMQQADRLYAAGLLTGMDDAQEQQCPSALPRYLFPLLPEEL
                     PAVLAHVIGSARHVMHAVARWAPKDVLIEVTRHCQRSDVEAAADARGCTSVYHALHHR
                     QPFALETFAALRVPMGQPCRKRQCQTPLMVAAARGCTAFVVALLKPHRVNQRDREGRT
                     ALMLAAAHGHRATVEALLAANADVSLGDSCGRTAVMLAALGGYDDLAVQLVQNFCHAG
                     DLMSAQTSVLHCAAVGGCWRTTAAALKLAVPPGAQLMGGCAEAFALLALREDMDGHTP
                     LHLAHAFGSARVLHELLQVLFNFCEEGGTVQGLLARLSTHGGGSIEKRLLLCDSTLQQ
                     YGWLRGVLEVNAALQEKVRQGYEQSPAARGLKAGEVVFQPFAPPLRSAASLLLWCVQT
                     SNTVGLRVLADYNVADDCGVLHVAAANGSLNVVKLLVQLEMSDPSMQDARTGRYAFEW
                     AALHENAECASFLLTHTALDCAALLDSCMSENDNGAMGTEEVPPETNGGWTGEDASGN
                     APRAGDSSSAASSAVPLLHVMAGHCGGQLLLQFVEQILYTAARTYMVPSTRHGGASGE
                     QSGAEVMSLVLYRALQRPAGPSRLTPLEYAIAVGDPAAVLHTAQVLQRLQETADALKP
                     ALSSSVRFAPMGSGRSNTAGAVRWDGEEGVASLQPSDHASTTRNGAVFVSKSFLSWVP
                     ILSPAVRAILFDVLGMWEVASVAGFAPQRHVAQTSLTTPPTDGGADANCERKLQQSLS
                     LQQRGEDEAAAAATTKGTVSALAGTQRVRFSDVRLLGIHMLQQDDYCAELLHDFLTPD
                     HEREVLRLLLQDFPYKIRYEPDSYRQCSLSTQTQLLRWLGTSLVLGTYDVPPPSSVPT
                     TSWAAATGAEREKVATVDSIEIQVVPHRGEEFVELNGTALSHSLYLSTAQHALAIPDV
                     MARLPRTLCTQREVWRAELAAVSARATRLLQRQAHPVLQRSTVTVDWNLSMMSSDGTT
                     SVSADLDGYGAVFVRVCEALRTFMDWVRGQLRSLLAEVDAADLAAVVVGVRQGGMAGL
                     QVRFRYVTEEHAVTRFPAAPTAAASTALMFKSAAYPSCCIEFNEVTHTDVMHVCQATI
                     GRAIAADVALVRVHHTRDRFLQVVHQLLSAPKGVAVVSTTPPRHVDVSKENGRSAAAD
                     VSPSPPRDAEELKKSRRTKSACGLATPPLSSELLRFKLELEGTTLDAMPVQEFERLLL
                     AETAAAIDAVVSPWPRAASPSRKSTADAPTKAYDAFHSAAILSAALVRRLRSVLVLFT
                     TRREAMVRLSSDKLMLCFTADETPSRSDIAAEITRTLVQEECDVYQRRLAEVYEMMTQ
                     RLTAYLPQAKLVVDVEAMQRLAGDDAHMLSAMRLLVHQQSEWVLQRLVEGVSIGWDTE
                     LGAVVRRHVLQVTLTLDPGLYGTCYLSPDGVFAYYCPLLCLERQPPGALTPSSLPSWQ
                     LLSSQHIASLLLMQLAVREPQVLQFVDRKRSVACWTTARRIPRRILPGRPVVIEVQAR
                     NLFNRPLRRGGERLLLMGEVEKLRVEDAGKGRYMIRFDSPQRAGGHRLFILLHGQPIA
                     QSPMWYTVWPGVVDLCRTRVCDTFNAVVIGVPFTVLLQLRDAAGNRLLAAPNGLTVAC
                     ASPASMVQLQTWGWKGPGRVAVTLRVLPAVPTKTALIISLKLTCQSAAAGATADGAVC
                     TATVPLPAYSCVDSKTYQHVCRVRRGLIADSGSPIRHQSPCAYPGMGPTPHTAPPQPS
                     SLYFRQATRRAVRRKLAKAAAALGGALSYRYPRNAAMKRLQMRTKLAALKGSGGTRPR
                     AKPVSNSGSAAVTPTTA"
     gene            <831570..>831971
                     /locus_tag="LMJF_35_2050"
                     /db_xref="GeneID:12982501"
     mRNA            <831570..>831971
                     /locus_tag="LMJF_35_2050"
                     /product="60S ribosomal protein L32"
                     /transcript_id="XM_003722549.1"
                     /db_xref="GeneID:12982501"
     CDS             831570..831971
                     /locus_tag="LMJF_35_2050"
                     /note="previous protein_id=AAZ14428.1"
                     /codon_start=1
                     /product="60S ribosomal protein L32"
                     /protein_id="XP_003722597.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982501"
                     /db_xref="GOA:E9AF27"
                     /db_xref="InterPro:IPR001515"
                     /db_xref="UniProtKB/TrEMBL:E9AF27"
                     /translation="MVKPTVSKAIVKKRTKRFTRHRYELFPQLSSSWRKPRGEDSPVR
                     RRYKGQKAMPNKGYGSDRATKYITPSGFKSFPIQNVQDLYMLVMQNRKYAGVISHTVG
                     ARSRKAIVRKAHELDVRLINSGAKLRKLESN"
     gene            <833306..>834754
                     /locus_tag="LMJF_35_2060"
                     /db_xref="GeneID:12982502"
     mRNA            <833306..>834754
                     /locus_tag="LMJF_35_2060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722550.1"
                     /db_xref="GeneID:12982502"
     CDS             833306..834754
                     /locus_tag="LMJF_35_2060"
                     /note="previous protein_id=AAZ14429.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722598.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982502"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="UniProtKB/TrEMBL:E9AF28"
                     /translation="MDSLRRPGREEQQQPREFSISASGAVEAVLRFAAADAKTNRGAG
                     SRAKTDRVVSEHKTEQCIALIDYHALEEDEISFRAGDVINVTGKGTASGFWEGYVATP
                     VSPALATAELSDAEHSSSLSHSPSASLLSPQHQQRCTRGLFPNCLVTSNMRLKRSLSH
                     YALQNVALCLYAYQATGDGEMSFVHGDVITAVRPSSSPGWWYGVKSGGPAWVAPGVAA
                     SNRFVDPAAATDSSASRAGRKTRAAIDAAPQGGTTAPAGDGNDEERLFPTNFVTCDVV
                     QANFSFTGRQPHELSCKVGDIIQVHRRWNDGWWEGSLRGRRGIFPSNYTMPNVTTTAP
                     PLFCPRCRTVYASSMLYSTCAKCMAEERVEDAMMQAVEAYARGEAAELDLFANVDISL
                     HTPVEDASASDGEVSVDGTLRQSSREANHDDSRNLTRGLSTVIPSTCNDGGTSGRRQC
                     RRSGSRPSEARVSLLTEKDMADLASKRVKLME"
     gene            <835729..>837840
                     /locus_tag="LMJF_35_2070"
                     /db_xref="GeneID:12982503"
     mRNA            <835729..>837840
                     /locus_tag="LMJF_35_2070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722551.1"
                     /db_xref="GeneID:12982503"
     CDS             835729..837840
                     /locus_tag="LMJF_35_2070"
                     /note="previous protein_id=AAZ14430.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722599.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982503"
                     /db_xref="InterPro:IPR025257"
                     /db_xref="UniProtKB/TrEMBL:E9AF29"
                     /translation="MPPKKVKDLANAPVLKMAHEEQVQLLSDALLREYMHRRGFLATL
                     KAFDEEHPRDANTISSRALMSDLMALDPADQQRMKGEGIETIMEMLCNLRVERRLETE
                     RLIAEAHMPLPQVPANYEALKNKQAVREARMAERQSRKVSSKKKPKASTSATRDHESE
                     GAGDALQRNNRHGKHHQHRSVASLSGTSRGKEFAGITMDDLLGSSHGSSDNVNEHGSP
                     DEEEEGCSSFDCHKAERAGARSAAKSTASHAGLSSSRTASTPAAQPAWMEVAAKQKSS
                     SMKGNGGGGGAQPRPSDDEGDNDAGAVDSEADEDSADGVEDCGGAAMTAEQREQLCAA
                     FQLLCGFDGSLHKSFLEQGFTFDDCADCALIQWQRGGCDGVIAPIQAFVAAYYYEREV
                     YVGKEKRQRECLAKALCTSLEQAQPNVAKIVLLDSVWKTERDSSRYTRSHVLRQAAKP
                     RTRCWAKMTSIQEVTEVLRDTLLTEERWMKPRGGGVVSFLFSLLVSRGVDVVQQELTK
                     ASTADSGRPSLLLPMSGRATLGLINLVLTGRAIFFRHNGVRNGNEVGYSSRLRCGLLC
                     GDSAADLDDHDRATAVSAAPSSPLSYTNATEPQFPSWVVWHRESFSNLYMPKDTRQLF
                     QQKLNLGGNASVDLVYWDAATEDEEFPLTATVRSIVFGAGSGSGGGARNAKSFVNTAI
                     TSVPAWSSAVIDWNGKAPLRD"
     gene            <839745..>840449
                     /locus_tag="LMJF_35_2075"
                     /db_xref="GeneID:12982504"
     mRNA            <839745..>840449
                     /locus_tag="LMJF_35_2075"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722552.1"
                     /db_xref="GeneID:12982504"
     CDS             839745..840449
                     /locus_tag="LMJF_35_2075"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722600.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2075"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2075"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982504"
                     /db_xref="UniProtKB/TrEMBL:E9AF30"
                     /translation="MLGLTSVMQRIRFCLRAYVYGDRSSALCLSHARFSSRRYHLFLL
                     RNVPSPLLRPSSSPITVCYLVRTFHLCRSTPAPEPASLAIFPLPTPSNATPPVSVPYF
                     ATPAVKSADCHSIITALFSFQLIPALPSAARGCASFHKLSARLSLVGESGTRLMVPAR
                     LVLDLFLPFSPQLSPAFELGPPPHPPLILVLLFVVASWRLSLPPLSFVSCPWLSSLSS
                     CASASLCVCVLLRCCS"
     gene            <844928..>848257
                     /locus_tag="LMJF_35_2080"
                     /db_xref="GeneID:12982505"
     mRNA            <844928..>848257
                     /locus_tag="LMJF_35_2080"
                     /product="putative calcium motive p-type ATPase"
                     /transcript_id="XM_003722553.1"
                     /db_xref="GeneID:12982505"
     CDS             844928..848257
                     /locus_tag="LMJF_35_2080"
                     /EC_number="3.6.3.-"
                     /note="previous protein_id=AAZ14431.1"
                     /codon_start=1
                     /product="putative calcium motive p-type ATPase"
                     /protein_id="XP_003722601.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982505"
                     /db_xref="GOA:E9AF31"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR006068"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023298"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:E9AF31"
                     /translation="MTIEMTKKSISLSADLAAKGLEESDDSQHLPVFSGEKLNGRALG
                     DGAENGTAVVADAKEHHAMNFGDEQGDEPTPEAYDARDKFWALALENVFNLVQLEDPL
                     AGIDATDAPRHAKELGDNVIPIKGGPSWIVILASQFKNAITIVLLIVIIISGVFGDWA
                     EFGVVLFILFFNAFLGFYQEYGAERSLASLKQMTAGVAKVIRNGIPEIIFIDEVVVGD
                     VIVLEQGASVPADCRIFESNGLEVDEALLTGEALPVVKHANVIRDPENRLALGDRKNM
                     VYRNTQVTQGRGKAVVVAGGLNTEMGKLAKRLNDSKGSGKTALMKKLDYMMYFLFLCC
                     AIAAVIVFAANKMRYTPATLSYATAVAIAILPESLCAVITVAMTFSVKRMAQQKCIVR
                     KLPVLEVLGNVTDICSDKTGTLTENKMVVKKAVIGIDDMYSVGGAPYDTHGDFFPAMR
                     NGQEQQPVIMAHQQEVRYVYQFFKCAALCSTTVLHVSEEDMDSLAGNGNPTEIAIQVM
                     TWKAGLNRDKLEDEGWECITEYSFDSKIKRMSTAWENKAKRELYLCTKGAPERVVELC
                     TYKISEDGKLVSLTQQDREQVEWHIRDLAAQGLRTICFAYREDATKIFPIPADEPFID
                     AYDRDQVERDLVFLGIVGIYDPPRPESRPSVVACQHAGICVRMLTGDHTSTAGSIASM
                     LNIIRRRDLDDPVKLQAGPDFDKVDPETIDGWADLPVVVGRCSPESKVKMIESLHRRK
                     KVVAMTGDGFNDSPSIKIADIGCAMGSGVDVTKGVADLVITDDNFATIVKAVAEGRRI
                     SQCIRKFVVHLLSSNVAEVIALICGLPISHGGESVFILSPIEILWLNMFTSAPPATGL
                     SLDRATDDILQVPPNTQGFFTIELIADTVVYGFWLGAITLCGFAVVLYGFKSGPEGTD
                     CNRHNGVGCDNIWTARSTAFGILYFGLLIHSYTVRHPRVSIFRMRWLDNKWICGSCVL
                     GGALFVPIVYINAIAHGLFVHSMITWEWGVIAVGVMTFLAACETYKVIKNLIFPIRKV
                     LVEVDEEEAEDVEEQRQREYNTFTRTMPDDRNVERIANENLRMSFASLAGSVGTANTG
                     SFRMPAQREKKKRIGLFRKRE"
     gene            <851511..>853607
                     /locus_tag="LMJF_35_2090"
                     /db_xref="GeneID:12982506"
     mRNA            <851511..>853607
                     /locus_tag="LMJF_35_2090"
                     /product="putative kinesin"
                     /transcript_id="XM_003722554.1"
                     /db_xref="GeneID:12982506"
     CDS             851511..853607
                     /locus_tag="LMJF_35_2090"
                     /EC_number="3.6.4.4"
                     /note="previous protein_id=AAZ14432.1"
                     /codon_start=1
                     /product="putative kinesin"
                     /protein_id="XP_003722602.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982506"
                     /db_xref="GOA:E9AF32"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:E9AF32"
                     /translation="MAALGNQRVTVSVRVRPMLREGASANHQQEKFELQGVHRVGDNS
                     LKVELTKPGEPTKSSLFSFDYVFDQESTQLEVYEDAVVDMVDAALVGVNVTLLAYGQT
                     GSGKTFTVLGDVKPNPLENDLLTTNSGMFLRVLSDLIDYKARQAKKGWHVVVGLSCIE
                     IYNDNIRDLFGGKPNSAPPALKAVMIGEDVYLPSLIIKEMTTLQAVFSEIQLAIARRM
                     SRATDSNSQSSRSHCLFSIDILQQANSAPAPSLDILDQSKKGNDTKKAVLSEKRGSAT
                     TKRGGGPASAAQDAQLSEWEMPFQGTVFRLPGQKEPIYTSKIILADLAGSERIARSGV
                     TGDGLTEATSINSSLTALGNVVHSLHEGGFVSYRVSNLTRLLKPTFSHPSSRVLLLAQ
                     CSPTQLTFDETISTLHFANKVKDMKVTTCTGAEVEKLQFDFLESGKMYDALLADLRVF
                     AVESQATIGIIRRNLPQKNSLYYDASAGKNGKTAKVSIKDRRLSADASGVLSVAQRER
                     AELVARMEKEKSDEMLVVQRSADEARDEIVREHMTELNEVKEAIAAQVSLRLHHASQQ
                     LLLDSAARSNKIVEDEAEEWASVMLLYLKEHKVLCSKELAAISSRLEDLSENVNKQHL
                     PDTRKETPETVEADTKYALSTWSHCLAKRFFSFCMEVHEYQAAFLSICHGNVTLVRWK
                     KKNAELLTKFEEEKSV"
     gene            <857931..>860102
                     /locus_tag="LMJF_35_2100"
                     /db_xref="GeneID:12982507"
     mRNA            <857931..>860102
                     /locus_tag="LMJF_35_2100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722555.1"
                     /db_xref="GeneID:12982507"
     CDS             857931..860102
                     /locus_tag="LMJF_35_2100"
                     /note="previous protein_id=AAZ14433.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722603.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982507"
                     /db_xref="UniProtKB/TrEMBL:E9AF33"
                     /translation="MASAGTYIAAWFRHHLSSVVTFQKQFVDDVSETVKEQKAQFHRH
                     TREAKERAVQLHLDKLEEKYLCCVCGRGGEVREDDEFVYDTYSMIELPPRAALEAALW
                     EELADTQLSDGRIKQHQRMLAFRQRHLPQSSTTPAATYESDGSLYGSSDVSVAPSDGR
                     SERTRKKHRRRRDSSSQHKRAKSSSRRHVMARSRRQREELEAQHHDHDDRDKRAAVHA
                     SEPSIRKSLSLDESPPSRSTAARGDALELHTADLAVIDPDMVGPLEVRHTLYKIRHAV
                     LHKEARVRRKAVVVHKDKGLMMIEESEIEMFSHFFQRPVHGYLCMACYTSAQRRLDTL
                     TQQIRAILFKAEHPVLRRLPAKELEGLIAGNQVPVTLIQSVLAVQRRWTKLTEEQRME
                     VSRAEAGAGPPQGSTAAFDAEKRTSWTSQGRDPTARMATLPEKSILTLREEARCGACQ
                     RRAACFFEPKSVVFLCQFCTARDRFYREHAVCINDEEMPLALVHLLQNLALYYQGVHQ
                     QAELRQAPLSAIPEAQTDLFPLTDIMREKEGLFACQASAAAKADRQGCREVAEVVPEF
                     IAETPMHGTYVPVARPCTSAASIRRVCGSTVPLQEQRERVGRTMISLFDGVKVEGSGV
                     NLFKDAASSSFAAGVSDLFQPAPAPQLSPSQTNGGAAAHAGERAAANLLANGGTAAVT
                     SPPATVWGHEGHLQTSATGSSSATPTVHFPEAPNSQRESLF"
     gene            <862588..>863958
                     /locus_tag="LMJF_35_2110"
                     /db_xref="GeneID:12982508"
     mRNA            <862588..>863958
                     /locus_tag="LMJF_35_2110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722556.1"
                     /db_xref="GeneID:12982508"
     CDS             862588..863958
                     /locus_tag="LMJF_35_2110"
                     /note="previous protein_id=AAZ14434.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722604.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982508"
                     /db_xref="UniProtKB/TrEMBL:E9AF34"
                     /translation="MTRLAELLINSQPDDPEDFLWARLEARSFGEDATHSVVFSADGY
                     PVVRPEDPTQVSLLKDIPTTSPGYVVATGLLPLLFAKKPVDPISYLFYHIGSRARSSA
                     AQSAHSSTRHLRFGEDEGLDAESCTSRELDDDSNYAADDAAEVGSAGGSISMVPLQRK
                     GSLGSLFDNGAAAQLQRRRSDRSDNARQRLSQSTTVPRSSSIRRSGAGSSLKRVSVTQ
                     HEGKSCSPMRISHESSPVTVADLGSSSTRTFRIPFLTASSSTLHNIESDEHARVRNEF
                     GLLRLREELRLERLQHEVRILTRECEYRNHMALLNRTDRMADRAAATAQEALEEAQKY
                     CAFLCAQIDQLEVEKQRQLRLISQHMAQSSSPLSAAVDPRISSPISGRCLGAEPSLLY
                     AEPQVPSELDILKKQVELLAMEQARARSIGYGVAPSYAAAAPHTTRFPVSATGVSGSA
                     RASFAK"
     gene            <869302..>869919
                     /locus_tag="LMJF_35_2120"
                     /db_xref="GeneID:12982509"
     mRNA            <869302..>869919
                     /locus_tag="LMJF_35_2120"
                     /product="putative R-SNARE protein"
                     /transcript_id="XM_003722557.1"
                     /db_xref="GeneID:12982509"
     CDS             869302..869919
                     /locus_tag="LMJF_35_2120"
                     /note="previous protein_id=AAZ14435.1"
                     /codon_start=1
                     /product="putative R-SNARE protein"
                     /protein_id="XP_003722605.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982509"
                     /db_xref="GOA:E9AF35"
                     /db_xref="InterPro:IPR001388"
                     /db_xref="InterPro:IPR010908"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="UniProtKB/TrEMBL:E9AF35"
                     /translation="MKLYGLLILKPHPPGIEKDPVICCSAVNVSSFGFFQRSSAREFI
                     VFLSRTVAKRVVLGAKTQITENGNVVYAHATLDGLVAIAVSDIEYNARVAFTLLTELM
                     LQFQQTFRGRYESVGGKADEFLHWPHISETLEKYQKPEEVDKILRIKRDIEDTKVIMY
                     NAIDQIIERGQKIDDLVAQSEDLGMASKTFYTQAKQTNSGCCAVM"
     gene            <871355..>872170
                     /locus_tag="LMJF_35_2125"
                     /db_xref="GeneID:12982510"
     mRNA            <871355..>872170
                     /locus_tag="LMJF_35_2125"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722558.1"
                     /db_xref="GeneID:12982510"
     CDS             871355..872170
                     /locus_tag="LMJF_35_2125"
                     /note="previous protein_id=AAZ14436.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722606.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2125"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2125"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982510"
                     /db_xref="UniProtKB/TrEMBL:E9AF36"
                     /translation="MSHSTQVDNDAGSLGRHGADAYPCNSEESEFDEGDWEEGEEQEE
                     EEESDRCSSDSFGGDEDADDQEAEEELEREEQEEYDHGSSDVLEDDAKTEPPVAAATG
                     SSGTFAAASPSAAASLSGGSGGSAFGALAASVEASPSAPLPTAPSVFASSPLASAAPP
                     QPFSARMAPAFASHTTLQEQRPLNTALASPFQPTAAASAAATQQQLGTTTAPLHFVDF
                     ERSLGQKLSSSEWHRAHSKADEVQDVKRALARYNLVLPTDKFDEAIEKALYGS"
     gene            <873237..>874748
                     /locus_tag="LMJF_35_2130"
                     /db_xref="GeneID:12982511"
     mRNA            <873237..>874748
                     /locus_tag="LMJF_35_2130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722559.1"
                     /db_xref="GeneID:12982511"
     CDS             873237..874748
                     /locus_tag="LMJF_35_2130"
                     /note="previous protein_id=AAZ14437.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722607.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982511"
                     /db_xref="UniProtKB/TrEMBL:E9AF37"
                     /translation="MAVSTPSTPPLRPTSNSVRSPAALDDLKLQFATEEVRKRFSDIS
                     MADMLAVLSTLLTNPCIRECGGEQAGGAMKNSIHRLPLALELKQNSASACTGRNSTSR
                     LQHQASASSSITASELSSRDWSTRSSEMDEVPMFKAPAASRLSPEWTTTVASILDNAH
                     QYRESADEHRTVVDIVQLSIKGWFEDAGVEAAESEKMHAATGSAACDPSAWLATLKQV
                     RRLAEDVCHSKYDAVYKRLCSEAAEEVGEGMATPAYVLHDEDSTVAPSSVVARQPVHR
                     AATEPAGIPPFSLVIQRGRDGSGTEVSDSPLNIDLDARNGGTRGSGLESSSASFVVGC
                     EWFQWVFLVQSPLACQSEPYPAVENGAAGKDAEAVAAEQQKWRQRHCTVQLLYPSQAG
                     FSDASDESSGLRSAEAEYELSEPHVVLSSLLGVAMRVWCQNHPHIVVQVLQLEEDTYP
                     WHIYDGSLFWAGWPLNDPAAQGECAAASDSMPIPLLPGECFAHESDIKDDEDH"
     gene            <878791..>880431
                     /locus_tag="LMJF_35_2140"
                     /db_xref="GeneID:12982512"
     mRNA            <878791..>880431
                     /locus_tag="LMJF_35_2140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722560.1"
                     /db_xref="GeneID:12982512"
     CDS             878791..880431
                     /locus_tag="LMJF_35_2140"
                     /note="previous protein_id=AAZ14438.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722608.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982512"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:E9AF38"
                     /translation="MSLRLESIRVYRELYRAASRSARECALYNSSGLLDYVSRRFGQE
                     ADKQSGQLANALRTLERRASDQGSRKRRGAAVGRAQAKLLQQYQRYVSMQIDRTRTLA
                     KALYMAPGNVQLTSVLQVLSAGVGNRTYQQMMESSILSFLEHEAKKVSHNEAAEDMTS
                     ERQNRIMLQALLPYAERLLLVHRTAVGEQNRASSLIYLTPWQVTESIIGSRSGVSAVH
                     LRVGRDHLVVEVDETYNKQVVYICCTRQDGGDSGSYEWAQEVERVEISESEEVQKTMF
                     HSQYLFMATRICDALLHDSPLHPTRSTVVIGHAVGGAVGLVLSLLLTQRGFEVSNTIS
                     LGAPKSLQGTLERYAGAINPIRVVLAGDPLVELPITGAEGAPFVHIGEILLLSPVNSS
                     SDTLAAADTSECESDNNAVSDAPPSPRVDNFTAESLSVMMADSEGVPFASGSADDPSA
                     AASVSFSKADEALAEEENSEEEGMTEILRVAAQRYRDHFLVEHYVQHLKDPSVVLTYA
                     EGDEVWDEGDYEELKRKSAHELSVTSEERRIRDLRGPL"
     gene            <881141..>882463
                     /locus_tag="LMJF_35_2150"
                     /db_xref="GeneID:12982513"
     mRNA            <881141..>882463
                     /locus_tag="LMJF_35_2150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722561.1"
                     /db_xref="GeneID:12982513"
     CDS             881141..882463
                     /locus_tag="LMJF_35_2150"
                     /note="previous protein_id=AAZ14439.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722609.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982513"
                     /db_xref="GOA:E9AF39"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:E9AF39"
                     /translation="MKLGYKSETSAFFVGAAAFAACFFIPRGFLAAAIPVWIVASRLL
                     ARGAVNHARPVTDADTADKQAQARFVMSRDMPMSKRPVAIVTGTNSGIGYWTAVGLAV
                     EGYEVVVTCRSAVLTQQTAERIQQEAERRRRAQPKLYAHSPASVLVEGHLPVECDDFD
                     SVRAFAEWVARKYAQRNVQVLVNNAGGMRKALRFSRFHPNLELHTAMNFLGPLLLTEL
                     LLPVLERNGGRVVYVSSEAHRFAQSLLLPGRFSVWRSIGAFPTCNGLIGGKLLNALKE
                     VNQGAGKSSGPLQTSSTQHAFGRYGISKLLNTYHAHMIARRYRGVKDETHRVYACSLH
                     PGCVATNFSRDIMGSFVGIIFSWASLLFLKTAEEGAQTTLHCAMCPRTELELVSPSGE
                     KPTTNADAVSPYFVECADQTTSMLRAYGWDVSEAAAILQWGRQQVGLA"
     gene            <883665..>884753
                     /gene="AAH"
                     /locus_tag="LMJF_35_2160"
                     /db_xref="GeneID:12982514"
     mRNA            <883665..>884753
                     /gene="AAH"
                     /locus_tag="LMJF_35_2160"
                     /product="adenine aminohydrolase"
                     /transcript_id="XM_003722562.1"
                     /db_xref="GeneID:12982514"
     CDS             883665..884753
                     /gene="AAH"
                     /locus_tag="LMJF_35_2160"
                     /EC_number="3.5.4.4"
                     /EC_number="3.5.4.2"
                     /note="previous protein_id=AAZ14440.1"
                     /codon_start=1
                     /product="adenine aminohydrolase"
                     /protein_id="XP_003722610.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982514"
                     /db_xref="GOA:E9AF40"
                     /db_xref="InterPro:IPR001365"
                     /db_xref="InterPro:IPR006330"
                     /db_xref="InterPro:IPR028892"
                     /db_xref="UniProtKB/TrEMBL:E9AF40"
                     /translation="MADATLLHHLIEVLPKAELHVHIEGTLSPELLFELAKRNGVQIP
                     YKTVEEVRVAYNFTDLQSFLDLYYEGMSVLITEDDFEDLAYAYTRVMHESRVVHAEPF
                     FDPQGHLCRGVTFRVLYDGLMRGFRRGEAEFGVSVMLIFSFLRHLSEEECLALVLDDM
                     HPDNGQYIRELFVAKAFVAVGLDSSELGHPPEKFARLYRYCREELKVPFLVAHAGEEG
                     PPEYMRDAMSMLKVDRIDHGVAARLDQALCKDLREKRIPLTVCPTSNVALKVFQDRAT
                     CGAVVMDLILTEGLCVTINSDDPAYFGGDIRESFRILAETGRLTPATLKQLVLNSFSS
                     SFIADDSKRAYKERVEKVFKDVCGGTYE"
     gene            <886969..>888423
                     /locus_tag="LMJF_35_2170"
                     /db_xref="GeneID:12980693"
     mRNA            <886969..>888423
                     /locus_tag="LMJF_35_2170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722563.1"
                     /db_xref="GeneID:12980693"
     CDS             886969..888423
                     /locus_tag="LMJF_35_2170"
                     /note="previous protein_id=AAZ14441.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722611.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980693"
                     /db_xref="GOA:E9AF41"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:E9AF41"
                     /translation="MLHLFSSEVAALASMVLFGLVYGAFYFLNIAWARNPNAADLLVF
                     ICSCIFACRTAAKGKVCQWPSGVDFTGRVALVVGATSGVGYSTAMQLAEHGWTVVLAA
                     RNTDRLLFSKRTIERHLQKCNAKGSVKVLGTVDLRSDASIRAYVKELAAMKAHLPVGL
                     LIMAAGALHRHLHFVGEVEELKTGSASVAASSRAWRSMECMIAANAVGPYLFTQLMLP
                     LLDETAERTSVTSRVVNVASSCHTFLGPGRQARYNPLEMIRGLDERASEVLPGGGCGD
                     TQESKAARSPYYIRDYSWANFVGYYGLSKLCVMWNTRLLARQVATMRFIPKTAARTPA
                     LREPAAKCTTADSAQNVTATPETDRQDQLKIFVACTHPGIITTYLYRDIFAPWVLDYF
                     FYYPSLVFGKTWFESAQSTLKAAVEATGMVQGGYYLCSGEYGPESGVNCVSAHAQRAT
                     SIEEYQRWMMARVTPVLRAENEMAAKKQDEAAPQ"
     gene            <889514..>892726
                     /locus_tag="LMJF_35_2180"
                     /db_xref="GeneID:12982515"
     mRNA            <889514..>892726
                     /locus_tag="LMJF_35_2180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722564.1"
                     /db_xref="GeneID:12982515"
     CDS             889514..892726
                     /locus_tag="LMJF_35_2180"
                     /note="previous protein_id=AAZ14442.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722612.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982515"
                     /db_xref="UniProtKB/TrEMBL:E9AF42"
                     /translation="MPPPASTAQAGAGRDAPLAESPPPNSTTLTIPHVNIPLLPPGHP
                     LPTSTDDMEASTAVYFREGRNPYGKRHRSTLVNEPSASASSTVLEIVSAEEDVRAAVE
                     GTDRGRFAGSAPQSQSAAAGDAVTAQYLAQLFDEPARCEQDLYRLVDVAYCRRLLAQE
                     AEEFKMAVSSQPPAGSSLEGTEAAVVRAKRVHEFNSCLTAGQHRRYRVFVLEWLRHQL
                     SPSAPPNSAEVLKVVQQEQRLFLEALRREALCRVVRLSSGHHTTTYACLGRALTSFAQ
                     YRRLHQMQEQLVSFLNDAKAKESKGLLLPGSAPAASSSAASGAAEEDARSRDVAHSPS
                     GDLQQGVPHGATPLQVFQRRFPSLRVLQWHLIKLYNSQQNGVAAPFPNPQVRSFAAPS
                     GAAAGGRPHNRHSESDGTAKASSSAAAAAHPSAVPLVPASATLLLASLPQHRQDDDGD
                     QPDTRDGGRVSDDGDSERSTSSAVPAFSSHLSTDVTAAAASLTPLSTSALHTYVAHHL
                     LPRLGWQASKYQGKDGEAGVDDEGSTAVVASVSLTMTFEAMLKLFVAHVDTEEPRTSF
                     RIPICVHVRRKPDSRHTDSTTSERGVYHAHVAVGAAVPNVTESRQSIQLAAAEYLLCQ
                     AANRKGSRGEAATSSEARHLPSTPTAAETVPLAAATVHLSRSTAMPRDIKTRQATAQS
                     MTGGAGGNPINASVENLLEQQEPASETVLPLVFRVAAPVAAAVSTAHGTDPLQRVSPV
                     VIMAKMEHLNVTSAVAPHARSPSLAASPSTVDSECVVASLTETATPCRWLLEMLSPRE
                     MLQLDLLFACFPSATAHLHRVQLSQKSGRSDSAEPRGTCEEEECLSMDVLAVEQLTPQ
                     KWGLSRQHLQKRPAESLITTPSPAEVLATYTWDLLYDTLAWLLDTIARRVAYALESEG
                     GRGEGSAEGTTNATEERYMYLILSNHANLVNTSASTKLCAKKRPENASEPAYTTVITS
                     SYTESRFAVRYVVQDAAEIYPNYEPKVPIAFEVANLRFLEKDAPSGSDEDGEGDIKST
                     REERDVSKVASRLYRDPHTWNAETIPFTFPRAPAPALAPT"
     gene            <893395..>893889
                     /locus_tag="LMJF_35_2190"
                     /db_xref="GeneID:12982516"
     mRNA            <893395..>893889
                     /locus_tag="LMJF_35_2190"
                     /product="putative 60S ribosomal protein L12"
                     /transcript_id="XM_003722565.1"
                     /db_xref="GeneID:12982516"
     CDS             893395..893889
                     /locus_tag="LMJF_35_2190"
                     /note="previous protein_id=AAZ14443.1"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L12"
                     /protein_id="XP_003722613.1"
                     /db_xref="GeneID:12982516"
                     /db_xref="GOA:Q4QAA9"
                     /db_xref="InterPro:IPR000911"
                     /db_xref="InterPro:IPR020783"
                     /db_xref="InterPro:IPR020784"
                     /db_xref="UniProtKB/TrEMBL:Q4QAA9"
                     /translation="MPPKFDPNQEIIVVVRAVGGEVAATASLAPKVGPLGLNAKKIGE
                     DIAKCTKDWKGLKVTCELRVKNRVATVVVTPSVASRLIRALKEPPRDRKKVKNIKHSG
                     NIPFAEIIKIAKESQPKSMGSDLKAVVMEVLGTAVSIGCTVDGESPLDIQAKVREGKL
                     KVPN"
     gene            <895340..>896164
                     /locus_tag="LMJF_35_2200"
                     /db_xref="GeneID:12982517"
     mRNA            <895340..>896164
                     /locus_tag="LMJF_35_2200"
                     /product="putative RNA-binding protein"
                     /transcript_id="XM_003722566.1"
                     /db_xref="GeneID:12982517"
     CDS             895340..896164
                     /locus_tag="LMJF_35_2200"
                     /note="previous protein_id=AAZ14444.1"
                     /codon_start=1
                     /product="putative RNA-binding protein"
                     /protein_id="XP_003722614.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982517"
                     /db_xref="GOA:E9AF44"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9AF44"
                     /translation="MMEERHSHGSNDEIQNGGDTDNFRRNQGTILFVGNLPFQTPWQH
                     VKDYFRNAGKVRYTDLIADRTGRPKGSALVTMMTVEGAENAIRMFNETDFEGRRLIVR
                     RFDDGPRPPLVQRDMMPAYGNTAPQSRGQYTAGGYYQGAAASGAAAGYNRHNMAGSAY
                     GRGAPYQVGAAESTEMNGTEPLPKPRSQQVPEVGRKLFVSNLPFDCTNSALRETFQQV
                     GLVERAEIILGRNGKSRGMGIVVMKSEDEAQIAIAEFDGIEMANRAMNVRLDNKTL"
     gene            <902825..>903103
                     /gene="KMPII-1"
                     /locus_tag="LMJF_35_2210"
                     /db_xref="GeneID:12982518"
     mRNA            <902825..>903103
                     /gene="KMPII-1"
                     /locus_tag="LMJF_35_2210"
                     /product="kinetoplastid membrane protein-11"
                     /transcript_id="XM_003722567.1"
                     /db_xref="GeneID:12982518"
     CDS             902825..903103
                     /gene="KMPII-1"
                     /locus_tag="LMJF_35_2210"
                     /note="previous protein_id=AAZ14445.1"
                     /codon_start=1
                     /product="kinetoplastid membrane protein-11"
                     /protein_id="XP_003722615.1"
                     /db_xref="GeneID:12982518"
                     /db_xref="GOA:E9AF45"
                     /db_xref="InterPro:IPR004132"
                     /db_xref="UniProtKB/TrEMBL:E9AF45"
                     /translation="MATTYEEFSAKLDRLDEEFNRKMQEQNAKFFADKPDESTLSPEM
                     KEHYEKFERMIKEHTEKFNKKMHEHSEHFKQKFAELLEQQKAAQYPSK"
     gene            <904771..>905049
                     /gene="KMPII-2"
                     /locus_tag="LMJF_35_2220"
                     /db_xref="GeneID:12980708"
     mRNA            <904771..>905049
                     /gene="KMPII-2"
                     /locus_tag="LMJF_35_2220"
                     /product="kinetoplastid membrane protein-11"
                     /transcript_id="XM_003722568.1"
                     /db_xref="GeneID:12980708"
     CDS             904771..905049
                     /gene="KMPII-2"
                     /locus_tag="LMJF_35_2220"
                     /note="previous protein_id=AAZ14446.1"
                     /codon_start=1
                     /product="kinetoplastid membrane protein-11"
                     /protein_id="XP_003722616.1"
                     /db_xref="GeneID:12980708"
                     /db_xref="GOA:E9AF45"
                     /db_xref="InterPro:IPR004132"
                     /db_xref="UniProtKB/TrEMBL:E9AF45"
                     /translation="MATTYEEFSAKLDRLDEEFNRKMQEQNAKFFADKPDESTLSPEM
                     KEHYEKFERMIKEHTEKFNKKMHEHSEHFKQKFAELLEQQKAAQYPSK"
     gene            <906689..>907564
                     /locus_tag="LMJF_35_2230"
                     /db_xref="GeneID:12980709"
     mRNA            <906689..>907564
                     /locus_tag="LMJF_35_2230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722569.1"
                     /db_xref="GeneID:12980709"
     CDS             906689..907564
                     /locus_tag="LMJF_35_2230"
                     /note="previous protein_id=AAZ14447.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722617.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980709"
                     /db_xref="UniProtKB/TrEMBL:E9AF47"
                     /translation="MLRTCRVLRFRMKLGSMYVDYKIVSRNHRRSIRVEDALVDPLLP
                     TTVVPLHWLEQLRCPSTRLLTGYHTEEAVYAKPNYGDRVSRTPALLSLPDAAAKTADN
                     GAHANAIRAGPVVLYITGQSIPVVLNPLFVQPDEWGLTQSNGEWDLRIGMDAIEQCSL
                     YAELRPGGLLYSKLPHASLTEAMEPVQDTLKRYGMRCALAESPLVPRPWTRMRYMFID
                     ELQRGQKMTEFVGYNPRNGTQWRFSQHTKYFRTGIWRETIRRNEMNDGLHAHSSWQKS
                     PQQAVPEISFLAPYP"
     gene            <908777..>910336
                     /locus_tag="LMJF_35_2240"
                     /db_xref="GeneID:12982519"
     mRNA            <908777..>910336
                     /locus_tag="LMJF_35_2240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722570.1"
                     /db_xref="GeneID:12982519"
     CDS             908777..910336
                     /locus_tag="LMJF_35_2240"
                     /note="previous protein_id=AAZ14448.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722618.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982519"
                     /db_xref="UniProtKB/TrEMBL:E9AF48"
                     /translation="MPLCTSSTHQCVRQLTQLGFAGPQQRGFCTLTGARRQRSPTSLR
                     GRRYSKGNGAGAASASSKHNLLSPFGHALQGSSRGPQGLFVEPLEAWLSALADSVPFY
                     KDCLVICPSTASDVQVRRVWNRCRQHIPAAHVSALTPRKHKRAQTTATDAAPTLLSLP
                     NGTSAGDTAGAEPPMPLPAASLVPRGGGGDHLTSASTARIPSLYSPLEHVSPGSLDLI
                     VLPSNVFAHEMLFDAPWHLSLAHRALRPHGVVAIFGHVAEAGVGAPEWAATDARDYIE
                     STHLDAQETLRLAASDAARTPGTDDEHVRHLRRAVEVHETLRSGHADVLFPFPSVRRR
                     WFTSEYALQPAQLAAHYRATPLYQALYGPTGSLWWNKMRFRADVRQRQRTDASAVRGS
                     EESFFVDITGASLDGTASLGQITERHLEDLVAAWSPLGVRRRRDVNDPLDMLQIILDT
                     HAATVNASAAKPPLQVQLHHFVVTCSARSMNAIPLSKGQIGLNRNPLAVLGGGQRLSF
                     HASERPRASDV"
     gene            <912282..>921146
                     /locus_tag="LMJF_35_2250"
                     /db_xref="GeneID:12982520"
     mRNA            <912282..>921146
                     /locus_tag="LMJF_35_2250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722571.1"
                     /db_xref="GeneID:12982520"
     CDS             912282..921146
                     /locus_tag="LMJF_35_2250"
                     /note="previous protein_id=AAZ14449.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722619.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982520"
                     /db_xref="UniProtKB/TrEMBL:E9AF49"
                     /translation="MNFVNTYLLLPLQRKIFKNFGHYDYQTSTFHLNEERVNEVFFDP
                     AYNPFVDVLRATSHASAVASSKAATAAAQQQQQCAFSSSTVRRRNTTSDVDAGLSASP
                     SPPSQSCSGPVNSEAAATKAAKGAESNNEFTAGVPRSPPVRLLRGKIRSAGLVSFLRQ
                     VTTQKSLSVESMDLVFDVATAAIADSTDDSHTDAPSLVTRPAGVPQDAEDDTARQRDS
                     ASVPDPAVAGLSVAEEGDDAKPTQPPLYSSRRLRRDEMAKLARSYSIEDHSWLHIEAE
                     NQRSSPDATGADFGDLDADAGLLTADGAARPASPKEGPATQFHTVGDLMTYLKQQLQG
                     VAVGVEEVRLTFCIPPVGAAGSLLRSTDSASRRSGRPHAAARASAAAAPLRVLSGTRV
                     LHLSCRRGLRFTVDESTGASVEDMQCTASIQDWQCYVHVMASDGPLPSEFSLDDLVFT
                     TSTALTAGSAEQPPGATARDDSEPAAGAPFTVRVARRGAGAAANAMSTSPSPSLVSAD
                     APLPPPRVLVDVDAAEGWSIVLSAVQIAHLVAMMKQVMGDTTDSDEGVAYACSLSSFS
                     SAVEPASTAGELAKQVAAVPLDSDEAVTAATLTAAQLRAAAKYVSVHCGGCSISLLTR
                     SVVDANAVACAWRCALSSQQLALLDPRATAPLQQPTAASTLPVYEALTTPHFTYVMRD
                     ADILFPNIDAEAPLSLSTSLPTARGVFQQSARKRKIYRRIFDNKLADPAVTEQLARAR
                     TAAGNSNGGGVSFFLGVGSISFLEYRHATAAAGQRSAASSYSFSAAEVRGVPLLSPLL
                     AHSLRPAKLMHAERSPYALVIFHRSTPPLPDQPPAAGVLAPPPSPCLRIYQETVVVGV
                     AKISVQLDAGLVEVLAMYGTTVEKLIRRVGGVQKGGRGELNRTAEALTGTTGLSARRL
                     SSPPSPILPLSPVIRTRSSVKVLLESVDASIRFPIHPNGTTTSPELPPDLADGVSAST
                     ASPASAAAEPQSLLLARLLQRLRESSFDTHRHNRALLRRRARQAKGDGDRVAASPTTA
                     SAKLAEEAAVASAIVVQEQLGFPEDVDTRARFLPELLSFSLRDLQVVHTPSATTAARG
                     ADVATPAAVVYTPASTSVKWREAVVYLQDILEQTNSELFRVDYSHEMNINVTHTSLPG
                     LVGGSWRALERVLALQIRLGEITTTALTQDDYLLATHYVNELLLTLSRCRQRLRAGKV
                     ATAAREPGSSAPPRDQVPVVSVASVRSDGLPAPDGAGAALVDVSDESRCLNTSGGAVR
                     PYDCREEPVEHPTGSAAEAFAMADAVTTSRGLAGARVSRCAAGGDIQDDTSRLKSRGS
                     GDGGDSADPLRNAVPELWRLLDTTCTSLDVRVSRIRLGLFAPRLSPMGQVVGEPLYRC
                     LPRSQRRCLVDLNCLYHLYIMELVDVSVRGLSGDGAFAKAGQANYARVRLGGFSLWER
                     QPAPAPPHTSCDGRGAGGGAGAAAASPLYKSYVSNSVGSGGAPPVSHGLGGSTCKDLA
                     YYMRNSQAAHLGHRRAGTLVQLVQSYAEVRDDEEEGDDRCHRDASDTTEGDDDSGGQW
                     VSRSSRVLSDVWGAYVRELQSIATTAGRAAHAPLPTVRESGVCEVRLLEMARVPPIAT
                     AAHSCYTTPLVPTAFSAAPVPPNRRHLWLQLTGLGLHHAVAYNGDHLAAVLKQYFSGG
                     DGTVGPAASAVRDGGAARGGAEGFAASAFPEEPLWTTKVHVDVANLMATYRPRGAGRS
                     LAVLLLPRASVLIKLPAIVPASAEAHGTAVPPEELRRGSAAVRLPATSVPAPASEDVS
                     APLTMRAQAWLHTSLPLYVCNDCDVEALVHEVLNPAESDDWGVDLESAGFVRLCEVIS
                     TAACSSSSSFAAGMQQSTDDAGAPRTGKSASCSRTPNLILTVRSKSLSASASGAHGGG
                     DTREEGGSVDYAYLAPAVSMHLQHIELSAFMAKDSFEVFRELVEAWGSGTDLKATDAP
                     AALVMRSGPGFEWVAEEVARSCAPMTFRVNPYLVTRDRAAEEDASSGGFRTSPVGAPM
                     MRNIASVDDYTSHYPFLPSTTSLQASSDFESPWTVPEKSQLGPPTGVEGYSASHSALR
                     SSASAYGYSHWLDTLHASYGRDPQLYDTYQTRAAELLDGAPWVPQHQRVHSTSSNASG
                     VEQERARCGRSVSPLPASSADAVPQSRRYDEVSDTISVSSDDDDELTAEEGAAAVAPT
                     RGVRGAQGGAPFQLPQPPLPSVAAAGAATSSLSSSFSDLEDTVASEAQLRWCVLPSED
                     PVASSLLPSGDPRPCGDRADSDAVAGDPGVAAERRFDLFAACDRQPHFLSCWSRERVE
                     AARQRRAVRLNRLDCTDDALLHDTPEKYLYPPVELEFFLSDCSLNLSLYEGTDLMSAA
                     VRKQRRGYLQIVSRGASLAQAAPYVFGGDRRSEAALRAMSSNSASADTAAPSVTAYTA
                     ALAHDPSHLPNGRTKPSLSRCSYATSIGTGATWSFHTISGESSTSRLERLHDRGCRSG
                     FGDRDASKRLVLSCRGITVQMDTFPQGSEEDLWFHVVVGEATVFDCINTSDVHRLLTA
                     TPKPPASLAAQPRRGSGVARCHADMPGIQAGGGCGRGGANDTRHLELTGLLTSSKSVL
                     AAASGGMKGASRASFTVSHFQQGGSELSLAVRLRPTSLTWSGASVDFAQAFFSTASAS
                     PPSSPANSKGAAAIAASSPSVPAAEAGTISGTEAPPLFYRRVVILPTTLTAAGSFQSD
                     KGVLAALAEGNSFDALRSIPVLSWISLQEIPLPIPFIRVEDCSSAATLLQRIVEDSNC
                     VSIRFLLTACCCGLQPLSAVTRVGEAAKGLLLLPLSNYRGAALHHAIRTASSVFMQEL
                     LTQASDMAALLASGSYHASRSLLEVLVAPQHRGLTIEEPSRASQPAGVADGWRQGQEQ
                     LRVGLQEALTMASYCTGPDGSLLRVPAAALRLLMGVSGAATTTLWGVRNSQGSVMRER
                     DGHIYKKKSC"
     gene            <922786..>924387
                     /locus_tag="LMJF_35_2260"
                     /db_xref="GeneID:12982521"
     mRNA            <922786..>924387
                     /locus_tag="LMJF_35_2260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722572.1"
                     /db_xref="GeneID:12982521"
     CDS             922786..924387
                     /locus_tag="LMJF_35_2260"
                     /note="previous protein_id=AAZ14450.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722620.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982521"
                     /db_xref="GOA:E9AF50"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="UniProtKB/TrEMBL:E9AF50"
                     /translation="MTGTSLEAMNGKVVVFLRTSSVARLPLYRRLRSLNVTLVLVHPF
                     TPLPEFDGVFSHWLKHETSDVDEVHLALSAFLASCGLVPDAVVSFDEYAVYQAAVIAA
                     RLNLTPIPLPPAAVLQNNLKDMFRLFCSEHGIPSPKSVPLPVAAVLPTPGEVNNCASD
                     ADALSMAFEKARPALVKAISKTLEAEALAFPVVLKPSPGAGSLLTRLCPTLHDAVEHV
                     WSMWTVLAGHPVTRNFAALTNSAAAGPVLEGGAAAVQILAEEFIEGQEVDMDCVIEHG
                     VVRFCSISDNFEPSPPYFAEVGGVCPSALGHCGQCALRELLDSYVSAHGAHLHGVIHF
                     EAKYDPARQRAYVIEVNCRPGSAETSVMIQTVYRGLNLGEALVRCALQIPIQEQLAGL
                     FPELLAGQQEGGVEMPWQKATPSRHPEADANERIPNSAARTAVWSLLGGPSHGFFPPQ
                     CWAASVNIYPKQDGVLSKVRVPVEDASLVAFSVSARPGDAVAPPPKQFYMICWMVVQG
                     TTEGEAKDNIRRVTDTFEQKVTLPL"
     gene            <928166..>931618
                     /locus_tag="LMJF_35_2270"
                     /db_xref="GeneID:12982522"
     mRNA            <928166..>931618
                     /locus_tag="LMJF_35_2270"
                     /product="ATP-dependent RNA helicase-like protein"
                     /transcript_id="XM_003722573.1"
                     /db_xref="GeneID:12982522"
     CDS             928166..931618
                     /locus_tag="LMJF_35_2270"
                     /note="previous protein_id=AAZ14451.1"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase-like protein"
                     /protein_id="XP_003722621.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982522"
                     /db_xref="GOA:E9AF51"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9AF51"
                     /translation="MSIHARIAPYPPPPSTATVAAAATPTPAAAASSADSPIKKLQQL
                     MQQPQARLNYYAALPPRVAVQREQDRYGRGNRAQRMNNRQLPPPCHQQRHLPSAPPQQ
                     IKATPLAHVADIDPVVAKRFQDEYAQQNDNENIGDDLRAQQATKMGTIGTLDEELCLS
                     LIETHDVTFVVTDTGTGKSTRIPMALHKAHPDALVVNAQPRRTAAINLAQRVAEVLDA
                     ELGEEVGYSVRGEHIGDLGETKIMYVTTYSLFIYFLWHEFKEKLPFSYIIVDEFHERT
                     PDVEVILLMLKLWLHKHPGAFKLVLCSATAQVEEWQSFFDGLTVGTYARSPIMYPVQE
                     YFIEDLQRLTGIRTAPILPQDSNNMVTSEQMHQIILVCKQLLEYLAKNTATQDSVLVF
                     MPGRTQVELMTTWIRESLEESLEPIAWYRDVELSLIQEALARPAVTRKKVYVATDIAE
                     VSLTLPDVVFVIDSGTGKRPQVSEKEKTSYAFPPLRLLWETTSNAQQRRGRVGRVQQG
                     FYFSLLSRDHHKALRESDNRIKNAVLTELVLHSLLITQKPFAFFQLCNEKPERGALAY
                     SLHLLQDGGHIIRKDDPMADAERVSLDRQRTTHVMDSPWNALIEEALAAAPAALSTAP
                     ADAAKNSPATKEAAEGPGSSDEVGGKGYGDEEDSVEAAIPEADAEAFQQCYFMTLRGV
                     IAARSPVSVAAATNVFFGLLYGTPTLSMLAAAIESSKSPFHVPYTVSDRMERVAMVRH
                     VSNVMQRYHGSLQSDLICSMEVILEYMSMQRDGLSEEAQEEWCQERSLSRTRVVDTLN
                     LFSQMKEQVSSVLPFPDVTDIDVLNAQFNQNAELLVLMLVASHTELAIQVQLDGPVAQ
                     RKGFVGHGMFFPLKCLKDESVPTVCPWDRTKISVPLSLQTIQRKVLAVFASQVEPDLF
                     ALVLLVFSYKLHYSVQDSGATPSFLMAVSHSGVRRTFQCDTLTAQQILQLRRIQCAQM
                     RCMQLQVEERVKANESEKLSAVLKSANSDFGLPESAMKTPYLIPTVLQHGLKLLVSRL
                     KGSPSYTAQRRGIAEFSPGTPYCKLAHGAELPPPVLQSVLIHSNNGLSVLQPTATAAA
                     AAAPLATVGVATGAAEHSDVAAVALTEAPSPAVESKSESEDDDDSDRSSDSAAHVPTF
                     SYDI"
     gene            <933480..>934877
                     /locus_tag="LMJF_35_2280"
                     /db_xref="GeneID:12982523"
     mRNA            <933480..>934877
                     /locus_tag="LMJF_35_2280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722574.1"
                     /db_xref="GeneID:12982523"
     CDS             933480..934877
                     /locus_tag="LMJF_35_2280"
                     /note="previous protein_id=AAZ14452.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722622.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982523"
                     /db_xref="UniProtKB/TrEMBL:E9AF52"
                     /translation="MFGTCDKSRHADEAAEKPEGSTSGDAAGSSSSRRRQQRQQLRER
                     DSSTRGAKNTFGTPTMLGIQYTSEEASNIYSKVGTLNGYTFEVPPVNRFHSKTAAAKF
                     TQLTGGINPKFEASRFDNLRERLQVADKRDKDGHLQAIAMLYAEFLGNNFLKAKNIDY
                     AEIERCFYPNYAPKYDTLLKSLGMPKPLWWRQGMFSSLEDISRLPLDRCNVEKEASLT
                     FEEWYCLFWNYYQPFNTLAYLCMVTAQSMVYTRELVDSVAGYLAERHALITEAKAKNA
                     PILFLGARTGKFGALLNATKKLPVPVIHTHENPNTNPYLMVIPQSKQAEFKPNPIIKM
                     KNQAALEKYEPSIVLFSDMIMNSDPTAQIRQQGSVREYVYFGVPDSYCEGHAWDTWGY
                     FKYRERGTDHIPAYMREGFGKVRLPHLSRWMIHKLDSDMQMGNGAVTAWIRTPLLPAA
                     SARWKWRIMRLQPFF"
     gene            <935803..>940317
                     /locus_tag="LMJF_35_2290"
                     /db_xref="GeneID:12982524"
     mRNA            <935803..>940317
                     /locus_tag="LMJF_35_2290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722575.1"
                     /db_xref="GeneID:12982524"
     CDS             935803..940317
                     /locus_tag="LMJF_35_2290"
                     /note="previous protein_id=AAZ14453.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722623.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982524"
                     /db_xref="UniProtKB/TrEMBL:E9AF53"
                     /translation="MLVFAVAADVAALRRAVAAVAGRATSTNYADELHREDGGAADQT
                     SAAAGATRGVLSDAAWVFASVSGSCSLAAMPDSPSRFSAARYEAAAREMRQWQRLLSL
                     ARLPHLHAGVSCTSGPATRDRQANDATLRARASAAATEAVDESLSCDQHVDRVSSAES
                     TEHSSLMWTHVPHTTAGAEFADFDFSRSLVCAARRGVAADVSPPAGHHLLCIDVGGVY
                     LASSRTHHAAGPTQTAPPQPAEAAATKTAGKSERASRRPRVTRVGHGGAPKEQTASLA
                     AHLSNVNAMKGERGAEASQGLWRLLQQRFATATRTCPFRTDAGATAFPLTLTEVWVIP
                     LLTAERDSEEPLHSAALGLSAFPLLVQDEYHRNSADCAAAEGDSVQVVRLARHPPSHM
                     LRLAVDDGAHSTDPSSSTMCQAAALRSRKRLRDSTAGRQDEAEGRQRLAAHATPLLPA
                     AVFLHSCRCNRGGADPAAPEVSALRLRILERDFLLRSCYFSEWCCAADFDITNGFVSP
                     HLGKWTRSATAYHAFYSALRRCVLAEDALVRHSIEEEAGKWVASFGSLSGTVVTSSSG
                     AAAVLRSPTEALFKDSALEGRSEDDSGVRGSERVWPIEELWGLWVRLGWTPPLAWPRV
                     RVCLRLSEGLGLGNVVQSSIWDLSPRALLALLSRVGAAVNAAYIEAKQLQPTHDPRGD
                     CLAAEIESDGEAAGVALDRVSDPGRAHSCQERIPSSSAARCESSVQVQRLLEFQAALS
                     VAPEFATGPVLAELSDFAVAAPCVPTVDSCAITAPGDAAGGFLVLSAAARDLAVDIAA
                     TRVLPTSHPVASPAGSVADVVALTVTWLRGVLESPALLILPLGVSGHVNERESADDSS
                     GGAGAYPSRRIAMDKETTLLTALLARRSLFQPEKLLRGALDISSTSHSPQIAPPSSLS
                     AAEMYCEVADVAELRWCSPQASTATATTTAYRETLSTAASQNPTLRSPSSVSSTASCC
                     ALACVELARLARTETADETVNECRTSHQQLSATNPLAAFLYTRFAAYLQEQGAVAVAS
                     PSGAGSSEGEAQDSGRDDEHKPRAACPARRSAVTVPSSSQPPMLRHEDCAQGGVATVS
                     LLENGGCLNDMSGPSGDGDAVKTLLAETVVRVVQQNKSVVRRILALIQSYSGVIAAAT
                     AESNGGARCAASMDEAAMIKSGDTQPKDAVAQDLWRCLAPEVNGAMCVDEAASPVSSC
                     AKAAARRLVQAFWENVAATARLHLRDRLGALSGREKGATSDSDEEESARRSASPPERR
                     DGAANSPAEAAAPTSSGRQHSSAAKESGAEPAPAQSSTLSPSSREQVRASPSFPLLPS
                     ASLSRRLPSPNPVGQSYGALSQAVRALDGAQAMALYMQHILGCSNAAGRQQGQTRLGG
                     CTLLSCVTEAPGRAPPTTVDTAATPARPQQPNHWLQHALFLLSYGLACPADEPVTSSA
                     TASTPANASAKGCLPVGPYQEADQLALPPPPALAAFRALRCAKISLDVYIGEALEVYV
                     QRWTLSEQAR"
     gene            <941461..>942681
                     /locus_tag="LMJF_35_2300"
                     /db_xref="GeneID:12982525"
     mRNA            <941461..>942681
                     /locus_tag="LMJF_35_2300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722576.1"
                     /db_xref="GeneID:12982525"
     CDS             941461..942681
                     /locus_tag="LMJF_35_2300"
                     /note="previous protein_id=AAZ14454.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722624.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982525"
                     /db_xref="UniProtKB/TrEMBL:E9AF54"
                     /translation="MPFMSFMNADEGFTEPIVETPGYSEEDAFGHKDPLRAVEHTLTA
                     KRKFSACDAASSCDAQTAAIATSPACDSTVDSTATSAPDTNLAKEVDAVASGRNRRRN
                     RRKRTADAILGDVLHDALLLRDMGEKPTSDFVYKRTQERMYEEEYGRKPPSAKENAAK
                     FIPFPPDFHLHRLLPLFGECGRDAAEDVATDSASCGAARPVTPAPVYTKNFMNAYALM
                     APDPWPERAVTPENPVWTRRDVDLDKEKTGGRGLKEWEERVYAPRPGYDVHGEFLDAM
                     DELGHWEVQLIHFLRVVPLSQRRSLPFLHEWYRLLVHRLIRAERRYIRIRDAALANTK
                     VSTSLLKRTEQPIDAVRSYYAEAHRSLASANYDPLRMKKSALAPLMRMTDEEFAEWQE
                     VQRQRRNSLAAELA"
     gene            <943803..>944549
                     /locus_tag="LMJF_35_2310"
                     /db_xref="GeneID:12982526"
     mRNA            <943803..>944549
                     /locus_tag="LMJF_35_2310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722577.1"
                     /db_xref="GeneID:12982526"
     CDS             943803..944549
                     /locus_tag="LMJF_35_2310"
                     /note="previous protein_id=AAZ14455.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722625.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982526"
                     /db_xref="UniProtKB/TrEMBL:E9AF55"
                     /translation="MGRRTVATPTVMTSAPSASHSSGAYTTLTSRLRSAAIAASASAA
                     VGTRRGALRADSPQLHGCVGAGGSSPALFRPTRVARIPPQLARFLIAGSAALLQVFMV
                     AYQRESQKLRQEEQARGAVGSAEDSTRFGNPRAMSAMEAMQVLGLDRSFPDAYTSVQQ
                     AEARSMSTSALLPLAPGEARRTAQQNFERMFDLAAKEGNVFLAGKLSAAYRICVDPRW
                     DQATSGKDETADANTRSTTATNAGEQGRTL"
     gene            <947625..>951005
                     /locus_tag="LMJF_35_2320"
                     /db_xref="GeneID:12982527"
     mRNA            <947625..>951005
                     /locus_tag="LMJF_35_2320"
                     /product="putative protein kinase"
                     /transcript_id="XM_003722578.1"
                     /db_xref="GeneID:12982527"
     CDS             947625..951005
                     /locus_tag="LMJF_35_2320"
                     /EC_number="2.7.11.1"
                     /note="previous protein_id=AAZ14456.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_003722626.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982527"
                     /db_xref="GOA:E9AF56"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:E9AF56"
                     /translation="MVTSRGKVRGHVKPASPASAKDAAAFFAAASTAVTASKTSHSSN
                     DGHNPLINDLLKDLDKNSSKDVHGLGHVQEQSGSNANSFSNFDLQLRRPSEESTASCR
                     SSTRNRDKTATDILCKTGQHFVHAMWMHKLEDFFCPADGESAEDVLRRQLRKKDEEEV
                     EAVVLTLVELLEEVRKARSQLVPLAGSLSLLDMPGRKRASFNSMHSAVSTASLMRPPV
                     HETNQLAMAYDQQGNRMINCYRVIANLGRGAYGKVKLGVDTNTGQMVAIKIIDKKLLK
                     RIGGMGSSNQEAALKREIAIMKKVRHRNCVSLYEVIDDPDSHILYLIMEYVPNGPVVR
                     LKPQELSRTALESIEAGIPLSGEVCDKALMRCAVRQSANGDTASLTEAEINSNPTVFL
                     CKPLSQHICALYLRQLVSGLRYMHKRNLVHHDIKPDNILVGTNHHVFLSDFGVSEILS
                     TRQEVKNAVKKNRGSTSDDLISEHSFESDASDSTSEDDAGKPRLGGGTLLFTAPELFD
                     TSVTKRLLDPHLTDVWALGVTLYCMLVGMSPFFGNTYAEVRANILTQTYPWCGKTMYG
                     TPLAAEWRVVLNGLLAKNPNNRWSLARLKSFLDQQSFQQAMRQSAFLEASTRNRSLTS
                     LDGDASPSTSTAQRAAGLAASLSTGTVAKGLKLPLVCSSVAKGTNASLPPPRVVSSPR
                     AVSALPMEASSAARNLWDFDVSEKEVRGATRTVKVEVMRQTTVLSAHTRTIVRRYVEW
                     IRACMHARNFIPLGCASPLSRKSKVGSLVSVQMCAGANKSSKTLTASGEKAHVTHVPV
                     LAVAARFHQASEASPIDTRSCVCPPRRSPHSPAGDTRAGRQRKGSCSSNNGGGRALTC
                     GSLENRALDGRLQSLDAALSIVNLQSTFDGHSLTFSLTSSSLSSKASFSSQHGDSGHH
                     AGRETCSSNGMLVGNLTTPSEKTLAPRNGLANRVSWCNVQMPSTVAQTMLPSSVTPSY
                     IAEEGSRKRAGAKGIKGRFQQFTRGTKKQSDTFVSDNLTSYQSTFAPRSHSVVSPLLD
                     SVLCSGTSVLEDSNPAGYCSTYHKPKTVSTTDRCLAVPPAEHLSAVQSSGSVGNRHPV
                     RPMQERRCDGKLVVPALTSFEQVPRVTASKGLSSGVRK"
     gene            <954388..>957147
                     /locus_tag="LMJF_35_2330"
                     /db_xref="GeneID:12982528"
     mRNA            <954388..>957147
                     /locus_tag="LMJF_35_2330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722579.1"
                     /db_xref="GeneID:12982528"
     CDS             954388..957147
                     /locus_tag="LMJF_35_2330"
                     /note="previous protein_id=AAZ14457.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722627.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982528"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9AF57"
                     /translation="MTSIASQILAALAAASSPVAETRHAGDLQLQQLKLNATAYFSSC
                     AEIFVSQQADLRGRQLVGFQLKNSLADPACAQNAQLQSAVCEQAVADPQRIIRNVAGS
                     IISVAVREGLWPAEPVVRQLGTILTHRSNELGAVHGAIRTLSYIVDDAVSLLDAAGLT
                     KPVLLAALPYLTSTAFGTTGADVLEIRVKALEVVALILEHAGMDFESNSYKSLQGGIT
                     SVVQACFDNLKAPLSQAIATQCIRCMALSLTFYQEIDDDLFGQIGQLMYQATTAGNGA
                     APANAEEESLRIEATEFWRAILHFPHFAEVAQSTVVQIIPVIIRSMIYSEMEIGMLQA
                     SAEDWQVPDKMDSIRPRHYTELNRAAGDGGNDGEEDNGEDDDEVEEWNLRRVSALTLD
                     ELSQYYGDLLLLPVLSCVEGMIRSGPAGWRQQEAGVLAIGAFCEGCYDSLVQFLPDIC
                     PMLLQLLEAADAHFLVVSISLWSCTRLGSYFLSNHPLMERLMACILRKMENPSKMVQG
                     AAVEALRSMLEMAEEGQVDAAAPAIVRSIATCFGAYQLKNRVLLLEAVQSVCQTLGAA
                     VRGSEELISALLAPLGQLWSQTPNDSPLLWSLFDCMATVCATLGPAMQPMTGEIFNRS
                     FSLLREHLQQRHAALQSGDIPPDEEFTVTSSILLSGLFDAMGSGLEPLVAQNEPVFMQ
                     LTLSMLSDASPHIRQNGFCLASDVARTCPMHLQQVLPQFCDVAVQNVTMADESCYAVV
                     SNVAWAVCNLLEHEVDGTGAPTMQASPAMSQLFALFAKLLGQTNITSDMRNMAENVSL
                     CLGVMLYVDSDVESKAGCSVELFAGAFCRFVRNVRESSSLLEAGTNGFLMAVQQKPSA
                     VVNNLGLFCDLGCSVAVEGVEASRMIRHLLSNASRANPDVWRQALAACTEPTRKKLYE
                     RYGFQ"
     gene            <960346..>962379
                     /locus_tag="LMJF_35_2340"
                     /db_xref="GeneID:12982529"
     mRNA            <960346..>962379
                     /locus_tag="LMJF_35_2340"
                     /product="putative ribonuclease"
                     /transcript_id="XM_003722580.1"
                     /db_xref="GeneID:12982529"
     CDS             960346..962379
                     /locus_tag="LMJF_35_2340"
                     /note="previous protein_id=AAZ14458.1"
                     /codon_start=1
                     /product="putative ribonuclease"
                     /protein_id="XP_003722628.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982529"
                     /db_xref="GOA:E9AF58"
                     /db_xref="InterPro:IPR006941"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:E9AF58"
                     /translation="MEITNSNAVALLPYVGTLLRDCSFFAVDLEFSGIDHEGAEAEAE
                     TPEQALHSLMRKPSDLYPAKLQAIKPYSMVQIGISVFMELASGDAEGVTSASGAASLT
                     VPPSAAAHLRKEVAEFLAADVENHTTYAETTTVVEGMLTSANSAAAGFTSAFTYITEQ
                     MVAVAQSLGVVARPSDIGATAEPPPLTQSLPGLRYHYRFLEALSRAVASYRREITATG
                     ASALEAPVARYKVHTFSALTFPAATDFAANVTLNIDTAQFLVKNDMDLTRWVKEGLRF
                     APIKVAAAQLAKEAEAKLQQMNLLAQPHIVLPGYKECIGSKLDELLPLSPGELQLVRF
                     VIALPDAGYGDMAAARVKQFYVGALRPLISFARGIVPESALPESIYTRDKLFKDEMDA
                     LAAIGMTKASRKFVRAAISSSCGSGCGSCLVSHSYGSALLETLLYATEVQRKPIVFYN
                     GYTDVMFLLLALYGPQNMPPNLSSFKSLVRRHFPSLFDTRVLSCAGPLQGLGNFTGKL
                     SSVVDEMSKVSAIGPHVSFSFDPLVSGGRDATQHLVAHNAAFDALLTGKLFAFAKYGL
                     ENANVSVKVYENFLATYTTLMSINLQGNVDSVLPEAAANVYYLTKTSGLRADTIREAL
                     AGCGITAVVMYRRNGYTIQPVGAACQMPDLIEVVRKALRARARSQIELYQIAL"
     gene            <963545..>964999
                     /locus_tag="LMJF_35_2350"
                     /db_xref="GeneID:12982530"
     mRNA            <963545..>964999
                     /locus_tag="LMJF_35_2350"
                     /product="putative aminopeptidase P"
                     /transcript_id="XM_003722581.1"
                     /db_xref="GeneID:12982530"
     CDS             963545..964999
                     /locus_tag="LMJF_35_2350"
                     /note="previous protein_id=AAZ14459.1"
                     /codon_start=1
                     /product="putative aminopeptidase P"
                     /protein_id="XP_003722629.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982530"
                     /db_xref="GOA:E9AF59"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR001131"
                     /db_xref="InterPro:IPR007865"
                     /db_xref="InterPro:IPR028980"
                     /db_xref="InterPro:IPR029149"
                     /db_xref="UniProtKB/TrEMBL:E9AF59"
                     /translation="MSAHDKSLAYPFPISMKMYREQRERLGASLQQAFPEGGHAAVLR
                     AASEVPVNSTDCNYLFVQESYFHYLFGAEIPDAYGAVLAGGKSVFFIPRLPADFATWM
                     GPLPTPQSVKAQLEVEEVHYVDEMEQVLMSCGVHTAEVLKGTNTDSGLEVLQAKLPEG
                     TALATSTDYLYRVLSSQRCYKTALEADVLKYVCKVSSAAHVKVMQIAKPGMSQHHLES
                     TFLHDVYYNGGCRRVSYTCICATGPHGATLHYPDNNCVIEDGTMALLDMGGNYRGYAA
                     DITCSFPVNGKFTEAQKTIYNAVLDAHDRVMRAMKPGVEWVDMHLLAIRTTCMHLIAA
                     GILKGDIETLMAKEIMQYFQPHGLGHLIGIDVHDVGGYMEGCPERPTKKDCCRLRTAR
                     TIEEGLYMTVEPGCYFNTALLEMAKANPDVQVHLCMEKLEEYVNFGGVRIESDVLVTK
                     DGVVNYTLVPRTVEEIERTMAGAPFTKEVEVYHN"
     gene            <966874..>967473
                     /locus_tag="LMJF_35_2360"
                     /db_xref="GeneID:12982531"
     mRNA            <966874..>967473
                     /locus_tag="LMJF_35_2360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722582.1"
                     /db_xref="GeneID:12982531"
     CDS             966874..967473
                     /locus_tag="LMJF_35_2360"
                     /note="previous protein_id=AAZ14460.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722630.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982531"
                     /db_xref="InterPro:IPR013885"
                     /db_xref="UniProtKB/TrEMBL:E9AF60"
                     /translation="MKSKQAPRASAKQTPSVSKKSGHATNKAITTSTASPSTSDLDEV
                     ASLFNTIKQAKAQKHGSAATLQPPSLQRGAGGASVKAHDIKRSSSGAGAPPPSSSSGA
                     QAKPVRDGLYHAPEKSLQMSDNQFFSGTWLREDRAAATTATTSSAVPSTESPEASEEL
                     LRREGVNRIVSMEELSKILSHNTRAGTTPNCPFDCDCCF"
     gene            <968680..>971157
                     /locus_tag="LMJF_35_2370"
                     /db_xref="GeneID:12982532"
     mRNA            <968680..>971157
                     /locus_tag="LMJF_35_2370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722583.1"
                     /db_xref="GeneID:12982532"
     CDS             968680..971157
                     /locus_tag="LMJF_35_2370"
                     /note="previous protein_id=AAZ14461.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722631.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982532"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:E9AF61"
                     /translation="MELFVFRQQLVDRRVLPDFQPATYAPEELLEVRVITDPRHPAYG
                     QAGLFAKSTIPSNTIVTSYSGFIEVFATSCNSRTYTMGFGAVGDDYALDAEFVGNYGR
                     FANDPRGVGTLQANLSAENRFNNRGESFTALVSRRQINAGEEILMSYGKAHRLSATPW
                     MTVQGEPIMRPRLGGVIPFPSFRTETVSADSDSTSASPALATSLPQRSADSANAEDSC
                     AAEGSGLTAGSVSVTDGSASVSKVDGSSAPAIDPAGTTLSAPDTKQPLARSRLVPGVA
                     NDLLWECTQCGMWSICEASTADAPLRCAACATPKLSGARLVSLLSSPAITQAMLLAEA
                     GLDAQGPSAASTSTPPQTQVSAVSITSSTSFSSERTDWPMNVPFLPWQVWDAAVPLTV
                     LAKHSRFETQRHIFVYTVDTGLDREKRGRSVRDAHGIGPTVAAPMPPGTPDAEQSQEA
                     CPSKGSRFQPHSSSADDASLAWVRVRDERPIVTEENRAGRGRRGSAAHGSGRSKRNAL
                     WERQGDLDSEELALLTPGIAALPLLSPSVSVYSPAHALASAASPTKLPFLEWTASASG
                     ERGTSAGEHSGVEQTGSFTAIVSHDTSDSVAGISTRPPLSYLLSTTQEVGRLVVLRRA
                     AASGPSPAAGTPYSPQMTLVRRRLQCMTRRLFTGKAFQPGDVVSYVGGLVRERGDTRC
                     PVSNSCLEIPLRFFLPPRLRHRCGRGACLARSGDSLCDAAEDAALQTFCDRLDRLSLV
                     VTNEFMYCPCLVLEVTWEKNSVAVAGTEVSGCASDSVGYEDEVDDALASCNVALVLTM
                     DALGSPFACAVAIKPIGAFEPLLARAQ"
     gene            <973840..>977655
                     /locus_tag="LMJF_35_2380"
                     /db_xref="GeneID:12982533"
     mRNA            <973840..>977655
                     /locus_tag="LMJF_35_2380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722584.1"
                     /db_xref="GeneID:12982533"
     CDS             973840..977655
                     /locus_tag="LMJF_35_2380"
                     /note="previous protein_id=AAZ14462.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722632.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982533"
                     /db_xref="UniProtKB/TrEMBL:E9AF62"
                     /translation="MTLHSPAGTPARARKPPEAFATSLLNLEVKVLTQALGAENQWAE
                     QGDGRVVFSDFTIRVIAAGVGKDETQRERKTAELTSSGAADAATASGNDGVGAAPRKS
                     VATSDASALSNTVSEFEEDDTADELIILEDTISNDTPFVGENCCIVWNSFEKQLSLCL
                     MYASEEGYSASWSALVALQDKSYPPFRFDLLERCRPVSERTALAPGDSTSSLTPSTAA
                     TDKTEDVVLPYSYFIHTKYDPPLGFIEHHALSLSIIEHRHATNPALYADKETVLKMLN
                     MANADLLDYLISEDTFPLLLSGLQCTAAPRSWSVPEPLRLLHIPEEVITFIRKDRWIG
                     FLQNTVLPSCGAADSVAELIAKYATMSRRVRNDIVCALLTCDSMFSEACEALRVLPQV
                     TPAMASGGSSARNRGLSVEASLSVTSLSSEGRCSMSGVGNGAPSPSSTPPAVDTVPPA
                     QKAELQVLAHLRFFRELVTLSIAELGREMVGPIVGKIYQSGVLEPLSLVAERFAMPNG
                     TAAAFVKHIMDGSGGALNGARRNGGGGSASNSNSAAAGGTSSTANCYSLAVEQELAAV
                     LDVTLVRLNERQEEQLMNEHVRSPILADPVKYNGIVTFMLRQLIVGGPIGAAFATSGT
                     GTNATRSSLSIFPPPKRILRDSMSSTNPFALFHVLGLHDDEGSAASERKLDSESTGIR
                     NRFHNFIITKYIAHATRGVMTPVPLPPSLGGVVGSTRNIPIVQFNNANASQNGGARPV
                     HQDGNGSDTASATVGAPNTCPAAGGGGSGAASPVLPLPQGITPALIRVLEYMVNLTNN
                     ANRELILKTVFHYKSHIWHFIEGVCDTLCGENGAGARCQIGLDVLCGCVRFLKVVVTQ
                     MTVITAEVDENPLSSYASSREPLSPQLVTTICRQLTVERDTFGYFLKAYNELGGRRRD
                     SVFHSSLLSVLDIIGKCSVHEPEDSTTNNLRDVRDYLFFKHFTRLPEVFACRYREALL
                     SEVTVRLGQEATHSPNDSVSVLSSTAGSELTRCSSKLRFVDEVDAVSGGVDGTVVPSS
                     VVSPAIMVSMANAEEKQRRRHGRSSMEQWNATANIAMGSPLQVRSVASLGLADDHGTR
                     ASPSSSPPSRKSSPLTISITRPGSGSNSSSGSAGSSRTPAGDLLKVNAAQHNGSSVNG
                     DGPLAQASPPSTVVPTTRKADTVLRPTAPKEEKPPARPRNFASVLENPSRTNAAASGE
                     QGRKSRSMPNATAKHAPPSPEEVLLSRTGQSSVPQSVEHANGTALPFSDNVVLPKIKK
                     LLSTGGKRS"
     gene            <984295..>984753
                     /locus_tag="LMJF_35_2390"
                     /db_xref="GeneID:12982534"
     mRNA            <984295..>984753
                     /locus_tag="LMJF_35_2390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722585.1"
                     /db_xref="GeneID:12982534"
     CDS             984295..984753
                     /locus_tag="LMJF_35_2390"
                     /note="previous protein_id=AAZ14463.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722633.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982534"
                     /db_xref="InterPro:IPR016046"
                     /db_xref="InterPro:IPR022800"
                     /db_xref="InterPro:IPR029040"
                     /db_xref="UniProtKB/TrEMBL:E9AF63"
                     /translation="MQTSQSLHTAPAEKEVEAPPQLPLTDGRCYACRRCRRILSEVQW
                     YATGCVECSATMGVPDRDSLLDFATPHFHNFIGLIAPGQSWVARLIMKSREPTNGIFA
                     ETLSDDEPEDEENEIEPYVGDADEEEGPALLDGEDGAAEPVHELAAEAPE"
     gene            <986134..>991515
                     /locus_tag="LMJF_35_2400"
                     /db_xref="GeneID:12982535"
     mRNA            <986134..>991515
                     /locus_tag="LMJF_35_2400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722586.1"
                     /db_xref="GeneID:12982535"
     CDS             986134..991515
                     /locus_tag="LMJF_35_2400"
                     /note="previous protein_id=AAZ14464.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722634.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982535"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:E9AF64"
                     /translation="MHSVPAAAASHVAAVNSAVARGAEASSAADPSTASEFEACCRAL
                     SHKVNKAVVEQLPVLENGTVVDLSHNYVGAAGFQAIAVILQHNPNVTEVRAPRNGLTN
                     DAVVLFCRAMRGHQQLSALDLSDNPDVSLAGGLALVNLAQQTPSLRVVKLKGTHVLAA
                     VFDKLTRALEYNASHHGTTSPSVVAALSTAAVVASSSTSPSSAAVAMADEARTLQTLR
                     ARVEAALEEGYLIPPASPQTGWRVLDVPILAPPLLFDNEVCLLCNEVFPRLNQEFASH
                     RVILCPVVVGGGAKAVEDNDKASASAVWLRPHRTAGSYNRALHFRPASDITSIVERGR
                     FVTIELIGDLSGDYAQLGASAMLRLQGIPQSAPQRVESHDDEEPEEAAAPLQPVLYEA
                     HEAALRYTRWLIVATRRDTRTLKVPAALAPLLTADPIIAHPDRHRSVVRAVFVGDEGP
                     SPSVAGPAKVAEGCRTGTTSAPGAIPTSLEWDYATEEYQWRRHVDWREHVVATAPVAE
                     LVIPQYTATFDCIDAQGGVRLKHLDGFQTAVYARLRTVLEACVAAEASKREAREAAES
                     DAGVTSLSRLLRSIGTQRAWDTTYIQALAASSSGAAKKNLMNRMILYAANPPSRNMLL
                     LHGTDAASLASLMARGAARLQTLQHAYTLAVYTARSALLHEEPTELRSVMTHVVSQLT
                     KDAAVLRYVNAEVDIERLSGFFLQVISGSLASKKVVRPAHASAATTAAARAMCEAGLP
                     GYVAQYTLNTDEEASAGNTASTHAFVVLLDGLEELAMPVQPCGALVHPPRSSGNIAGG
                     GGAEPSSWSTERPAQMPCSAAPSGATSKTQPKPPKTLLDWLLPRALARYVRLIASCVS
                     SSAAFSSFCHLGRDSVDMLGFGAVSANEVEQYLSPASLARVGLVLSEDEYECARSKRD
                     APIAEYMNYLLDAARSVHEAPGFLTQMQVIQTFPETLQEAAQGVYDRLVHKFGLPVTC
                     NVLGLLMASRWGLLLPELRDLLPSLSMCRLQELLRLLRPALEQQAPVAAAEMMGVGSG
                     NVLLGAVRLTAPSFLEVVQRESLQRVTDELQVENDQRIWHTRLAQYYLSIVYRWLQPG
                     AAADGVPAKVRRVNDASAAEAYVCPETQALHRRAMKEVIYHMTQSGDFWSRMDVTVLS
                     VPFMEQVYELGLGYAYLRDLTAAFNERYQRHLLSEDIGEPSWQQYPLVAENGGAKITA
                     MAADEAQASGTPGSAESSRYALPAVLIRMRDYICFARQYGLLLSLHPTLVAQVALQLP
                     ASLLNAVQRDTVTFLCRQLQDNGGLRGSRASLSRVFFSMTSAAAKTEGKQPTHLRPIT
                     CAAFLPNRLFVVTASSDRSLAWVNPESGKVAWYARQPTAAVESLTVCRTSAYVAALSE
                     DRTVWVYDGLQGTLVSQCRGSKWFDAPIASLTFSARGRYLWVVTTDARVRCFACESGQ
                     LRCTMSLSKLLQVCVDEVSANGEMTQLVGAGATAAEEGMPLASGEWRHRRHYLHLLVD
                     AEDDEVCTTVVATELRQWRLRPWDELLLTAEKDGRPGHNNTTLIACEMTMSCSLAKAP
                     ASASDGPVGYKLMKLWEPASVRSPDMCILAAPHTEPEVQLFTVEHTTGTPRLVVRFPL
                     VAPSGGNSGAAPTAQEVSVMCTSPDGRWVAVGLSCGAVSLFSIGAAYHAWQRQQQQHQ
                     TDAALVCRPTCVYTSLMPTPGMSAAPLRSLTFHRDGLFLFALGSCLLCWRLPDAASVT
                     LQTDAAEAVRNTADGQYLCSNTPTCLAVLPPPTPCMSGAELPRNIAEVAVGDDTGRVT
                     LLTLWRQLS"
     gene            <994026..>996797
                     /locus_tag="LMJF_35_2410"
                     /db_xref="GeneID:12982536"
     mRNA            <994026..>996797
                     /locus_tag="LMJF_35_2410"
                     /product="putative ubiquitin hydrolase"
                     /transcript_id="XM_003722587.1"
                     /db_xref="GeneID:12982536"
     CDS             994026..996797
                     /locus_tag="LMJF_35_2410"
                     /note="previous protein_id=AAZ14465.1"
                     /codon_start=1
                     /product="putative ubiquitin hydrolase"
                     /protein_id="XP_003722635.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982536"
                     /db_xref="GOA:E9AF65"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:E9AF65"
                     /translation="MSDTTGTSSVHSQRQRCNIVMQRRRRLCSKSSTVRSSAQRISRK
                     PSAVDAPAAASTVVPASPVLALQKLGSARKAARDTYGNTTPKANGLHGYGQRSRASPG
                     DGNNVDTALEHTSLPATNRSDELPNVFGTDSSSTARVSTLHDDSHVCPDSASTKGPLK
                     GASGAMARDALSFDVYGGPDVFKPHPLRLLRGPRRGAGSGSAESTSAAEEGSLCKQTC
                     GAAFNNAGAAERGTRGRSLLAYSCNAATQDKTTPPPSAHLNQPSKGSYPSSTPAAKGF
                     PPRNVSENLGGTIRAIATINNADSSNVLASPPLPVSHRPSVGSDDDAASITSARQPVR
                     GRDEAGAARALLVVPQLFHRNGSTPPYQHLSPVCGSLPSQSQAGMMTVAETKSTGSVD
                     SFSDKGSFSSRALRVEPQVPPMRPSGSAGATKKSLLSTSTRSGGSASTKVPSAHSIAR
                     LHAAPIPLRNFGATCYLNSVVQCLLCTPGLLRKLNIDRQRIVRECEGRRRSEAKQKPD
                     DTEGQSCAERKAPATSSLIDLGTACAAHHVAVQQLLVSLKAACAECNNEFSSNGQKDA
                     HEFLITLLGVIDKEVCRSKPGNQETFRDFEDEKKSDVYARWVSWMQQENDSTVYDLFG
                     GITGCTVKCSSCDLTSYRFEVLLHISLPISYRSRSQGGGTDIELSDGKFDGKATPKGV
                     ATADELLREMFFSERGESLNGPMQVTCERCKQLRDKRIWYSMEYWPPIVVLHLKRFNN
                     AGVKDETAVVFPYTFHPHRCVKYQLYSVCCHRGTCSSGHYTAYTYVQADDKKSVARKK
                     APTVAAFSDIYHPLLKGTRSDRIFSPQTLPRRGGAGIFGWFDGVGIRNGGSNARASSE
                     ALSPKRNGRADGKDRVRSAGRTAKAGKWYLCNDKNITEVTALDVLSMTKEAYILFYRR
                     VDDGDGTII"
     gene            <1000040..>1001293
                     /locus_tag="LMJF_35_2420"
                     /db_xref="GeneID:12982537"
     mRNA            <1000040..>1001293
                     /locus_tag="LMJF_35_2420"
                     /product="putative phosphoinositide-binding protein"
                     /transcript_id="XM_003722588.1"
                     /db_xref="GeneID:12982537"
     CDS             1000040..1001293
                     /locus_tag="LMJF_35_2420"
                     /note="previous protein_id=AAZ14466.1"
                     /codon_start=1
                     /product="putative phosphoinositide-binding protein"
                     /protein_id="XP_003722636.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982537"
                     /db_xref="GOA:E9AF66"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR015404"
                     /db_xref="UniProtKB/TrEMBL:E9AF66"
                     /translation="MAAGNSISVKVDVPSQVKGQGTLEMSYYIYPITMRLPGFMSDAR
                     FNRRYTDFETLRGQLCATYWYCIVPPIPEKESVQDKLGKLPRMVASAKETTASEGDLL
                     EYRRISLRRFLQRLAYHPILGKSDLLQKFTNDNEWRQCIRDPVKPPRFIVSSSLEEIA
                     RSWVPSSSASGAGAQGSGGAAGGGGVSQTGAAYQSALTQEPVDEATWRATSEYIGELE
                     SNLKNMRNLLEALVDRHRRAASAVSNFAASFGLLANGEEDAELRGAIEGVRDCGRKVA
                     DVYSKHADNESTRLVSTLSFYVGMCAAVRETLNHMFSAHQYLRNLQKKGQELQASAMR
                     AQSANQVQVQSELHFVNEQRAHLEEDLMGAEKTFSEEFVLFHENKQYDAKDMLKKFGM
                     LELSFSESMKQEWDALRPMLESLGT"
     gene            <1011693..>1014044
                     /locus_tag="LMJF_35_2430"
                     /db_xref="GeneID:12982538"
     mRNA            <1011693..>1014044
                     /locus_tag="LMJF_35_2430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722589.1"
                     /db_xref="GeneID:12982538"
     CDS             1011693..1014044
                     /locus_tag="LMJF_35_2430"
                     /note="previous protein_id=AAZ14467.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722637.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982538"
                     /db_xref="UniProtKB/TrEMBL:E9AF67"
                     /translation="MPVVSSFVAAVLLGGAPILLDAVSVESRAHEGRNGSTLSSPEQD
                     YSDPVASASKSTALSSSSSGTGSSDTTRPAHSWWQDLCGNRAYGRCFLTYATSIVCVG
                     VLLLAVGSWCLRRWWRYCTRWLSRWRRFVDDASDAENDSAVRSGDAVVSRRGLLSGHQ
                     LDSQDVPDDERAGRRAAESDRALGTFFHADSCIVEGARLWGARRQTPVGLFYMSTQPT
                     DSTEERRRTDSIAVDAGEGATDNPRDSRNLSRDADRTPSASPRASASLSHMQEVLCLA
                     TAITDSSDTGDDRGDHRGVSSCESSMRDRRCSCESDRGGEAHAEVERPALRGAAADER
                     GSPLHIRGDILTHLIHFNSSFDAEDQLLTSDCRNNASASQQPRGGLAAMTRSTASDAS
                     VESSSHTPPPPAHLAELSRRSSASCVCLFGADAFHDTPCARVALPHVGTAIFDAGMTH
                     HADQTIADGLFDTGCFPPTEPSSEALCTTVESYISEVEYLALPSEHESTAAPSPVPNA
                     ALHVPFTSLTKTALPATDALSDRLDMVEEKSMEEGTDGAALSRNCVPTPQLRHLPAAK
                     PPKSLRKRRSERYCEPWQPVLAPCKTLPLAAAAVVTTLSPLSPPSSLLCNRVQRSPGP
                     NALEDDLDDLMLADEVSSAQSNTTGNGSRVFTDSSLITSRALTPSAESEQEMAATPLV
                     MTVAHCSDANVCLDLEPKTPLVSVNNPQPPASPPIAMYPRTAGSARTLMGKSDEGSHG
                     QFAWSPPVDGPRPALNLSVEERTLLLKSKKWLFPLIDGADEIE"
     gene            <1016296..>1017120
                     /locus_tag="LMJF_35_2440"
                     /db_xref="GeneID:12982539"
     mRNA            <1016296..>1017120
                     /locus_tag="LMJF_35_2440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722590.1"
                     /db_xref="GeneID:12982539"
     CDS             1016296..1017120
                     /locus_tag="LMJF_35_2440"
                     /note="previous protein_id=AAZ14468.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722638.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982539"
                     /db_xref="GOA:E9AF68"
                     /db_xref="InterPro:IPR002529"
                     /db_xref="InterPro:IPR011234"
                     /db_xref="UniProtKB/TrEMBL:E9AF68"
                     /translation="MSSLAFMLRQTVVPVVTRGAKPLNFPVRRIYCVGHNYDSHAREM
                     GGAINRTEPFFFLKPTDSITTDLGNHTTPNATVSIRYPPVTECYHHEVELIVALGYPT
                     SKKTMSPESAQGPGDAHYANMNIEDVHDIIYAYGVGLDMTRRDLQLVAKSNGKPWDLS
                     KGADGAAVVAPLVLSEDLKEAHPEMFLTLDKDETNVVSCGSIFLQVNQNERQRSDLNC
                     MVSSVAELIAQLTKYVTLQPGDLLFTGTPSGVGAVRRGDVMEAGIQGLGTLKVNVI"
     gene            <1024005..>1030940
                     /locus_tag="LMJF_35_2450"
                     /db_xref="GeneID:12982540"
     mRNA            <1024005..>1030940
                     /locus_tag="LMJF_35_2450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722591.1"
                     /db_xref="GeneID:12982540"
     CDS             1024005..1030940
                     /locus_tag="LMJF_35_2450"
                     /note="previous protein_id=AAZ14469.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722639.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982540"
                     /db_xref="GOA:E9AF69"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9AF69"
                     /translation="MDVGVYDPKAQVKAVAAELKSMNTTRLLAAVNVMSTSLVMGFEG
                     YLRKFDSATAIPLLADVCETFIREAAQGDLIVMALRALSLIMEHVPSSYEAAQGFHVS
                     LMQFSSQAIHRALCTEWKFVHSNNALMIEEGLRVMRFVSKDDMTGEIIQHALVGDLLT
                     LCTDPHPLVARQALETLLMMSSKVVMPSELGKRNHSFAAGILSFFKSKKKSSRTSSDT
                     GKAGQMSVSSGRSSTKAASAEDIAPYADHPTVAQVENVILPLLVSLIEQCAKSFTSIP
                     EHWALLELSLQCLGTLIERALICHRPHTARALASPLLPKILFQLILDTESNVTLEPSV
                     RVDRILLCETTLTLLTYCHRYLILESLQLPEARRFFRLILEDSTEEITTLLDDPFPRA
                     VIATRSTQRRDKDHITSIAALQLFVLACPTVPPNAFGLKPKLVLPVHQWMWEDELRHY
                     NRLVEEQCLSLERSWTRLNPRARISVHVKQLNVDLHTMTMSKAAGAGHRNVCRSYVPF
                     VYHFADEMTLRPIVAVKEAGPCAEDGTMLTWKPTASAMHGSKTTASASRAKQVDENTS
                     RSSSAKRSRRKGVNTPSLSEGEVTNATDSVPSTVVLNTQVEVPEDHILLAEEYFGFLC
                     TFAKNTSGQMAKQVATCACASMLQLMFLSGASARFEGLMATAILSMCEMCREALISAD
                     KATKAVVLTMIEWMLYHPMAEPCQFTESALRCGLLEQLDMLSKTTPLVCNKPTRTATL
                     VEKASALMGCIVEKLENCRAAHVGGVGINGSIGSKTTLGDAFLSPTMLRVQTVLDELR
                     LCHCGAVKGTVTATSSSSSTSRARAADRNGSPTRAIKALADTHEGAIRELLRIFNESN
                     DITAFEVFTAGVASTLLYYLFGDRTLEDMLGGTSMFASGASTSTSRHETTPLSEVHTG
                     PIDRNTSSWTAMMASGMHVADILAMYVVEKRLRCFIQCAVAYPIGMRRLVHTLAANLS
                     LQSCLPLVESVVTYDKVVCKTPLQAYQALSVISPLISLCGDAGRRISAAIKTVPHGDA
                     VLLPRSSSSAIMAGDSSVPAASSSNGTEPKQRKTTLLASSFARSRTESWWANDPTKVA
                     CMAKECCMAGHRLHHMERYPQPRRCDKCNRSISSSHSCRTCNYDVCDNCYPGYTGNVD
                     LIRSLSTMERNRVHLCATIGDLERWFRTGSTSTKGTESAPTSQSSLHHLERFTTRVLT
                     FLKRYTAVHNSSAVSNIPRASSATGSNFLAFANPTASSNLPVELAEKLLSHPNVVRRL
                     TYKYLSRFSTRGALMDEGTPITPDIAATLDVEVQRVLRTAAERQAAESIVQEAVEERY
                     ILYRASCGMLPFQETLLSTLYRRAFALGDRQVLLQLENCLLRADGAVEAPLTLEANSS
                     VTVANPAALPIRFNANVKVTKKAKSAKSPPAVAGACSSIAAAATAAGEPVTTCVEKLA
                     EAREFDGHRVGLNQNYLFHHFESDSAAYCACGAHSRAEFHTEEPPALTFTPPAFAHRA
                     DMLLLIILHRALFEETHGLIAYAGEAKDIFGMDDSIFQNNTITTALVRSFEASALRVS
                     LLPPRYALPRWVNFLLREGRFLIPLSVRERASRFLAYGARRAFIQHMRVFRSQRNDRA
                     VLILPGEWARLSNHKFAVSRDEFARDAYTMLRKCCDARFPISIEFKGDVGVGQGPTAQ
                     FYTLLAAEVSKCCTRLWRDSDDNANGSSDNAAAVSNSSAGIVMATGSLMVGLPPKSLP
                     PRRSSITPITSPSRMGTSRPGSVTNGAGGTVSTSRLGSIPTQSSLRNFARADSAHPTT
                     PSATLSPSPSMTTAAEAAAVLIPPPEGFYPRHMDGVQRYLEDIDSFPVTPLLRCSHSH
                     TVPDNSSTHALSHSSSDHFGSTPTRKGPAFTGHASTAGAGDHRTNSNSLNASAVQYDL
                     SKAAFLVDRNVGLMRDYVLEQRERAKAYYVIGAALGRAFVDEQVFPLPLSRAVAYFIR
                     RGVPAYQCVVSDVTHIDPPPEFPVDLFELPLTAASWVDQGIADSLACLSTMDSSTLAA
                     LDLRFTLPGDDSVELCPDGAQILVTKKNLRLYQRRVVGALLYESVAVPLYFLTMGCQD
                     VVPQEALTVMDVKELIGVLCGEDKNPSDPLWTTEEIRSVLVGDHGYRNDSPQLELLAK
                     VLGQRLTPAEQREFLLFCTGCPRLPIGGIRALGAITVVRRSNAFVDEHTEVLGGEAAA
                     ATTSSSGGGGALDMEGEEDDGGGGLMGGLYDHTAQSDVEDSPSGQGEAPSHMFSSVYP
                     AASEEPGGMLSSFFFHLPESEWALPSVNTCFRYLKLPPYPSEELLYKKLLMSIMESGS
                     SFELS"
     gene            <1032715..>1034202
                     /locus_tag="LMJF_35_2470"
                     /db_xref="GeneID:12982541"
     mRNA            <1032715..>1034202
                     /locus_tag="LMJF_35_2470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722592.1"
                     /db_xref="GeneID:12982541"
     CDS             1032715..1034202
                     /locus_tag="LMJF_35_2470"
                     /note="previous protein_id=AAZ14470.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722640.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982541"
                     /db_xref="UniProtKB/TrEMBL:E9AF70"
                     /translation="MKVRAIFLNFSVQLTPPSRLVILRNQSVFFSALLLNCPPLLPLP
                     TEASPCYAVSESQPYARKQSCIITAARSAPSVDHIQVVLCRPHNSLLVCPSSHARSST
                     AVMATEDELRELLPKMRFNKEFKKKQKYQYKKRVEAREKEREIVTGKRRPASEQIQSA
                     SDGAKTKTTAAKKSGGAGRAGTKRKPKTRVPKLKVANVETGKETLTKKKARELVQENR
                     KKKACAKKEPKLTAKSTRAGAATAAVVSSETLEGKQSKARVTKDELPATAAQAASSVE
                     PTQTLTQAERDRELLARAIRGDDLLGSDAAAGVADDAAFIRQDPSLYPDHAFLDDYAE
                     KKHAEAVSADELLQNAHHFFKKLSKQERALNKVAKEHINHLRAVNRRGGDKQGFRYVV
                     PKNVKQVVRELLSAQKARDGDEDPETLVDTEQLVSTFGGDGVAETSEKPVRRSRRRRL
                     RTYSDFYQFQVSRRWTRNAENFLKRSRSNKLLFEAKKHQRTIKHF"
     gene            <1035608..>1036627
                     /locus_tag="LMJF_35_2480"
                     /db_xref="GeneID:12982542"
     mRNA            <1035608..>1036627
                     /locus_tag="LMJF_35_2480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722593.1"
                     /db_xref="GeneID:12982542"
     CDS             1035608..1036627
                     /locus_tag="LMJF_35_2480"
                     /note="previous protein_id=AAZ14471.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722641.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982542"
                     /db_xref="InterPro:IPR011687"
                     /db_xref="UniProtKB/TrEMBL:E9AF71"
                     /translation="MGRQKSRNLWNDGEGTKSVCRPQQVTVAKGWRVTPDLLPAKPLA
                     PRRRKYAPIRPNNRDAVAIPLGGQSYNPLDEEHQEALAKAVRQLSKKKLKDEKFVKMM
                     TMGRDKKYTGNLSADKTWEEEVQETEPATAKTPKKKRTKTAPASTGASSSAPSSAPSP
                     VTHNGNKAKHEKVAAAPAAVAKNGKTAKKQKKKTKKATAEEAKRAMTHRRHPKRGVVA
                     KETDELDVLLAAHKATACKREVARQKRRAAKKANLAIKHYGRHYHTPLVLDVTPSDKL
                     VGSLRHLSGGYVHPALERMKSLEERNLVPARMRHTYNKRKVLKPKGEVRVKREEFGVM
                     PMTGF"
     gene            <1037682..>1042652
                     /locus_tag="LMJF_35_2490"
                     /db_xref="GeneID:12982543"
     mRNA            <1037682..>1042652
                     /locus_tag="LMJF_35_2490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722594.1"
                     /db_xref="GeneID:12982543"
     CDS             1037682..1042652
                     /locus_tag="LMJF_35_2490"
                     /note="previous protein_id=AAZ14472.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722642.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982543"
                     /db_xref="GOA:E9AF72"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024095"
                     /db_xref="UniProtKB/TrEMBL:E9AF72"
                     /translation="MSFLFKAVLGQRVVHPPPPESDKKLHVAANGICDTKSSSAPATK
                     PANASLLNTGAHGKISAPKPSVDAAASPSSPAGPSVTASASLAGPQSRSLSSSPSPPP
                     PRPSTPTQTLLLRIEGCTVAQDIRDAQRDLLRCPDLPYALDATSLKSLLDLLVSYADD
                     ESITEPTLHLLANATDLDLYPDKLESNRRIVEVDAAAKRRARDALLQPLFGAVPSLLG
                     SMKTTAPFWSRYYVVVLLQRLEELEPYKLNQSLLGARGIGVLLDALNEDEHNFLLRNQ
                     ALLLLTSLTLADAELQTLLAFHNAFDSLFDVIQREGGVRHGRSIVQDCLTVVHNMLRS
                     NKATQKFFREMGCAARLAALFDSVPSELAACTLVDHSRSSGDSSSPSSIYPQPRVLTE
                     KLEALLNVTKTSESMLNVLMSVSILACVLRGVDEGEEERHSTQDALLRCGLLTSLARL
                     AFCGLLIDDAVRIEAVRVLALLLRDSRRAVEEWLNLPPVTTLVRATLPYTVQVWPAPR
                     ALLAYVCESTDTTLVSAGVQLFTAVLSVPACQERSVGVFLSGLVSPTLQRGDHRGVRE
                     AVQSWATTTSPPSSLSAGTAGAVNADAQCGAALARVLLSSQTSAVEKFYTAQVLRALV
                     TVPGATPVLQDLVNAPVPPHLQTSTLDGLVKAQPGWTLSSRLPPSFFNYTVTFVLFCL
                     GGGAAAQQVNTAALGAYVGALLAWMGSSPVAAAAFVEEASWGETLLHQARRDGAAHFR
                     LWPSVLVASACVLSTTATIAAAAPPTAAAAATALTRRFLQIVGGGAALDTILFDLKAS
                     TPVWQHPVASGLRTQNPTPYDEAIVGLVEQLVADFKQLLDSVAESASQVARATMALRP
                     SIHSAQLQPDDEQMECRVASEPVAPPLPPPRHAGPLASMQQPPSSPALASLGGFGHSS
                     MPPGNFRAESSLPQPLAAPLHPVEAPLLADAHACDLAALQAELEAVRAEKVNLTNALR
                     EWRERAEQTAAQCAALEKEQQRRAAAAAGEERIRLEDAATSAAEAAHSHAVSAEVVEE
                     LRENIRLLEEALSSKEEEHQQLVESLNMMEEQLRHVSNTTAAAASQQQEARQQRQHQQ
                     EQQHLPPPDVIAAMEAERNAVVEQLALSQEETARLQRALQGISSDYSELLLLVAELNE
                     ECVSVKAGSSVADTPARPWPEDAGLSLKRVVEAPHEPAVYDGAMTDETFFSSAEVLPG
                     TAATPQPVRWEGTMDTAATGMLKVQGQEPVPTTQARALALAIEGQPSADANGRPDASM
                     HAYEAAMDVTLHHSGARTPTQAFATPLPAQRSIPLSAAPANPLSISSLAVSQAEATPP
                     SLAPLPQPDGEQQQHADQSPPPPASHAPPPPPPPLPATAHEHPFQRSALQAPRYPDLP
                     TIFFGGGDGASVGAQPPQNSVSNAAGEQRSHDGRPPPPPRDLLPPAAQCSPQRSALSH
                     RFPAPRVECALLAEDSPQNSDPVERQHRGGLVDGTVHDSARGVPPWVCRSIQETPVTD
                     NMLEARYNTPDISATHHSAQLRAEEAPAAAVVTTSGAALSNPFLAGAGSPEDNSIAMA
                     GGDCTLLGSGGDRAMGVEGARDRGAARWTTRESSLATNAPPQPQTAAAPNNSAGSTSE
                     ASRRGVPETESLEANNPSSTPTTAYNPFADLNASGDEADDDIGDLR"
     gene            <1044565..>1046232
                     /locus_tag="LMJF_35_2500"
                     /db_xref="GeneID:12982544"
     mRNA            <1044565..>1046232
                     /locus_tag="LMJF_35_2500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722595.1"
                     /db_xref="GeneID:12982544"
     CDS             1044565..1046232
                     /locus_tag="LMJF_35_2500"
                     /note="previous protein_id=AAZ14473.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722643.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982544"
                     /db_xref="UniProtKB/TrEMBL:E9AF73"
                     /translation="MTQPAAAVAAAAPAQTAPILGECVLKLSRSTTYEPPLYLFPELL
                     PPVPQGTPPLPVWDAVADAVDIAASSWRVADATQLIAAGVAAAGTSGIKPSTGVERRP
                     QAMVTLTSMIAENRLLAAGLDATVLERDAFSSAAIITHLAALQARMGLSDEEGAAIMS
                     NHFINLLAWQKLRELNGPSLHAAVSRAEQKVSDEEAAGSAAFSPSHAAPPPSRKRSRA
                     DQDNDERDVWLPSPHPWATEAELAASDGSGRFVAVSEANVEQQVELLRTLAELYHRPW
                     RTLASRGQQTDFVVPPGTVNVTSPFADNSKVPGALLDPATALGWGATLSSSLSTDYFG
                     GVRVAHTACFYAVVLSAGTPTSAGKSVAPAPTRLPLDELTTYFGRESGVRGAAAVAAA
                     AATPIAGALAPYTTHPEVLSRFQFALVLRPVYEHAADANEVRRPDSHLHVGKREPSTD
                     DEASESDADAHQGHAAVLHTKRPHHYTLWLVNYGRNGVRVAGRGWVLSEPRQLQAGDV
                     LIVGSEVQLRVEEHFSAAAARAPVVSDATLNTASVSSSQVKQERIEG"
     gene            <1047582..>1047917
                     /locus_tag="LMJF_35_2510"
                     /db_xref="GeneID:12982545"
     mRNA            <1047582..>1047917
                     /locus_tag="LMJF_35_2510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722596.1"
                     /db_xref="GeneID:12982545"
     CDS             1047582..1047917
                     /locus_tag="LMJF_35_2510"
                     /note="previous protein_id=AAZ14474.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722644.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982545"
                     /db_xref="InterPro:IPR013880"
                     /db_xref="UniProtKB/TrEMBL:E9AF74"
                     /translation="MGISVYSLVSAVVLCLNALAILSESRFLSKFGLATPQALQEGFA
                     PQQDTAFNDMVPSSFDADFGSNRNGGVRSVSSVKLQIGSLLHSIRLLMRWPLIFVNIT
                     LIGLALIFG"
     gene            <1048826..>1050016
                     /locus_tag="LMJF_35_2520"
                     /db_xref="GeneID:12982546"
     mRNA            <1048826..>1050016
                     /locus_tag="LMJF_35_2520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722597.1"
                     /db_xref="GeneID:12982546"
     CDS             1048826..1050016
                     /locus_tag="LMJF_35_2520"
                     /note="previous protein_id=AAZ14475.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722645.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982546"
                     /db_xref="GOA:E9AF75"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:E9AF75"
                     /translation="MSYSTNCDEGQVILSCSHVFHARCFRSFERYVRAQQRADALRIG
                     EVSAPLACPVCRTQSYYKRIFYEGKAVAQRAAIVKVQAAVRGLLARRAYIKIKLQNNP
                     EFRTRYVQERLARLSAAWQTFCAEQEQRRAGLQTALTVQQEMARAAFLSEEAWAEIWR
                     KAVHGPSTSSEPGSSAAPSTAGASVQCPICLELIHCSQCPGTGAAASHAGGVRRLTGK
                     DAVAAMWAAYEARKVAKRLPSVEPKAARASAGALVRSAVKGAAQRKTGNSLTPMPGAV
                     ASVRDGKVASSRAPEHRAGRQKGFAQPTAAAPWPEHANAFAALSSAPGVDAVGAHEAA
                     VVLPQSGILLSCGHCFHAACIDCYERFHERRCLDMVEQDGGAVVAFPSRCPVCRSGYA
                     KHPM"
     gene            <1050826..>1051842
                     /locus_tag="LMJF_35_2530"
                     /db_xref="GeneID:12982547"
     mRNA            <1050826..>1051842
                     /locus_tag="LMJF_35_2530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722598.1"
                     /db_xref="GeneID:12982547"
     CDS             1050826..1051842
                     /locus_tag="LMJF_35_2530"
                     /note="previous protein_id=AAZ14476.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722646.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982547"
                     /db_xref="InterPro:IPR008978"
                     /db_xref="UniProtKB/TrEMBL:E9AF76"
                     /translation="MAGIDYSKWDKLCDSGTSSGTEYEGDRDDKGHDDSSRAPQVTRL
                     EYPSRVTLGPNGVQLEQVPPKASASPFPGTCAPPEETDNGSVAVARCPIKEESFHAEY
                     DTGASNASSHATGNTAGRRDDDQERMGATDDDEDLLYESLARNGGREGSHHWWTQTED
                     TVTVSFLVPWETKGKSVTEFRLYEARSTTALESELLQAHLEITILVRPACLTSPSSGP
                     SASAAPLRIHQVFRYPVKLSEDLIDGCWQLHFMPRRHLRLLVVQLFKEPVGLGMTLWW
                     DRCFVTDTTSVIADTQTIPDRKRRMEATPGSKEKAGQFRKVWADAHEEFRRRAQERKR
                     KIIE"
     gene            <1052546..>1053193
                     /locus_tag="LMJF_35_2540"
                     /db_xref="GeneID:12982548"
     mRNA            <1052546..>1053193
                     /locus_tag="LMJF_35_2540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722599.1"
                     /db_xref="GeneID:12982548"
     CDS             1052546..1053193
                     /locus_tag="LMJF_35_2540"
                     /note="previous protein_id=AAZ14477.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722647.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982548"
                     /db_xref="UniProtKB/TrEMBL:E9AF77"
                     /translation="MLNKADLVVFYFTYAALMMALMVCSVLSPIQVRSVGERNLFVYG
                     VALAYNPPPSTWLAASDRASKSSIDIMDTSSGSSLPIEGVRIRTSLAHLPASTLTRCM
                     TAYLVFASLCLLTCLSLLVSLFVQMLPLKHGRAAVLITRVLAVLVPLAAIACFAMAAV
                     LGLQSHLYHNVAAGYYTDARRDSPVRKLHSGFFSSVAAAVIGLLVVLLSPVLRMW"
     gene            <1055959..>1057326
                     /locus_tag="LMJF_35_2550"
                     /db_xref="GeneID:12982549"
     mRNA            <1055959..>1057326
                     /locus_tag="LMJF_35_2550"
                     /product="putative RNA binding protein"
                     /transcript_id="XM_003722600.1"
                     /db_xref="GeneID:12982549"
     CDS             1055959..1057326
                     /locus_tag="LMJF_35_2550"
                     /note="previous protein_id=AAZ14478.1"
                     /codon_start=1
                     /product="putative RNA binding protein"
                     /protein_id="XP_003722648.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982549"
                     /db_xref="GOA:E9AF78"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9AF78"
                     /translation="MADSSCTSAAASVATAAPAFDFKPLQKSNVDLFATAPQVKKLTR
                     REKDKMLRELEVKRAKPRAVDDSSGAAGKGRKGQPRQSDRSAAVAEVVRSATISSSSD
                     DASGIGNKGEKKKSLFETVFDTKEVEKELAAQEDRRSRKRSKKQVLRHALHSNEEEDA
                     RTVFVGNLPNTIHKRDVEKIFKSCGSITAVRIRCQALEELDEQHQNMGRAVRVLRGEI
                     KKDAKYSATAYVLFDSAKSIASALEKNGLIFHNRHIVVTTMDVESRAYPPETSIFLGN
                     VAYNTTEEDVWSFFQEHGIADVKRVRLVRDRETGDCKGFGYVEFMHASSVQPAIETRG
                     DKLNGRELRIVHVNKSKEVKVATKSRREKRRSEHAGGRGGAEACKRSRSGGDGDGGSR
                     GSAGYSNFKKPRTDSDLPSWAGLTTNPRRKMPKDLRPLVEGKVEFKPRGPRAPVKRKT
                     RNPEK"
     gene            <1060086..>1062581
                     /locus_tag="LMJF_35_2560"
                     /db_xref="GeneID:12982550"
     mRNA            <1060086..>1062581
                     /locus_tag="LMJF_35_2560"
                     /product="putative cytochrome P450 reductase"
                     /transcript_id="XM_003722601.1"
                     /db_xref="GeneID:12982550"
     CDS             1060086..1062581
                     /locus_tag="LMJF_35_2560"
                     /note="previous protein_id=AAZ14479.1"
                     /codon_start=1
                     /product="putative cytochrome P450 reductase"
                     /protein_id="XP_003722649.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982550"
                     /db_xref="GOA:E9AF79"
                     /db_xref="InterPro:IPR001094"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR003097"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR023173"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="UniProtKB/TrEMBL:E9AF79"
                     /translation="MVQKRYVALAGALVLGATSAVLLMRQWRVQRERSEFAERYAKQI
                     KAAREAHAQFLNGGSASPDSADISDADFDDEAAAVKVIYGSESGNAEGLAKGFVMTLR
                     DRGVQAALIDPSRWAYMEDYLYHNKRNVPLFHPIKVASASTRAAKKESRKTPEEANTP
                     RPPLVYIFIVATAGEGEPTGNFMALFQEMQSAVRRATTAKVPAQSSAVTAGAAPSSAT
                     EEAPFKNIYYAVFGLGDSSYKYYCRSATDTNTLLKKGGGINVHRVGFGDARYGMQEDV
                     FDDWQEKVMLALEEKCGLEMTTGTRAPPKPELQFRFLSSTAATTAATTSTVPQAGPCG
                     AAEGTAAPSATAITNNADPNRSVLLRTATPSSAVAAESTSAPPISLPFPPPPVLLEPS
                     LLNPTRIHLVTKTQLSPPRDSDGSSVYRFCFETDGTGISFQAGDHLGIFPTNPPEMVA
                     RCAKALSIPAGELETPVELCEMVPSRGILRNVLPARVPLRVVLQRYVDLCGRPKKSAL
                     RVLAKYCADPVQQEAFLELLRLPAEEAEEAAAGSCAAWKPKKLRTVVDYLEKFPSCCC
                     IPLGHFIEVMPRTQPRYYSIASDRMSHGTKVEIIVRVLTDGLASSYLAHRVEEGDEVF
                     AYVRITTFHLPQRIGEKRPVLMIGPGTGAAAMVGFCYRKEAIMRKQPAAHYGPTVFLF
                     GAQRRETEYFVKEEVQRWAMAPAEMKQWDADHPTSHAGLAARRSKTHSWEPLPTSVIT
                     TVDCAFSRDQEEKRYVTSLIDKHKDLIYEMLTSTAGGGCLVFLSGEASVMAKDVDRAL
                     VALLQDRGGMTRLAALEFLRRLESDHRYLKDVY"
     gene            <1065476..>1066129
                     /locus_tag="LMJF_35_2570"
                     /db_xref="GeneID:12982551"
     mRNA            <1065476..>1066129
                     /locus_tag="LMJF_35_2570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722602.1"
                     /db_xref="GeneID:12982551"
     CDS             1065476..1066129
                     /locus_tag="LMJF_35_2570"
                     /note="previous protein_id=AAZ14480.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722650.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982551"
                     /db_xref="UniProtKB/TrEMBL:E9AF80"
                     /translation="MSSDDIDALRSELLRQKIIFEAELRRQRETFEERLSLITNELAD
                     READCRNLQSVITILGRKVDAIAEQRQYIAVVHRPPTPTRQPSIHESPFRRETSALVP
                     PPSSNGDAQEHERATSVKKSSSRRPSPSLNAPPAFVRRSGMPITRVASISALSRTSSP
                     HVHGHAARPLLRTNTSATVTSEGNSNSEKRALRHRAVSKRRTSSVSHLAGLRSTDDW"
     gene            <1067573..>1068148
                     /locus_tag="LMJF_35_2580"
                     /db_xref="GeneID:12982552"
     mRNA            <1067573..>1068148
                     /locus_tag="LMJF_35_2580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722603.1"
                     /db_xref="GeneID:12982552"
     CDS             1067573..1068148
                     /locus_tag="LMJF_35_2580"
                     /note="previous protein_id=AAZ14481.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722651.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982552"
                     /db_xref="UniProtKB/TrEMBL:E9AF81"
                     /translation="MQRFCSSALRRCSAGGVARLAVPFSHASPALVVPRREASSLRAA
                     ATGSAEASRSPAKPSAAGETQAAPELDAKAAEQVRLAQELGEQAFSENTEILKKVAFR
                     GLRAFVMCAVGVAAFMWAMKKKKQERQADALPGVEAPRAAHAEGHDDPTQRYLQEMRG
                     LGFDVETLEEELEHERVAKATASQKLAGRLS"
     gene            <1069146..>1069988
                     /locus_tag="LMJF_35_2590"
                     /db_xref="GeneID:12982553"
     mRNA            <1069146..>1069988
                     /locus_tag="LMJF_35_2590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722604.1"
                     /db_xref="GeneID:12982553"
     CDS             1069146..1069988
                     /locus_tag="LMJF_35_2590"
                     /note="previous protein_id=AAZ14482.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722652.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982553"
                     /db_xref="GOA:E9AF82"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:E9AF82"
                     /translation="MHLPPGTTKRALGRLRIVWCCVVTAESWHALFVGLPILFFTTLF
                     VTVVVPRGEWLTYVFTALFTTISVTCLTLSVTLDPGVIPPAPQSQQPTQSTAVTVGGQ
                     PVLCKVCTTCHIIRPPRSTHCRFCDVCVEEFDHHCGIIGSCVGKRTFRFFGGFFVITS
                     FLVLYILIRSFIILVSTDFKPANERPHLIWLAASCTLCIVAAVIGAILVMPCAGRYIM
                     LSASNSTVKETMRTQRQQTQSGEQPPGVVPVAEARSGKYCVNLLRRLFSPIGRSRIPF
                     DYYV"
     gene            complement(<1070802..>1071281)
                     /locus_tag="LMJF_35_2600"
                     /db_xref="GeneID:12982554"
     mRNA            complement(<1070802..>1071281)
                     /locus_tag="LMJF_35_2600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722605.1"
                     /db_xref="GeneID:12982554"
     CDS             complement(1070802..1071281)
                     /locus_tag="LMJF_35_2600"
                     /note="previous protein_id=AAZ14483.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722653.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982554"
                     /db_xref="UniProtKB/TrEMBL:E9AF83"
                     /translation="MRPRCVALLHVAGRRAEVGRVDAPDNADSRAGNLCGVVVRVRFR
                     RRLWADAGEHVVVQWGVVRHAHDLKDGGRHQVCGVLAGGAVEQDGLLPPVCTERGARQ
                     QLQQLRQLVASVADMVAVRGVDEVTHALWRGLRFGLPQAPPIDPSHNQLEHVLSVPK"
     gene            complement(<1072582..>1073565)
                     /locus_tag="LMJF_35_2610"
                     /db_xref="GeneID:12982555"
     mRNA            complement(<1072582..>1073565)
                     /locus_tag="LMJF_35_2610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722606.1"
                     /db_xref="GeneID:12982555"
     CDS             complement(1072582..1073565)
                     /locus_tag="LMJF_35_2610"
                     /note="previous protein_id=AAZ14484.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722654.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982555"
                     /db_xref="GOA:E9AF84"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR017956"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:E9AF84"
                     /translation="MKLEPRERRPRSDYILDNAAALQLGKLYLGWGRSKRRSKPKLAT
                     PAAVSKPKTAPVKASTKTTNKAAAAESSQVSEKAATVAPRTPAKQVPAKHATSATPVA
                     KRPRGRPRKTTSPAAVVKSMPPKTRTRGRPATTPAKAPRKAATRDRVPSRKNPNPVVK
                     SISSKVVAAATAAAAAVSASAKVPATPLPHTPRKTARVLATKTVVQQYHRRRANSKVP
                     PVIPNPVPTPALLLGAAEQWVGSDDVTVLVRTMNGTSFRLACTSESTLWELKRRILEV
                     IMPWTASASPGSMVRLPMLVMNGRALGPETATLAALRFSAESTVYCFPEPN"
     gene            complement(<1074173..>1075378)
                     /locus_tag="LMJF_35_2620"
                     /db_xref="GeneID:12982556"
     mRNA            complement(<1074173..>1075378)
                     /locus_tag="LMJF_35_2620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722607.1"
                     /db_xref="GeneID:12982556"
     CDS             complement(1074173..1075378)
                     /locus_tag="LMJF_35_2620"
                     /note="previous protein_id=AAZ14485.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722655.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982556"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:E9AF85"
                     /translation="MTDSPPKLTPPPNGSALLRENLFEEKTDDDDGELLKRREPTMLL
                     KGTKLIAPPSDGTKRYTVVFDLDETVVYARDGPLYARAYLKDLFRFMKDDFEVIVWTA
                     GERDYAKCILEEINEDHIIQHLVYRHKKWFREEDYTKDLRQLGRDLNYTLMIENTPDC
                     VRANPENGIIVEDFEVLPETTEEEGSMPATPVPTPPPAQAAEATATAGEAKDSATPQA
                     STTAAPRPALESGGGGSSQSPLRRRRTTDRTLFLLRELLQSLVKSGETVPRFLASCEL
                     LSRQTVTGSDGNDIPIYHLGTRRRRKDAGVQRKQVRVNRDRAPPAAAPGGVPLPPSDA
                     SAESSMNEKNVSSEDRDDCNDVAHSSGSSGDTPQLSPAGAPRQGADGQVECGRAGGAD
                     NEDKGKPHP"
     gene            complement(<1075880..>1078111)
                     /locus_tag="LMJF_35_2630"
                     /db_xref="GeneID:12982557"
     mRNA            complement(<1075880..>1078111)
                     /locus_tag="LMJF_35_2630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722608.1"
                     /db_xref="GeneID:12982557"
     CDS             complement(1075880..1078111)
                     /locus_tag="LMJF_35_2630"
                     /note="previous protein_id=AAZ14486.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722656.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982557"
                     /db_xref="GOA:E9AF86"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="UniProtKB/TrEMBL:E9AF86"
                     /translation="MPRVRVGLRLRFVKLPHIDGERVFRDVISFVEPEDRSYDDLRAL
                     VEAKMRFMELSHSDFTAFHIEEHTGDRVVVDTAYFSALLRQWARRAAKERPPPKRPTA
                     LEMAGLAVLGESPSPFGNPEYEGHVGSGGMLTMPTSNTSSDDDVEDDERPPDMLERFE
                     IELQSSKSVAVATAAAIPNLVSSVSGAMPSPVQFAALTRENLARLCDGDVAKSGASAL
                     LSASGAASPGKQVAGIDPCKAASNSHLPDPNAEVLMRVRDLTYPLGHVKFYLRCIILA
                     VRFKIPKPGLTVAELDLGDAEDVTQAITAVTFDEVVHKAIRDRLRGDRRQVLELRQVY
                     VRRKNDVDVRYQTNAHPLLLRLDRSSKMEVVRILATPAPQPGSGAIVTVREQLGSAGV
                     VDVTQLMGQPQRLRHVSGGASGASSSENGVCLSGVGSGAYPPVCSSSSSSSGPRRTTF
                     TMCTSSGNAGTSTALVSGVVPSSFGQELRSRQEMLLRQQRPAGSTPIEPGVAIVTARD
                     VREREPLIEQYANREEQRKMRIRRKVEVSTQCLLCGLDCSDESACMAIVRQQLMRSSR
                     NRGAHVPQFEQVKRDLSDRRRVPEGKVPTRLLCAHTFVNSATRTVHVVHPRCAHLCSA
                     YQSGSELEDIVACDLSMNVCTLCGMPGACVACYHPRCTEMFHVVCALYSGGYVNLGQR
                     DPFWPCPACPRHTQVMVVPKKGREGSNVLHVDHSCWEDGVAFDSRVVESTDLRDPDEN
                     DGQ"
     gene            complement(<1078923..>1080761)
                     /locus_tag="LMJF_35_2640"
                     /db_xref="GeneID:12982558"
     mRNA            complement(<1078923..>1080761)
                     /locus_tag="LMJF_35_2640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722609.1"
                     /db_xref="GeneID:12982558"
     CDS             complement(1078923..1080761)
                     /locus_tag="LMJF_35_2640"
                     /note="previous protein_id=AAZ14487.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722657.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982558"
                     /db_xref="GOA:E9AF87"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:E9AF87"
                     /translation="MTKDRLHYRLSRKHAHGAEEVERSIGITCSRYAPAARTADARRP
                     VALMKWAFDDYIMEEELPSDAFVSSTPADAKPRTSLVVRLLSEGVPDTVVERQLRERL
                     PKHMQFHFLSPVDFVSCASRYVWLRCDGAQAAQLLSNSFQREQLWHTGAGDVYVSPMQ
                     EVCVDSSADHFPPHLLPSTRYTITLRNVQGSLGDVLPQLRSIAQNGFLNYSHAARHGV
                     GLYYVYKDAKLLLRREYGEFLQSYMRRLTEGTTHVQREMPVLQEVLASPRSSRRDWVS
                     VVEGMEAAVKGDMQVYARTRQTGLYPPHHDLLLDFVRRAADVAPRHHDSAQIIREAVR
                     PLVLQEALHAITDVHFNALASLRWQRGGDTVVVGDVVRVRDLTRQHAAEPDNARDVFA
                     GAADHVNGAMLSSAHQDWSAFTAEGIGAAQTAVAYRRVATKAEASQYRLTDVVLPTFG
                     RDVAHLPLLSEESSDALFAALAQELRVEGLADMRLAPRAAFRPLVQLPVSMSFYLVDE
                     KRGWDWEEDAGATRIKASLYHDQDGVLRCHSPMSRRTGKNMVARLGIRGDAARKFFLK
                     PARKLGMTCVMQFTLPAGSHATSAIREAFMMATVSPSAIFRLLAAK"
     gene            complement(<1081443..>1082246)
                     /locus_tag="LMJF_35_2650"
                     /db_xref="GeneID:12982559"
     mRNA            complement(<1081443..>1082246)
                     /locus_tag="LMJF_35_2650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722610.1"
                     /db_xref="GeneID:12982559"
     CDS             complement(1081443..1082246)
                     /locus_tag="LMJF_35_2650"
                     /note="previous protein_id=AAZ14488.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722658.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982559"
                     /db_xref="UniProtKB/TrEMBL:E9AF88"
                     /translation="MALDKSRISILSATKVDGEKLSSVGDTMDSLIPASRRLQLESEK
                     CCPLCCVAYGVLISSVAVFCITAFGTAVSIFAESRINYTVNGAMRQTAWIAFPGILAG
                     ATLHYFMAEAMWSSKHNSWGQAWTKAIIANAGLWTGAICIGTLGWRKGLPLTSTGRRL
                     YHRYPIPSEPLEARLLRSSREFFTGMGATYWLSGVASGHLGFVTCVSFCVSANRPYFM
                     MAPHGGYAYRCMPPWRRQQLQAMALGSDSTNQPTKPQPQEQIRKQPSIK"
     gene            complement(<1083157..>1085154)
                     /locus_tag="LMJF_35_2660"
                     /db_xref="GeneID:12982560"
     mRNA            complement(<1083157..>1085154)
                     /locus_tag="LMJF_35_2660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722611.1"
                     /db_xref="GeneID:12982560"
     CDS             complement(1083157..1085154)
                     /locus_tag="LMJF_35_2660"
                     /note="previous protein_id=AAZ14489.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722659.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982560"
                     /db_xref="UniProtKB/TrEMBL:E9AF89"
                     /translation="MCETSPSAPSPEVATVTQPPRPAVGDGKDEVTILSACSPAITAL
                     GASALVGCTEEDKLTRNFVEAAVVADEGANAPFSVDDAAQSRISGRTLFLVDTEGSDV
                     ILGDTSQNILPSPPLSFREAGEHHGAPQHNSHAGGVGDEEEQKADGEDGADVARGNAI
                     QSKYSVTSEWVESFPRADSSVFLDESMQATACAEATQVLSAVLDKKRRRREDDGKDGH
                     AKGGKGDRKRRAQEKAKAAEVQAAFKHSQRALRKQAKTLNMRDVFSRTLSLPSPLQAA
                     TDALVSPLSFPPNRLLVDTSIKSNAANDGGTSPAETGVCSPSSLRPHSPAFSPASLVS
                     PSSPSSSSAWSPDVVGELTNRFLAHVQQQKRQKFEQMVSRELTQSQALSQTRSLAQHP
                     REHGGAEDGQRGDDDEYNPRTRTDSAMANDFRTPVDELVIGEEDNEAANWMPADSSSP
                     TSQHARRMMQRDPVTGNEMMLLGASSSEEGRLPSFSTTPAESRKAEEDEEASQEQDQV
                     MRSLARKHEIWKLKQRHLRAQEQVELDERAKALQQQKSAKPLAAVTSASFSVNVPLAR
                     GDADSAPATSATEASAASAPFFTGIFRNYAAAAAGVERSGRRGGDSATAAVGCGQVAT
                     LSPDDISMIRRINSFDNTSTQRVVVFGTAASKQTRYESMQR"
     gene            complement(<1085989..>1086510)
                     /locus_tag="LMJF_35_2670"
                     /db_xref="GeneID:12982561"
     mRNA            complement(<1085989..>1086510)
                     /locus_tag="LMJF_35_2670"
                     /product="putative ankyrin repeat protein"
                     /transcript_id="XM_003722612.1"
                     /db_xref="GeneID:12982561"
     CDS             complement(1085989..1086510)
                     /locus_tag="LMJF_35_2670"
                     /note="previous protein_id=AAZ14490.1"
                     /codon_start=1
                     /product="putative ankyrin repeat protein"
                     /protein_id="XP_003722660.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982561"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:E9AF90"
                     /translation="MSSTRSPRDTTSRREPPAETIYDACRRGNAERFMAYVQKGGCLS
                     ECDDQKLTLLHHAAFSGNNAFVKAILDGSDAQQVNIDAADSEGWTPLHYAADRGHVRV
                     VEALLDEGANVNARDAAKRTPMHLAALSGRAEVVAVLLRNGASKAAKNVAGMSPMDCA
                     QQTGQAAVVAQLE"
     gene            complement(<1089006..>1089233)
                     /locus_tag="LMJF_35_2680"
                     /db_xref="GeneID:12982562"
     mRNA            complement(<1089006..>1089233)
                     /locus_tag="LMJF_35_2680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722613.1"
                     /db_xref="GeneID:12982562"
     CDS             complement(1089006..1089233)
                     /locus_tag="LMJF_35_2680"
                     /note="previous protein_id=AAZ14491.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722661.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982562"
                     /db_xref="InterPro:IPR009643"
                     /db_xref="UniProtKB/TrEMBL:E9AF91"
                     /translation="MVASSVPQGGTQEVTSHVQGLMQQMQARFDEMSKCIISRIDEMS
                     LRIDDLEHSIDDLMQQSGAEQSQKPAARPKK"
     gene            complement(<1091867..>1093111)
                     /locus_tag="LMJF_35_2690"
                     /db_xref="GeneID:12982563"
     mRNA            complement(<1091867..>1093111)
                     /locus_tag="LMJF_35_2690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722614.1"
                     /db_xref="GeneID:12982563"
     CDS             complement(1091867..1093111)
                     /locus_tag="LMJF_35_2690"
                     /note="previous protein_id=AAZ14492.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722662.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982563"
                     /db_xref="GOA:E9AF92"
                     /db_xref="InterPro:IPR000210"
                     /db_xref="InterPro:IPR003131"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="UniProtKB/TrEMBL:E9AF92"
                     /translation="MAASVAAPENDGVDHPPDHSSASATPAGRDSVRDPHSATSSFAD
                     GGEEDNMNDDGDPSGLVHSITSPTFSPSDAAGNMTEEETAARLLQQSRGAAQSIQAQV
                     ESCVSRFKVMETRLDTLLKERQEVKPKLEEVAQSRHLERYMEVVSLNVGGERFTVPLS
                     TLLSKDAPNYFHILLGSEETGWVAPVFKDEHDTIFIDRDPSCFKYIVDYLRGYHYFNL
                     LKEDSLRRLKVDAAYYQLPGLLAMLGDVDRDAELQFSPGPGVSPERNRLRVVYGVAVV
                     GDVSLVTGRHTITYEVKVADYVGFGLISESCVNTDQEFHKIPDCCVYYMSGVFYTNYP
                     YHRKEENLERIENGDFVTVKVDLEKGYVEYVLKNSRKMVSLGRARRLRFATTMKLASR
                     VRIVPPEEVRRRLSPIHYSFEE"
     gene            complement(<1094640..>1098659)
                     /locus_tag="LMJF_35_2700"
                     /db_xref="GeneID:12982564"
     mRNA            complement(<1094640..>1098659)
                     /locus_tag="LMJF_35_2700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722615.1"
                     /db_xref="GeneID:12982564"
     CDS             complement(1094640..1098659)
                     /locus_tag="LMJF_35_2700"
                     /note="previous protein_id=AAZ14493.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722663.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982564"
                     /db_xref="InterPro:IPR013935"
                     /db_xref="UniProtKB/TrEMBL:E9AF93"
                     /translation="MDSHRATMAVVVVVNAAVLTVSVEHAVQVVSIIFASQFKDKVCR
                     CVVVDPPEGLAEKLSKSSLYLCVSDSIPVSQTVRKLLLCVAQAVVDAQGAALRLYSQP
                     DKADSTAVRTPMDKLTTFTTARNASTLIASRFKKKAADVLLQFGAVAAAVAVYGETQF
                     NSNVDCLWCSATLESIAAARYRYLQTTLLCHRDALNATVLQLQSDNPTWGPDLAASVN
                     QLDSCVAQYSESLTLTIASFRSASVPNSMRARLTREVEENVAVQVALLKELLVRVHVC
                     LNAGTWEVPSDPQSYRLGSDVKGCVENVLRLAFSEIDVYLSESLRQLRRYAAAGTLTF
                     YPSAMAATASLLGSGGTSNAMVNTTLAMLRKRELEARFKRLELLAAREARQPFLEELS
                     TLRSLFPGIYGAEWTERSLPFFAYLCMINGAERRARALLVEFASIKARLQHTEEAAEV
                     LLRVCALAGVGLPLVGLQASSSTASDDGVTLDSATSADPLYQLSRAATATQVAQQVKD
                     SDAAEPAANGNTSIGASFSMFSSVEEKAPDRGVVRLNQSITNAALLNVPLLLELINVF
                     DRVAPATATAALRCQLATFLLFKFPHLLEKATQQTLKSVLREASALLEPQMNTAIVPS
                     PFFLGWQAFPLPPHLAPKTVPVGGAFFTFIDTQRLKLTILCLNGRKLSSRTVWTVGDV
                     ASVLVTLYNPFQEPLTFDALALRCRSCASLVADDGDAASGEGAVSASSSHTLSAPISY
                     VLSNVEVPPLAKRKVLLKVQPTEEGTLLIDGVTLRLADTRSSQPMTGQLPAPMYIPVL
                     ERLPQVSCTLNTSELEVFGTQRINFTVRVVNCGRVPISCISLTAHSEQCQLEGCEGCK
                     ERRNETDTTVKLNKRALDAAARTPLQPGDVVMIPGTLEAPPTISKFGAHYVIFRTDLS
                     LPHPEPQKPRDVPDAVPVYAVIPRRVTETRLRLFHSPGLVVTSVALTKDRRAVEVRVA
                     NRSRLYSMELQLSALTFAELPAAFIVAGAEYVVPPIKLTRIPPTKEKDGLRFHVPWVA
                     RELPNCTGTLELNLSLTGTEVVSAEPLDECAVTLEARVPQAVLPPQPSDAWSSPVLPD
                     ESRDYVVAEDPQTDPLGDGAVLIYRWEYDGDASYGGAETSPVISRAKVVCRGARLCDA
                     TGAVTATAVYDSPSQSPPTAGQHLAHPRAAQASESLLDSPASISALLSRHTDSMDSGA
                     KASASAPQALHRARTALPRLGGCESGTLSTGGEGTPVPIVIPALRPIRLCLRVAAPRW
                     RRAIPLHVHVSIDSHFDVAVLTGAVQADAIVGEEGRAVHEGEFELFAFKTGEHLLHVT
                     ITDDAERELTHTIRLLVEH"
     gene            complement(<1100282..>1101820)
                     /locus_tag="LMJF_35_2710"
                     /db_xref="GeneID:12982565"
     mRNA            complement(<1100282..>1101820)
                     /locus_tag="LMJF_35_2710"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722616.1"
                     /db_xref="GeneID:12982565"
     CDS             complement(1100282..1101820)
                     /locus_tag="LMJF_35_2710"
                     /note="previous protein_id=AAZ14494.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722664.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982565"
                     /db_xref="UniProtKB/TrEMBL:E9AF94"
                     /translation="MKVAPVYRKVLKQLHKACYTRPHYVQDIRFLLSFPLHTTGSEAS
                     TAVPGTTSSSRTVNSAAAPATTPADVSKSPKSSSRKTTSRDPVAEHLLRPSSECYPID
                     TSMLFAMCYTDLHNAVRESAPVVAGMNPVAMQIVRYRNLLWLQERLGRVLSSKTQQLL
                     ATSLSISRGPAEHDFIPDEYFESKSQNTGSAPLSATTASQRAEAAVTAAMSTRSTSGK
                     ASQEATESFALAVAGGGLAEVVEESDPDIVYSAGAIGQQQEMFVLRHREPFPMAEQFL
                     AGFPTVTAAELATCAYQRAALTQLVRQKFPTKLTCQDANVSLSISLEPYDLQYTSKEH
                     AGMGYFAAAHRQFRVRFLLAPLSPELSGAERTDVLVVNSYFVRLDMELMQLVEEVGYL
                     HSSDVLRMLRERDYGDHFSELIGSGVAEVLGEGVFAGPNEGKVAVAATSVDKRTGIET
                     SATSPAPATVAEGSRVFSLYFVNHSDAPMVLKGLLYYKLGKRRHLAHAPIQCIPFGFL
                     LMEA"
     gene            complement(<1103294..>1104202)
                     /locus_tag="LMJF_35_2720"
                     /db_xref="GeneID:12982566"
     mRNA            complement(<1103294..>1104202)
                     /locus_tag="LMJF_35_2720"
                     /product="putative QA-SNARE protein"
                     /transcript_id="XM_003722617.1"
                     /db_xref="GeneID:12982566"
     CDS             complement(1103294..1104202)
                     /locus_tag="LMJF_35_2720"
                     /note="previous protein_id=AAZ14495.1"
                     /codon_start=1
                     /product="putative QA-SNARE protein"
                     /protein_id="XP_003722665.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982566"
                     /db_xref="GOA:E9AF95"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="UniProtKB/TrEMBL:E9AF95"
                     /translation="MATRDRTGEFLQYRAIRPRRHETEQLLAEEENMNRVYVTPLWVK
                     KMADVRRIEDQIKEQMAALEKLRKDHLKVEFSSTRDEGREEAEIEDAQSTIDRLFKQS
                     EKGVKDLEVSYTRDLPDGGTDAELSILRNVKMCLVNEINNISKIYRESQRRYMMDVKK
                     QQLVSQRWAGGDRQKAVEQQLENDALMDQYLQKGMTQEQVETIMLNQQMADERVKEFE
                     RIYSSIKSLHEMFKDMNTLVIEQGALLDRIDYNMTITHTRVQKARTELQRAAEYQSAG
                     TFKLCVLFMIILIIGLMIALVFKAIT"
     gene            complement(<1106606..>1108320)
                     /locus_tag="LMJF_35_2725"
                     /db_xref="GeneID:12982567"
     mRNA            complement(join(<1106606..1107199,1107202..>1108320))
                     /locus_tag="LMJF_35_2725"
                     /product="hypothetical protein"
                     /artificial_location="low-quality sequence region"
                     /transcript_id="XM_003722618.1"
                     /db_xref="GeneID:12982567"
     CDS             complement(join(1106606..1107199,1107202..1108320))
                     /locus_tag="LMJF_35_2725"
                     /artificial_location="low-quality sequence region"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722666.1"
                     /db_xref="GeneID:12982567"
                     /db_xref="UniProtKB/TrEMBL:E9AF96"
                     /translation="MSKMRATGKERSRGKRPRGAYHTRPRDPAVARWRGPPTVVSPCV
                     LFFRHLRQKRHLCPCRPSCRQPPPVLDHIASQRPACTRRHKKTDDMKIASLETGDAKE
                     NACSTPSLATTSTAAGPVLRPPRRMAPPSQDMPQTARAVPQQLAVSALASCCGADPVD
                     RPGGLYKTGYARRDTVVGHIMLREYPKVISGHQKQIVLAVKDEERLASRPTIVTFSVR
                     PTLTASMTQPMHSASPSASPTDRNSAPAPLLPNLGWPSMANSARFGIAAGQTRLSSTI
                     SSLHRTLASADAPDWRAFAAERRSSISTSTPTLSPSYCFLVKDAATSSNGNTSWTVPA
                     VAALRLWRTPRLPPSPALPLLPLGPPRYAPYMKRDARPMKPLKSATRIKAQLEAELTL
                     TGAFFTDSGVDRDAAKQRDLRQEMHEDFEALHIMDDTGVEINRALVGNVPLIHRRKQC
                     NRLLGFLRKYSSSESVLRLHDHHWRLNLARAACVHETVRLCAVKGAMPHARQLDPCSK
                     TLFVPTKTVYDISLKQLAAEALFIPPGHPHSLTTYESYLYLLAILPRRSPRRRRIPRR
                     ASQT"
     gene            complement(<1111235..>1112473)
                     /locus_tag="LMJF_35_2730"
                     /db_xref="GeneID:12982568"
     mRNA            complement(<1111235..>1112473)
                     /locus_tag="LMJF_35_2730"
                     /product="putative acyl-CoA dehydrogenase"
                     /transcript_id="XM_003722619.1"
                     /db_xref="GeneID:12982568"
     CDS             complement(1111235..1112473)
                     /locus_tag="LMJF_35_2730"
                     /EC_number="1.3.-.-"
                     /note="previous protein_id=AAZ14496.1"
                     /codon_start=1
                     /product="putative acyl-CoA dehydrogenase"
                     /protein_id="XP_003722667.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982568"
                     /db_xref="GOA:E9AF97"
                     /db_xref="InterPro:IPR006089"
                     /db_xref="InterPro:IPR006091"
                     /db_xref="InterPro:IPR009075"
                     /db_xref="InterPro:IPR009100"
                     /db_xref="InterPro:IPR013786"
                     /db_xref="UniProtKB/TrEMBL:E9AF97"
                     /translation="MRRTAVALSSVAAAGEAAPNPVTYLTDDEKMLVETVRAFSLTHV
                     VPRSRQMDEVGKMDPVVLKEAFAAGLMGIETPADLEGGGMSFFSSILAIEELARHDPA
                     VSVTVDVQNTLVNNIFFNFANDAQRRKYLPKLAKDTVGCFCLTEAGSGSDAFALNTKA
                     EKKGSKWVINGSKLYITNGGWAGIFLVMATVDPSKGYKGITCFVVDSSETSGVSVVRT
                     ENKLGIRASSTAELRFENVEVSEENVIGEVGKGYKIAINILNEGRIGIGAQMLGIAQG
                     SLDIVMPYLFQRKQFGKLIGDFQGMQMQYAECAMELHAARLMVYNASRKKQNNEMFIQ
                     DAAMAKYFASVVAEKTASRAVEWAGGVGFMKDFGLERFYRDAKIGAIYEGTSIIQLQT
                     IAKMIKAQYDESSSPSGASS"
     gene            complement(<1117792..>1119222)
                     /locus_tag="LMJF_35_2740"
                     /db_xref="GeneID:12982569"
     mRNA            complement(<1117792..>1119222)
                     /locus_tag="LMJF_35_2740"
                     /product="galactokinase-like protein"
                     /transcript_id="XM_003722620.1"
                     /db_xref="GeneID:12982569"
     CDS             complement(1117792..1119222)
                     /locus_tag="LMJF_35_2740"
                     /note="previous protein_id=AAZ14497.1"
                     /codon_start=1
                     /product="galactokinase-like protein"
                     /protein_id="XP_003722668.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982569"
                     /db_xref="GOA:E9AF98"
                     /db_xref="InterPro:IPR000705"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR006206"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR019539"
                     /db_xref="InterPro:IPR019741"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:E9AF98"
                     /translation="MPAESYPDERLDSMLATLTPIFCEKFKVENAADVEWRVFTFAPG
                     RVNLIGEHVDYMEGWTCPAAVLEGTHILVGRVKHFQKEAKPKVRFYATHTKEHFDMDH
                     LGGCVHNKAWTTFVRGAMTLRLNRLGVAIDDASLNGVCMVVHSTLAMGAGMSASAAFG
                     VALIHAINSVVTKSYKDCPTSSGRRYSIVPAMPKDELMELAKEARLIETEYCGVNVGI
                     MDQFISAFAEVDKFMFLDCKHLTFEPVDMTPLLGHGEYSWMLIDSMIKHDLLGGTAQM
                     YNSVRIDQENAQKKIGEHRYRGKPYSFSLMVRNPEQYGFDGDVQQFMAEFKPLMTPGE
                     FERGTYQVMEQLRTLEFRKLNDPALPLSREERVKKAGDILNAGHAGMRELMKITTPEL
                     DYIQELINEDKDVAGGRMMGGGFGGCIIMLLRRSAEDRVLAHVRKHFKARFSIENSCY
                     KVKRAGSGSFVVSLEGKKMSGAGSKL"
     gene            complement(<1120383..>1121672)
                     /locus_tag="LMJF_35_2750"
                     /db_xref="GeneID:12982570"
     mRNA            complement(<1120383..>1121672)
                     /locus_tag="LMJF_35_2750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722621.1"
                     /db_xref="GeneID:12982570"
     CDS             complement(1120383..1121672)
                     /locus_tag="LMJF_35_2750"
                     /note="previous protein_id=AAZ14498.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722669.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982570"
                     /db_xref="UniProtKB/TrEMBL:E9AF99"
                     /translation="MLDVEQEQPHCSPNASGARSLHHQHGCCTPIHAQSASINGDANH
                     DLPAPQQPVSNGGTAGIGCAHQVQNKAGPLVNGNRTEPQQEANGLLGLASRWRLDACC
                     SATDAEGAMHELQRQLQQEHKRRMEAEQHRHLLSRLLDEVSCPQSREKQTAAAAALST
                     PEQDGALEELRQQLHALQRKLSEERTRHSKQREELLSENEQLKKRLGQQHREQSARIE
                     KFLKDNEDAAKRMEDALHKREEEVRAVYAQALQERDVRIAQLSQEVLQHTHEARQLAA
                     VRSDEERLHAQRAAHLEDMAVQLREWNLSLQRQLADANDEVRRLRQRLEVMDVASVHD
                     AKGYAPVSGSAGSELAGFCFPCGGLSHAHAVQLATQLYHSQQLLEKCREENQTKSKEL
                     MRAAQLIDALKEGLRRVKVDLGAGSTAAAPATAMPSS"
     gene            complement(<1122951..>1124813)
                     /locus_tag="LMJF_35_2760"
                     /db_xref="GeneID:12982571"
     mRNA            complement(<1122951..>1124813)
                     /locus_tag="LMJF_35_2760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722622.1"
                     /db_xref="GeneID:12982571"
     CDS             complement(1122951..1124813)
                     /locus_tag="LMJF_35_2760"
                     /note="previous protein_id=AAZ14499.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722670.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982571"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9AFA0"
                     /translation="MHKPTEATRQQWKHRLRERTLQRRRNIASKEAEVQRSLKEVTSS
                     RDLIIAQLADQIFSKGHRHVASAMNIGFVPDGNPATPLVALAGREKCGKTSLLRSLFR
                     SAREVGRSNRHLRRDAMNFFNVGGVFNVVDLPGCGGTSVPWSTVLQHAVLLRNFARCQ
                     PSLKMLYYCMDTHYKHGLYIQDIDLLQFLAREVPNFTIVLTKADQINDRAIRTVHMED
                     IRKELIYHGIHHPVLVTSAFHMGGIDTLRYDMVMSSVHTLPTERLTLTEAQRLSARLF
                     SQKELSTIRPLAIAPSQVDDETREWNEEVRLRERAGDSSVGASVADAAMGTAEDASLV
                     TEATEEELRYSEAESAEFAAADDGTSAAVAPAPARASTAESLLVELALPPEEVPLPVD
                     ASRDASSSSTHIPVVFKDHVTQMAYERVVRTLRNRPLLQYVDATSPWRNPLRWPRHVV
                     PTKHPKANIMRCPEAPENPYLFQSQFVAPRADMYFRRPNVGARKSSQKGRYEADKPLA
                     FLVKAYTIPYFPDILDTAMQPTPWAFLGSREAYYECNGGRQLGVRLANYATAGSVNPL
                     SDNPAPQEPELANELQALETKRYGAPIAMLRPPDAKLAPSAFPLDAPSSPTLST"
     gene            complement(<1126021..>1129971)
                     /locus_tag="LMJF_35_2770"
                     /db_xref="GeneID:12982572"
     mRNA            complement(<1126021..>1129971)
                     /locus_tag="LMJF_35_2770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722623.1"
                     /db_xref="GeneID:12982572"
     CDS             complement(1126021..1129971)
                     /locus_tag="LMJF_35_2770"
                     /note="previous protein_id=AAZ14500.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722671.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982572"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="UniProtKB/TrEMBL:E9AFA1"
                     /translation="MTGTAAEAAIYMDRHLGEKVRLTLEKCLQDKPCDPIKFFAHSLR
                     QLAEQDASNNQKPVRTEAQAKQLQGEPSKHLQLTASPSVRLGNGVKYELRPLAHDFRC
                     AAGMPPAAEATAPPPVFPAVQYREAIPSYEVSSCLRQLHMIDPAAPLLLFIECPAPNT
                     GAFFYQGVAYRCGSATGKPVNQTALPLITALQEALGAENVRDFDSEIRAAAAEAASAV
                     RVSFLPSFQGDYLSIFDTLDGALKTATQATDASTSDSPTHPPRWRLPSVLFVSYKPES
                     AHLTYARLLASYGPLYEAAQRASLQAYRAAQMKRKRTYTFAYAREYWAKVQRQRHTSS
                     GAPRTVNSVPKWSSSVDSKTRSDQPTGPFSLVDGATPTTAAEKFPAAKPAKRGLLAYT
                     AAHQAEDDVFLVVVRRLEHAAATLIQSVYRGYRRRRSYAEAREALHSASGAVVTKSPL
                     KTSWKGPRMSESPEDHILPPLLRACLERLFREGDAFGSLWGDYAISPAPESRRCWIYR
                     PVQHREGGGDTEQSGNGSAMGGEYVREGWVQEELLLPPWRATQPRLHLNLLQRLRDYL
                     ALAQCTSLHENVQLLMDSPGMSVLQRRAYDGIKSVCLNLFHVAYAELRQRHPKGLPTS
                     FSAYMRQMHGAVLGWLSTPHRCSLILRAVQMTATDAVQDAQQGNTRSPGVSSSHSATE
                     SSMSRVVRDQLAANEALLIAPRFLSASDTAAPAAPPAEPTVFSVAPQLYISQQPLLPR
                     KEWVQEVTVLLQSTRDRAADAPSPLVEWMTTASFPLCCVDDTPVAAVLRLDTQQVEGV
                     PPYDSFVPRLGIATQQLTGTRAAEGAAVGDSVTPASLAVQAAAAVQKWMQGDLARAAD
                     AGLKHHIQESLSTESGMVYYRARVRTGGTATEAFTTLSPSATLVREVLRQSHRDSAAD
                     PCKGKTGHEASTPRSELSGSVSASANPWHRSVLSSEEWDPVMGAVAQERSSAARRSCS
                     RTASIVTASRASAGAFNSSRTTAARVSINARPEVRSLAVLPNVEWEATDALSKHVFRV
                     LTADDVAKEVSAALSGSPFKHTRVSMRFFAGPTVLEHLDAFLDRIATALQKATHSPLL
                     VLAMDLPSQGFYALAAALLAFRLHDMREIPVRPHKKSRAASEGSPGAQLDGVPSDAHV
                     PFLSEFHKVLETALPTPSGSRTTMQSTGVQAAVQHVSHVMNCAPLPQLNLVALLRSAV
                     QEAEAAIKPSPAIVRATQLAEQYALLVLLDYYLWSSQSSFTPAEPSLGSRSAMLRMVG
                     NCAFAAFVNRVPAALEWMAHVDPWKMSSPDPLHLQYSNALRRWDDKHYVCFGAF"
     gene            complement(<1133821..>1135917)
                     /locus_tag="LMJF_35_2780"
                     /db_xref="GeneID:12980433"
     mRNA            complement(<1133821..>1135917)
                     /locus_tag="LMJF_35_2780"
                     /product="transporter-like protein"
                     /transcript_id="XM_003722624.1"
                     /db_xref="GeneID:12980433"
     CDS             complement(1133821..1135917)
                     /locus_tag="LMJF_35_2780"
                     /note="previous protein_id=AAZ14501.1"
                     /codon_start=1
                     /product="transporter-like protein"
                     /protein_id="XP_003722672.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980433"
                     /db_xref="GOA:E9AFA2"
                     /db_xref="InterPro:IPR001958"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:E9AFA2"
                     /translation="MTQRGRGTSDTTRTLAASCEGSGNSHERVECTPLPRGQLFILCV
                     VLLTESVCWSVLIPFVPSFIAYIKGWDIDSSGYASGFPVGLFMLGQVLSGKIWGAFSN
                     KVGRKVAINIGVFCCAICMFFVGLSGSLWMLCVWRFLHGLLAGCSIVAKTMISELTDT
                     TNRAKGLAMVSLTWGVGTLFGPAIGGFLYNPASSSNLAFLHISPTSFMGRHPAFLPGT
                     VVAAYNLFAVVISGVFLRESNQSARPLREVLPRSVVKFLGPVLRFLQPRPPCDKATEV
                     TVIYADDHTEPNGAGPDKSPSSAAHPVGTCVSEPHTHFGFKQAFLNPLLRRVCFISML
                     ICTSDMMFAEIFPLWMAAESQNGGLQLSPHQMAILLLVNGAPTVLANIIFASVIKCAG
                     GPIRLSIASQLIYAVFTAVVPTATAFSTTSRFWFTMAIGMLRKVVESWNFALIMLFVS
                     LTAPQGKIAIMFGIQQSAGCMVRCVVPFIFAPLFAWSISTPRPFPFNHYLVFLLSVIP
                     LAIGAYLAAFVYIPSENSGDGVDVVEHGSSSDMEDNNGSERRSGADSGRGSVRSRYSL
                     LGSVTGEVQECESLLHCSFATVAIATALNPISGVVQNALFTLSEGSPVQMPGEHGAGT
                     ARRPPDESDDSRENSSQEGDEVDDNAEYTTLTDEMEVMPPLISDGILEHEDVRVVQVD
                     ELLEDEELPPSAPPSV"
     gene            complement(<1144579..>1145787)
                     /locus_tag="LMJF_35_2790"
                     /db_xref="GeneID:12980434"
     mRNA            complement(<1144579..>1145787)
                     /locus_tag="LMJF_35_2790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722625.1"
                     /db_xref="GeneID:12980434"
     CDS             complement(1144579..1145787)
                     /locus_tag="LMJF_35_2790"
                     /note="previous protein_id=AAZ14502.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722673.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980434"
                     /db_xref="UniProtKB/TrEMBL:E9AFA3"
                     /translation="MNKGAVTTCRMSVVRNCLAWVGVFALLSLLFAGTVDAQVTAPWY
                     RINYNTPAYVLYKPQDVAQYATSRAAANGYCVQNGMSIFSAELPAKDNNFASDTAKEL
                     GGTGYFTYTGSSAEPVPSFARFCTQLQPNPSSTPNSIKCGFTFRFGLLTIIDTMLLGN
                     QPGVAQYYSLYPNVWGAGNANTGYAVEWDTTRLNPRGYYFMAVTGLTDTVGRHVNVDA
                     TVSASDSYVTASKFAIYCESQSFLGYVPVPTVLVQPTFVKGYKDLTWAQEHWWVVFLI
                     IAIFILIVLLTILIYCCLTRTPPKEQPPIAPMVLREHNGSAYVNVLDDGSSKPHNAAD
                     APHQRGLMPETYQQGADILMGPKPAVDPEALIQAKPSIFVREETLQTADGDSVALENE
                     DEELNEKETS"
     gene            complement(<1150756..>1151958)
                     /locus_tag="LMJF_35_2800"
                     /db_xref="GeneID:12980435"
     mRNA            complement(<1150756..>1151958)
                     /locus_tag="LMJF_35_2800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722626.1"
                     /db_xref="GeneID:12980435"
     CDS             complement(1150756..1151958)
                     /locus_tag="LMJF_35_2800"
                     /note="previous protein_id=AAZ14503.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722674.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980435"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:E9AFA4"
                     /translation="MIFGSALVLVVAAINSSANRYLPAKLKLFAPSVGWFIMNLFIAR
                     GPLVWYVCSLAIQGLFATLLFMALGFKSDLVLRAVILPFLVTAMAAWAKEVLPSVGGW
                     TTVAVTLTQLWSILGGIIIHACYPANILQVLEQQDARNRRVRATASTLVRKKDKSVDV
                     RMVPSLDGKTELQTLVVKQGYETSRWIVYCGGNAEFLENSLNDIHVISDALKAHAILY
                     NPRGIGFSTGYLSQLGELVEDVAAVARAYIEKERIDEHNLLFFGHSIGGGTAAQVVAE
                     CYPHASLVLDRTFSSMSDAAVAFSYLTPKVTRKVFPWFVGDLHTLAGWDSVRHNRKLV
                     LYSKQDEVIKFDISSIARLPQFQKDGADADKAVALCGAPPSYHNSLLSAFDNYEEVCV
                     RMSKMFSM"
     gene            complement(<1154541..>1156658)
                     /locus_tag="LMJF_35_2810"
                     /db_xref="GeneID:12980436"
     mRNA            complement(<1154541..>1156658)
                     /locus_tag="LMJF_35_2810"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722627.1"
                     /db_xref="GeneID:12980436"
     CDS             complement(1154541..1156658)
                     /locus_tag="LMJF_35_2810"
                     /note="previous protein_id=AAZ14504.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722675.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980436"
                     /db_xref="GOA:E9AFA5"
                     /db_xref="InterPro:IPR001958"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:E9AFA5"
                     /translation="MHSVENGKPGDPHVVVNGSENRQQGGARKKKRKATPLPMNQLIP
                     MTFVLLNESICSTMLLPFVGLLVAHLKGASVDEAGYHSGVLIGVFMLGQVLSARMWGW
                     VSDKYGRRFPIISGLFTSGLMMFGFGLSTSVWMCAFFRFMHGLFNGNILVAKTMMADI
                     TDRTNAAKGFAFVSLCYGIGVLIGPTLGGMLYDPANSSALRWAHISKESIFSRKPALL
                     PSLVIFFYTNLGMLICTFYVMESNVKAQPLPMFLRYIYPCFLREPQMFVHPSVRSTEQ
                     LEATTASTNSEDTNDFRSEDEDGDCVVMKSGRPLVGNVAMTQVVDFVTATSPVLSEDP
                     RFDQLVLAETLSNASELDLRVVPDCVQDSMFLTRADAEDEGASCQLKCGLFSAPLLNI
                     LVSGGETDDLQRTSGKCRAADDASDEDNRTFFVEAERGGRGAAAINSGADTSDGKVEK
                     QQQHGDSIELKRFGYRQAFERPVTRTVLILYGLVSAADMTVQEILPLWGIAHTDKGGL
                     GFKADKIGYIVLTNSLPCLASNLLFSKACCRYVNKLSLFRIASLWCGVSIMLLPFTSY
                     IKSNYFLIPAVLLCTSVRQFFSSWCYGLTTMLTAHSAPPTHVGSIMGISQSCGAFVRA
                     VIPFFVTPIFAWSITSGHSFPLNHVLVFLLSALTFASGYVYSKRVRTNEEDVLEMMER
                     SWEWTVSVKNSVQNAYRRFRGTS"
     gene            complement(<1163600..>1165543)
                     /locus_tag="LMJF_35_2820"
                     /db_xref="GeneID:12980437"
     mRNA            complement(<1163600..>1165543)
                     /locus_tag="LMJF_35_2820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722628.1"
                     /db_xref="GeneID:12980437"
     CDS             complement(1163600..1165543)
                     /locus_tag="LMJF_35_2820"
                     /note="previous protein_id=AAZ14505.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722676.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980437"
                     /db_xref="GOA:E9AFA6"
                     /db_xref="InterPro:IPR001958"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:E9AFA6"
                     /translation="MKGKMKAASFYTSMVILSTVFVSESLSATLMMPFVGLFVAHLEN
                     IPASQAGYVSGLLIAIYQLGQMLTGKLWGTASDRVGRKPMIQMGLLANVVASIFFGLS
                     PNLKFCIITRFIQGCANGNVLVAKTVIADITDKDTEGIGFAAISIFWGVGSVVGPALG
                     GYLYNPSHHPVLGPWLFTDGMEDNDNIFVLHPALLPCVVISTFSAITLLVIWRVLPET
                     SRHPVDPFMSLFMSAWHRGRRMSDLAKQRGMGAAGRSNGAESIAVIENEDDDENGVAE
                     NAWQNITAANGFSGHPRLAALRPPLSKKTFPCTNAPSTQESLNQAAALTSWTRDSVSQ
                     SPVAGMGGSAGRYGLSERHTSRAASHSSAVCLLEGARCGESDVPGQQRQLSDDVASPP
                     LHWLETQLKDKTCSDTPLLCQSREAASDSDFTTRTFEPMAFGYREALALPTSRTVLII
                     YMCIACTESALLEVIPLWAIAEREKGGLGFSSSDIGALLCISSIVYIAVSLAFSRILK
                     CLSGATRPLWDFSVLLWCTTSILTPCCAYLADDSTIFYAAAIITSTREISLSWCYSIV
                     FMYVVRSAPDECAGSINGIAQSFSSLSRMLTMSAIPPIFAWSLNGVTHPFPLNYHLVF
                     WITCVPLLLSFVLSSILPVRVSG"
     gene            complement(<1167186..>1168928)
                     /locus_tag="LMJF_35_2830"
                     /db_xref="GeneID:12980438"
     mRNA            complement(<1167186..>1168928)
                     /locus_tag="LMJF_35_2830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722629.1"
                     /db_xref="GeneID:12980438"
     CDS             complement(1167186..1168928)
                     /locus_tag="LMJF_35_2830"
                     /note="previous protein_id=AAZ14506.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722677.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980438"
                     /db_xref="UniProtKB/TrEMBL:E9AFA7"
                     /translation="MLSLFAFPFLWADARAHVCVCVYVSCMSSVLFCGIPHSQPNAWE
                     VHQAPPATALKSHHDSPHFSLEVHELKFYADIYNEHHTCCWPRLVLDAHLGKSAEEVA
                     HAQAAVTAAENVKQTFFGPSAAAADAAKASLSLYTNHMAEVMEQLYMTQQEKVPRAAY
                     ARRALFHQGVPPVLRCHEHSDSFAYVLSGQLRLFHSCRLRTSVSDHQFDGRESRCSHG
                     PTADDLARDVFPLVLIMAPGDDCALYVDAEPPVASAATQWRAKPLVLALESVEPVGSP
                     SLDESGVEHEVWCGAYAPFTWICNPFGNQKVSVLIKSTAAMRRMPRTQKHDTAKSAAS
                     TQKAIARQIESPDTTAPASLQPLQLSFIVHASQYACEAAKERIVRALASSDVYNLHVT
                     KCMRFGLGGADFYKRAVLGADEEALSHARSRRPAQLMRLLDDKLELVADATSRVTKPE
                     ERLHSSFADGASRESVGSPSLKVPRHEGDGEPPSSAADAECSLPRLVPSVAAYPIAQL
                     CTRRPIEREWCRLPKSITLASVLPGPTGITPSHSGWPLRVLPHASEGSGPVVELSSLA
                     TLQDLAAALRSVSP"
     gene            complement(<1169334..>1170701)
                     /locus_tag="LMJF_35_2840"
                     /db_xref="GeneID:12980439"
     mRNA            complement(<1169334..>1170701)
                     /locus_tag="LMJF_35_2840"
                     /product="putative aminotransferase"
                     /transcript_id="XM_003722630.1"
                     /db_xref="GeneID:12980439"
     CDS             complement(1169334..1170701)
                     /locus_tag="LMJF_35_2840"
                     /note="previous protein_id=AAZ14507.1"
                     /codon_start=1
                     /product="putative aminotransferase"
                     /protein_id="XP_003722678.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980439"
                     /db_xref="GOA:E9AFA8"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR016454"
                     /db_xref="InterPro:IPR020578"
                     /db_xref="UniProtKB/TrEMBL:E9AFA8"
                     /translation="MCNAHGPPLKKRKPQPLPPTASLPIYLDYNATTPLCEEAWQEIC
                     RVRKAWGNPSSTHPYGLAAKYELEEARKKVQKALHALSSESIIFTSGGTESNNLAIIG
                     GLLALRQRQPSRRYVVSSNVEHPAVAEVLKSIAGSDLGTGGAASITDGAEAASGTTIE
                     TVRAEVNPQTGRLDASTLRAILESLPGGPESVALVSIMFANNEIGAVNDIKELCRVTK
                     ELCGAACLFHSDGAQALGKVPVDVQDTNVDLLSVCGHKFHGPKGVGALYIKPGVTVHN
                     ILFGAGHERSIRPGTENVLLAAGIAEALLFACNNMDRFSTVMRDTRDELLRVLTVELA
                     AYDMGLVVNGAIAVTLPNTLNCALFRRVPNRKTGSPVTYISAQRLILSAADEVCISAG
                     SACHSTAEGAEILVSDPLKAVQANADRAIGTLRISTGRTTTMDEVRRAGRIIARRAAQ
                     QFEEC"
     gene            complement(<1172569..>1174236)
                     /locus_tag="LMJF_35_2850"
                     /db_xref="GeneID:12980440"
     mRNA            complement(<1172569..>1174236)
                     /locus_tag="LMJF_35_2850"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722631.1"
                     /db_xref="GeneID:12980440"
     CDS             complement(1172569..1174236)
                     /locus_tag="LMJF_35_2850"
                     /note="previous protein_id=AAZ14508.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722679.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980440"
                     /db_xref="InterPro:IPR007149"
                     /db_xref="UniProtKB/TrEMBL:E9AFA9"
                     /translation="MASAPHVPTATSPLAAATATGFDEDDVLSQPGGAHAPAALELTM
                     QALFGPIFQVEERGRAAAKDPALIDTQSILHDLFGGAIREDDVHLFQDERHSVEVLAR
                     EMKMNKDVLVYEEGARYFGSAGADVLRADHNVPFTLLESSLPERWDEKRERAAAPSWL
                     LDMPVIFPNRQTLHADPRPCDPSTCAYLESNKFMLYTPTNVLRWSVSDKGVSSNSRIV
                     RWSDGSMTMHVGNDVLTLLPSQESTLNLLGETLEVGKAGMEIDAVIASTVPEKHLTAR
                     LGEAASIEAALAQERRQRKLENRHRNLPYADFSMPPIDWARPRKGRSIHEEFVREEYE
                     MREREMKRRIKDGRPMTLAEQLQLEARLQDHVTTASAEQLQAEREDQLRRAALKAAQR
                     AENRSQKRNRFDRDLDLHGATDSGHGMGGDPFLRDKEDDGRDSDEDVSDVDSFEQQLA
                     DMYARNNAADATAKPVEKKLKSERGNSRYDGLAAALRSLLTQIPMNAEAFASVDGTLT
                     FISMNDTPEDVVRSEVPKMLAEVAAELPTVNTQRVKEEIAALFPGEL"
     gene            complement(<1175705..>1176160)
                     /locus_tag="LMJF_35_2860"
                     /db_xref="GeneID:12980441"
     mRNA            complement(<1175705..>1176160)
                     /locus_tag="LMJF_35_2860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722632.1"
                     /db_xref="GeneID:12980441"
     CDS             complement(1175705..1176160)
                     /locus_tag="LMJF_35_2860"
                     /note="previous protein_id=AAZ14509.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722680.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980441"
                     /db_xref="InterPro:IPR022784"
                     /db_xref="UniProtKB/TrEMBL:E9AFB0"
                     /translation="MTKLVRKLKQMAKKRAHRKTVQKRKVERAQRELERRSEQQSEKL
                     EDEVDREIARLNGELEKEAGARTGVSGPDMDEAATNVVVKRAVRIIGDLILDAPVTKK
                     KQLTRKQAKRKEKMVERGLAVNDSLSKKWDRKKLCVKLRAQIRNEDLHN"
     gene            complement(<1176699..>1178921)
                     /locus_tag="LMJF_35_2870"
                     /db_xref="GeneID:12980442"
     mRNA            complement(<1176699..>1178921)
                     /locus_tag="LMJF_35_2870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722633.1"
                     /db_xref="GeneID:12980442"
     CDS             complement(1176699..1178921)
                     /locus_tag="LMJF_35_2870"
                     /note="previous protein_id=AAZ14510.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722681.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980442"
                     /db_xref="GOA:E9AFB1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001245"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9AFB1"
                     /translation="MSAVLVDTRGHEYRLEMAVDPERGSYGALFAQATTYRAQRLFRP
                     CMEDIPGLVEDNASEAGAKSLASAALVTYIPLTTSLQESDTTSEAALLHLLVQNIRLR
                     RQADHPYLRTLIDAFYTNQVPSSPSSTSGGVGSVVVMKGPGASPASLSPPRENLVKQT
                     GTAQDSGGTNWPAGAAAPALALSPAITALVVVEEYIEGCSLADYADAVAKMHLKQGNL
                     KIQNDAAAIACQLAQALLHLHAVGHVLCRDLPLDCVHMDINKGCVQVRLPLSATAMLD
                     MVEGSASAAPGAVMASPRTTSIGESTSNAFREGKCFVGAPELSKMSDWNKIASPPCGA
                     LPLYADVWALGLLMLQLCSLNHKNLSGATDATERLLVIRSHLLQPAALLPADTEEDMA
                     ELILSCLECSPTKRPTLSMLLKSSAFAKHRSFTMREPNRAVISLAQAVKAIRRHERTS
                     ASVQPAALHSRTMSTIDTDLPNQVVDDSLISLSLQDLHWTTPPSFRDVFVPILVSPPG
                     TADLCEVPGGIASRDLTAAATTQGRQRPPPSLAAATEQALHDVALLHDRYRDICVMAT
                     QSSTSAAPSAQQSACAALRDRVQNTGQLPRDFTTTTTIMEELTEHLAKLEQNDPKLCL
                     RFMELLLEGFATCPSDIAAVADSVALADTLFHASATDTAATSGAQPVRKEAPLEEATQ
                     HSVPGQKEAVFNVAETLRVMPSMPAHVISSDRAANTSSVLYNSWLRKQRKKHLKMDEY
                     "
     gene            complement(<1179762..>1180187)
                     /locus_tag="LMJF_35_2880"
                     /db_xref="GeneID:12980443"
     mRNA            complement(<1179762..>1180187)
                     /locus_tag="LMJF_35_2880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722634.1"
                     /db_xref="GeneID:12980443"
     CDS             complement(1179762..1180187)
                     /locus_tag="LMJF_35_2880"
                     /note="previous protein_id=AAZ14511.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722682.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980443"
                     /db_xref="GOA:E9AFB2"
                     /db_xref="InterPro:IPR007233"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="UniProtKB/TrEMBL:E9AFB2"
                     /translation="MTLYSIYVFNRYGDTIYTKQWKRTSAVQHGEDGLVAGFVYTLQH
                     ISSQLSSTQAGGLRAVHTPLYKVHYLETMTGYRVALFTDKAMSTALVQVALTELLKDV
                     FIRTVTKNPSYRHEKGMLITGTEFEEAMEALFRQKKLLT"
     gene            complement(<1181027..>1182736)
                     /locus_tag="LMJF_35_2890"
                     /db_xref="GeneID:12980444"
     mRNA            complement(<1181027..>1182736)
                     /locus_tag="LMJF_35_2890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722635.1"
                     /db_xref="GeneID:12980444"
     CDS             complement(1181027..1182736)
                     /locus_tag="LMJF_35_2890"
                     /note="previous protein_id=AAZ14512.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722683.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980444"
                     /db_xref="GOA:E9AFB3"
                     /db_xref="InterPro:IPR001537"
                     /db_xref="InterPro:IPR029026"
                     /db_xref="InterPro:IPR029028"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:E9AFB3"
                     /translation="MGEQRSVARMSKSAYRHPLAPKDPSQRNVTIPIRASRAAASASS
                     SSASAALSAEDLKKQAQKVLLLQMQQKVLWEGTVIDDVNHALVQHFLKLSTNDKYRQA
                     RQMLVIGGRAMIEELCRAGHRPRHLMVECGKPIPEFLHDRRKTDVVLVDRSVSVAVTP
                     GSDGYVGDFAIPTPPMKEKLIANHQRLNRVLVLDNIEDPGVLGTLLRTASGYQYDAII
                     ATNHCADLYDHRVVRAARGAHFQTSVPIYTLKDEDGDDVYGLLNHIVERNNLLPLCYI
                     AQADAAGVDGETAGTQTGFVSSPEAPVGRVFRSSVVGAAPVPLPAPRQSDSSYAASLS
                     RELASVSQAREELLSDFCLDRFTGASSAEDDARSGYILFAGPNHKRNMLRRLERSLSR
                     RSTRLLLDSLPSPSEAPSDLLIAMSVVLYTLRPRGNWDYLPVDTKHEHSTLDLQAKHA
                     SVDIGVNRLRVSVDDINLDEAEQQDRAHEANEFMRWRRLARRRGSDYDHWMAAEQRRV
                     QAMVRRERQRRVAPWMPLRDAKTKPMPDWVPNIIDEYRQSLDRDALARERDISTSYQR
                     PPR"
     gene            complement(<1183801..>1185987)
                     /locus_tag="LMJF_35_2900"
                     /db_xref="GeneID:12980445"
     mRNA            complement(<1183801..>1185987)
                     /locus_tag="LMJF_35_2900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722636.1"
                     /db_xref="GeneID:12980445"
     CDS             complement(1183801..1185987)
                     /locus_tag="LMJF_35_2900"
                     /note="previous protein_id=AAZ14513.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722684.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980445"
                     /db_xref="UniProtKB/TrEMBL:E9AFB4"
                     /translation="MRFPATSRIDKATLHRLWTSLPHEQLDKNFWVALEAFCEPFLDS
                     CSPFNHQTFFSVPRTGRILREELTLVDPAIVKACNEQRPFYNAFTLWNPLALAALFKV
                     PIEVVTAQLLLAVQQSWMSVYFVITCRSCGCDVARFRSVNDISFVGTFHSTNAFRCPM
                     CTDRTEVKELKNVAVFFQMERLPALFQRQHHRLYYTEEAGRRRLESFFCPAQASFAFT
                     AHLPDGRYLLSAPFCGAFVEFSVALSAQVIGEKVPYLSHIVDLKAYIRSQNSSADPFG
                     QPIKRCSTTTIPALPRRGMRASPVNDALHCVSSGCISQFSLSDAIQPEEAASSVTGFG
                     AENTEQITPISVVSLKHGKVQFRVYNDTPHSGFLDLFVAFDTRIEFSANPYPQLFHVP
                     HFMHCLPRGMRSSFFTECIPRPPSTTPTTGAYVRHQFALRREQADDPNIISVLREVHR
                     YSLEDHYGLLIGVGDGGASFESTFLSTTAALASSICFFQRVLTRLGEPVALAMRCSVT
                     EGPLKIAAYQGQYNDTDNTRSSYPGAQFVGSVVYASNHPPITGPYLYCSEVEPPKTAV
                     VETTDDGTGKKVVARRLGLLDKYRSPAWLHDEDSSYYDLRGPYGSHATNKKVAGESSQ
                     QEQQFLIRFEVRCVPSMIDDETEMSPRRASACPRLTLQEDGSDSTDVILPYFLEFLRE
                     HFEGASVKEEAHALVVQIPLPMIYAALQISKILDKNAYTKELRGPF"
     gene            complement(<1186893..>1187264)
                     /locus_tag="LMJF_35_2910"
                     /db_xref="GeneID:12980446"
     mRNA            complement(<1186893..>1187264)
                     /locus_tag="LMJF_35_2910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722637.1"
                     /db_xref="GeneID:12980446"
     CDS             complement(1186893..1187264)
                     /locus_tag="LMJF_35_2910"
                     /note="previous protein_id=AAZ14514.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722685.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980446"
                     /db_xref="InterPro:IPR005334"
                     /db_xref="UniProtKB/TrEMBL:E9AFB5"
                     /translation="MQGEVDATTFSLRPDHHHKFRPNELKPIAKSVLESRLEDQEYNA
                     DEIQSISKEIADTVRDKIRSKDLERYKIIVHCMIGEQRGEGMRTGCKMFWDSDTDNYF
                     EEVYVSKHLFAAVTVFGVYQY"
     gene            complement(<1193110..>1196103)
                     /locus_tag="LMJF_35_2920"
                     /db_xref="GeneID:12980447"
     mRNA            complement(<1193110..>1196103)
                     /locus_tag="LMJF_35_2920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722638.1"
                     /db_xref="GeneID:12980447"
     CDS             complement(1193110..1196103)
                     /locus_tag="LMJF_35_2920"
                     /note="previous protein_id=AAZ14515.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722686.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980447"
                     /db_xref="UniProtKB/TrEMBL:E9AFB6"
                     /translation="MQAQPNTSFIGDLLRLFRIELCRSIFVAQNDDGAIGYSDDTALS
                     ATGVRPDGEESMDSDRPNKLKDGSALCAGGNLTRAYFEEAESLRRAKAFLTTAVAKST
                     SGESLLLLQRSIEDKDEQIVWYEAELERVRRQFDQVSDECRQLRQKLEVDAQEAASIQ
                     RQLQRELQILHVENKDVQLQLFRLRKQMAGGNSNQLKEGYRQLKLSKIAQTQSLFDEG
                     DERVVLLVLLGQVESRVNEILDAYDNEYVLTPEALRRDLRNRMAENVVVLLEDMHFCD
                     TAYRRLVAARCSGGNNKSSVAAGDNVDEPDVHRIPLELVHTGNDEEAPDETDGFVAIL
                     FDQRVYEHFQARHALQARLQQYQAMSNASSGQAKDTQPAPSSETDPVYPDPSTLRQET
                     QTTVTPETTHDKRGSCLRGRAHSRAEQSGALPRPATEHQDTVGGGDTAGALEPHPLWP
                     ATDLLPLSATSDGSPLSSSPAPTLPTHSSRATLTALPGMPAAHRGPLLERASRAQRAQ
                     WVANILGPSATSVAFTIPRPNSEQADVVVVQRRLPEVVPAEAAMQRVLRHPMEELSSE
                     RFLSTVEVFTGEDPVQQKLLCRMNYVDPSLAIQVPDTTNFVKVKYAHAENARAVAAAG
                     PAARGSTASQSASESSNGGAGGGSGVYGGNPSLRLFKELGSKSLVENNPGLQYRAGAV
                     SSTTASTVAFQRLNPLSPDRAPEWLLYKQLFGAYRSLTPRMIEVTTIDHLMACASERF
                     FIRMEYRYDECLARAAQQCANLQLRRDMAERLFKDMYVLSDFQEALVDELEARYGYPE
                     LVAKTLYEILCYLDAVVEKDSVLAAYLDVIRGFVSPTQVHFVSYMLYHLSYCWPSADP
                     TVAVAADEVRTVFDYLYRNASPMLLIDPENIFKDYNMASRSAPLTFVSMRQFLASAMV
                     HMEEPLLLLLHGSFHAYTQRKATDEITWDTYEAVIAKCGRMKEERRSLVRFLASGLGV
                     NRRTFASLQQLTFLAASAWSSNFWV"
     gene            complement(<1197115..>1198776)
                     /locus_tag="LMJF_35_2930"
                     /db_xref="GeneID:12980448"
     mRNA            complement(<1197115..>1198776)
                     /locus_tag="LMJF_35_2930"
                     /product="putative dolichol kinase"
                     /transcript_id="XM_003722639.1"
                     /db_xref="GeneID:12980448"
     CDS             complement(1197115..1198776)
                     /locus_tag="LMJF_35_2930"
                     /EC_number="2.7.1.108"
                     /note="previous protein_id=AAZ14516.1"
                     /codon_start=1
                     /product="putative dolichol kinase"
                     /protein_id="XP_003722687.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980448"
                     /db_xref="GOA:E9AFB7"
                     /db_xref="InterPro:IPR026566"
                     /db_xref="UniProtKB/TrEMBL:E9AFB7"
                     /translation="MQAGSILVLCTVALTSEHGESRLLMPLIFLSERCLDHAMNLGHS
                     PILFYASTLLSYLSLVAAKAERRGKSPRDRNVVAETVLYAVVGLAVVFFIVRDRVISL
                     GGIAYVLSGYIFFLKMLPVIGDNEAILIGSLVGFYFCDICVNNNLSFDGGRESVLSLN
                     APGYRTSYPHIASRGMILCAIYIVILVSVLSRWCLIPTNKNSKSSRRRVSRKRISIIF
                     WVSNAVVGVILALLISYQFRDNVLRWLFAYFVSSRFRMWTLVCWFTLLPFAVYLVDAL
                     SMQLRPTVRRKLFHFIGVVAFTPATMIDPPFMAFAFSTAISLCVLVEVARYYNVYGSE
                     CISRFMARHIDDREHIDSVVRTHIYLLVGFGISLMMRCRQLSIDGPPVPAIIELSVNI
                     IPGIVSLGIVDACAAITGSSLFLSSRRTLGRYLKNGLFTERANASITHKTTTGTLGGL
                     VCGLVFWGVILAIAEVPITGPALYSFTMIAACTLTECFIDGVDNLQLPLVVLGAVNNL
                     FALLLPVEDLWVNPAIRRPNPTTARSMANALASPWKGFSSPVTNS"
     gene            complement(<1202307..>1205975)
                     /locus_tag="LMJF_35_2940"
                     /db_xref="GeneID:12980449"
     mRNA            complement(<1202307..>1205975)
                     /locus_tag="LMJF_35_2940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722640.1"
                     /db_xref="GeneID:12980449"
     CDS             complement(1202307..1205975)
                     /locus_tag="LMJF_35_2940"
                     /note="previous protein_id=AAZ14517.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722688.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980449"
                     /db_xref="GOA:E9AFB8"
                     /db_xref="InterPro:IPR003347"
                     /db_xref="InterPro:IPR007213"
                     /db_xref="InterPro:IPR011043"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9AFB8"
                     /translation="MSSEPKPAEAAPPPASIEEHEPAPSTFSESTADGAALSRKKQKK
                     ANKVMQRIRVVDGSVDVRVQHTNDDSVVSKRSAVAHEYIRDKFLRHFVKKPSRRSPLV
                     NRGYYLRMAVMTDLVVRLVQSYLEAPERRAAVYEGAPCPPPVQVLSLGAGYDTLAFRL
                     LLDSVDVFNMDEKRPGAPASSSCPSPSTPVSFAGGEVLFIDVDFPAVLKSKAALMAAA
                     PPKTFPADWHMTPQSEECPIRSPHYAAVGVDLRIASAELLPRLHQHGPTGFAATNPTI
                     IYAECVMQYMPHEDAVQLLGLLATSFPNAVVMAYDQVSPFDSFGHVMQYSLRQKSSPL
                     LGIQACPDGAHMTRRAYAAGMRRAWWGDFYRISTFCLAGAELGRVEALEDFDELEEWS
                     EMCEHYGVTMAVTPAAWDSVITNCCAAHSAFVEYSIDGVACSKSGESVPQNVGRFKVE
                     LHNWPSARYGFEGWGNGGVAVEPLANGDRLLVSFGGFVAGKQHQRVSTVYAHSLQEGE
                     LRVVVAGEDSEGVATAEPTARAAHPPPLVFHTFSRVAPRTFLVWGGRTNPSAPSNEAF
                     LLTLDVPRMVGLDTTVVARWRALSVRCDNGRRCCPSPRYRHSMVSLGSTGDEATLLLV
                     GGKAAGANAAAALECFRVTVCMRRFSISYEALDCAAANGLSPPPLHSAAATALSHDTV
                     LVSGGVLLGQNACNPHLWQLRLSTKEWSRVPVRLGEGRYSHSLTPVTVNHQDYLLVLG
                     GSSWTEKSRLPPALLVPRSLLSSSTGGEAAPAVAVTVSLPADAPWWSRHSCVALGEGV
                     VGVVGGGYTCFSFGTFAAKPKLLCLGDAVDESAWRSITALTASANVGRGIGATNSTAQ
                     EPAYSYDELLSKPWSAVREVMHYSAAAFLEAATASAQPVVFRNVPLGSCLSTWGSSAY
                     LKEAEGNATVSVHVSVGSPQLDFVRKNFAFRHVTLAQLVQHVEDATQLFRTTRGTPSE
                     TWYYRSVAAHMKTERSNLWTDFPALGTDFVLPPGAKEYIEPRLHQSCLRMSAPPLQLW
                     THYDVLDNVLCQIVGTKRVVLFPPREYNNLYVTGSSSAVLNVDAPDLVRYPRLIAACK
                     AAQEVVLRPGDMLFIPAMWFHHITTLLPDAESAESAEGTAMAPYNMSVNVFYRHFSDT
                     AVYDPKDLYGNKDILAVTRIREDLQSAVYDVLGKVRLTPASDAPHVPSNYVEFALRHF
                     LQDLERTVAAMADAHHDT"
     gene            complement(<1206804..>1209956)
                     /locus_tag="LMJF_35_2950"
                     /db_xref="GeneID:12980450"
     mRNA            complement(<1206804..>1209956)
                     /locus_tag="LMJF_35_2950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722641.1"
                     /db_xref="GeneID:12980450"
     CDS             complement(1206804..1209956)
                     /locus_tag="LMJF_35_2950"
                     /note="previous protein_id=AAZ14518.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722689.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980450"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:E9AFB9"
                     /translation="MVGLEGARHYAILAASSTLLRSPASGSAFHYRPFSSEDEAALAS
                     VLSTKPRHVARHIRQSMLHSRRRIAQFRNAVTYLMISLQSKLQRKEMRPEDATAIMES
                     LMRECVDLRQGDMAHLLFRAAIRFRKYGLKISFPFVRYLYESYKRESAKELMRSMAEE
                     LKTQEEMKVLAVLAYQFSGQRDESVALWETVPKDKVTTNDYCAVLDGMGMTGCFNDVV
                     DFAERVVKDVIAKRWHGIDLHVVVSHAAIASRGSSAALHSVVRLAKDHQLTLSDSAVG
                     ALARSRLQERSVTSMADVYKVEAALCAELNRVSLGMAGDSAIIAKSSELMARSHETGD
                     DVMLQKVGHLRRMVEDAITNDTMDDLDPLFASSLLRGFGVLGRFEEMRKCFDLLDKAG
                     AVKDHKLYDEMLRWYAHAYNLKDVIALKEEMTRKEVYHTTQTYQNVFRVLDRYYPRLV
                     EKYLAEMRGRGMQVDGSMYPTLVRVFHALGDHAKVEELFREAKRKAEKGATYNMSPSL
                     IVQMLRCYPKDIVRGDAIVRDAEQYGLLVNEMVQAEVLNYYAMNDRPDAMEAFMARLP
                     YKTANVYRVLLRNATQHRNRAQFNVVLKEMETKQVPLNERLFSVIVTSLAHFQDTEGV
                     REYVHKALGSNQIHTPLFFADVASAFERLGDADAVDQCWAGLLESKMTVTMPVYNRFL
                     DVYMTLNNMAKVQEILETMMKLVPPNPVTATTVVDMLGKMGRLTEMEAILDEMSKSTN
                     AVPTLVTYHQAMNAYAKCGDVAKMEAVREKLKLEGFQENAVTYNILFEGYGRAKRFEH
                     LLELVDERKERGIPMEEFGYVVLLNTYARARMPAEAEALVDEMVSGGTVVLSSRLLAT
                     VASTFSHIGNVEQMQRYISLLLSHPDCRVRDVESVYSIYARLRDTVKLQELLDAAKLP
                     KTALIYNTCVSAFARAGEHAKVAFLLTEMEKQGFALSRNTSIILSSLLLKAGKLELAQ
                     TVLKWKGLTTADVEAGRAAASNGAAAFSSPAYGDSPSCPSAEGDGEVDADEADLLLRD
                     MDDRMVGRTHEVESDEPMCR"
     gene            complement(<1211535..>1213214)
                     /locus_tag="LMJF_35_2960"
                     /db_xref="GeneID:12980451"
     mRNA            complement(<1211535..>1213214)
                     /locus_tag="LMJF_35_2960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722642.1"
                     /db_xref="GeneID:12980451"
     CDS             complement(1211535..1213214)
                     /locus_tag="LMJF_35_2960"
                     /note="previous protein_id=AAZ14519.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722690.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980451"
                     /db_xref="InterPro:IPR001194"
                     /db_xref="InterPro:IPR005113"
                     /db_xref="UniProtKB/TrEMBL:E9AFC0"
                     /translation="MGTVIDEGSQFHEVNESFVRYRKKETAFTSKSEIFYNKGNEHSC
                     INCFLVMRLERHPSGEEVVKISWSYPYTPATSLLRYPNLGKFAMANAGTSYTVDQLSY
                     TFVLTDSKGVREYGHTTAFVNGEAVVTISPYPWCNFFYRLAYLFVTNGQEGGQKLVKA
                     LCKCSTPPSGGMFNTPLDLGLTFNRPYDRLCSFIDTAPLDMLFIFPNMDDLFSVLADL
                     MLEKHIIIVGPNFSIVSNVVMSLQALVAPFDWMHILIPILPTSLLDVLAAPPPYLVGI
                     LTSQLPHVARVPLDSVVAVHLGPGGVCERVDYQNETRDHLPHSGKLSALRTGLSILRM
                     RHPKDQTVRDLCSLFLTYYASLFGEIVLKGKRGYKRDKRALGSTSVFFEKLLCTQSFT
                     ILSEEVKKALESPNSNDWMDNEFIVAAVRGQRGMFPAHYEALVQEEKNGGGFIEKYED
                     CFGSKESFNGFTAAVHGFGGHPLGVGRLFIRCLCSRWCGSDLSEENDDSYYPGRRMGQ
                     AILQHRYYSSSGEAPVITNEMMIDMPSTHASAPEGAREFEVSVHAMTSLST"
     gene            complement(<1214489..>1215634)
                     /locus_tag="LMJF_35_2970"
                     /db_xref="GeneID:12980452"
     mRNA            complement(<1214489..>1215634)
                     /locus_tag="LMJF_35_2970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722643.1"
                     /db_xref="GeneID:12980452"
     CDS             complement(1214489..1215634)
                     /locus_tag="LMJF_35_2970"
                     /note="previous protein_id=AAZ14520.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722691.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980452"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:E9AFC1"
                     /translation="MFKASGTLAALLPSLNFGVNKTDFFTSLWNKPQTRDERVKEYVP
                     EVLEESFEQQRAVLEESMSRDIIVELGNKILQEIDSKSPTPSIAPHLNKLLLEYGVKD
                     VIAQRPLSYLLYPNSSALSAGEQAHELVSSFPDNFRAMIEEVERNGCSAKAATPASAA
                     PGVHAPKAAPSVAAVGHEATSSVQVVSGTAASGEEATSTVAGGQTPGNGAASLPSQQR
                     ADGVIMASEDEYEPMDITMFVKVAAGMAMANLHCGDMRNAVRCVDAGIAHAKEASRLG
                     GLLALKAGLLVRQKKLAEAAECAKLAVEASGNVQGYLHGAYALHKLGRPEEAVALLER
                     GREDHPMNTQLEAQIEAIQKELKLALPASPSFSSAGMGATQEALPAK"
     gene            complement(<1219855..>1221291)
                     /locus_tag="LMJF_35_2980"
                     /db_xref="GeneID:12980453"
     mRNA            complement(<1219855..>1221291)
                     /locus_tag="LMJF_35_2980"
                     /product="putative chaperone protein DNAj"
                     /transcript_id="XM_003722644.1"
                     /db_xref="GeneID:12980453"
     CDS             complement(1219855..1221291)
                     /locus_tag="LMJF_35_2980"
                     /note="previous protein_id=AAZ14521.1"
                     /codon_start=1
                     /product="putative chaperone protein DNAj"
                     /protein_id="XP_003722692.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980453"
                     /db_xref="GOA:E9AFC2"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR012724"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:E9AFC2"
                     /translation="MFRYLSASTARRAGAWGAGASLSAAPGASSTFCSSTNPARLYSS
                     GNKDYYKMLGVDRNSDLKDIKKAYRKRALETHPDQGGNKEEFAEVAEAYEVLSNPEKR
                     KVYDQYGSEAATNPNMGGAGMGGFGTGGRSAEDIFAEFFRGGMGGMGGFGDMFGGGPG
                     GRQGTPTLQPLEVRTRLTLEDVYKGVTKTMRVNRPQVCSDCTGFGTKSKTEKPKCTQC
                     NGSGHVVQQHRMGPGMVQQTISECPRCRGTGTVAKLEDQCHKCHGKGYRTVSQDVTIE
                     IPAGVPSNVTLVVRGEGGTIPGAPPADMHLHIELTPHRVFQRRGNDLIVNKDVTLQEA
                     LLGLHMPLRLLDGRTVNVETSADQILKPEGVIKVTGEGLPGTSGERGDVYIFTHLKMP
                     NKLSDEQKAHIKKAFGTPGKDADASPGNTVRARVLRESREQLEEQKRSLWASQESGGH
                     SGGGGGSSRRSAGSTHGSGAQQVECATQ"
     gene            complement(<1223742..>1224980)
                     /locus_tag="LMJF_35_2990"
                     /db_xref="GeneID:12980454"
     mRNA            complement(<1223742..>1224980)
                     /locus_tag="LMJF_35_2990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722645.1"
                     /db_xref="GeneID:12980454"
     CDS             complement(1223742..1224980)
                     /locus_tag="LMJF_35_2990"
                     /note="previous protein_id=AAZ14522.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722693.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.2990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.2990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980454"
                     /db_xref="GOA:E9AFC3"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR002562"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:E9AFC3"
                     /translation="MRTCQLYACAAFRGLVRSAAATPARTISQSTPLSSSAHDVDGSS
                     SSGGAVSTAPERTSWSHVSPRFSSFPVSGDCAAILKYPYKVISTEQELKEAVGVLQRS
                     RQIAIDVEAFCTPEAIKTPQLGRVSLVQTCSDVVPVVFLFDVLSLSVPVFMQAIRPLF
                     HDETIRKLFFDCRRDIEALSTQMDLTPRRVLDLQLLFTSVQWKLRSVNRRSGMTYVLK
                     SVAGIHRQEGDSAVQTAMMVGDRPVWDTRPLPEHFLEYAADDVRHIHLLSTYFPSLTQ
                     QVSEAAVERLTAQYVQHYGVGHAVTEEADAQPAQVNTAWLERYIGPGGVCSFCGSKGH
                     TETECFRKLNGNMRCSFCGVTGHTARNCFQKHPELLKCDRCGQLGHSTANCFRANPCK
                     HCGGNHRSENCHYRAHIANA"
     gene            complement(<1227171..>1228553)
                     /locus_tag="LMJF_35_3000"
                     /db_xref="GeneID:12980455"
     mRNA            complement(<1227171..>1228553)
                     /locus_tag="LMJF_35_3000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722646.1"
                     /db_xref="GeneID:12980455"
     CDS             complement(1227171..1228553)
                     /locus_tag="LMJF_35_3000"
                     /note="previous protein_id=AAZ14523.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722694.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980455"
                     /db_xref="UniProtKB/TrEMBL:E9AFC4"
                     /translation="MLGIQSWYTALAVPTIVIGGFVATRKRLAYQWREELMDPDGAAY
                     PTMTDADMEFFRRVAPASAVAAAEAVAAPLQRQRAKLQNTPAAHAATEGAHGVALTAK
                     ENIGVCVRSNVLPPEMRNVLLNEVQRWSQTLGNTVDPRKIRAIERSVQLAIAREALES
                     GEVDARASSNPGAASSTPLDFGFLKHTRVIADHPEDIQLMKAPWGSGDRIRLAEMPAS
                     LRYLVERAWQTFEGIGRLRHVYIEYSPTGQFYRAPRPPKMYDGHDYVVIPLRRDQGDT
                     VVTMSPVLRSRVSDLREVVRHSWTNRDVDVLLPSGCMLRVYGTARYEWGWGIRPGPTW
                     FGSRLNPLSPAKAARLDVDPCAGLLYRLKHRLRTYLGMPQGSTAVPPPSCSAATDAAL
                     VVLHYEGPRSSTKQRSLLLEPEIWIFGRAPSVESFETWTEDRPTADAVGEEGLLWFMM
                     RNYLDMLTVS"
     gene            complement(<1232310..>1232735)
                     /gene="GLO1"
                     /locus_tag="LMJF_35_3010"
                     /db_xref="GeneID:12980456"
     mRNA            complement(<1232310..>1232735)
                     /gene="GLO1"
                     /locus_tag="LMJF_35_3010"
                     /product="trypanothione-dependent glyoxalase I"
                     /transcript_id="XM_003722647.1"
                     /db_xref="GeneID:12980456"
     CDS             complement(1232310..1232735)
                     /gene="GLO1"
                     /locus_tag="LMJF_35_3010"
                     /EC_number="4.4.1.-"
                     /note="previous protein_id=AAZ14524.1"
                     /codon_start=1
                     /product="trypanothione-dependent glyoxalase I"
                     /protein_id="XP_003722695.1"
                     /db_xref="GeneID:12980456"
                     /db_xref="GOA:Q68RJ8"
                     /db_xref="InterPro:IPR004361"
                     /db_xref="InterPro:IPR018146"
                     /db_xref="InterPro:IPR025870"
                     /db_xref="InterPro:IPR029068"
                     /db_xref="PDB:2C21"
                     /db_xref="UniProtKB/TrEMBL:Q68RJ8"
                     /translation="MPSRRMLHTMIRVGDLDRSIKFYTERLGMKVLRKWDVPEDKYTL
                     VFLGYGPEMSSTVLELTYNYGVTSYKHDEAYGHIAIGVEDVKELVADMRKHDVPIDYE
                     DESGFMAFVVDPDGYYIELLNEKTMMEKAEADMKEQGTA"
     gene            complement(<1234327..>1235688)
                     /locus_tag="LMJF_35_3020"
                     /db_xref="GeneID:12980706"
     mRNA            complement(<1234327..>1235688)
                     /locus_tag="LMJF_35_3020"
                     /product="putative phospholipase A1"
                     /transcript_id="XM_003722648.1"
                     /db_xref="GeneID:12980706"
     CDS             complement(1234327..1235688)
                     /locus_tag="LMJF_35_3020"
                     /EC_number="3.1.1.5"
                     /note="previous protein_id=AAZ14525.1"
                     /codon_start=1
                     /product="putative phospholipase A1"
                     /protein_id="XP_003722696.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980706"
                     /db_xref="GOA:E9AFC6"
                     /db_xref="InterPro:IPR005065"
                     /db_xref="InterPro:IPR016715"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:E9AFC6"
                     /translation="MHPIFDYILSIHYLPAGASVLLSCLAAAWGVDWKVCIMMTCVGS
                     LVTCAVFYVQPLQCFSPLGGSFNVGTREVCGERGAMKPPVTIVYPTASGTPRSGIQYI
                     PFGERSYLVGIASYSKVPYALVKDLWLLRKKMRPNAEPAPLFQRDGMPRPMIVFSHGL
                     GGFPHLYSTLLMDLAVRGAVVFALSHMDGSAAFCRDAEREIRIPLNTQVGWTSEDRAP
                     QLEVRIRETLNTIKRIRSGELLLALGYDKETVDKYIEKEPRIHLLGHSFGGATCLAAA
                     LADTQAASERGGVSSIASTVVYDPWMIPLQKTMFYDKLTDRKQPVHFTTPTLQIFSEE
                     WVRSKEQHAFFEEVKAIVDAQPRTTEESALVSAVDAKLKVMKTSWYTIKDYRGTGHLT
                     CTDVSLFSPVLYRAAYMTASPRGCIVAFAAETMRFIEKVSGPLPLDTKLLNDSALAAA
                     LRG"
     gene            complement(<1236443..>1237243)
                     /locus_tag="LMJF_35_3030"
                     /db_xref="GeneID:12980457"
     mRNA            complement(<1236443..>1237243)
                     /locus_tag="LMJF_35_3030"
                     /product="putative prenyl protein specific carboxyl
                     methyltransferase"
                     /transcript_id="XM_003722649.1"
                     /db_xref="GeneID:12980457"
     CDS             complement(1236443..1237243)
                     /locus_tag="LMJF_35_3030"
                     /EC_number="2.1.1.100"
                     /note="previous protein_id=AAZ14526.1"
                     /codon_start=1
                     /product="putative prenyl protein specific carboxyl
                     methyltransferase"
                     /protein_id="XP_003722697.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980457"
                     /db_xref="GOA:E9AFC7"
                     /db_xref="InterPro:IPR007269"
                     /db_xref="InterPro:IPR025770"
                     /db_xref="UniProtKB/TrEMBL:E9AFC7"
                     /translation="MSHSSAREQGAGEKEEIRRINRELQRNLILETALIGFALGVLAL
                     AGVLFTAYGWHTHNDNLFALGLYILAVHVAFHVLEFLVAAFTRPRDTHPDAFMVFHSI
                     PYLTASGTALLEFFVEAYAVPEKWKLDPTRHALLGFFLRVNYTSALFFTLLVLVFYGI
                     RVVSMLQCGSNFSLMIEHERHSGHQLVTHGLYRYLRHPAYFGWFWRTCCAQWILANPV
                     SAVVHTVVTWYFFRSRIAYEETALQRPDYFGEAYKKYKVRTIVGIPFL"
     gene            complement(<1238262..>1239077)
                     /locus_tag="LMJF_35_3040"
                     /db_xref="GeneID:12980458"
     mRNA            complement(<1238262..>1239077)
                     /locus_tag="LMJF_35_3040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722650.1"
                     /db_xref="GeneID:12980458"
     CDS             complement(1238262..1239077)
                     /locus_tag="LMJF_35_3040"
                     /note="previous protein_id=AAZ14527.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722698.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980458"
                     /db_xref="GOA:E9AFC8"
                     /db_xref="InterPro:IPR007763"
                     /db_xref="UniProtKB/TrEMBL:E9AFC8"
                     /translation="MSSVFTYGAHGANPMAKKYGEMAVKSSKCGSKNFVYTKAHDDAH
                     SFPRHHHRQGDNPVRLSFTWARWRWIVHDFRMFGLFGALRKHYYIGEAWRRKDEKIFV
                     GKDENGNKYWQSRRAQGTYFVRILEPADPHWFRGQSPHAASPMWLKWMQGGAAHTPAQ
                     MKARGEWGHNSRLGIPMPFNIKYNEWSPLNAGNIYTRDPMWVATTGLLVNPERRALQE
                     AGFSRWMWQKGLPVYMPFCGVHDYSDELVEEFYRGQWAFGHESKGNDHDEWRN"
     gene            complement(<1240662..>1241894)
                     /locus_tag="LMJF_35_3050"
                     /db_xref="GeneID:12980459"
     mRNA            complement(<1240662..>1241894)
                     /locus_tag="LMJF_35_3050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722651.1"
                     /db_xref="GeneID:12980459"
     CDS             complement(1240662..1241894)
                     /locus_tag="LMJF_35_3050"
                     /note="previous protein_id=AAZ14528.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722699.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980459"
                     /db_xref="GOA:E9AFC9"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:E9AFC9"
                     /translation="MVASITFRLKSSNHVGTIDMEGSVMSCRDAQQAIAAKLRAPPEE
                     INVFLAGSTALLHPEEDLPAYAVVDVVRQTHSGKPLFLTRPRFASLPSSLDSIPSSSG
                     FGGPPGFGDGHALTEEERLAQLQAEAALETGIDEVSSRFRRGGRGGRGGMGGGRGGMG
                     GSGGSSGSDLFFGGGRGRGDAMRANMEENFRPPPKGYICHNCGKGGHLIQHCPSAKGG
                     KAMKVLSFPVGIPESMLVECTMDDPAPKFITRDHRLVKRRVDPSVFTAISVAGIGGDV
                     SGDTGRDDELHEMAFSPENATEPSKVNSASATTAEASPSTKPTDAALSCVVHNGVARE
                     AMRLPCCGRLMCQSCFTKMAEEALDETRSLDDEDDGGVVCPGCKEPLIMDEVVPATEE
                     RERMRQLLRERKRERDTH"
     gene            complement(<1245239..>1248703)
                     /locus_tag="LMJF_35_3060"
                     /db_xref="GeneID:12980460"
     mRNA            complement(<1245239..>1248703)
                     /locus_tag="LMJF_35_3060"
                     /product="putative ubiquitin-activating enzyme e1"
                     /transcript_id="XM_003722652.1"
                     /db_xref="GeneID:12980460"
     CDS             complement(1245239..1248703)
                     /locus_tag="LMJF_35_3060"
                     /note="previous protein_id=AAZ14529.1"
                     /codon_start=1
                     /product="putative ubiquitin-activating enzyme e1"
                     /protein_id="XP_003722700.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980460"
                     /db_xref="GOA:E9AFD0"
                     /db_xref="InterPro:IPR000011"
                     /db_xref="InterPro:IPR000127"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR018074"
                     /db_xref="InterPro:IPR019572"
                     /db_xref="InterPro:IPR023280"
                     /db_xref="UniProtKB/TrEMBL:E9AFD0"
                     /translation="MEAERKALIDQRYLDKQSRTIGTYGLETMAKLIAFKVIIVGCGG
                     VGIEIAKNLALAGIHTIRFYDPRKPTVQDMGVNFAVTPQSMASGKTMAELSAAYISEL
                     NPNTRVGVLAELTTATVADNVALIFTTAAPDLRLTTLSEWNAFCHNHTPAISFVLALQ
                     TGTMGSVFTDHGPSFVVKDADGRPMLQKLITEVVTLRDKTGEMYTRIRYETPEGQTPG
                     ALRDYTQIKLSEVQGLLKPDGTSANGQVYDGVICPSDPRDTVRVYPAFETQGYSPYET
                     GGFLHELKEVKVLPFRPLSEALAAPGPFVSVSPMMDNSEESLTHVTLHALLRYADAHA
                     GKLPELHNAAQATAVVELAKKVLEENKAMPAPPEQRTTGKPSNAEFPYKVPPPPPPAP
                     LVLESLDEKAVMAEALVARAELQPLASFFGAVVAQEIVKITGKYSPIHQWFHLSCAAV
                     RPERADYSSEEFRPMNSRYDHIISIFGKGFQQLLQNLRLFMVGCGALGCENVKNFALC
                     GITCGTGGSLVVTDNDRIEVSNLSRQFLFREENVGQSKSAAATARMRQMNPDANVDAR
                     QDFIGTTTEHLYPDTFWQSLNVVVNALDNIEARLYVDQQCVRFQKVLVEAGTMGTGGN
                     VDIIVPGRTSSYADGGAADQTGGIPMCTLRNFPYIYDHCIEWARAQFDDLFVSPMQAA
                     QQIIEDPAAFTQRIHHEVSSGSSAGERRSLIDKNVGPLKLLKRTLTILADGPTMDRCV
                     ALGWEQLFKMFRDRILDLQAAFPRGAKKKNGEDFWSGHRKYPTALQVTAADIATNPDA
                     KNFLVAAINLYACMFGVHPPKHEARFNDEKNRWMQEYRTDAWIQAEVNKLPTPAYVAG
                     SVDNLDDDLAADAQEGKQVSMEESEAELQGLLADVAALASKCKGSKAAALEFEKDDDD
                     NFQIDFVAAASNLRAENYGIPTQDRLKVKLVAGKIIPAIATTTSAVTGLGLIELFKVL
                     QNKDISVLRNGMLDVGTNNYVLFERDLPIKNFTKVVATYIPEQDYTYKKKIIRVPEGF
                     TKYDMIRIPVTPATTVKAFAAALEAVLNKTLPEGADYAYEVDGLGVGKGMLWNGRSSH
                     ANTNASLMKVIEQQKASEAGGTLPAPFWQNRFQFCDLSATVSIDDGDDTVDEVDVETA
                     TVCLEIQQ"
     gene            complement(<1250506..>1252974)
                     /locus_tag="LMJF_35_3070"
                     /db_xref="GeneID:12980461"
     mRNA            complement(<1250506..>1252974)
                     /locus_tag="LMJF_35_3070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722653.1"
                     /db_xref="GeneID:12980461"
     CDS             complement(1250506..1252974)
                     /locus_tag="LMJF_35_3070"
                     /note="previous protein_id=AAZ14530.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722701.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980461"
                     /db_xref="InterPro:IPR023374"
                     /db_xref="UniProtKB/TrEMBL:E9AFD1"
                     /translation="MHFPAAETAVEPPVQRQRFEDESVEEKSLKERLRNSWPQLSVAD
                     DDGKGPSVSASALWSMLLDHDRAHEHCQTERWTLRSRFGAHNRFALCVTFHSVAVVSD
                     VDPPKEDSLLTHACVVNWSITDHEKKKYYRFCAADDRAPALFSMMVAKKTIQNQPAML
                     QAMLEQFNNERLVLPDQLLDEAASTRLTELDVQFGKNTLKAAASAANRVHQLLVPRYT
                     LHLEGVSSEHEESDLSKEVRAVVDLTFMPRSIPPALGGTRGIVSTGNWEDDEFSYCLH
                     HTRLLGGSLRVTRASDNLELARDLEINRGSMWMEHSFGGVVPRSVEEARFMQDLRRCR
                     LAEETDHMVHDHCLIRLYDKMAQCFSITRVMSAETGAVKRCDATVHSAASKEAFQHNS
                     GVIMSDETDESYMSSETGVVYPTRWRVECPASDGCRVELHLAATLPNQEMITCLAQPS
                     EWEGTVTVTGKLIMADGSVTEVRGDGFVTSRGRGKLRMENDVFGMLHGLGSAAMKRAE
                     VAAAGSWEAIAEGPGLVALAGLKVALKMQQFHLTLSQQMVLAALLGTYGYIYHHPQEV
                     EEVKKALQWCYNRWMTFYGASAINYRTLTLRAFIMQELCDVAHAKCAAWIQKRAQALD
                     IAVPVSCLFNSDVADSCVFSLPARCLLLQPPSMLEVSQIKALMAGTWVMDPEKTEGSM
                     NAVLLEQGVNVLLRSVNSKTVPTWVVHVNCENKIVIDEVTMLERRHFVIALDGTEWTW
                     ESVSRDRVKSRSCVLSGGRELYVETEVQEGIERVWYQFQDGDKTMVQNIFYFTNPTTS
                     TPVASCKRHFKIQLPPGSPTSAKK"
     gene            complement(<1258898..>1260436)
                     /locus_tag="LMJF_35_3080"
                     /db_xref="GeneID:12980462"
     mRNA            complement(<1258898..>1260436)
                     /locus_tag="LMJF_35_3080"
                     /product="putative glycerol kinase, glycosomal"
                     /transcript_id="XM_003722654.1"
                     /db_xref="GeneID:12980462"
     CDS             complement(1258898..1260436)
                     /locus_tag="LMJF_35_3080"
                     /EC_number="2.7.1.30"
                     /note="previous protein_id=AAZ14531.1"
                     /codon_start=1
                     /product="putative glycerol kinase, glycosomal"
                     /protein_id="XP_003722702.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980462"
                     /db_xref="GOA:E9AFD2"
                     /db_xref="InterPro:IPR005999"
                     /db_xref="InterPro:IPR018483"
                     /db_xref="InterPro:IPR018484"
                     /db_xref="InterPro:IPR018485"
                     /db_xref="UniProtKB/TrEMBL:E9AFD2"
                     /translation="MPYIASIDQGTTSSRCIIFDEKFTILSAHQLFHKQITPRPGWLE
                     HDPEEIYSNCCLCLAEALKKLRSKDPKFEKVSAIGITNQRETGVAWDRKTGKPLCNAI
                     VWSDARTYEVSNRIAKECGGGDRNFAANITGLPVSTYFTAFKFRWMLENVPAVAAARK
                     SGSLLLGTIETWLLWKLSEGKVFLTDVSNASRTFLMNLRTQQWCDKLCQELDIPLAAL
                     PEIRSNSERYCDVVANDHGIRDALGVPTPVTGCIGDQQSALFGHIGLHKGDAKNTYGT
                     GCFMLMNVGTEPQFSKHGLLGTIAYKLGTEPTKFALEGSVAGAGATVEWMRSNLGFFD
                     HPMQMESIARKVGGTDGVVFVPAFGGLLAPYWDPTARGTLVGMTYKTNKSHIIRAALE
                     AISMQVNAVMLAMKEDSGVEMNCLRVDGGLTRSRLLMEMQADILGVNLYVPHLTETTA
                     LGAALCAGLAVGVWKSVEEMQKTAKEHLSGETVNPITTDEQVRKARLEAWNAAVKLSR
                     WAKL"
     gene            complement(1261365..1261440)
                     /gene="LM35Cs1C2.3"
                     /locus_tag="LMJF_35_snoRNA0182"
                     /db_xref="GeneID:12980463"
     ncRNA           complement(1261365..1261440)
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs1C2.3"
                     /locus_tag="LMJF_35_snoRNA0182"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461115.1"
                     /db_xref="GeneID:12980463"
     gene            complement(1261844..1261919)
                     /gene="LM35Cs1C2.1"
                     /locus_tag="LMJF_35_snoRNA0180"
                     /db_xref="GeneID:12980714"
     ncRNA           complement(1261844..1261919)
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs1C2.1"
                     /locus_tag="LMJF_35_snoRNA0180"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461113.1"
                     /db_xref="GeneID:12980714"
     gene            complement(1262312..1262394)
                     /gene="LM35Cs1C1.1"
                     /locus_tag="LMJF_35_snoRNA0206"
                     /db_xref="GeneID:12980712"
     ncRNA           complement(1262312..1262394)
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs1C1.1"
                     /locus_tag="LMJF_35_snoRNA0206"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461138.1"
                     /db_xref="GeneID:12980712"
     gene            complement(1262990..1263065)
                     /gene="LM35Cs1C2.2"
                     /locus_tag="LMJF_35_snoRNA0181"
                     /db_xref="GeneID:12980710"
     ncRNA           complement(1262990..1263065)
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs1C2.2"
                     /locus_tag="LMJF_35_snoRNA0181"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461114.1"
                     /db_xref="GeneID:12980710"
     gene            complement(1263457..1263539)
                     /gene="LM35Cs1C1.2"
                     /locus_tag="LMJF_35_snoRNA0207"
                     /db_xref="GeneID:12980713"
     ncRNA           complement(1263457..1263539)
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs1C1.2"
                     /locus_tag="LMJF_35_snoRNA0207"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461139.1"
                     /db_xref="GeneID:12980713"
     gene            complement(<1264614..>1265897)
                     /locus_tag="LMJF_35_3090"
                     /db_xref="GeneID:12980711"
     mRNA            complement(<1264614..>1265897)
                     /locus_tag="LMJF_35_3090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722655.1"
                     /db_xref="GeneID:12980711"
     CDS             complement(1264614..1265897)
                     /locus_tag="LMJF_35_3090"
                     /note="previous protein_id=AAZ14532.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722703.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980711"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:E9AFD3"
                     /translation="MLRRTLRRLTAHSDHSGPLNAHQVLGVSPGTPFEEVQHRFYELT
                     KRYHPDVENGDPVKFREISAAYHLLRAQYRVSSTRGSAAGEARRSPSSRSRQREKRET
                     PTGGAFWAERNEQVRKANEQRERERWAAEERDRRQTEHRSFLRELLVFLNGSEIAISI
                     GTVILVLLYSVERYHTVHRMLAEKRRRLKNMDEGLPPPMPLEVDRTLIDKYSTLPEAR
                     EQQIDALRIREESSYRRATQRKFEDFREFMFVYDPEAIASRKVTSTRFSHQYMREEEI
                     PKRCPILREFNSKSRTHHYGAIQKELEQAIRETPWSAPDAGYAGSLVAKGLNSIAMNS
                     PNTTKWTFIEYTDMNNGSKNAKTTCLAALRNLRFEQTGMCQRIAVTGKSKLQPMLVAQ
                     REKDLKEGVLKKRAIVTGGELPVKDLSTPLESMKL"
     gene            complement(<1270926..>1273697)
                     /locus_tag="LMJF_35_3100"
                     /db_xref="GeneID:12980464"
     mRNA            complement(<1270926..>1273697)
                     /locus_tag="LMJF_35_3100"
                     /product="putative ATP-dependent RNA helicase"
                     /transcript_id="XM_003722656.1"
                     /db_xref="GeneID:12980464"
     CDS             complement(1270926..1273697)
                     /locus_tag="LMJF_35_3100"
                     /note="previous protein_id=AAZ14533.1"
                     /codon_start=1
                     /product="putative ATP-dependent RNA helicase"
                     /protein_id="XP_003722704.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980464"
                     /db_xref="GOA:E9AFD4"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9AFD4"
                     /translation="MEYINDKKISDTEYQRDGAVEGGDVNTFRDDRPEYSRGGRGRRG
                     GAHRSDNWRSDPSGGGGGGGNREDNEEYRGGRGGYRSGRGGRGGGRGRGSYNAWTNRE
                     TCDEDNASPAASDAAGDRAYASNPSTAPAPVSAPAPAPAAAPTPASAPVSVPEKAPAS
                     LPAETGGFAPPGHERREAASEPWNREDDRCYSRGGRGGYRSGGRSYDGGFGGRGGRGG
                     RRYYDAEEEGGGGYRRRNYDDGDGGEGGYSRNYDSGYGGGGYRRGGYGGRGGRGGRRY
                     YDDEDDYGEGGDRAGGTGNEDDDYEDGGYDAYRRGGSRWRRGGQGRDYDYDRPRGRGE
                     RGGRRDFRSFRNEDDAMEESGGAQGNAWASSPAPTEAGTAPQEYAPAPATAAGAVAPR
                     SAAPDPAKADEGVPSPAPQQMQSGIRRVTRAAHLRRNCHDEAKVMELFEHHHRQSGIS
                     LDNYDSIPVEMVPRDVKPVEDFADLLVEPALAANIERCGYKKPTPVQRYGIPVALSGS
                     DLMACAQTGSGKTAAFLIPVVQYMLVHGVSPARQRKSYPIALVLAPTRELAVQIFDEV
                     RKLTFNTDIFYDVVYGGTRYPQRFEQDILVACPGRLRDMFNEEYLSFSAIKFLILDEA
                     DRMLEMGFEEQIEELVASRYTDMPTVDDRQTFMFSATFPQRILNLAKRYLRRKYYLLT
                     VGRVGSTTKNITQTIEHVPDNEKMDRLLQIIYGHEMSDMVLIFVETKKMAEDVNRRLH
                     REGISSTTIHGDRRQQDREAALEDFKQKVTPILVATDVASRGLDIPDVAHVVQFDLPQ
                     EMDDYTHRIGRTGRAGNKGIATAFYNRNNRRLALDLHKYFSEHGQEIPKWFQQEAELV
                     EGEALLSRDMGGGGRRRGGGGGGGGGHRSGGPGGRGGGGGGGSWGDSRPSAPSGGGRR
                     GGGVDDGGF"
     gene            complement(<1275337..>1277145)
                     /locus_tag="LMJF_35_3110"
                     /db_xref="GeneID:12980465"
     mRNA            complement(<1275337..>1277145)
                     /locus_tag="LMJF_35_3110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722657.1"
                     /db_xref="GeneID:12980465"
     CDS             complement(1275337..1277145)
                     /locus_tag="LMJF_35_3110"
                     /note="previous protein_id=AAZ14534.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722705.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980465"
                     /db_xref="UniProtKB/TrEMBL:E9AFD5"
                     /translation="MEFKPNHRRVWVTSAVVLTALVALMVRRRQQKRQLARRTVGDAM
                     HEELAEALKHTLLPVLVRPEYLPAGWGVAPPVFYPPCCAAIPLVLPREMQDLETDSSG
                     ARSASTSRFERGGADGLTVAPTAFLFCSYTGYAAGPFATRQDEEVFLAEVLAHHPVLR
                     ERLAENPGQWSPLPEFAPHAGTDVKSAAAVTKGRRQNSFPRTFSHVLVSDDGIFLAGM
                     NGPYTVVAVLIDFAGAWPLSRTARASADGEESGRKRTGSATPPTIAEETELSDAIEGI
                     ACATVNVPLVALGSDAAALASRAPGTSFAAHQGYYRVVCAREGRELELCVPPEWTVRN
                     ECVRPPFTAPAGPSVPARKSVSTEGEYAESKGTILILSFTPSSFMLEGRVDVRISAEI
                     FSALFEDPEAAAATLWAASGATDVSNPVAKVTLGPLTARPLPASSHARTNVVTMVYVQ
                     PKFGVLFSVHPRSAVVYEPWMTEQPTILYYPLGDAAEDEESPRMTIEYVVELPKTWEV
                     FARDDEEFVHNVLFHFTTGEAAAISTTLTEISGIRCAMFNQTRESRRCRTYVLPRGAT
                     LLVIRWETLAESWDKDLPVFQQTLDTLHIDAAAVRQ"
     gene            complement(<1279779..>1284653)
                     /locus_tag="LMJF_35_3120"
                     /db_xref="GeneID:12980466"
     mRNA            complement(<1279779..>1284653)
                     /locus_tag="LMJF_35_3120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722658.1"
                     /db_xref="GeneID:12980466"
     CDS             complement(1279779..1284653)
                     /locus_tag="LMJF_35_3120"
                     /note="previous protein_id=AAZ14535.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722706.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980466"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:E9AFD6"
                     /translation="MKHLFNHVNIHNQQRVTWENFVNYLVAEASNDTPGTRLSNYSFN
                     QFTFSRRLRSQSKPSQKLRKPKKSTSAEKLTFKRYCRGVQEVPKAARTSADQEGVTGR
                     GRAAADVREDEDLGLIRFLDGLPGHRSLFFASTRSCPFMLYSKNTLERVYSAPPNMLP
                     GVIPSAVCYLAAHDLFVCYSPDDRLLRGWGALLSNGLTGTTITPLLLEGLVRRIQVMP
                     RESPTYADYMETLFLGNSLGQVLRVTAPHGHSGGMEFTVAQTYANLHTRTSGGLVDFC
                     VYGVHLYSSGFDGRLVATSLLTGKSCELGRVANEHLTTLVYVAGHDWVVAATSCGRQL
                     LWWEAHSHGTLPGTLFDVSGHGEHNACIIALVHVAAADQVVSADCEGVVKVWDASTQR
                     CVQSFRSSRVPQRHKGSLCSVPANEAKASSANTRTAAHAGSGLLAGNLAGLFVNLGLL
                     ALLPAGAGQAGHVGGPQCHSLIYCASTQELLCGFSNSIVCWGLHGRDSPLVCDAEEVC
                     YDVFYDIRTRTFFVQGATRLSVWDGVHGHRRGVLSQVTESGVSQVGADIKAVCIDELG
                     SRVFISLSDGSVVWHATQKLVSDASQCTPATAAVWWHAKSSGSGADGGGPPFVEQMHY
                     SSISRTWIAITSNGTLLVRSEEDNQEVGFSATISVSASPLAQLRVSEELGLVAVTDVQ
                     RTVYIYDMQAWTDAPVTKRLTMYGSLVDLIFLDSAPALVTVHAGGVCRCWSCAPAVER
                     FKLLSVFCHPQHPAPKLATAATVETERAWMQAMGRTHLASAGTTRGRPHMQSPATSPC
                     YNTIAAPTTGIHNTLQMTGASASPLGFMLPKLACFSRPGSACVASRPATPALCTSQRG
                     SLNPLRLGSVLERTSPDQTEVSCEGASSLMKLSMLTGRPATEALQDTRAGDGWTATAA
                     TPTASVEFTSAAYDGRQHYLFLGDSEGVVHTYSMCPLLQAYTLPRCSYASRPAFSLTA
                     VTDFTGADADDGFAAPKLVRSVQVHLSQSTTTERGAEARAGCTYRGNMSTATRRDSDR
                     CGVVCVRWLDDRGVLATSGYDQEVWFLDCNTGEKVACLSTEQRFSGADRAHQSLTASR
                     QQHGGPTQESTVLNGVCNRHKAEAASTLPSHSAFSLPQPPRHNDLNDDGAAAFLTGTS
                     QLCCCTRGSRNEEAPVIEEGGGTVSPAPWSQQEGSALASLPNARYAPVNSHRPASSVR
                     QRCASSSTLSRYSVPELIATAKHDRAPTGLKDGIQGLKDQRGSFLLRPSSCSPTKEQA
                     LSNDAPRGWRPLSHYNTSLLAGSPLERGDSPRDATSAALSASRTSDCDGGTQIHIADW
                     QKRDLMAMRESRGVKPHAPVQPGLHNTLVHVEESKWHSAGVTGQRVLLGAADGVSRHA
                     ARTATAAAAAPALTGAAVPQTETASASSALSLSTNMATSNSLRGEAAARSAEISGNIG
                     SFSVQEVPAVIESCGAVSRPSCNRTRIAEALALCVSGCALTTSAVDEGRSAAAHQQQQ
                     KQPYLPQGARGGRIRPDSESNSSAQRHGSSSRVPLAQPSAPGHRTPFDALPPPQKALR
                     KDGSGEMTSSSTALGVTTCSPSQDTAARAQSFASANALRRPPMLAYSNECEGRSTLEM
                     YSSELHWCLRQPRR"
     gene            complement(<1285908..>1286429)
                     /locus_tag="LMJF_35_3130"
                     /db_xref="GeneID:12980467"
     mRNA            complement(<1285908..>1286429)
                     /locus_tag="LMJF_35_3130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722659.1"
                     /db_xref="GeneID:12980467"
     CDS             complement(1285908..1286429)
                     /locus_tag="LMJF_35_3130"
                     /note="previous protein_id=AAZ14536.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722707.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980467"
                     /db_xref="GOA:E9AFD7"
                     /db_xref="InterPro:IPR001372"
                     /db_xref="UniProtKB/TrEMBL:E9AFD7"
                     /translation="MANIGTHDGVALDKTLRPSQRHSNAEGDGSNSSVLSDMHLSDGF
                     AHGDAEGEDEMDIRASHVHMEALYIDLPAKQLQVIMHSALRAYNTHVFMPTRTTWRKE
                     EGARRELERDVERTALSRIAEYIKKDITAKLGGCWHVIYGHDFATFVTHKRLCFCHFQ
                     IEGADVVVWRHGG"
     gene            complement(<1288250..>1289380)
                     /locus_tag="LMJF_35_3140"
                     /db_xref="GeneID:12980468"
     mRNA            complement(<1288250..>1289380)
                     /locus_tag="LMJF_35_3140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722660.1"
                     /db_xref="GeneID:12980468"
     CDS             complement(1288250..1289380)
                     /locus_tag="LMJF_35_3140"
                     /note="previous protein_id=AAZ14537.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722708.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980468"
                     /db_xref="GOA:E9AFD8"
                     /db_xref="InterPro:IPR005522"
                     /db_xref="UniProtKB/TrEMBL:E9AFD8"
                     /translation="MSGEGSPALFDAVGGHKSSIFYGETAHDGRGTLRKKTTAWEVMY
                     YLAMELAKEDALAQQPDTTHPREDDACAKFVHAAGKMAAFASTLFSIRFPEKYMTKSA
                     TLKSYMENADEWIIVEAGAPARSVVLAPLFHELFDGAEQLKGFDDRYDTGIWGIGLVD
                     ETSGMQKPCIMDVKIGFTRHSPLTPEDKVARIVKKDQKALVRDTALRICGCRRYIHAA
                     AGTEGATASLTCERFGKDIGYAVSNVRELSTCLKTFLSIGAPLAETNEDGQLVFHSKQ
                     MGTATSTERTRMKQRIRHVRAEIKSLLDFFEGKPDGTFMLQHMAFVSASVLLLYDAAA
                     SPATARLCLIDFARSTWRKFNFDESTIGFIQGLKNLDTYLSF"
     gene            complement(<1290387..>1291940)
                     /locus_tag="LMJF_35_3150"
                     /db_xref="GeneID:12980469"
     mRNA            complement(<1290387..>1291940)
                     /locus_tag="LMJF_35_3150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722661.1"
                     /db_xref="GeneID:12980469"
     CDS             complement(1290387..1291940)
                     /locus_tag="LMJF_35_3150"
                     /note="previous protein_id=AAZ14538.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722709.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980469"
                     /db_xref="UniProtKB/TrEMBL:E9AFD9"
                     /translation="MPIKETQVYWHDLPTPRPPWRNVEELKQCVLESKRIAAQMARQQ
                     WRSVCGSVPALQSSIPRALPSRAEQVSRAERLRDRATRHIERPVLFRRVVPEPHATPL
                     QVVNLIMEHLRQRPVLTAEAAEVAERVTLHFNMLTQSSQHRREGGASRPRCNRRGAGP
                     RAGGVATESVLSQVQHQDDARLGLTSSQATIGTSGGTAGSLTMALQDSLLLDTVAEFC
                     AARGLVFRRLSRADLRGMRHRVSSVEVVPYRRVVVLADRHDPIFAVLFGVSRQVTPEP
                     FVVSALQLDGKTPESIPRYRKAEAPVTQVFCMAPAPVPWRRITTNISVSTLRDEFVVA
                     VIELDEAEETADADRNGDQVSTHRSGAKRGRTGGTGATALPRKMQRQLPVDLLGGDEE
                     EEGEMGLVSDAGEDGDAEAAIILNPAATPTVASSSATERVPLERRWLGSAPLFSGTTQ
                     LAETAPGEVAVEMVDPTRGAYDPLLNLPRSEGAARRRGSLQRAWYRRLLPKGSDDFMA
                     RMHTYQADE"
     gene            complement(<1294251..>1294802)
                     /locus_tag="LMJF_35_3160"
                     /db_xref="GeneID:12980470"
     mRNA            complement(<1294251..>1294802)
                     /locus_tag="LMJF_35_3160"
                     /product="riboflavin kinase/fmn adenylyltransferase-like
                     protein"
                     /transcript_id="XM_003722662.1"
                     /db_xref="GeneID:12980470"
     CDS             complement(1294251..1294802)
                     /locus_tag="LMJF_35_3160"
                     /note="previous protein_id=AAZ14539.1"
                     /codon_start=1
                     /product="riboflavin kinase/fmn adenylyltransferase-like
                     protein"
                     /protein_id="XP_003722710.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980470"
                     /db_xref="GOA:E9AFE0"
                     /db_xref="InterPro:IPR015865"
                     /db_xref="InterPro:IPR023465"
                     /db_xref="InterPro:IPR023468"
                     /db_xref="UniProtKB/TrEMBL:E9AFE0"
                     /translation="MRPWFLRGRVIHGFGRGGTQLGYPTANLELSEAAIDFLKPYDNF
                     VLWGWGCVEAAEPNTWEAHAEDASHAPLGPFPFVMSIGNNPQFKNVDVSAEVHFLHKF
                     DGDFYGRVVRIITLERIRSQSAFTTLEELIRTIDCDVVFAEEHLKMPEWAPYGQHEMV
                     NPCCVPAQLRGAAEAPSFGFLEL"
     gene            complement(<1297255..>1302876)
                     /locus_tag="LMJF_35_3170"
                     /db_xref="GeneID:12980471"
     mRNA            complement(<1297255..>1302876)
                     /locus_tag="LMJF_35_3170"
                     /product="putative protein kinase"
                     /transcript_id="XM_003722663.1"
                     /db_xref="GeneID:12980471"
     CDS             complement(1297255..1302876)
                     /locus_tag="LMJF_35_3170"
                     /EC_number="2.7.11.1"
                     /note="previous protein_id=AAZ14540.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_003722711.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980471"
                     /db_xref="GOA:E9AFE1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008266"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9AFE1"
                     /translation="MAHRDSDAITPHSPRSQPRTPTGHIGKQKDAIDRDGVQPGGDVG
                     IGAASLQRWRGMYDGGSKIAPFLSERHTHQQSKEKVAIGGDSSTVVVSPNVIAATPRE
                     SRSPLDSATIPPSPLQVHPKPILPASVAASTSLARQHGVRGNVRSVDKASTDNDEQAD
                     SQGHSSPSCSIIAPSSNGGGDFSLETDNDAQLSNAPCHAPSGRRLTQLELPFPQATLS
                     SPLQSAQSTSADGVDTSAGSQDTRLSSKRSTASRRCYVPGRASRLHANTLLSDGGGGM
                     LSALLSTTSRVTTQASQVTTRAPNESLHGLDTSYMRASLLPLTSETDSTSEGTSLTPV
                     HQRDASITYLSSLPPPPPPPVRTRTFTLAEATEHAAHAPAAHSSTRWTPSALMTPPLM
                     VVESRSLAPSFRTRNPLMQQRQLSHGHLGEHAVAPSQFHDDAAPAAAGPPCPCYRGPR
                     SALLRGCTDRGQSASRTPPIAVLVPLPPESEESAPAPASTPAIASPPPTQPLDSDTYE
                     VNADSMASEMSFRYRERPSPRAQQLDQASVLEPRASVCVSPLHPSLSQVYALTPRPQQ
                     PRSTPARSSPPRNGDPTLLEYVANLKPPRGSCSVRGGLLSVGVALCAVPLCAAILLFG
                     LHYWAVTLQEKSYAEALLRPRMGTMLKVDVALLLSILVSIAVVGGGSGAAIYVLLYRL
                     AIRHQVRAFALCVRLADALPPLDVHRLAAEDSEGRHDSATPIDAATAVGQHAASGDTR
                     TQWFSPFVARWHEEVSRLVKLVTCPIEVSQAEWRSFLFSERRSLALPNEGANGSGDRP
                     VAETTLADGPFRNSNNSRSLPFGVQASVPMTENEPWPPHDAQPGSRYRMSEAVFSRRP
                     QHPVDVSKRQEAVTVVVCRLMAPAELLVEQRPLTQVQLKELQRLSNEFHQRLRTVPRT
                     SYAAITEVGVHEVVFSFNTFSPLPSLVASPAAVALAVLAHKALVEWSPTYLGTPVQWG
                     IAVHRFDAYMSPTRGMQGRLYVSFGTVEYDFARLLAELAALFNYGALCHAGFLADASC
                     ESQCLPVDYVMDLRQQAFVVYQLHDGDVDREQRLQMHSAIASMRNGEYKAAADALRVW
                     RRKNGGCSGLPRTAAHLRYVAGFLECAARRRRPRVSEAKVAAETAPSFTCAVEGVAEW
                     AGESLLTSYFRPPPVWEEEEAPQAPSPDLLCAPAIQATSGGGSCGLQRRECGSSNVLV
                     PSSAQPSRGAAGELTTFFRSLMRRSYRARTRYVLSTEQQEGQVGSRAMGEAPHQPREV
                     LAAIEGDASPPSSLQRCYGPPSPGTESVSGEGNVLEAGSAPLSPRDNVTGCSSSFHAT
                     RSVFEASTPITTFPDVVSGDRKWAALALLTEPDQSTITVTASRPHLFSNSWSLAESGV
                     PEMPTLTPLTSGVLRSSQLDVRRQRRTSILIPAAKKEDDAAGPVTACASAKENATLRS
                     SRGRRDSGGCRSERPRGRSGSQFTTEVPTSDELSSRLLGHPCVSQLTDTTIAHFPSEV
                     SHESLSARSGSVRPRASASTAAASSVLPLFADSTVPFTLQDRAEARSEEETACEADLN
                     QELSMMSVAQRSRSRRSHRATAQPSSVVCSCTRRIDNSLSNTVMVFQGFHPDGYLVVV
                     KRADRRAAKQVAQLRNEVDLLRELHHRNIVNIVSAWKDDEAVYFAMEYACETLATVLQ
                     KFKVLLPGVVRFYARELLNALVYLHRDCGIIHRDLSPNNIIITNTTDRSRVKLIDFGR
                     SIMAPRFCSGSISMSTTVPGNASLEFTERRSSRNKVSATDMPTSVVGTPLFMSPQACR
                     GLAHPTSDIWSLGIIVHLCLAGTYPYPPETFTDPETFVANIGSGRLTPVIADTCEMTG
                     EARSFIEQCLTLSHTERPSASALLKHGFVER"
     gene            complement(<1307636..>1308214)
                     /locus_tag="LMJF_35_3180"
                     /db_xref="GeneID:12980472"
     mRNA            complement(<1307636..>1308214)
                     /locus_tag="LMJF_35_3180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722664.1"
                     /db_xref="GeneID:12980472"
     CDS             complement(1307636..1308214)
                     /locus_tag="LMJF_35_3180"
                     /note="previous protein_id=AAZ14541.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722712.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980472"
                     /db_xref="UniProtKB/TrEMBL:E9AFE2"
                     /translation="MRTPVVGAGVAPLEPAPLEASSAAGEDGGEAGVGDEGTDRERFS
                     KMWMYCLQQMQGHEVGMLMDMMPPDIQELYSDKLSDEYLLDEHDNMDKGVHALRAAQK
                     MVEELTSEQLFHIEEFLAGTDAFNAEANRCHGKAHHPRGDGDNLEEEEEAGGDDDEDL
                     FMHRDEGMGSDEEEWLLEQMIAAGDKTSAAAK"
     gene            complement(<1311071..>1313779)
                     /locus_tag="LMJF_35_3190"
                     /db_xref="GeneID:12980473"
     mRNA            complement(<1311071..>1313779)
                     /locus_tag="LMJF_35_3190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722665.1"
                     /db_xref="GeneID:12980473"
     CDS             complement(1311071..1313779)
                     /locus_tag="LMJF_35_3190"
                     /note="previous protein_id=AAZ14542.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722713.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980473"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:E9AFE3"
                     /translation="MPAISSSALPYPSQRVVVLRHGERRDSVPDAPAESNPPLSEAGV
                     AAIKALAARLQHHLGKDAARSAALVVSPFRRTLQTAEALQHHGIGAAHSMVIDNTLSE
                     VFGPIRVNTSRAPKLPIPSKSCVVGQLPAWGESIEMAAERYVASFLRNGDLYGGLMTA
                     TSSLKDAASTSGEDLPTANDAAVPEAVTNRKVSRLPPRNTSSKSVASGKEKRSSTLSE
                     SSPRDVILVTHGDALASVLSHFYPARVVYETDFLSFVIMRRYGVGNQVYHLEKSEGVN
                     WLVEGADAEPRDPILLIVEKQRCAAEGSSGSGYGNGGEDECASFEDEVVEVDNAADVP
                     LSLAGGRVRLRQSGDFPDKPHANLRVSSATGSRMEVVSPVYAANPLAPPTRLPASATS
                     KSRDPRCSSSGLPTQVGTPPQPPPQMSTSASHHHGHMPGSASHNRSSGQSRSTAAATT
                     SAPAHSYRPSEYPKAGEGCERIRLPTGTPAQSSINSVTINNYGRNLGECADDTEAVGI
                     GNGSLQSTEGRMPLKEGGSVSGHWYREERWEAEKCAMPEDAYRDPTVVFMGSCGGLSE
                     EHRTNRSLQPPAMPAKLVPATAASRIDGPTPSPNLKIAVAVASPVVCASYCSSLMGLA
                     GKSFEMDLGEDATLARGGASRTICTHPAFDTAVAVGASGDLTESLNRRIDRQRSVVHA
                     AFASSGLRAVAAFLIFFNVLVQPHNAATLWFGIFAVAWEVVFAAVVHFSCQPDGWRMR
                     RLRSAVEQLRVKEFCAKSRTTAAGPQCVVIHGAGSHEDADSVPLSVQPLHHLGCSSAV
                     EWQNDAFDLNEDLSPTSRVPKRSMACVLCGVRLIAAIVLKLFIISAMSFVFALLFGLR
                     ATRAMAGICSVYEPTAGLLLLLAYGCICVARGLWDETKLDAALDSA"
     gene            complement(<1315688..>1317796)
                     /locus_tag="LMJF_35_3200"
                     /db_xref="GeneID:12980474"
     mRNA            complement(<1315688..>1317796)
                     /locus_tag="LMJF_35_3200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722666.1"
                     /db_xref="GeneID:12980474"
     CDS             complement(1315688..1317796)
                     /locus_tag="LMJF_35_3200"
                     /note="previous protein_id=AAZ14543.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722714.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980474"
                     /db_xref="GOA:E9AFE4"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9AFE4"
                     /translation="MKTAHDLNQYRLDFLELKALSIPSSLRFLLGIEYDVVLCVNEVG
                     TRRPFRLHFPVFAPTLRKLLSLCARRFGLDCEHGEAESVLTGTASMPLLQYADYLPGA
                     LHVKEILECLQVKPAAKAKKWMSPAACPALPSASAGSDATTDNAAATAGTSNEFEASF
                     IDYSEFSSDSSLDDVHGLGFYLLLDYGLSLATHSHLVGIRFHKDWDPAEALREFQEFS
                     GWSEFDLRYHDEQRPHDGGVIIMPSSQDACDLLEKYEDEDSDDEGDLLPFILRPVSPL
                     VPVPSLEDATLRKLRDQHWDDVKKHWTHLPHTLNTVVVYNLYEGATLTEVLSFFEPLP
                     IVSSAFVEDKAPSHRRRAFITFANLEATRKALDVDGKNTRGCTLRVQVSPPYISPSRR
                     GNPVKTERDSHGAGDGFAKTVCGGAAASTAAHNSCRSASPTSSPSLQIIDNTTTVLHG
                     KAKPAGNGNGGAASDTSSVAAAHVGAASIPTGKSEASMVRPVATSPTPAYVVQAGSTL
                     PAAAAAQNASSFAGFVDRAAAVAGAIAARAHAIAAASAAPISPPKATGGGAAPAASGA
                     EKDKRIDVMSSPGGSHMNAAAKEFVPHFQLSANSPEYRPAPPPKIEAMYGDYAGLSSL
                     RDGVGFPPPPPPPPPPSYVEALSPAPEYRPAPRSSRLSHVGASPSLPPYALPPPYVAG
                     GDDVDDMFPPPPLPPPYLGD"
     gene            complement(<1321153..>1323147)
                     /locus_tag="LMJF_35_3210"
                     /db_xref="GeneID:12980475"
     mRNA            complement(<1321153..>1323147)
                     /locus_tag="LMJF_35_3210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722667.1"
                     /db_xref="GeneID:12980475"
     CDS             complement(1321153..1323147)
                     /locus_tag="LMJF_35_3210"
                     /note="previous protein_id=AAZ14544.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722715.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980475"
                     /db_xref="GOA:E9AFE5"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:E9AFE5"
                     /translation="MSVKNTFGTQAAKALCANLYTNWLSEDENVERIRDLLNRVLTLS
                     ATDQHSEMGAKNAASMTTAAAAAAGDKKGKAAGADALGNGARHSDPAVGLSTSSAAIH
                     GNADRAQSPQPSPPQKSDKSAAALAADDRTPSPIQPSTSPTLIARFPGGVDELDYPHR
                     AGSPVVTPVSPQPKPIVDPSAPLPHVGTGSLSPHGVHSLGSPRLDTTLNAAMVSGDLT
                     IPLDASSTLSTTARESTTRFLHTSGSFAVTPPANLKQATLDEIPCFYSKRESRGLQIE
                     VDVEEAQELSRLLEKNDPVKKTVWVFGDISSKVFKVPIWYKEALFKDIATRSGLDAAT
                     ADTLTAAQIRTVYNDVYAPLSVSRRLYELICTHPKKEFITLSDLEGMGKYLVAAHPGL
                     QFLQQPEFQEYYWHTVAVRIMYMLERQQCGRIYWRDFDRSDLPERMMELDAKDVNLVL
                     DYFSYEHFYVLYCKFWELDTDRDLLVGFEDLCNYGQGSVVTGVIKRVVEGYGRPLSSG
                     VPGKMDFEDFVYFCLSEEDKNSEPAVLYWFKVLDTDEDGVLSGYEMMQFFEENQQRFL
                     EFSDSPEGDIAYEDTVCQMLDMVGFDRVKVRKYGVTLGDLRSCPTPANFFNMIFNASK
                     FLLFEHRDPFGEHQMRLRVEKTEWDRFARAEYDRMAAEAQ"
     gene            complement(<1325134..>1325643)
                     /locus_tag="LMJF_35_3220"
                     /db_xref="GeneID:12980476"
     mRNA            complement(<1325134..>1325643)
                     /locus_tag="LMJF_35_3220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722668.1"
                     /db_xref="GeneID:12980476"
     CDS             complement(1325134..1325643)
                     /locus_tag="LMJF_35_3220"
                     /note="previous protein_id=AAZ14545.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722716.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980476"
                     /db_xref="UniProtKB/TrEMBL:E9AFE6"
                     /translation="MAKSRSVSAKKSRKKAAPPPPPPVVKPVSTIDDLERDVTLHAGS
                     ALLVVVSPLDAATTNTVVEAMERLNSSRSALLTDINIAVCYALPTTSEVCRSLCVTTV
                     PFVQSYAYGEVVSEFIGDNTEKMELLAKMAATQAAVKAAQLAEEEKQRQVAAAEAQDA
                     AAAAVAAAA"
     gene            complement(<1328264..>1329493)
                     /locus_tag="LMJF_35_3230"
                     /db_xref="GeneID:12980477"
     mRNA            complement(<1328264..>1329493)
                     /locus_tag="LMJF_35_3230"
                     /product="putative cystathione gamma lyase"
                     /transcript_id="XM_003722669.1"
                     /db_xref="GeneID:12980477"
     CDS             complement(1328264..1329493)
                     /locus_tag="LMJF_35_3230"
                     /EC_number="4.4.1.1"
                     /note="previous protein_id=AAZ14546.1"
                     /codon_start=1
                     /product="putative cystathione gamma lyase"
                     /protein_id="XP_003722717.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980477"
                     /db_xref="GOA:E9AFE7"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:E9AFE7"
                     /translation="MSSQQHLVSDFTAGSGSWLPQSQGFDTLQVHAGVRPDPVTGAIL
                     TPIYQSTTFVQESINSYQAKGYSYTRSANPTVAVLEQKLCALENGSYCTVYNTGMAAT
                     TTAISSFMNAGDHAILTNCCYGGTNRACRVFFSRLGMEFTFVDMRDPQNVIDSIKPNT
                     KLVISETPANPTLILIDVAAVSKICKERGIVHMCDNTFATAYIMRPLDHGADVTLIST
                     TKYVDGHDMTVGGALVTNSKELDAKVRLTQNILGNVMSPQVAFLQLQTVKTMSLRVTK
                     QSHNAQKIAEFLETHRAVDRVVYPGLASHPQKELADRQHRNNLHGGMLWFEVKGGTAA
                     GRRLMDTVPRPWSLCENLGASESIITCPSVMTHANMTSEDRMKVGITDGFVRVSCGIE
                     DVDDLIAALKVAMDALV"
     gene            complement(1329892..1330039)
                     /gene="LM35Cs2C3.1"
                     /locus_tag="LMJF_35_snoRNA0184"
                     /db_xref="GeneID:12980478"
     ncRNA           complement(1329892..1330039)
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs2C3.1"
                     /locus_tag="LMJF_35_snoRNA0184"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461117.1"
                     /db_xref="GeneID:12980478"
     gene            complement(1330304..1330389)
                     /gene="LM35Cs2C2.1"
                     /locus_tag="LMJF_35_snoRNA0205"
                     /db_xref="GeneID:12980717"
     ncRNA           complement(1330304..1330389)
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs2C2.1"
                     /locus_tag="LMJF_35_snoRNA0205"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461137.1"
                     /db_xref="GeneID:12980717"
     gene            complement(1330447..1330528)
                     /gene="LM35Cs2C1.1"
                     /locus_tag="LMJF_35_snoRNA0216"
                     /db_xref="GeneID:12980716"
     ncRNA           complement(1330447..1330528)
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs2C1.1"
                     /locus_tag="LMJF_35_snoRNA0216"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461148.1"
                     /db_xref="GeneID:12980716"
     gene            complement(<1332458..>1334860)
                     /locus_tag="LMJF_35_3240"
                     /db_xref="GeneID:12980715"
     mRNA            complement(<1332458..>1334860)
                     /locus_tag="LMJF_35_3240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722670.1"
                     /db_xref="GeneID:12980715"
     CDS             complement(1332458..1334860)
                     /locus_tag="LMJF_35_3240"
                     /note="previous protein_id=AAZ14547.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722718.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980715"
                     /db_xref="UniProtKB/TrEMBL:E9AFE8"
                     /translation="MEKWRTAKAQKQAEVEQLNGKLRRLCAAVEDEKSAAEAKIRESQ
                     GEHEAALRAARQSVEQAVKAEYQPKIAEAQQQLCAARKEEADLRELLEEKSGDGGGAA
                     GAAKDVVKTALTAAVSAVLRRLDDVFESEEAEGLKMDEWRSELQSLVQREIQTSFAVG
                     VESETQAERMEYTRFFDDMLAFWRSAEDQERERLLKMDESLLIDMQAMTQQELKRLQD
                     EALGMERVYIESREAWAAEHQRLLQRELEATLQRQEAELQEQRRRRHSLHVERLRDAE
                     ARHKDVMAREEALHQKQMEQLKAYFAREEDLRAEQQRIQAAAQEDVKKSTALLRDIMA
                     TAEDAAAAVKAYEAAVDEGRRCVEVECEGRFKEQAEMLERLQQLAATQCSNTEAERAA
                     LEGCASQLRLASQNLDRHLQDESAWLAQQEATYKRSKDEWEREYRRWQHLVQQERQAA
                     EEHFHEALLALQQSLGLLDTEERDLAVETAAMHRGFGDMEALAQREMESLRRRAADVQ
                     SRSVAIADVQAQLTQKKAAMAEAKQQLVLAQQRLEDEQAELRLDEERLRDMVEAVRVA
                     RSQAALRCYNMELLRTADAQRPRQPPEAVVTTAIDSDRRPPMRDEGRGSARRPASHEV
                     AKGGLAALRDAASAKNGRLHRDPHRLPNRVLQELHDQLNALTTATGGGVGRDVFVPTM
                     RWPDPALPRAMAAQRTRQTHPRRREAADDTFAADVPGPLSSPPLPGRRRHTRSKVHIR
                     ARPAATPQKGRPADPSSLPLTSDNLSQLSLRSDDEWSPSGNTFTNLIGFSDLDTTSQS
                     IQ"
     gene            complement(<1336256..>1337350)
                     /locus_tag="LMJF_35_3250"
                     /db_xref="GeneID:12980479"
     mRNA            complement(<1336256..>1337350)
                     /locus_tag="LMJF_35_3250"
                     /product="putative replication factor C, subunit 3"
                     /transcript_id="XM_003722671.1"
                     /db_xref="GeneID:12980479"
     CDS             complement(1336256..1337350)
                     /locus_tag="LMJF_35_3250"
                     /note="previous protein_id=AAZ14548.1"
                     /codon_start=1
                     /product="putative replication factor C, subunit 3"
                     /protein_id="XP_003722719.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980479"
                     /db_xref="GOA:E9AFE9"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR008921"
                     /db_xref="InterPro:IPR013748"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9AFE9"
                     /translation="MYAGRQGEEAKAAASHLPWVEKYRPSTLESVVAHEDILSTLRHL
                     MDSGNMPHLLLYGPPGTGKTTTIKACAYYLYGKARVRANVLEMNASDDRGIDVVRQQT
                     REFASTSSIFSMMGTGSSTGGGSGGPAAKFKLVILDEADQMSHDAQAALRRVIEKYTR
                     NVRFCILCNHINKIIPALQSRCTRFRFAPVKKSSMMPRLRYVAEQEGVKYTTDGLAAA
                     FRLSHGDLRRCLNTMQASALSANEITEESVYRVTGNPTPADVTAIVSDMLSSDFATSW
                     VKAEESVVQKGISMADLTREIHPVMMAMDLPQDCKCFLLMKLSDLEYYAAGGARESAV
                     LGGLLGAFQLVKEAVTQRKPIKDVAGECAC"
     gene            complement(<1338795..>1339724)
                     /locus_tag="LMJF_35_3260"
                     /db_xref="GeneID:12980480"
     mRNA            complement(<1338795..>1339724)
                     /locus_tag="LMJF_35_3260"
                     /product="Peroxin 19"
                     /transcript_id="XM_003722672.1"
                     /db_xref="GeneID:12980480"
     CDS             complement(1338795..1339724)
                     /locus_tag="LMJF_35_3260"
                     /note="previous protein_id=AAZ14549.1"
                     /codon_start=1
                     /product="Peroxin 19"
                     /protein_id="XP_003722720.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980480"
                     /db_xref="GOA:E9AFF0"
                     /db_xref="InterPro:IPR006708"
                     /db_xref="UniProtKB/TrEMBL:E9AFF0"
                     /translation="MSDGDLDALLDEAMDMVDEQERKHEEEVRVRDAKLEDDLQKALD
                     ESSGAAGGDADMMKMFMSMLGGAGSDDASLDSFKKSVMTMVSSLEEEENLGDEDKENL
                     QRVKELVRVMEEEDIGKANDLLEQMKQEGKLPDRNNVGDAEIDEASRRCMEMLQQLSS
                     ATQGGHLDPAATPGAASSSSAAAAAAPAGNGAEIPAEVDRATEAMASALISTLADPQF
                     VEPIKLMRDSYGPYMDAHRSELSQEDCERYDRQRAKAQEICDLLQNPISGAEDPRLIQ
                     LLELMNKYSELGDPPRNLVEYAPKNRQEIEECQ"
     gene            complement(<1340637..>1341206)
                     /locus_tag="LMJF_35_3270"
                     /db_xref="GeneID:12980481"
     mRNA            complement(<1340637..>1341206)
                     /locus_tag="LMJF_35_3270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722673.1"
                     /db_xref="GeneID:12980481"
     CDS             complement(1340637..1341206)
                     /locus_tag="LMJF_35_3270"
                     /note="previous protein_id=AAZ14550.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722721.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980481"
                     /db_xref="UniProtKB/TrEMBL:E9AFF1"
                     /translation="MATEVVEEEEWQDGVDDFFADFSLAASNEKSTRRKNAEAHHASV
                     AQSQKKAERREADRGESAEEARRRITAAVISRATAKELERAARNAKQHHKMSHKNCDT
                     GASSVKSGLSSFSLSEQHHGSSTAASFSPSLKGHDSTAHQVEAEPSSSRLGKKRQKID
                     AKFARKTARKEAAKEHRIKYRRVLHKQHR"
     STS             1341901..1343145
                     /standard_name="D1S3688"
                     /db_xref="UniSTS:474266"
     gene            complement(<1342048..>1342614)
                     /locus_tag="LMJF_35_3280"
                     /db_xref="GeneID:12980482"
     mRNA            complement(<1342048..>1342614)
                     /locus_tag="LMJF_35_3280"
                     /product="putative 60S ribosomal subunit protein L31"
                     /transcript_id="XM_003722674.1"
                     /db_xref="GeneID:12980482"
     CDS             complement(1342048..1342614)
                     /locus_tag="LMJF_35_3280"
                     /note="previous protein_id=AAZ14551.1"
                     /codon_start=1
                     /product="putative 60S ribosomal subunit protein L31"
                     /protein_id="XP_003722722.1"
                     /db_xref="GeneID:12980482"
                     /db_xref="GOA:E9AFF2"
                     /db_xref="InterPro:IPR000054"
                     /db_xref="InterPro:IPR023621"
                     /db_xref="UniProtKB/TrEMBL:E9AFF2"
                     /translation="MTRAGMKGKVLGKEKKAAIIDARKKAAESRKNRDDKRWKRVLAN
                     MDEEKRKKFHGVGNTAKNSRVRGATRASLLKRTGRKPDAVSMEATIHLSKLLKKKTFS
                     KRAPLAIKRIKAFVGRLMKTKDNRIDASLNTYIWHKGVKGVPGRVRVLIQRKSETTEG
                     NKHKHFYTVISNVPVASFKGLTTKTVEQ"
     gene            complement(<1343560..>1344126)
                     /locus_tag="LMJF_35_3290"
                     /db_xref="GeneID:12980483"
     mRNA            complement(<1343560..>1344126)
                     /locus_tag="LMJF_35_3290"
                     /product="putative 60S ribosomal subunit protein L31"
                     /transcript_id="XM_003722675.1"
                     /db_xref="GeneID:12980483"
     CDS             complement(1343560..1344126)
                     /locus_tag="LMJF_35_3290"
                     /note="previous protein_id=AAZ14552.1"
                     /codon_start=1
                     /product="putative 60S ribosomal subunit protein L31"
                     /protein_id="XP_003722723.1"
                     /db_xref="GeneID:12980483"
                     /db_xref="GOA:E9AFF2"
                     /db_xref="InterPro:IPR000054"
                     /db_xref="InterPro:IPR023621"
                     /db_xref="UniProtKB/TrEMBL:E9AFF2"
                     /translation="MTRAGMKGKVLGKEKKAAIIDARKKAAESRKNRDDKRWKRVLAN
                     MDEEKRKKFHGVGNTAKNSRVRGATRASLLKRTGRKPDAVSMEATIHLSKLLKKKTFS
                     KRAPLAIKRIKAFVGRLMKTKDNRIDASLNTYIWHKGVKGVPGRVRVLIQRKSETTEG
                     NKHKHFYTVISNVPVASFKGLTTKTVEQ"
     gene            complement(<1344812..>1346722)
                     /locus_tag="LMJF_35_3300"
                     /db_xref="GeneID:12980484"
     mRNA            complement(<1344812..>1346722)
                     /locus_tag="LMJF_35_3300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722676.1"
                     /db_xref="GeneID:12980484"
     CDS             complement(1344812..1346722)
                     /locus_tag="LMJF_35_3300"
                     /note="previous protein_id=AAZ14553.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722724.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980484"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:E9AFF4"
                     /translation="MCCVAPAFDSFRCAYPGVTDSVNDVDVDPTGGCLYAACSSGDVC
                     VWNIQTQKLRVRLRHPQWVNAVRCFPMCNSAASSATWLKPPPAASPAAPGAGSADCDA
                     LNADLVVNHDIRWVLTGTEDGVVAVWCPVTYRMQSIFRPGGAAITALQLIPETSPCAA
                     DTANASKMEHCATGARFRRASTKVNDGPAICCAASLRDVYVFRVTTASSELALLHAFQ
                     HHGHITALTYVAPSLSLSTPLLVVGQEEGTLCIWNCATWTYHDTMPYPTGEADVTADA
                     RDDPTSVHEPVYQLGRVFKTFLYNRRRCNPLSDQAAIEEEAAAAAPADSPDYIGVVPA
                     SVSADAIDVLERKCGTLPHSAKEAFLEQQRQQQEGPDGTRLPAARRDWRYDKRRVTCL
                     AASPNPTSSNPNSYLYSGHATGEVLLWGSVRQELPLLLLLKKIILFKPGAWVWNLCAV
                     ATLHTSASQPSEQRCGAKAAAKLLSRLGKNKANKRARPKAATSLTPTRYARAGAPSPL
                     ETTHVSPLELIVWSDGGAVVYVSTRQRHVLRRQGPGFVCAAACAWSGPTITPPPAAEP
                     VTTFDNGRADAATSSTEAAPKRSGGAARGSRHASAFSAHQYLVMAGFDGRLERYDVTE
                     VLELVKSSGKLV"
     gene            complement(<1348773..>1349684)
                     /locus_tag="LMJF_35_3310"
                     /db_xref="GeneID:12980485"
     mRNA            complement(<1348773..>1349684)
                     /locus_tag="LMJF_35_3310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722677.1"
                     /db_xref="GeneID:12980485"
     CDS             complement(1348773..1349684)
                     /locus_tag="LMJF_35_3310"
                     /note="previous protein_id=AAZ14554.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722725.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980485"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR003603"
                     /db_xref="InterPro:IPR025875"
                     /db_xref="UniProtKB/TrEMBL:E9AFF5"
                     /translation="MAGVLTLNLVLQRSKTDDIRRVQKLNVCASQIQDIGVLRQAVAL
                     EVLSMSLNDISELGALSNCRRLAEVYLRKNQIRDINQVLHLSRLPCLEVLNLVDNPIT
                     RDPNYRRFVVAAIPSLERLDDRDITDEERDNALAVFPQLLSFAPPPSKYAQPLEGITP
                     PTIQEREAQARANSTHVSHSGATGSEAGHPNMHPRKATSSVSGFGGGNVYNGRGGSGA
                     SGNPTIHKTPPAPVYQDPHRGAALPPARSSPAARAQAVNDYQSVPSYPSGPSEEGVVQ
                     AVKVLCSELSPEALDNVRRFIDSLSEY"
     gene            complement(<1350862..>1351491)
                     /locus_tag="LMJF_35_3320"
                     /db_xref="GeneID:12980486"
     mRNA            complement(<1350862..>1351491)
                     /locus_tag="LMJF_35_3320"
                     /product="putativetransport protein particle (TRAPP)
                     subunit"
                     /transcript_id="XM_003722678.1"
                     /db_xref="GeneID:12980486"
     CDS             complement(1350862..1351491)
                     /locus_tag="LMJF_35_3320"
                     /note="previous protein_id=AAZ14555.1"
                     /codon_start=1
                     /product="putativetransport protein particle (TRAPP)
                     subunit"
                     /protein_id="XP_003722726.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980486"
                     /db_xref="InterPro:IPR007194"
                     /db_xref="InterPro:IPR016696"
                     /db_xref="InterPro:IPR024096"
                     /db_xref="UniProtKB/TrEMBL:E9AFF6"
                     /translation="MRQRTVATGKVVSDKSGAAGELSSSEHTQVALSAFSFLFSELCV
                     RAYTFPTKVKNVEEVEARLTSLGAHVGTRLIMLSSVRDPVDLQRRPLTIDAVLKLMQE
                     KLWARWFGRPASEIQRESNSDRFFLFDSDPIVLRYVHPSPDYVDSEGRWNVNYAGFMG
                     GIIQGALQSMGFEAEVQAYHQPEPGKPHQSLFVIAFAKHVWDRERKMRT"
     gene            complement(<1357595..>1358683)
                     /locus_tag="LMJF_35_3330"
                     /db_xref="GeneID:12980487"
     mRNA            complement(<1357595..>1358683)
                     /locus_tag="LMJF_35_3330"
                     /product="putative mitochondrial carrier protein"
                     /transcript_id="XM_003722679.1"
                     /db_xref="GeneID:12980487"
     CDS             complement(1357595..1358683)
                     /locus_tag="LMJF_35_3330"
                     /note="previous protein_id=AAZ14556.1"
                     /codon_start=1
                     /product="putative mitochondrial carrier protein"
                     /protein_id="XP_003722727.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980487"
                     /db_xref="GOA:E9AFF7"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:E9AFF7"
                     /translation="MTQSFSPSLNGSSQSISAKSEHLWMHGAAGMMGGSAAMVMFYPL
                     DFLRTRMHTLHQGSRAMPLRSARDILRQEGLRGMYKGIGVSVISHSVGWGLYLVTFRS
                     AQQRITELLDEKLEDSMIEQSGLDFMSACAAATITGTVVTPLHVIKTRRQLCDGNRLR
                     SGVRVQPLPPGFAGVRAIVRREGWRAMLRGLWPQILLTGNTTIQVTMYEWFRRNLFTN
                     HENPSPLQVALASGFSKAVACALFNPLEVVRTRLQDQRNHGRQEYKSMLTGLQTIWRS
                     EGLIGMYRGLPVNVARVIPSTMMAFVLYEKFLSAIRATYQMAESLHVTGAATSSTSTA
                     FKGGPAVSNISTASSSQTGLAMGQPQLQ"
     gene            complement(<1363367..>1364806)
                     /locus_tag="LMJF_35_3340"
                     /db_xref="GeneID:12980488"
     mRNA            complement(<1363367..>1364806)
                     /locus_tag="LMJF_35_3340"
                     /product="putative 6-phosphogluconate
                     dehydrogenase,decarboxylating"
                     /transcript_id="XM_003722680.1"
                     /db_xref="GeneID:12980488"
     CDS             complement(1363367..1364806)
                     /locus_tag="LMJF_35_3340"
                     /EC_number="1.1.1.44"
                     /note="previous protein_id=AAZ14557.1"
                     /codon_start=1
                     /product="putative 6-phosphogluconate
                     dehydrogenase,decarboxylating"
                     /protein_id="XP_003722728.1"
                     /db_xref="GeneID:12980488"
                     /db_xref="GOA:Q9NGR0"
                     /db_xref="InterPro:IPR006113"
                     /db_xref="InterPro:IPR006114"
                     /db_xref="InterPro:IPR006115"
                     /db_xref="InterPro:IPR006184"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR012284"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q9NGR0"
                     /translation="MSNDLGIIGLGVMGANLALNIAEKGFKVAVFNRTYAKTTSFLKE
                     HESEKFAANLNGYETMKEFAASLKKPRRAFILVQAGAATDSTIEQLKEVFENGDIIID
                     TGNANFKDQDKRAAQLESQGLRFLGMGISGGEEGARKGPAFFPGGTPSVWEEVRPIVE
                     AAAAKAEDGRPCVTFNGKGGAGSCVKMYHNAGEYAVLQIWGEAYSALLAFGFDNDQIA
                     DVFESWKADGFLKSYMLDISIAACRAREATGNYLSEKVKDRIGSKGTGLWSAQEALEI
                     GVPAPSLNMAVISRQMTMYKGERIANCKAFPNFPRGPSEEATDKSPNSPEAKKLYHAV
                     SLCIIASYAQMFQCLRELDKVYGFGLNLPATIATFRAGCILQGYLLGPMTKAFEENPN
                     LPNLMDAFTKEIAAGLDDCRQILAKLTVNTAVSLPVMMASLSYINAMYTETLPYGQLV
                     SLQRDVFGRHGYERTDKDGRESFEWPALQ"
     gene            complement(<1366007..>1367392)
                     /locus_tag="LMJF_35_3350"
                     /db_xref="GeneID:12980489"
     mRNA            complement(<1366007..>1367392)
                     /locus_tag="LMJF_35_3350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722681.1"
                     /db_xref="GeneID:12980489"
     CDS             complement(1366007..1367392)
                     /locus_tag="LMJF_35_3350"
                     /note="previous protein_id=AAZ14558.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722729.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980489"
                     /db_xref="GOA:E9AFF9"
                     /db_xref="InterPro:IPR000878"
                     /db_xref="InterPro:IPR014776"
                     /db_xref="InterPro:IPR014777"
                     /db_xref="UniProtKB/TrEMBL:E9AFF9"
                     /translation="MLGWSGTRFAAALHLRSVCSPRSAAAQGSHARAPRALSSSSSFV
                     ALFGSARGFSGTARRFSGTFHYRKVRLTPEDALDPLTKPTNIDKAALHVVSVPIGNLK
                     DFSLRALDVLRGVDYIITTDRPATKTLLDLVNIPNQGRLIHYSRGNRSTSREKLVELL
                     KGGRSMALVTTSGTPCIGDVGGELVQELQKSGIRVTAVPGASALMSALAISGLTTSAY
                     ESAKNDKRGADAAADGEAGLSPQTFEDGSFFFGNVLPKSHGARLRILRTIVAPATFPC
                     VFYEVPYRLVMVLQDIASVLPHRFVYVTHELTKLNESLHADTAERLVGFYLRQEAQML
                     VKKGQLVLVIAGAGPKETAAWLEKEAAKRRRLRRTVSDLMKDAPPAASSHLESAPGTG
                     GTTAAASSSRESSVTTAKEERRQRRKQRAELRRLRQRKKRERLIRAIESEQERLRVIL
                     SINRNDASRLM"
     gene            complement(<1368208..>1375113)
                     /locus_tag="LMJF_35_3360"
                     /db_xref="GeneID:12980490"
     mRNA            complement(<1368208..>1375113)
                     /locus_tag="LMJF_35_3360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722682.1"
                     /db_xref="GeneID:12980490"
     CDS             complement(1368208..1375113)
                     /locus_tag="LMJF_35_3360"
                     /note="previous protein_id=AAZ14559.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722730.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980490"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR019442"
                     /db_xref="UniProtKB/TrEMBL:E9AFG0"
                     /translation="MAEQSANATLTRRRQRRPDLQSTFDVPEDVRQPLEQVARALFVT
                     APSSALAAKVVRTTDAALQELLQLSLTPEQQLHAISKMTGAIREIPKSRLAATLTEPT
                     GELHSWSRTLALEAVVPLLLDCRVRYLHRALMTLLRTLLPAPDAAAEATVREMYVARI
                     LHSAKSWEADTATAMRPVAALGARSDTSEAAAAVYFPSSSEDRGTTIPAARSIYDCSA
                     ERDRVLNFLNAVDGLTSTLMPMMPGIFKDTFLEVLPLLADSFQWVVVNATSHSRVQAS
                     IAPDASDGAGTLSRLTNEAAQSVTNADGEASNAVAVSVPPVAHNADAAAVFGEDLEHI
                     RFCVRVVAAYIHKYMDSLTLAMASGATSDSVRRDLTRLLQPTIVMLYSPIFPKDVLNA
                     VGLLVASILTVRTCDAWLLAFVCAALRDDVAQCTGGAARLLGAETSTDSVPELQESGT
                     AGALSLAHLFAQADVALRIVSAANPREAAQADGGSGAKALHDVFSHLTPNGCFALLKG
                     ILAHTSAPIRGDWMSLGLLLRPLPWTSLSATGAENAPSNVSHGTVVAYDIILQAAQQY
                     CNVVQEPETRFMAIQTVDSVVRHVSSVLTIAVKALAQSAKNEGAAALTKLASSQCSLE
                     CATPEVHQATALRRHLSSLCTSSPKLQNALSYATQLIMALWDDGTQQMSGALYGTYGE
                     ILRIHALLRGSASHAPGEQIDHDVDTSVTLDQILQAQAERRGKYHALLGLLSMMPLGD
                     FIAALQRHYGYPNAAADAVSAFSRTLLTGASNHKIGNVAGDVFAHLARGIAKAPPGSA
                     IAGCSCDGETAEYVMRRGIIEPLARAITEKGYVGVSSNVSEAVNISHITAHFVAPLVK
                     QDPACLRAILTAVAASLDGASYGQSSLPGTLAAPEYERVEQGVVETVARARGVGVDIT
                     PYLAPGSTTLRVLEEGSRSLNYEVRNTALCLCVLGAKKIQAVQPWQLRRVEEYIIFNM
                     HLGGDSTARKGLLEMVKKWVRRLMESYTSKPQNGASASAAASATPKKAHTKGERQENA
                     VATAQRSGATSLVAVSASEPDLQLELGTAAYRVAVMDHCRCLSSIFAQNIGTSARAGA
                     GLSVERRVTAMMGYSILLQGLRTHVAKKEAMQWAVATEPVSGGAALPLLHICVVPSLL
                     AALSDGWSQARESARELLRTFCELAPTVVFTATNGIDGGSAASPSAMAARAHQDLLRA
                     QTFRNAEGAVGRFLTFTTLTAEAQEAARQRPLEELERLSGLLERERTSVEGKCAEMSA
                     MRGTKAYAYIQANPLHGTLSLCAELLSLMASVECRAAAASPSSLLTLACTNLLQCCCL
                     VLRTCSSLVGTETMAAGTTASSVADEVVDCRGHVYDRSRPEAESAMRGVVNNTWLSMR
                     VAAGSITRLLKIRPVNAMPFAAVHAAAYELVHALLLTKHNGVMRCVREALKALVVTLV
                     RSRQTLFYQLPAELLEYLMGPEGVTSGHVTRMLRRSQGLPHAILAVLEAEDTTVPCCL
                     FPSAMRQLLRVARSDIAGAHALGGAETAPLGVSAETVRRSQRSNALNVLKFIFEDKVF
                     ADRAVAYIEEAFSLATEGFHDASWYTRNSSLMLFSAVIHRFVGEHPSTGGSGVNTSLH
                     DVAKRMPRSIAYAYAELTRGSRSGQEAKGEDGGAASAAEVSVALFPVLQLLSMLSPDP
                     PHLITKVSHGESDDAARMIEAVMQCAGSPSLMVRSASAVALCCLVPLSSLRRTIEQTR
                     RGLSLELLQPHRSLTDSANHAGPLKQRGGAAGGGLNSCHGAVLQLLQFHAQYVGTLRR
                     HYRQKRSSYATLTVAEAVIQAISEALLSCKQALVRACTVSATVAASLFALLADIVFYG
                     ARHKLSPGQQHAVRGMCVEAMTACLKARHVVSERGSVMEGVSAMLVLLAAQRERAPIG
                     HWTGVEQARLAELLQEEAAALSIRRGEHNLISWVMTQLRHYSDAADALNRADVAVVLR
                     VISRDLHCDLPQLALKSLTELFDGAASPASPMTMTIGCVAWGQLVSHMRFAAMAMTLT
                     NKTAGATTAPPHSSDLSSFDAGQQTPAVKQLHSTLLSLLTLSADGDDSTTATPLHNSD
                     ACSAALDFLTTHDIYVSDAHAVSPAVAYLLSYYCEPGQPLESRLAVVKALRTAQSFLR
                     CSAAAATSSAASTCPGSAVTLFLVLLRLLVDDTSEIREAAAAICSRGMWGAHEAPRDQ
                     VSCLLAVVRLLRRLRDTGLLFGVDALRFVMSLADSPTTASVVVGTAPAEEAGDGEEVA
                     GSDDEDVLFQKEAANMFAEKTVLSHLAAHILGNATSDTATMPVCFSVYDSFLV"
     gene            complement(<1377781..>1381035)
                     /locus_tag="LMJF_35_3370"
                     /db_xref="GeneID:12980491"
     mRNA            complement(<1377781..>1381035)
                     /locus_tag="LMJF_35_3370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722683.1"
                     /db_xref="GeneID:12980491"
     CDS             complement(1377781..1381035)
                     /locus_tag="LMJF_35_3370"
                     /note="previous protein_id=AAZ14560.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722731.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980491"
                     /db_xref="UniProtKB/TrEMBL:E9AFG1"
                     /translation="MPIAPRQGRKGGKISSSPAIASSDSPSTVSPGSLPFGSAGAALP
                     TDPNTTLQFNIEALMSKKRRSPSKAKAAARANESSASASSGTEAVKAASGAGGTSTTA
                     ASGSSGASATAGPAETIANPSLVTPPGADSNVFKFDLDAIQQVGQGVVFGGNKTMRTD
                     SHQPESDPAVVYAKLKQLIASQDAYFHGGNAAAADVVSDEVLGLKEVASHQVVLLQRP
                     YAALRLAVALSQKSKERVLVVVPHYSDVSDIAAALRALSPSRGPVGELSGQSFVGEAG
                     TALWVTDVDTALVYLTSQRGMGPFTHLVLPNLTRMNPLVSYFLWGLRERVYRQSAILD
                     TAAPPLHVIVSVSGAMTERMQQFFAKQTVATPTTTPMQPLVEFSYDEANALAGMDVLD
                     VTIDESGKYPGPHRKIIDHSVQMAATLVGRILSCSTACPQAIYILTGDSREMIDALHK
                     ERLLDTTVYAGRFPSKEDAGATPSKHRVCVLHSVVSFTNYNNEDATFVLDMATTRRLA
                     VQNKSEGFMASSASEWASKMDVEERRQLPGTKYPGCYIALYPPAADVVLPTTEAPQPT
                     VYEVEDALLQCSRAQLPIQRANQEMVCPVEAESIEQVQHSLSEKCLIANLSDFSLTFT
                     GEIASRLPLEVDLAHFVMNCCTLGHGEVGVIVAGVCALPYRFPTGESAEGFASWKKCV
                     IETRQEYAGDIANQSDLLADVLVFLEWWRLKARGASTADFVAKLQLKEDRLEHVRGLI
                     TYLRVQISDYAFVDDLEDEATLSAVMQSIKSNASIFTFFEAVALARRLFFVRDAGSIN
                     VKDRAGALVFVRTSKKVVPNTASPSSVVWESGAALVAVDLRNLVSNITCARVSAVNNT
                     YLFAALLLLYPQVEYSAPVEVPSKGGRVVYFGITCNRQMKRFRISIGEAAQILDFREK
                     WNHAIRYLQVLRTAKKPLSRHKFNFMLKEEDRHFDLEELRAEVQRELQNLVTEIEVAE
                     HQASFTTHGVHCLAPKQVAGVVDGVDASDVDVSRKFHDGDLWASSFASKTDTPATMAA
                     ATSITANHVPTTAQSSALTFPMNAASIDDDKDDEVEVMGELYFRMNGPIIDDDE"
     gene            complement(<1381980..>1383623)
                     /locus_tag="LMJF_35_3380"
                     /db_xref="GeneID:12980492"
     mRNA            complement(<1381980..>1383623)
                     /locus_tag="LMJF_35_3380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722684.1"
                     /db_xref="GeneID:12980492"
     CDS             complement(1381980..1383623)
                     /locus_tag="LMJF_35_3380"
                     /note="previous protein_id=AAZ14561.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722732.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980492"
                     /db_xref="GOA:E9AFG2"
                     /db_xref="InterPro:IPR000176"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9AFG2"
                     /translation="MGSGYLKRKRQRQELLNDFYSALSLSSFDTTSGQFSKLVTRTVY
                     HYPSSLPFPVLLDDDFPAEPYRSRNKDIKSAIHWGQRKLLLSEIQLLSMYCRPEISYH
                     IVYAGAAPGTHLAFLDEMFSCRHTWELIDPGQFDRAVLEPRANFRLRNEFFTNATAYG
                     INARRLTEVLPALGFVYQNVAVDSVQVDKKAIHEQLQDIVGTLDVARGTEDIPAMYEA
                     PLSLPKGLELLAQVALERNKPLLFISDIRSGSVALPNFEDHVAENMRAQECWTNILHG
                     EHSMLKFRLPYTSKSTKFGGQGAVRETLLIREDGTVPYLRGDMLLPIWTRPTSTEGRL
                     VVPQGAFQKDYNVAHVEDQFFFFNSSVREQVHFNHLVAHDSELDHHYDAAAEVHCLLT
                     YLRFIRPELKTAKTGELRKEVLRVAHSITAHLGITFEDAIRRRDALMINHAKKSQNKA
                     VEGHKDDAYGDEEAEEQEAKSAASKVRAGSNESAAAADGAATSTTAPVPPSEWEQTTR
                     LMVRLSNYDRNRSVWSRNVREEEHSKTSGFWVTTKMPQA"
     gene            complement(<1384443..>1385231)
                     /locus_tag="LMJF_35_3390"
                     /db_xref="GeneID:12980493"
     mRNA            complement(<1384443..>1385231)
                     /locus_tag="LMJF_35_3390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722685.1"
                     /db_xref="GeneID:12980493"
     CDS             complement(1384443..1385231)
                     /locus_tag="LMJF_35_3390"
                     /note="previous protein_id=AAZ14562.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722733.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980493"
                     /db_xref="UniProtKB/TrEMBL:E9AFG3"
                     /translation="MALDFDVDDAPTFPELVRDARLDVMKGRTMTACWVELADQHTVF
                     RDIAKEGRTRGEILGAVLAAVQGICQALQRVELSNPEVRAPSPACTALFSSPAQGAVG
                     DTRPGRWLEEAQTLAQVSRAYVSLYCSTPIPTCAQWVRSLQPVFPQPLNAVSTAANGA
                     SASRFDDDAGAVPATPASSTLCRYLTKLRQSVDDVAQELPDSEVDGKDGSFAEEKLKE
                     LVVCCMTVGRRVARPTMLPPLDAILVREMVKVLQDFVGNSTLEW"
     gene            complement(<1386155..>1387420)
                     /locus_tag="LMJF_35_3400"
                     /db_xref="GeneID:12980494"
     mRNA            complement(<1386155..>1387420)
                     /locus_tag="LMJF_35_3400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722686.1"
                     /db_xref="GeneID:12980494"
     CDS             complement(1386155..1387420)
                     /locus_tag="LMJF_35_3400"
                     /note="previous protein_id=AAZ14563.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722734.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980494"
                     /db_xref="GOA:E9AFG4"
                     /db_xref="InterPro:IPR005045"
                     /db_xref="UniProtKB/TrEMBL:E9AFG4"
                     /translation="MPVAPAAVVQRPSIWALFKQQRLPAWQPILTPQHSALCLIAVAV
                     VCLPLSLSLFRANASAVDITVRYDHQQQCSFGYNNTGAFRYEASPGDVWQTGCVTDVP
                     FRVDKHLKAPVYVYYGLENFYQNHRRFSNSKSDAQLAGQRVSAAAIASATSPLTYPGE
                     LRHTADQGINLLGTFLHYSDFVYVPAGLIPWSMFNDTFTLYRITHHEAAAVTAPSLRL
                     ICNGSAFSRFTNEPLDGAGRCHKKGIAWTSDVEFKYKKPHFPPPSSPRPVWSAPKWAY
                     EAADGDVNPNPPSRMPSDNAYFNEGWYADEPGHRIPVTTDEDLMVWARVASLPKFRKL
                     YRVIDEDLVPGTYLMRIQEHFNAASYGGTKSFSLATLSWLGGRNTFMAWMYFTIGAVS
                     AVSGASFLCIHHWYGDRALRAVAMLLKGD"
     gene            complement(<1388571..>1390490)
                     /locus_tag="LMJF_35_3410"
                     /db_xref="GeneID:12980495"
     mRNA            complement(<1388571..>1390490)
                     /locus_tag="LMJF_35_3410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722687.1"
                     /db_xref="GeneID:12980495"
     CDS             complement(1388571..1390490)
                     /locus_tag="LMJF_35_3410"
                     /note="previous protein_id=AAZ14564.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722735.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980495"
                     /db_xref="UniProtKB/TrEMBL:E9AFG5"
                     /translation="MVLSSPVITLRRMVHFSSTPTSLHSRSSTSPLDALVDEVSSFIP
                     ATFTSIPQISRQLPPELMERVCDPVCGGLRSLLSRYAERFESKMIGQVHVVRSRLRQR
                     ESAAPCRRANAGAEVGYSFAVPSSPSGNAAAAASKSNSVDVQAVFTELQQLFPSYLVP
                     VKALWTTVPEAEEQQVRARVLDALRSPQHRAWLTFHEHPAHCASHSTSADEAELTHVL
                     EHGYVQLRLNPAAGDDRAAAPMPQSPNTRMAGHEVQPYEWYRVARVLPTTATELLFSG
                     ELQEQATLLLPPGRDVWHVLLSAPALFELRYAAPTTVDSGQQARVPTLSAEGSSLAPV
                     CVKYDATPPPSLCASVYVRFRLEERFVPPDMAGAREESILRELETLTAERAASACGLS
                     SRQRRRKRKLQRQLAYLRNPTPYFDERVLAQHLFDLLPLRDGVHQSALLGSLPQPAVQ
                     AFPQNVTELLQARNDLFQLSDVRHGILVRRADAPKVAQRSIESVTGEEILLHIFSSYS
                     LRSDPQEGTTISRSLPRLPRLVRERLFTMQDIIAEVLLLYPDKVEVLADRSPSISSLS
                     LSSSPHTSEADERALRELRTVRGRRDFLVPFRFVGEWQAKLTEKYTKQQTKDAVKSMR
                     ARQRSESSHRRPARY"
     gene            complement(<1391277..>1391846)
                     /locus_tag="LMJF_35_3420"
                     /db_xref="GeneID:12980496"
     mRNA            complement(<1391277..>1391846)
                     /locus_tag="LMJF_35_3420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722688.1"
                     /db_xref="GeneID:12980496"
     CDS             complement(1391277..1391846)
                     /locus_tag="LMJF_35_3420"
                     /note="previous protein_id=AAZ14565.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722736.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980496"
                     /db_xref="UniProtKB/TrEMBL:E9AFG6"
                     /translation="MRSTAAKKSFHPPFKHTAPCNTAASIHAVARQLHRSQAFALHAA
                     PSFADDPCAANTSSTPAPLAPDTAVAVSEPFTAPKTASECDDVTPPRGGTTDPLPSTE
                     TDVAFERCRPSRRQLQQRIDARRAELAGAKAWSLVEDTLYWVTVSQTALQHLADAKAA
                     GQVERVMSELHIDPPTVLFSVEEGSFSHQ"
     gene            complement(<1392655..>1394415)
                     /locus_tag="LMJF_35_3430"
                     /db_xref="GeneID:12980497"
     mRNA            complement(<1392655..>1394415)
                     /locus_tag="LMJF_35_3430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722689.1"
                     /db_xref="GeneID:12980497"
     CDS             complement(1392655..1394415)
                     /locus_tag="LMJF_35_3430"
                     /note="previous protein_id=AAZ14566.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722737.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980497"
                     /db_xref="UniProtKB/TrEMBL:E9AFG7"
                     /translation="MQLDDWDTYRETLLYARELAVLLPSSWSELSSEQSATKSSSSLS
                     HSSSLPSLAFVKRVEAPLLTQWMTAAAAAPVTCHCSSVGDSVEDMDYATAVVAARWTR
                     MLGMWIVLRVELLCNTSGGVLTLAEEYEVGRYRQYFVPLAWPMLDRSIRERLAARLCA
                     LADKRRVSQPMGGTSCANDMAASSFCGTLLGKDEEDEQACDEVCTRAMEATQRVAREQ
                     LRISWDALHPSSIPATVGAKLKRLSAQQSRRHESETGSLPRPVVVHTNCLGGLLHALT
                     SFRLRPQRQHADHGSAPLLTLTQNALLHIGYDLLTKVRSSVIERCYYLIPALLDYESC
                     LLFCEAMLKESAALQAHEKELTRTQSILRLTLQSLLQSALGMYRHVIEALLVDYKKSA
                     CKSSASSTPRLVKVSAHLLPANPLVAQEAAQKQHASDAVVPSKPPTHPGAADGCSASA
                     VMRLSEPAFSILVEVLEPTCDLLQRYPADWNVLWTRSLTGPDGRDQGATSGSHIAREG
                     GLLSPSSRRQRLVSQQRQRSIAMDVRREVVSFLDAEVSNCFAAAAAGSGAASKKAQQQ
                     AAADAYLTATYLSAYGPHWL"
     gene            complement(<1395796..>1396149)
                     /locus_tag="LMJF_35_3440"
                     /db_xref="GeneID:12980498"
     mRNA            complement(<1395796..>1396149)
                     /locus_tag="LMJF_35_3440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722690.1"
                     /db_xref="GeneID:12980498"
     CDS             complement(1395796..1396149)
                     /locus_tag="LMJF_35_3440"
                     /note="previous protein_id=AAZ14567.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722738.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980498"
                     /db_xref="GOA:E9AFG8"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR013970"
                     /db_xref="UniProtKB/TrEMBL:E9AFG8"
                     /translation="MYAQHIQSTPSNKFPVFQGVSPRVTAQTYQSHRGEYVSIIFELT
                     GPGEFKCGVTGMSVKVVGVPEAVEVSRVCEFICYVDPSTGDLTYFQHAMLDDEFDFEV
                     YRRLVSLTTKVPQLF"
     gene            complement(<1397543..>1400065)
                     /locus_tag="LMJF_35_3450"
                     /db_xref="GeneID:12980499"
     mRNA            complement(<1397543..>1400065)
                     /locus_tag="LMJF_35_3450"
                     /product="putative DNA-repair protein"
                     /transcript_id="XM_003722691.1"
                     /db_xref="GeneID:12980499"
     CDS             complement(1397543..1400065)
                     /locus_tag="LMJF_35_3450"
                     /note="previous protein_id=AAZ14568.1"
                     /codon_start=1
                     /product="putative DNA-repair protein"
                     /protein_id="XP_003722739.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980499"
                     /db_xref="GOA:E9AFG9"
                     /db_xref="InterPro:IPR004583"
                     /db_xref="InterPro:IPR018325"
                     /db_xref="InterPro:IPR018326"
                     /db_xref="InterPro:IPR018327"
                     /db_xref="InterPro:IPR018328"
                     /db_xref="UniProtKB/TrEMBL:E9AFG9"
                     /translation="MAMVTSASVPADPAETRNVTEKDQSNLAADVDEWDEVELPVAFS
                     PAKKQEESESGSLVKKGLTDDGEGEAVKHETAYAVSTVKTEVTTTTTGEADTVTSGGV
                     KEELVSVDTEAAASDRPLMEWAQLPLVGRPRASDTWRQRDPAYEAMMEQRDLLAAKRR
                     SERIQRVCESLFALLAVLIRARLLWRESCHPGFVKQLLRLHVSRGRGPKRSRCEDPSG
                     KATSAYVFLKAVATAKVLVAESTKPSHRKPSLAPAWVTCAKDAVQNKTSAAVKVLIET
                     INDYFKLEALAAPASSSGREAPVGAAAYTVAPSSAEQDFSDWSMPVKPGFLFTKTAER
                     HCRVSADAPLELPHPLYFSLVFLALARVAGLSCRLVVAKLGKTQLEKARAAGPAGDTA
                     NGYNDTSEGKDNTADGESEDSTRRPLRVLSIFEGREKRKASDRTDASGVARAGKGSKR
                     QRPSAGLAEDTKDREELKSKKLPTSCYWVEVWSAERESFLSVNPCQSCATLWGASYTL
                     SVSGHVAVDATPRYISKYSTAYAYGRRLGTCRQHRFLWRDELAWDDTRELSEVLRATF
                     NVAAPHTSSLAQRQQQRESRQLHSLMYSEAVPTTLNALHRHPLYVTDSDLARHEGVYP
                     KDANTTVGSVKGRLVYKRSAVVSLRSRDGWLREGRSLLTEDQPAYKVVAPPASRPFAA
                     PSTLYGRWQTQPFEPLPLTAGDPPSIPHHGRTSWYILLDKAPPQGIVHLTQPQISRVA
                     RRMKLDFCLAVVGFERRRTDEHRRGHWETVINGIVVKETDSVALLHAYEEWVQLVQEQ
                     EATKRRQRAFHWWLLLAQRLLALKRLQDQYAKGLGAGSMPMQ"
     gene            complement(<1401048..>1402157)
                     /locus_tag="LMJF_35_3460"
                     /db_xref="GeneID:12980500"
     mRNA            complement(<1401048..>1402157)
                     /locus_tag="LMJF_35_3460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722692.1"
                     /db_xref="GeneID:12980500"
     CDS             complement(1401048..1402157)
                     /locus_tag="LMJF_35_3460"
                     /note="previous protein_id=AAZ14569.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722740.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980500"
                     /db_xref="GOA:E9AFH0"
                     /db_xref="InterPro:IPR002016"
                     /db_xref="InterPro:IPR010255"
                     /db_xref="UniProtKB/TrEMBL:E9AFH0"
                     /translation="MLLHHALSNTQTPFGCPIVAPENYREEAEEIVDFIWKLNADQPM
                     YTFPDLWAMLTAKAMARLGGPNVVPFRGRDDPPEFMTRDLLLAFPRSLVHEDDRDVLN
                     MKRVLSRQGFSLEQVVALIGCNRCIGFHDAANFHTREEVKPKMKRRPGVIGPSDDEFH
                     LPGTIQKTTMDPYVFGSEYFDLLLDYKWRQPGLFQQGRKGAYRCNAKERARQVTLLDP
                     FSEKSYESQQRRMRAAEKARESSDAAGKRIPSTLGGNDSAPGRGRFDRSGEAQFIPGA
                     HSANWSDSVESSNREPDIAGDPDYEAERVAVSVDPCEHVSMRGMDVMLLDDALTKGWL
                     YQFGDNELEFYAAVSEVILNIQGRGYNPNKLAMWK"
     gene            complement(<1403050..>1404648)
                     /locus_tag="LMJF_35_3470"
                     /db_xref="GeneID:12980501"
     mRNA            complement(<1403050..>1404648)
                     /locus_tag="LMJF_35_3470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722693.1"
                     /db_xref="GeneID:12980501"
     CDS             complement(1403050..1404648)
                     /locus_tag="LMJF_35_3470"
                     /note="previous protein_id=AAZ14570.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722741.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980501"
                     /db_xref="GOA:E9AFH1"
                     /db_xref="InterPro:IPR001227"
                     /db_xref="InterPro:IPR014043"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="UniProtKB/TrEMBL:E9AFH1"
                     /translation="MRNALVFSGQGAHAKGMCLSLLDDPAVVQVWERMADCMMRNYGI
                     SLQHIIQENPKKVAARSDAFVVDEVCKRPCTEVLNMKESTPCTHTITHPDGVMQLTYL
                     TQPCVLAAQLLAYEKLKQGNPQVYNRQISCIAGHSLGEFTALTALGVFSPETALDLTF
                     KRGLLMDQACDGVPRGNRKLYACSPQRANLSDNSETADEVFFALLEVIAQSLAHTSSF
                     VEVVNNNIRHQQYVVAGDLVGLAVLGKCLDPQYRANCASGEDVESLVSHALTSVRIDN
                     RDGVARDPNIVHDGDFATSSAQKYGSRSTFRRFIKGADDGFTPSLEELTHLTLEEDGR
                     SGLKKKSWFIPLIMEVPFHSSKLRRAMDAFLPVLRTALPDEAALRELFSISKDGLLDE
                     ERRAHPLWITNLTGRIFDPLNRAFQQSALERMKRANIGEIRHKGRFESTLVVDTFTSG
                     AAEGNVREMAAAVLAAQLAHPVQWITTMEEVVVAQRCSRIQEASPKRNTSEMFRRASF
                     FADDDRSRNIFLQVSSFPSEAPLF"
     gene            complement(<1408021..>1410213)
                     /locus_tag="LMJF_35_3480"
                     /db_xref="GeneID:12980502"
     mRNA            complement(<1408021..>1410213)
                     /locus_tag="LMJF_35_3480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722694.1"
                     /db_xref="GeneID:12980502"
     CDS             complement(1408021..1410213)
                     /locus_tag="LMJF_35_3480"
                     /note="previous protein_id=AAZ14571.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722742.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980502"
                     /db_xref="UniProtKB/TrEMBL:E9AFH2"
                     /translation="MHSYRLEVAVKRVYGLNPLIASSASTISVEMRFLDFPPIVIHPQ
                     GYAIGNSVTYNICHKADFRMSSEQAATVFPAMCQCQLVNMKEGAVVGAARWSCPCPLV
                     PQLDAAAQPPLRTYASYVIGNATGETVGYADMNCRVLSQDAPAPRASVTPLPVAAPPA
                     RDAEPSREAGAEQGKPYIVRVVVGESDRHRRPSQPTRCEGVQDASRGHEATAARASVS
                     DRGQPPRRVPANTAEKSSLLHLLQYDVAYQLQSLSETVAAALHREHDVLTRTPLKGPD
                     KSGAVSTSRLTKSIDHHVASIVRVANIILQVANQLVDNSPAPPRIGTSREVKDMARQW
                     RNPVNKLPLPAEGSVGHYLQYDVLYQLQCLGTNLSYMIVAYRAALDTPLSSIPAQHVE
                     YCDELGHQIQHLTKHINILVQSSVDGTLSTAAPSVVPEPVARDKHRKRSKRNSQSTPP
                     AAGPQLVSPKFTGVAKSLSRASYSSFSSTRSASSSSLSSSSLSSSLNRPPARESPPQA
                     PAVVAVPATPPPAVPSPQAATPAPNATSQPLPPSPSYSAAAATTSSQPKSPPLPTKPP
                     PPPYTVAAPSAQPTATPLPTPAKSQTGLSPSNSIESFSAPTAPSQANQLVSPVAWINQ
                     ESNYQPPPIATSPLSLHTALQSTGMYGTASSTFAPQPVLATGGPPVLNPPYLSSVPPP
                     LATPTPLKPPSAAPSPPPIATPKVATQLPLQPQPQAPLAIPIPVPIPR"
     gene            complement(<1411114..>1412394)
                     /locus_tag="LMJF_35_3490"
                     /db_xref="GeneID:12980503"
     mRNA            complement(<1411114..>1412394)
                     /locus_tag="LMJF_35_3490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722695.1"
                     /db_xref="GeneID:12980503"
     CDS             complement(1411114..1412394)
                     /locus_tag="LMJF_35_3490"
                     /note="previous protein_id=AAZ14572.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722743.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980503"
                     /db_xref="UniProtKB/TrEMBL:E9AFH3"
                     /translation="MMHSSGVARRQMRPYYNLPSKSEHGRRMTGFLTPYRHWMWKQNE
                     LWRNVHEAQFEHLRKLYKRQWLESFRVNADEYIYKYNITKSAQLAQWEHEMQGQERKR
                     RESQQLAQGRQALKKKHLDLLREFHERQFFYWYERASERLQYMTHINYVPQASIQEHI
                     DRELDKYTVGSKAPYPLNFVGQMPMLEDKDGNIAQVPANLMTNHATENPDGGVTMYEA
                     PEGTAVAEEKLLQMIASAQEEELRIRPEDSDALSESMEDMDRSESARIDSRKVARTME
                     ETDEEREVNRRAYIDRGKTGSKTIFRRPRLDSDGATPPSAGGTTPMKRRKSKMDRMHA
                     LQEQQDAVAAKATAKALKDEDSVAKATKRGEVAENRGRLRDRMIMPSLETLQQSPEMM
                     AQNKPGGRVRTHHLMEKVYGIGKFKKGGGGDEDA"
     gene            complement(<1413254..>1413892)
                     /locus_tag="LMJF_35_3500"
                     /db_xref="GeneID:12980504"
     mRNA            complement(<1413254..>1413892)
                     /locus_tag="LMJF_35_3500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722696.1"
                     /db_xref="GeneID:12980504"
     CDS             complement(1413254..1413892)
                     /locus_tag="LMJF_35_3500"
                     /note="previous protein_id=AAZ14573.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722744.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980504"
                     /db_xref="UniProtKB/TrEMBL:E9AFH4"
                     /translation="MVPIINQCEAANRPAAWAEGGTAGGPSADPRASDAAGVAAEAQP
                     SSTAPELTEEQRKAEEYYHNLYDGGAGEHGDNNAAGTAGTRQGTISPEALEKELLIQR
                     WNTVRQATVYVDILVQQSERVEPDTAVEYSRETEALTLEPELPINQLGTRMLPLPPPS
                     TDSARYLVEPVTTIGMPSTTLEKVAADLQQRLATRMPTHALTRESADDFVGY"
     gene            complement(<1415817..>1419782)
                     /locus_tag="LMJF_35_3510"
                     /db_xref="GeneID:12980505"
     mRNA            complement(<1415817..>1419782)
                     /locus_tag="LMJF_35_3510"
                     /product="putative structural maintenance of chromosome
                     (SMC) family protein"
                     /transcript_id="XM_003722697.1"
                     /db_xref="GeneID:12980505"
     CDS             complement(1415817..1419782)
                     /locus_tag="LMJF_35_3510"
                     /note="previous protein_id=AAZ14574.1"
                     /codon_start=1
                     /product="putative structural maintenance of chromosome
                     (SMC) family protein"
                     /protein_id="XP_003722745.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980505"
                     /db_xref="GOA:E9AFH5"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR010935"
                     /db_xref="InterPro:IPR024704"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9AFH5"
                     /translation="MLSKIHRVELDNFKSYYGKAVIGPFKDFTCIVGPNGAGKSNLMD
                     ALSFVLSSTVTQASASSMRGKSAVDFIHRKAKTAGNGCRVTLVMRHPASQRAVAAAAA
                     PTGGEAGKSDAVPSAARRGAVVADDGEHVHHSSTVETSFTRQVDVQGTVSCLLNGKRV
                     TEKEYVAALTEHRIGARVDTFLVFQHQVEAVAQKKAKQLTELLEQVSGSGELHGEYAA
                     KKAALEKANEALTSASLEKRGAAVAVHQMRLAKKEAERYEELHQQLTSVRQELALSEL
                     FAVETELEKHKEELQQRRDALAELEKSIATEQAIREMKRTYATRHKTYLEELKKARKS
                     ADDLRLKHNTVERIKAALAHLTRKAELQRQELEAAQKATTVRSAEAERLEGQLKKQKA
                     LLDTFEKRCAADDTKRVTLDAVLNQQQLAEYRQLRKEAECATVMLRQRRETVLRQRDS
                     AQEALKQCDRAAEAHQQQIKDVSQAIETAAKYGAELQRRRSELEETVSTLKAQLTEAS
                     KDLETMQKKNKAREAELARLQEQLHELRYMKDTSKQNLRMADALQALRSLFPIRGRMV
                     DLCTVPSERHRNAVTVAMGKNLEGIVVETTAVAIRCVKYLKEQRMPPMTFLPLDAVQG
                     KAVDDRLRTFGGTCKPIVDVVRFEPELEPAVRYTLGQTLLCDTVAEAKSVAYGRDGER
                     FKVVTLDGTVLLKNGSVQGGLASVQSRARKWDEKKYEDLRAARDRLLSEAAGGGEAEL
                     ARIQISIRDMEARREFAEKRVAVVHTEQCANDIKTQRLTEELAKLESRGADFTTRQKG
                     YAAELQVMHKELLELSKSISRVEGQVFADFQKKVGIPNLLQLEGQQTQEAKQRAETRQ
                     QLLLVIHKLESSLEMEVKQVGDAKIADFEEACARLHKEKEQCKKDLTDYKALVEKAER
                     QHQEMRKTAAQSRTELDSLEQQIRNATRNSETDLVRVAQARKLVTGIQLACDSLRSRR
                     LNLVRRCQMDEIGIPLKPVASSGAKRARGEDADAATRASSGLPTPSSRQRSSATGSRA
                     QVLLSEPFTLLVEGGASQSSVRGGTSAASFASSPALDSETTMCIDFSSLTEAQRVVAA
                     DRAQFSAYSHRTQAQLEALAAEMESVAPNMKAASRVTASEDRLGASSTLLDEARDMAR
                     VANKEFARVKEQRTERFMEMYEKVAATVDQVYRELTMGTRAHAVHGSAYLSLENVEEP
                     YLGGTTYHATPPLKRFMPMELLSGGERTMAALALLFAIREVSPTPFFVLDEVDAALDA
                     GNVEKLARYLRKNCQSCQFVVISLKEQLYHMADMLLGVMKDKDRESSKVLTMDLRGYP
                     Y"
     gene            complement(<1427989..>1429737)
                     /locus_tag="LMJF_35_3520"
                     /db_xref="GeneID:12980506"
     mRNA            complement(<1427989..>1429737)
                     /locus_tag="LMJF_35_3520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722698.1"
                     /db_xref="GeneID:12980506"
     CDS             complement(1427989..1429737)
                     /locus_tag="LMJF_35_3520"
                     /note="previous protein_id=AAZ14575.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722746.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980506"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:E9AFH6"
                     /translation="MPACTSIAVTGQPQSCTSAAALTVPLRPQLLRSKMLGLTGNACT
                     SPHLHPLREASTHLLGDTQQRARHRCCPTTHDATLSHHRKEALSTKAIDDINHSLLNN
                     TAYGVLSGKRGCRPRRSSSGACRSSSLALLDTAEAALTRPDRCSSAPAKEAVASTVAT
                     LPSLSPMKVKAVADSASVSPGVTSTTAVAEVLPMSLCASNTPRRLSDALRCDLGQSSD
                     SDCSIASPRMALSLYATEEELPVCIDPEGVQCCPLIDPECEEGVVTDAQINLSPFLNW
                     KFVPYLSSQAKGQVRPTVVLDMDETLLHTSVMPMPDADAEIDALCPSDEAQGTGTSMT
                     SGRYKLFVKYRPHLERFLLFCLDHFEVVIFTASKALYAQTVLRQLQKDFPSINIRLDG
                     SSASGSAPASQRVGDEARVIELLHRDHCTPTNVGYAKDLHLLGRDLRRTILVDNNNVC
                     GVFQPYNSVHVRDFARRRCAERVPEQQRMRVTQLCQLKGTAPASAMTAVEDADTSHLL
                     GNLECTTSTYDWLDREDTVLLRLCAAGGLLHRLSQCENVPSFMQRTVCFSRRAHLSRL
                     VRGSVSSGIRPFPGEG"
     gene            complement(<1434473..>1435624)
                     /locus_tag="LMJF_35_3530"
                     /db_xref="GeneID:12980507"
     mRNA            complement(<1434473..>1435624)
                     /locus_tag="LMJF_35_3530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722699.1"
                     /db_xref="GeneID:12980507"
     CDS             complement(1434473..1435624)
                     /locus_tag="LMJF_35_3530"
                     /note="previous protein_id=AAZ14576.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722747.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980507"
                     /db_xref="UniProtKB/TrEMBL:E9AFH7"
                     /translation="MTSSVTPVLSGMEEDLLCRPRHCRTGDYAPPEAMMASVDTTLPL
                     QLLLFSFINSSSSASHGGVSKISSKAVSYSLLAQDAAGDESAAAAARPPTASDLNDCL
                     WPVDAAFATREDAVKADVCRCIALHFERSLTGIGLVESLGGRLRWAHVASDRDGGSER
                     LGVALTLDVFRCWKQVVVPLLQRISDRASRGWPAGAATVDALFDCLVKGPAAAAAPSS
                     DASSPSASALTCEEAAYWCFALLRGYCQDFPETVWASILRAAQDAAVQQWSSSAVGLP
                     PLPGEALLVRSFIAHLSCSEVDAACATSATALEQPKYDDIVVAHMSAAVAAARARAES
                     WVWDEIELLQRTSADATVLDSSLSALLRADGYWAVLMQPYTAMFAQYYM"
     gene            complement(<1436621..>1437286)
                     /locus_tag="LMJF_35_3540"
                     /db_xref="GeneID:12980508"
     mRNA            complement(<1436621..>1437286)
                     /locus_tag="LMJF_35_3540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722700.1"
                     /db_xref="GeneID:12980508"
     CDS             complement(1436621..1437286)
                     /locus_tag="LMJF_35_3540"
                     /note="previous protein_id=AAZ14577.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722748.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980508"
                     /db_xref="GOA:E9AFH8"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="UniProtKB/TrEMBL:E9AFH8"
                     /translation="MSSDAVATVSSVGDGETKAPAAKTAVVPFVRETRSIKIPHHRFP
                     PLKKVWMEVYTPIVEQCKLEIRMNLKTRSVDLRTSPSTSTAEGDQSATASKVMLQKAE
                     DFVKAVIAGFDVRDAVALLRMDDVYIEGFEIKDVRANLQGDNLSRCIGRISGSHGKTK
                     YTIENVTRTRIVVADTKIWIMGTTQNIRVARDAICDLIRGSPAAKVYTRIRAVMNRAN
                     NAF"
     gene            complement(<1438266..>1440515)
                     /locus_tag="LMJF_35_3550"
                     /db_xref="GeneID:12980509"
     mRNA            complement(<1438266..>1440515)
                     /locus_tag="LMJF_35_3550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722701.1"
                     /db_xref="GeneID:12980509"
     CDS             complement(1438266..1440515)
                     /locus_tag="LMJF_35_3550"
                     /note="previous protein_id=AAZ14578.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722749.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980509"
                     /db_xref="UniProtKB/TrEMBL:E9AFH9"
                     /translation="MSSYLAARRDDERFTVRLEEVNKEMDGLLLKTSRTRHELDRSAA
                     EVHMGVPLHFHPCDVAGRVHLAPSDPAGSGPGRLPARDDLARSLVLAELSQWSRSHLP
                     SLVARLVEDQVQQQLLSLRDSAEEVRARQAKVEKAARDAAEQVRAHRADMHAAFSAAR
                     EETQRDMEEHQRTVKRQLAAWGEELRRVREDVLTWKQQSTNAGDRQEQRISEALQRQQ
                     AHVQEAFETLECEMQRWRQTTSRAVHKEAEELRAQHHALEHLVAQIQGMMTSTADMVA
                     HCAAETQRLMEHAVSRSSEVRVCRRDVNRLEMLVRCSSLQTVLPTASTGSNGVNDNST
                     ASPAASVVLNRLTPEMARFSDSLHAIVARIDGLDRDVRQLEMAVTRGTTASCGQSSYH
                     GSMRVMDEESLYGRNFPSTRRPSYSHLSNATGLRGHPASSGFARMPSLLGCDESANVN
                     PTHSGAAANKTGATCVALVSSAQPVGAGGAPGRGHSGAAGLGAQPSLTPLMSASPPSA
                     MHHPSKSHLSSSSLRFEGDASDSHPMPAVVSESHSAPHAGINEVILRGVAVEAGAQRP
                     PQHRAPPGGIIPVETGESDTWRGVAAKPTAAKSAARSTSLPEVSVDASQILREDALHS
                     LTHQRNVSSRSASSSLSAGNADATFLVQRPCSSLAESDAVSVAEEGALPTHSGANHEE
                     SPVVATPHSPVDSYVSDTPAADLDDSKANSASVSKSDTREAARYTPAQANDSESERDN
                     QVIVRSALD"
     gene            complement(<1442249..>1443367)
                     /locus_tag="LMJF_35_3560"
                     /db_xref="GeneID:12980510"
     mRNA            complement(<1442249..>1443367)
                     /locus_tag="LMJF_35_3560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722702.1"
                     /db_xref="GeneID:12980510"
     CDS             complement(1442249..1443367)
                     /locus_tag="LMJF_35_3560"
                     /note="previous protein_id=AAZ14579.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722750.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980510"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="UniProtKB/TrEMBL:E9AFI0"
                     /translation="MPPEKDSSLSASVRPTPSDGDLAACTVEADLDLPKDCFLFPKQN
                     DAFQIPYFLSSSEEVDKIRPPAVVKTWEQRHGELEEAQKRKLDDFKKMVAAASWYEEE
                     KFDNWMCLRYLTARSFNLNEAFSMLENTVKWWKETGSETWRCDACMENPNHHMGQFIG
                     WDKEHRPVMFMSMRWGPERKSPLRHMVCSFNHLIRMMPLGVEKWVCLTDFETYSHLHD
                     GKPSVGIGVIRVIQDHYPERLGKMVCINPPKLFSMLWKLFLPAIDPVTRTKVEFLWTE
                     AQPSVCETFPCLFPQHLSQYLSDSYDRSKYNLPATPLVWYPRPEGYPKNFEERKHQLK
                     VMREKEKGDKKDAKKAAHDAKKRDKEEQRRQRHEKTQP"
     gene            complement(<1447429..>1451001)
                     /locus_tag="LMJF_35_3570"
                     /db_xref="GeneID:12980513"
     mRNA            complement(<1447429..>1451001)
                     /locus_tag="LMJF_35_3570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722703.1"
                     /db_xref="GeneID:12980513"
     CDS             complement(1447429..1451001)
                     /locus_tag="LMJF_35_3570"
                     /note="previous protein_id=AAZ14580.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722751.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980513"
                     /db_xref="UniProtKB/TrEMBL:E9AFI1"
                     /translation="MSNHFDSDDEPIFTPKEDPSRNASDVVEAELRPNIVAPANTSIS
                     TKDPLTSSNATTVRHESKLTPPPLPLHVPEPATPATVILAGPPGAKSKSFALHNELSP
                     KKAATSIPIPTSRSPANAGGAPGERIANGIDRSNSFVKDDDVSLDSFGIPRYNVRYPQ
                     CGSGSHGDVSVPWNLRPPMRRINCTFFDFLRAPQFWRQFEFAIRITALGVLVPGALIA
                     AELPGSPFVSPFMVFASILLATKRTAGEVIAYIFIWIRAGCFWLPLSVIAGALSLGHH
                     FAGWCIYYSAMLFIMAIFTEDVVRRICLLLFNSCMVGLLVDNNRGAVFPCRVMVDWCI
                     GTGLCVVVAFFPYPLFCKREAQRLLRNIGRNTATAYRGLVYSFWSPSNVERNMAMSKV
                     RIMTDSLDVLLPMFEHHQSFSFYEFLFEPAEVREIRALKFALFERLRINLSSMARVLD
                     IVEAKPSAIDDSDRSKAFGELLNPHLNAVAEVFDELLDLLTKTKTRKALLGLREHFEY
                     FADRIDDLQDAFKLARRTIFYEYTSGILEEFVPLMTFYLFTVVCVRDTIDIFQTKVKA
                     HHPSVISTIEQISIKTAWEPLKENLHFLKKLFTERNRREVQRVVEAAKVSAAMILTIG
                     FSYLIKVDKASFSGPNIIAFVSGSNPVEAVQQSIVRLTGCLLGTVLGFFAGTYSETPV
                     QRVASLCALIFFGTFLRFDKEYGIMAVYGMFVLIPLVSIAETTVEDTVSRMNQNTFGI
                     FIYLFVSVLVLPLSPSFILRAKRSNVLRCMASVVSSMMDLFSVPLVNDPILNNHSIMG
                     NHETEDEQLSQNVGGGDGHLSSRGTLTNRSLHQLSKTDTAMVQIDKQLVELMRRLKST
                     KEMMKFARDERTLVEVDYPIKSCEQTYLHMYRMTMLLQTMWMSWNVIRSQRSYTEGTR
                     RMMRNLQPVAHDVAGAFQRFVDLMCYMIREPSINLEGDIMKAVFDLIEAANALHCRKS
                     QIMLMLINQSVQDYAEANDSSDISGGASVKIADLGTHQQSDLRDLQERGQRSMKGAAT
                     VSTSGEHPQQLRSQPHSPGLRHSPWLGYEASRHSTRPFAALTSRPSMLRAATFDGLFS
                     HFAPLTPVTSPTGQGHNFQVLASERNVSVVPYLRRAGTKEASEHNSHQTSPVHLPATF
                     QFPLTSEDVEGLHSFTLSIEMFANETKLLMVSIGAMLDNLRSKL"
     gene            complement(<1454411..>1456525)
                     /locus_tag="LMJF_35_3580"
                     /db_xref="GeneID:12980514"
     mRNA            complement(<1454411..>1456525)
                     /locus_tag="LMJF_35_3580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722704.1"
                     /db_xref="GeneID:12980514"
     CDS             complement(1454411..1456525)
                     /locus_tag="LMJF_35_3580"
                     /note="previous protein_id=AAZ14581.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722752.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980514"
                     /db_xref="GOA:E9AFI2"
                     /db_xref="InterPro:IPR002528"
                     /db_xref="UniProtKB/TrEMBL:E9AFI2"
                     /translation="MQAPEPPITFHRSHPSSTASGEHAPPLRGGSRIDENTPVATLAL
                     EVLKLSIPLGLAAVAQNSISVVLVAMVGKMVGDRELGATVLANSLLNATAYSLSAGLC
                     GALETVLSQSYGRDQTSKLYGVHVQRMALILLIVAAFVGPVLAFSDSLLISIRQNAEV
                     AHFTGEFCRISLFGVYSLMLLEVMRRYFACQHLNTQLSVNLIIGAGFFPFVLWACIKM
                     LGFPGAAVAWSLLMSCMPASLFTYLLVTGKYKKTWGGWEPMALINWGPLLKLAFPSMA
                     MMLSEWMSQEVNLIVAGYAPINELDAFSILHQFSTILWSMASGVFIEAAVLVGNALGE
                     RKPRFARRCALVCLGLTTLFALVNLSVTLLLRNWIPTLFTNNVAVHALFRKMLRIYVV
                     YHLLDSFQSCMMGVLRGCGLQLLGAMCIALVYSVVGVPLGIIVFFTTSMGVEALWLGP
                     CLGLSVVGCPLYGYLLMYYIDWESLQLHADDGPSFNPSMNERSMGVFIGTPSPSAPRS
                     DLDMVRSEDEEVRSEGGTVRLCRGSHHGTPGLRSLSETGHHTPHSAGLLGFAHDNASF
                     TSFNACTPQRRALSMPSFNVAVPNRSDARQLPLLAESLPEEYDATPAHESHCNVSPCD
                     GGSAPLHYRAGRRSLSPPKSTTGSRSPSAQPNSASRNEAPLHRPSTLRRSAPQAPPAR
                     SAGTRDSQHNPTMVLPQQEPSW"
     gene            complement(<1458318..>1461113)
                     /locus_tag="LMJF_35_3590"
                     /db_xref="GeneID:12980515"
     mRNA            complement(<1458318..>1461113)
                     /locus_tag="LMJF_35_3590"
                     /product="putative DNA repair protein RAD2"
                     /transcript_id="XM_003722705.1"
                     /db_xref="GeneID:12980515"
     CDS             complement(1458318..1461113)
                     /locus_tag="LMJF_35_3590"
                     /note="previous protein_id=AAZ14582.1"
                     /codon_start=1
                     /product="putative DNA repair protein RAD2"
                     /protein_id="XP_003722753.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980515"
                     /db_xref="GOA:E9AFI3"
                     /db_xref="InterPro:IPR001044"
                     /db_xref="InterPro:IPR006085"
                     /db_xref="InterPro:IPR006086"
                     /db_xref="InterPro:IPR019974"
                     /db_xref="InterPro:IPR020045"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:E9AFI3"
                     /translation="MGVHGLWRLLDSFGVVVQPDELKGKRVAIDASIWIAQFRARVAP
                     GEDTEHKVLEGFLARILKLLFYGIRPVFVFDGPASSSKGAEHHRRTMQRARTAQALVK
                     RRARQILVAQVAAGELEVEDLKAAMSSGACAENNAVKAEKDSDAAAASMAASAAEGTC
                     LSETVPRGGGTDRALGATSSARGSAIHGGKRPREASEEVLPLPRPHCRRHCLRQRRLA
                     PDAVSATITQSFLRDVEGLLEERTRHEACVLQNALQGTSTSLFMGPRRAVDENSDAVA
                     GVITSGHLQPLHPHCTAAVVLVSGDSQERDETGCVVISDSESDAEAVSSTSCIVTSTD
                     GEEGSDVEEVVLVENAGGPGRADAPEGALWLPSSACSPSAATAVLHSGDMTRFLNALS
                     QSTCTPPPELMPPTTASERTPSVIPSSSSSSSAALSVSADEGIATDPGSSSTRSSKSP
                     AFPSDGSSEEADGFTDGGDGDDRDDSEFAWEPFTQRRHLAQLLRPQEQESESHPHSSS
                     SAAAQMVTASFAGPPRTDATTVGKEDEYEDDYAPVRAVEMFSRRRTAPVPLPMVGSIS
                     RNGESEKGNCTISVSAPHHPNAVKGAISEVAGAPHRKSAEVHSSSTDRASSLGGVPPH
                     GGGAARTHRVVIPFELLNVVELLDCCGVPYVLSPAEADAQCAFLARCGLVDAVFTEDS
                     DVLVHGATRVLRGFFAQSKNVVAYEQTHLSACGITKTVLVALASLLGCDYTEGVCGIG
                     LVGALEALVVAWTTAESAEAGAASSSAVLHLLRRWALLVQRPPRSWQEVDDHMTILQF
                     ALLQVHVAQWRTLEQRACFPEAHAVEAFFDAKVDLDTTPFQWLPPDWQRIRVFAGALG
                     ALSSPWLVQRYELARKECLRREETAAKERASLTAGQRQLTEYGVQERVRARWAFQRQP
                     PKHAAALAKLRAVQQMQ"
     gene            complement(<1461894..>1463057)
                     /locus_tag="LMJF_35_3600"
                     /db_xref="GeneID:12980516"
     mRNA            complement(<1461894..>1463057)
                     /locus_tag="LMJF_35_3600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722706.1"
                     /db_xref="GeneID:12980516"
     CDS             complement(1461894..1463057)
                     /locus_tag="LMJF_35_3600"
                     /note="previous protein_id=AAZ14583.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722754.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980516"
                     /db_xref="InterPro:IPR026113"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9AFI4"
                     /translation="MSIATNSEAPTQPSRAASFSCTHDALHERKRARPPPYPPFVSEY
                     RPYSSGQLQAHRVNQHTDLHKRQWDMYYRNNTVNGFKDRHYILREFHELRAAIDAAAA
                     TERTSATDEAAPSKSAASASPARSFSWMEAGCGVGNAMLPVFAQYGHLPQWRALFGFD
                     ISSVAIGLLEEKRAVLPPALAAKVHVCVLNPVESEVADCPFFTPTGGGATASSSSTDV
                     AGAGGADGDSTAVVGRLPVCELPEFVSLVFVLCSIPVSSHAVVLRRIARCMASPGGVL
                     YFRDYAVSDHAERRFQASSYRRRGDGSEGDGTGNTNTYERTNGTLSHFFALEEVRTLF
                     EGAGFEVVALDIIANEVINRKTNVSFARRFVQGRFRLRTGSVMGERRGTKSGS"
     gene            complement(<1463735..>1464478)
                     /gene="CYP7"
                     /locus_tag="LMJF_35_3610"
                     /db_xref="GeneID:12980517"
     mRNA            complement(<1463735..>1464478)
                     /gene="CYP7"
                     /locus_tag="LMJF_35_3610"
                     /product="putative cyclophilin 7"
                     /transcript_id="XM_003722707.1"
                     /db_xref="GeneID:12980517"
     CDS             complement(1463735..1464478)
                     /gene="CYP7"
                     /locus_tag="LMJF_35_3610"
                     /EC_number="5.2.1.8"
                     /note="previous protein_id=AAZ14584.1"
                     /codon_start=1
                     /product="putative cyclophilin 7"
                     /protein_id="XP_003722755.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980517"
                     /db_xref="GOA:E9AFI5"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:E9AFI5"
                     /translation="MAVVLHTTVGDLPVLLHYQTCPLASFNFLALCASGYYDGCTFYR
                     HFPGILLQTGDPTNTGKGGESIFAKLPPVAYTADGDDNGDAVSSEAASVAAAGILPGR
                     YFRDEGFGVTTHAQRGTLSMAHKGTKADTNASQFFVTTSPQSSFDGFYTAFGVVDLNG
                     VYSASEAAVVAEVASSTEGEVAGSSLATAEPDAVGDAAPKCGDAVLTALEVASAKVDE
                     KNIVQLASRARITNATVLYNPFAEGKMKL"
     gene            complement(<1467146..>1467631)
                     /locus_tag="LMJF_35_3620"
                     /db_xref="GeneID:12980703"
     mRNA            complement(<1467146..>1467631)
                     /locus_tag="LMJF_35_3620"
                     /product="putative iron-sulfur cluster assembly protein"
                     /transcript_id="XM_003722708.1"
                     /db_xref="GeneID:12980703"
     CDS             complement(1467146..1467631)
                     /locus_tag="LMJF_35_3620"
                     /note="previous protein_id=AAZ14585.1"
                     /codon_start=1
                     /product="putative iron-sulfur cluster assembly protein"
                     /protein_id="XP_003722756.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980703"
                     /db_xref="GOA:E9AFI6"
                     /db_xref="InterPro:IPR002871"
                     /db_xref="UniProtKB/TrEMBL:E9AFI6"
                     /translation="MAVMPSAACAAQLAAVRTLYSDKVQDHYKNPRNVGKLDKNDPNV
                     GTGLRGAPECGDMTQMQVKVNPDTLVIEDVKFKAFGCGSAIAASSYASQAIRGKTVAD
                     ALKLTNKDIAHELSLPPVKLHCSMLAEETIHAAVENYLSKNPTLKSKVSKRKEEEAKQ
                     E"
     gene            complement(<1468351..>1470183)
                     /locus_tag="LMJF_35_3630"
                     /db_xref="GeneID:12980518"
     mRNA            complement(<1468351..>1470183)
                     /locus_tag="LMJF_35_3630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722709.1"
                     /db_xref="GeneID:12980518"
     CDS             complement(1468351..1470183)
                     /locus_tag="LMJF_35_3630"
                     /note="previous protein_id=AAZ14586.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722757.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980518"
                     /db_xref="GOA:E9AFI7"
                     /db_xref="InterPro:IPR002528"
                     /db_xref="UniProtKB/TrEMBL:E9AFI7"
                     /translation="MSTHSYVDSENGVAIDNLSFASHISTSGRCVPADVESIAQAIAS
                     TSRRPEDGTPSTTDGEEAGLGMSADLSTMDIVKKFFFLGYPLTLSSLAQFSLNLVIIM
                     VIGRLLGLEAMGGVSLALGLVNATGFAFGAGLCGALETVLSHSFGHFQQEKKRLAQAQ
                     TEAERTGTTVEPQVPCTLHIYGIYAQRMSIILMVACVPLGFVLCFADALLTIAGESAA
                     VVHYTGKWCRWAVFGIPAAMAFQLIQRYYSCQHLTKPLPVALFSAAVANPILQLIFVK
                     LFGFAGSPIAWLIMMTGIVAGLVFYLRYTGRDKLTWGGWDIRCAQNVNSLVKIALPSM
                     GMMLSEWVALEVNALASGYGTAAELGAYTITLQVFGIMWAMGSGVMILTSVFVGNAIG
                     EGKPLLARRIAFIALAVVLGIATVDVVLCLLLQPFIPSFFVQAEEVDAVAAIYRELMY
                     VVMPYHFVDVFQSTVMGALRGCELQKLGAVIITVAFCAVGVPLSFLLFFHFKIGIKAL
                     WIGPFTGVAVVGTPVYIYILLRYIKWENLKPHADNTAILEETETGAARTRAISNPVDI
                     PLDNAAASVESPQVVAVRRFVNSPTPITTVQVPTAASVAEKPQQ"
     gene            complement(<1471812..>1472417)
                     /locus_tag="LMJF_35_3640"
                     /db_xref="GeneID:12980519"
     mRNA            complement(<1471812..>1472417)
                     /locus_tag="LMJF_35_3640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722710.1"
                     /db_xref="GeneID:12980519"
     CDS             complement(1471812..1472417)
                     /locus_tag="LMJF_35_3640"
                     /note="previous protein_id=AAZ14587.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722758.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980519"
                     /db_xref="UniProtKB/TrEMBL:E9AFI8"
                     /translation="MSRATERLHTCECAAAYRVASLLQRPRTVEGADAGSLRGTTAQI
                     EQFLARASREPAVRMEPECMQTGSGNSSGAEELSLADEGPTLQLSVVAGVLEEAEVAA
                     EQRGISSLDGLVLPTAANQEELQRRKAEQAQAMLNLLSALSPSAPAPGGCRGASHAAA
                     HVPSSDDGDDGVVVMDADDLMGEDSSEDDAPSTRRRIVEID"
     gene            complement(<1473360..>1475918)
                     /locus_tag="LMJF_35_3650"
                     /db_xref="GeneID:12980520"
     mRNA            complement(<1473360..>1475918)
                     /locus_tag="LMJF_35_3650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722711.1"
                     /db_xref="GeneID:12980520"
     CDS             complement(1473360..1475918)
                     /locus_tag="LMJF_35_3650"
                     /note="previous protein_id=AAZ14588.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722759.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980520"
                     /db_xref="UniProtKB/TrEMBL:E9AFI9"
                     /translation="MLVGLTGLMEWTVMQPSTASQLDASYTSSTGALQQARTYPALLT
                     ELTPTVLTGRSSASASAAPLVYATVSSLVEIEKIGPRQLRLRQELFGVPGTYRVLYLT
                     APSAVACDEWWRALYRLTDDQRLHLRSTNAPVAAAPSFHPDPESAHPCCDAAACLADS
                     LVAPAPERSQEVSGVTELQRMLLFTPSSPCSVRAGRPSCRLRGCMSQSSPSAIEPSVT
                     DLRTSQLLLRPQQLALGTSRADSTRHPVAVLPPSGLMLACDAATAAAAAVTGTSSLSL
                     QCNSAPARTDVIPSIERPMPSGVSTASPPRPIAPVKDSGRRHLAQAQRPTSTSALSVS
                     LPMKSPVSSTAAVNGSANLLGAPAAASRRIAAPPSLCALLGSGTDLCSRTASVSTASH
                     ASTASISGDAAEREAGVSPQTLAAASAASPKEKETPAAETVATLSSSALPREHVEFNS
                     SAGVAWHPAFLTPATAAVVPTAAARTSSTQPLGQRPVSPRLCLRQVPLQNPPRGRSPS
                     LTRRGATAPAALPSSEAAALAQASTAGCTLSPVSSAYEPIHVDSTTVSRAHGSGCSSP
                     CSRLKSPSSALDIYLLHWYGCCTPSLTPRIMYRGVSPLWRRNMNAKGSRSRSRERRDS
                     AATPMSGQPRGNRHCGLTRSVGRRRYSSSSLAHRSRYVGAAYAPAIPPLLSVIAQPHM
                     FLKYPVRVSSPRSSDKDGAGADGAATYVFLTLDEDCVVTVPAARFDQRMKEASLLQQR
                     KAPDDSARAERCCSGADSVSVGVRSFERAQRFFGADYCRAMPVAEVERVSRGNEEPLL
                     LLNAAQRERFRDLSKMICIATQTHALILEATNSTDAERYVGKWKRYLRSLRGAH"
     gene            complement(<1476693..>1481036)
                     /locus_tag="LMJF_35_3660"
                     /db_xref="GeneID:12980521"
     mRNA            complement(<1476693..>1481036)
                     /locus_tag="LMJF_35_3660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722712.1"
                     /db_xref="GeneID:12980521"
     CDS             complement(1476693..1481036)
                     /locus_tag="LMJF_35_3660"
                     /note="previous protein_id=AAZ14589.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722760.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980521"
                     /db_xref="GOA:E9AFJ0"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="UniProtKB/TrEMBL:E9AFJ0"
                     /translation="MCSFASTVSGAAASSSTEQHARALALLSELQNAAGSAAASESLA
                     PPAEVPAETALWRSYMHPFARLLCNKIHVSVSTDNRTPLSAALLANGRWDETLLDCVC
                     QLASWPDAEAAGTVAQWMASLVQSCALRKSSRLVSSSSEMELMVRRVVEASSPALLCA
                     VVQACQVRTRRMDSSAGDGGAAFRGAATVLYASQAEEDLHGGCRWHPCMSDRAIKLSL
                     QQIVQVLSGSASDRRKGRAGSASAVTLVARLQIQQCCLCQIPRHMDDRTRHDCAVLAM
                     KALKQAPFTVLLAAYEYFREEGLASAVVAQRFLAHCGACVTHVTQRGVSLATYLSPVA
                     NKGAVEALLHAHSTVLSTGPDSKQMETTMSYVTATLNALGYPHVVRSLYKAPQPTMTT
                     TSDPELCETPHSVVSQVLLRDVHGAVVALEALGASRPEGWLSVPPSATESMAAVSRLV
                     GQEGSVADVKRLYAALVGFHNAGLFISYYVECVLAGVCDRVRDIGRQQRHARENASKV
                     PSAPPHEILERVIPVFRATLCYIGDELNADIIFELVETALQLRDYAVPLTAALVSTLR
                     ASMEVSLCLHELLCRVDASTHNTPFLAYYALCYTRDFGSHATFDHLAALWRVDADAIW
                     NRATHLSPSCQLWKCATCGRLNSDRYNYCVCSALRYSHVLCGACGYAQDERLRQCCSC
                     GQTLLNKASLAGAVARTAWQCRDCGARNPARQTLLCFRCGEPTGPCIQQHAAAEATES
                     EGSAASTSLECGCCFSRGCDKDQRRGAAAAATRRAAAYMAAVGVCHECGRFKMDHAAR
                     HSLVWVCTGCHQRRSSLERICPSCPQVECLPQAVCRGPVNVPRVCRHCGHEEVNPFAM
                     LCRGCGSTADPFVHRGDSAEATRMPERVSAASGHSSPTSPEAVPNQQQCQVYHWCLHC
                     HHMQVRDGTAPLHQQHCSKCAANCEEEGLYLLPSRVCGRCGASLPARYAGSAVCPYCA
                     AYVELVPQPQKCDSDSAQRYWTAFTLLHTCEVLDECCARESLLTERSTHAMPTALVRV
                     TPKTSASDSGVSLGSAAITVGASTRAYLQRRPTIERTLSCLRREWCNMDGDAWLSVRM
                     DVVTLLGRAVDTLRQWLSASLTARRLSALLKDILTHVDCACGVAVTGSQDAFSRSAQG
                     HFTPVEVCHECLGTHPPTLCPFLEDSGLWLCGECGSSNSNSDVCRYVCGRCLALRPVM
                     QDLLVSTCWECHACDRANVQFERYCMHCGAERAAWSTAMLPHWDSAGDGALTDDAHGN
                     DGFHSLAAAGAGELDPRGEATHQINGLATGKRRGDAEGHCVGLLNLKGNGQTLSPSLS
                     DALFCGASNASLLDTLAASSADTAEPVRGDEIPFSPAKCPLCGLVYIEARCPLCLNHI
                     ADVADARGTVCEVQDRCAFIQPSGTTRPQDRIFVDEALLKANTLKEGLLVHYTAELGQ
                     RGRMEARLLRC"
     gene            complement(<1482925..>1483602)
                     /locus_tag="LMJF_35_3670"
                     /db_xref="GeneID:12980522"
     mRNA            complement(<1482925..>1483602)
                     /locus_tag="LMJF_35_3670"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722713.1"
                     /db_xref="GeneID:12980522"
     CDS             complement(1482925..1483602)
                     /locus_tag="LMJF_35_3670"
                     /note="previous protein_id=AAZ14590.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722761.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980522"
                     /db_xref="GOA:E9AFJ1"
                     /db_xref="InterPro:IPR008698"
                     /db_xref="UniProtKB/TrEMBL:E9AFJ1"
                     /translation="MTEYLKDLASVKPGEPMPPVNLGPYDNPLLWNKLDPFGADRGHQ
                     RRPMTVSRDFMELNQVPIVYRDHCVHRWIPFNRCMRNLKPVTWGTVNCHEFEESWMVC
                     RAHETYRLQLLKSKFMELTKDYTAEDKKFFPSILYLGIPYYMPSFYWNLATSQRLSGW
                     DEKDPANPVMWREPNRSLMRSEFSPTNWEKGTMTSAYGHKLIPDEIVHEMVPGFPLPE
                     EKRPQAA"
     gene            complement(<1489694..>1490455)
                     /locus_tag="LMJF_35_3680"
                     /db_xref="GeneID:12980523"
     mRNA            complement(<1489694..>1490455)
                     /locus_tag="LMJF_35_3680"
                     /product="putative ribulose-phosphate 3-epimerase"
                     /transcript_id="XM_003722714.1"
                     /db_xref="GeneID:12980523"
     CDS             complement(1489694..1490455)
                     /locus_tag="LMJF_35_3680"
                     /EC_number="5.1.3.1"
                     /note="previous protein_id=AAZ14591.1"
                     /codon_start=1
                     /product="putative ribulose-phosphate 3-epimerase"
                     /protein_id="XP_003722762.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980523"
                     /db_xref="GOA:E9AFJ2"
                     /db_xref="InterPro:IPR000056"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:E9AFJ2"
                     /translation="MTAKFNHQDKSTYPNGRNKKQPIVPIISPSLMVADQTKLLQESL
                     DVLSDKGGSADWLHVDIVDGHLAPNFSFCPATVSDLRKHLPNTFLDCHLVVCNPIRWV
                     DSFAKAGASTFVFHYEATENPVAVCRKVREAGMVAGIALAPNTPAEVLFPIIDAGEVD
                     MALVMCVPIGFAGQQFQMETVEKVRRMRQRYPHLLIQVDGSITLDTIDLVAAAGANAI
                     VPGRAAFKSNDRKGSMEGLRRSIQKHIAQRAASHL"
     gene            complement(<1494218..>1494979)
                     /locus_tag="LMJF_35_3690"
                     /db_xref="GeneID:12980524"
     mRNA            complement(<1494218..>1494979)
                     /locus_tag="LMJF_35_3690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722715.1"
                     /db_xref="GeneID:12980524"
     CDS             complement(1494218..1494979)
                     /locus_tag="LMJF_35_3690"
                     /note="previous protein_id=AAZ14592.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722763.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980524"
                     /db_xref="GOA:E9AFJ3"
                     /db_xref="InterPro:IPR008733"
                     /db_xref="UniProtKB/TrEMBL:E9AFJ3"
                     /translation="MTNVPLTQRITAFNNYVGNASNRDRVMSVVQFGAMALAAPAAAA
                     GCPELSAHLSTILHGAAHYRTVTRFSQWLVVAPALTPSGIKSAIASHPNLLVGICKTI
                     STAFFTVFLIGEELVLASKCNMLDPVLGKRFNRIRFVFLFWSNIARLVMSYLLLKSSK
                     YDAVKDNQNEEKAKDHRRKVLGVADGVLQSMFCYTLLKSSAPAGPKYLSAALRSGKAV
                     DIITSLAPPLLVVPSTPQGMLGLAASVPGFMMSVL"
     gene            complement(<1497776..>1498453)
                     /locus_tag="LMJF_35_3700"
                     /db_xref="GeneID:12980525"
     mRNA            complement(<1497776..>1498453)
                     /locus_tag="LMJF_35_3700"
                     /product="glycosomal membrane protein"
                     /transcript_id="XM_003722716.1"
                     /db_xref="GeneID:12980525"
     CDS             complement(1497776..1498453)
                     /locus_tag="LMJF_35_3700"
                     /note="previous protein_id=AAZ14593.1"
                     /codon_start=1
                     /product="glycosomal membrane protein"
                     /protein_id="XP_003722764.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980525"
                     /db_xref="GOA:E9AFJ4"
                     /db_xref="InterPro:IPR008733"
                     /db_xref="UniProtKB/TrEMBL:E9AFJ4"
                     /translation="MSAAVFEYLGNTGDRDKVMAIVQFLPMTLAGPANDAGCTSLSKS
                     LKSLSSMADGYRAITRLALLFNALSKPTLEALSKPKGDVLLDRVDQLSHFFHVCFCFF
                     ENTAVLSSHNVYPNRFVRLGGCAVTCWFYTLLLGLMRQAYVMTKKKNTPEEQKRQMVT
                     TVKLGCFLIFSLTCFPKGGPQLLEDVSGPLVPLHKTLQLIAPKHLELNDTIRGVLGFI
                     ASMCDFY"
     gene            complement(<1499231..>1500256)
                     /locus_tag="LMJF_35_3710"
                     /db_xref="GeneID:12980526"
     mRNA            complement(<1499231..>1500256)
                     /locus_tag="LMJF_35_3710"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722717.1"
                     /db_xref="GeneID:12980526"
     CDS             complement(1499231..1500256)
                     /locus_tag="LMJF_35_3710"
                     /note="previous protein_id=AAZ14594.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722765.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980526"
                     /db_xref="UniProtKB/TrEMBL:E9AFJ5"
                     /translation="MVSWWPFQRGRQPAAAGGASPSPSSDAGGGDAKVPLSRSLMDTE
                     SFENVVTGKDREYGDSGVAYSQFDRMRGEQRIRRHGDGRASTMDVESIDMLVSRFENE
                     FRQADAHMKAREAQRSVLQRYDYANDRRYQQWVAEQKEMREKLKIHWLDWMIDQPSDC
                     LVYFLRVCTTAGFCFGAGRTAYLYRTMDKTYAKLNGVTLGSIAFREITTSVAKGGAVA
                     LMGTIGMPVGDALTNLFMLLWSGDVSSPQRTWWHILNSSLCSGFLGGVAYVSFNYKQL
                     TPWGVRALLSLSTGSGAAAGLYLGYVIYRPYAAQRTHNLYEPYWRPWHSRHQRDAGPS
                     NVRGRYL"
     gene            complement(<1502167..>1503489)
                     /locus_tag="LMJF_35_3720"
                     /db_xref="GeneID:12980527"
     mRNA            complement(<1502167..>1503489)
                     /locus_tag="LMJF_35_3720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722718.1"
                     /db_xref="GeneID:12980527"
     CDS             complement(1502167..1503489)
                     /locus_tag="LMJF_35_3720"
                     /note="previous protein_id=AAZ14595.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722766.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980527"
                     /db_xref="UniProtKB/TrEMBL:E9AFJ6"
                     /translation="MELAAMDPVAQQELQRMTRAIEEYAARLDSLGAELETIEQQNRN
                     DEVSRQIQQYNEAAVAPREIAAEDAMDNIVRMQNQLKIVQRRNQLLARENAMQEKLLR
                     ERANKLNSMHKELDTVMAATGWYGGKRDVQFSRIERERADIHDMSLVEASLRSDIKSS
                     KVTIARLEKTVLALSAKVLENEERRTRYMQLCNDCRVREKECSEMQAKAKRMAADNNK
                     LQLVVKTETDSALVENSIACMESDREFLSDAVQDMKMACRRQENVIKAQITREQQLQR
                     RLDTVTKSLNEMRLAREFERNVAKSALVPSASREEPEDVAEVLPQDEYIPVDTFRLLY
                     KNNEMMRTNVARKNMLVLEKESVVQSMESRVMQHIEKHNEIVRFDDSIHMSGEASAQA
                     AKRNLDTEEKKLVRQIEGLRESNNQMRAAISKKAAPAQARKAASGRGK"
     gene            complement(<1504779..>1506170)
                     /locus_tag="LMJF_35_3730"
                     /db_xref="GeneID:12980528"
     mRNA            complement(<1504779..>1506170)
                     /locus_tag="LMJF_35_3730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722719.1"
                     /db_xref="GeneID:12980528"
     CDS             complement(1504779..1506170)
                     /locus_tag="LMJF_35_3730"
                     /note="previous protein_id=AAZ14596.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722767.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980528"
                     /db_xref="UniProtKB/TrEMBL:E9AFJ7"
                     /translation="MQRRWRVSLLTSIILHWQCFVQTRKALHAVLSSWRQLLQQRSRA
                     FAACRQAQRKHCFQHWLRAFTWHRERGALDEAAIQFAASRQRWRHGPTLLEAYGGGAE
                     VLALLQGRPHASGTGTVVVAAVGPRLLLRRLFLAWRQRTEWRLMAHLAAWHYVQQMRV
                     NVARRVCSCARRLALQHHRSRPEHQQQRAAPAAQSLGAGSGVVEEQSRAPLRVCIVPV
                     AQRGLLKYKVSAARCIAHAAQLRSCFDWWHIRVRARRADRFHLQCVYAHVVCRWLQAL
                     AAHRARRQRKRLVLSRWVAATERCQATAVAWKLHVYQLARHALRLWRSRLTVRLTHQA
                     QLLQGCFGRWRDRTLLQRATRALQRTRQHGLLRQWHCRTEARVQVRTNLYVADTISET
                     ALVLGCFRRWRFRAAERHRARLAWGVLAQLRRERLSRHCFGVWRRRTLAPERPWARHL
                     TKDRSSPPMSLIV"
     gene            complement(<1508378..>1509544)
                     /locus_tag="LMJF_35_3740"
                     /db_xref="GeneID:12980529"
     mRNA            complement(<1508378..>1509544)
                     /locus_tag="LMJF_35_3740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722720.1"
                     /db_xref="GeneID:12980529"
     CDS             complement(1508378..1509544)
                     /locus_tag="LMJF_35_3740"
                     /note="previous protein_id=AAZ14597.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722768.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980529"
                     /db_xref="UniProtKB/TrEMBL:E9AFJ8"
                     /translation="MALPLAARQHFLEHGYAIVPNVLSSSVVERIRSAALASTTARFR
                     SFAHLPNVHSLLKSTPKCTDPLQDGLMSHLQKRRYILRYYRDMRRHKRRLRRAAKAFL
                     NGRDVSELGREDMLRLSEMVCAEAQKVWSRGCTSTVKTDLQMLTAINQYRANAWMTNA
                     QLEAVLRDNEEFVKPLSQLAEVVGGVARPVIFGDVPLLREAYGNPVGYHCLAPTIGTR
                     TNARVSKGGGEATAVSMVLFTYTPTPLCLPPFVLRNSQHAVRRQYLHSVHAERLWRPF
                     APMEADIRDQLRRFQFDASVVGQPLLAAMAGPSSTPAAPVIGPGTVMVVDPHLMMAFG
                     GNMTPQSEVLYRINVVAENARPHLMAPSWIRGWRTMPEEVHFASPVVFPPLYVE"
     gene            complement(<1509962..>1512589)
                     /locus_tag="LMJF_35_3750"
                     /db_xref="GeneID:12980530"
     mRNA            complement(<1509962..>1512589)
                     /locus_tag="LMJF_35_3750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722721.1"
                     /db_xref="GeneID:12980530"
     CDS             complement(1509962..1512589)
                     /locus_tag="LMJF_35_3750"
                     /note="previous protein_id=AAZ14598.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722769.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980530"
                     /db_xref="GOA:E9AFJ9"
                     /db_xref="InterPro:IPR001373"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="UniProtKB/TrEMBL:E9AFJ9"
                     /translation="MMPYQHSINEDGAMRILAEMLDALDTHGLALFSESGHGAAWPLS
                     SPTTWSSALAVLATSAPLNAMVADTLLERVSAALSVEIDVYHSAVLCCSGPLSTEVAL
                     PALERLGEVYRQVHSHLLRWCSALHTPGVAALLAVRLRCALLQTALVTGEEPPGRQAL
                     FSFLWRHGRFVLAKQRKAAGDGDEEDAGDSGCDGTLGEAGDANESASAPASASPAPDS
                     VMTCLHRLALNRSAEVKQLWRSVLEEGIRDRLSDLSDDFSTRILHKHLSWLENSVVPF
                     VRMVLPDSDGESDPLCRSSGSLRDETSANRRCEDVGTTSEGCHMVPGHVQEGDACPSS
                     QTNEAVRAEREAWCADLRLLLLHTYARRRLDGFWDILSDYPDSVPALEDMHYCLQSTP
                     ESGLKTELVQTVRHLLSSRLHRAGTRTDDILAILINTIHAFCILFPRNEQSSVVFSVT
                     SDTLEHLRRRKDCVPAVVQAVMQPGSAVNVAPPPLTQAASDGLVGNLDFDGDAGSKEG
                     ELHRAASRGRPDVVRVLLTSIPRRALVDEYQQMLAEQLLQKPMHQFDTTPEEEVLERL
                     RHVFGETALDRCAVMVRDMQMSRRISQQLREQLGSSREDRLPQLRPTAASATAVSPAA
                     SVSVLSMTAWPPLPRCSSANGGDSGPASAPLKFCPHPALQEEMDALAEAYKRLKDNQR
                     MTWLPSLGRVELELKQKDPSKGNALVAVPQVLSLFDASFVLHVKEMASRGGFSTPVHL
                     KEVAVVMEVQLEELRAHAQRLSPAVLMFQPATDLVTMQLGVAASADFVFMEDRETDEE
                     SGKPAGLPPERVKLMERMVTSLLKTRGAQSSTAIHSSLKLLGKFEGSNADVVELLRSF
                     VGRGLIVLNDARQYALPPK"
     gene            complement(<1513628..>1514065)
                     /locus_tag="LMJF_35_3760"
                     /db_xref="GeneID:12980531"
     mRNA            complement(<1513628..>1514065)
                     /locus_tag="LMJF_35_3760"
                     /product="putative 60S ribosomal protein L27A/L29"
                     /transcript_id="XM_003722722.1"
                     /db_xref="GeneID:12980531"
     CDS             complement(1513628..1514065)
                     /locus_tag="LMJF_35_3760"
                     /note="previous protein_id=AAZ14599.1"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L27A/L29"
                     /protein_id="XP_003722770.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3760"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980531"
                     /db_xref="GOA:E9AFK0"
                     /db_xref="InterPro:IPR021131"
                     /db_xref="UniProtKB/TrEMBL:E9AFK0"
                     /translation="MPTRFKKCRHQRGSTFCGYGRVGKHRKHESGRGNAGGMHHHRIN
                     FDKYHPGYFGKLGMDHYHRKKNPMWKPTINLNNLSRLIAAEEAAKAAKGGTLPVVDLQ
                     SSGYAKLLGNGHIQVPCIVKARYVSKLADKKIRKAGGAVVLQA"
     gene            complement(<1515036..>1516994)
                     /locus_tag="LMJF_35_3770"
                     /db_xref="GeneID:12980532"
     mRNA            complement(<1515036..>1516994)
                     /locus_tag="LMJF_35_3770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722723.1"
                     /db_xref="GeneID:12980532"
     CDS             complement(1515036..1516994)
                     /locus_tag="LMJF_35_3770"
                     /note="previous protein_id=AAZ14600.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722771.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980532"
                     /db_xref="UniProtKB/TrEMBL:E9AFK1"
                     /translation="MTRTSSSAVVTTLAVTATLLALLSVSVAVSAVNLLPLVGEGLFD
                     VEVVCRSAMLSEPTVYNRSVISAFRFSVNASAGSTNEKVYLPLYVERILDNDYVRTYY
                     INSTDKYNISDTEGCVHTKGSYESSDEVLLAGSLITMLRSPLSAKPYPSIIRGIAVNN
                     YSGQYDLTIPRSYGGLGVPATYRAAVLTSTQHWLVNLMSVDLTPVSIEVTTTGAASTI
                     NNCLFTFSFFGSNVSSVQGSLPSSCTNSSSVHPRLWKASNVALPMMRAPAGAATAFSS
                     RPSVFTSSSETSSSASAADTADYTMPAVPDIFTANFLVVSPLEDSFYQVRASYSLYAG
                     FSRTSLQFPVKGIAGRVYKHEWYSSSWNQMSYYHTEFAVPSGQGQADEALRKYFFPDL
                     NTCKRVVIAYDLIARSASSLLLYSPNVPPTFVGNQTVRNIPCGVWVAELEGVRVTWYW
                     ATDDLVDTTSFWTDNSISGASTYARLVRMTVTGKGGAPPLFTHHPFFPQRTAFPVTDR
                     DVACTAMMPSEADMGCYTYAKNADYTYIYEITSFVPYVRRNDYDIPAACAGVKILGSI
                     PSFQCNYKGITGGVASILLTVVALLFSLAGGCCVWCPFSRIVRQQQDELARFAWEIRL
                     AQSANGTEGHDTTDVVAKSEPDVRNPSL"
     gene            complement(<1518601..>1519038)
                     /locus_tag="LMJF_35_3780"
                     /db_xref="GeneID:12980533"
     mRNA            complement(<1518601..>1519038)
                     /locus_tag="LMJF_35_3780"
                     /product="putative 60S ribosomal protein L27A/L29"
                     /transcript_id="XM_003722724.1"
                     /db_xref="GeneID:12980533"
     CDS             complement(1518601..1519038)
                     /locus_tag="LMJF_35_3780"
                     /note="previous protein_id=AAZ14601.1"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L27A/L29"
                     /protein_id="XP_003722772.1"
                     /db_xref="GeneID:12980533"
                     /db_xref="GOA:E9AFK0"
                     /db_xref="InterPro:IPR021131"
                     /db_xref="UniProtKB/TrEMBL:E9AFK0"
                     /translation="MPTRFKKCRHQRGSTFCGYGRVGKHRKHESGRGNAGGMHHHRIN
                     FDKYHPGYFGKLGMDHYHRKKNPMWKPTINLNNLSRLIAAEEAAKAAKGGTLPVVDLQ
                     SSGYAKLLGNGHIQVPCIVKARYVSKLADKKIRKAGGAVVLQA"
     gene            complement(<1519632..>1520051)
                     /locus_tag="LMJF_35_3790"
                     /db_xref="GeneID:12980534"
     mRNA            complement(<1519632..>1520051)
                     /locus_tag="LMJF_35_3790"
                     /product="putative 60S ribosomal protein L23"
                     /transcript_id="XM_003722725.1"
                     /db_xref="GeneID:12980534"
     CDS             complement(1519632..1520051)
                     /locus_tag="LMJF_35_3790"
                     /note="previous protein_id=AAZ14602.1"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L23"
                     /protein_id="XP_003722773.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3790"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980534"
                     /db_xref="GOA:E9AFK3"
                     /db_xref="InterPro:IPR000218"
                     /db_xref="InterPro:IPR019972"
                     /db_xref="InterPro:IPR023571"
                     /db_xref="UniProtKB/TrEMBL:E9AFK3"
                     /translation="MGKDQANVKGCRFRVSVALPVGAVVNCADNTGAKNLYVISVKGY
                     HGRLNRLPSAALGDMVMCSVKKGKPELRKKVLNAVIIRQRKSWRRKDGTVIYFEDNAG
                     VIVNPKGEMKGSGIAGPVAKESADLWPKISTHAPAIV"
     gene            complement(<1521007..>1521426)
                     /locus_tag="LMJF_35_3800"
                     /db_xref="GeneID:12980535"
     mRNA            complement(<1521007..>1521426)
                     /locus_tag="LMJF_35_3800"
                     /product="putative 60S ribosomal protein L23"
                     /transcript_id="XM_003722726.1"
                     /db_xref="GeneID:12980535"
     CDS             complement(1521007..1521426)
                     /locus_tag="LMJF_35_3800"
                     /note="previous protein_id=AAZ14603.1"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L23"
                     /protein_id="XP_003722774.1"
                     /db_xref="GeneID:12980535"
                     /db_xref="GOA:E9AFK3"
                     /db_xref="InterPro:IPR000218"
                     /db_xref="InterPro:IPR019972"
                     /db_xref="InterPro:IPR023571"
                     /db_xref="UniProtKB/TrEMBL:E9AFK3"
                     /translation="MGKDQANVKGCRFRVSVALPVGAVVNCADNTGAKNLYVISVKGY
                     HGRLNRLPSAALGDMVMCSVKKGKPELRKKVLNAVIIRQRKSWRRKDGTVIYFEDNAG
                     VIVNPKGEMKGSGIAGPVAKESADLWPKISTHAPAIV"
     gene            complement(<1522118..>1522561)
                     /locus_tag="LMJF_35_3810"
                     /db_xref="GeneID:12980536"
     mRNA            complement(<1522118..>1522561)
                     /locus_tag="LMJF_35_3810"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722727.1"
                     /db_xref="GeneID:12980536"
     CDS             complement(1522118..1522561)
                     /locus_tag="LMJF_35_3810"
                     /note="previous protein_id=AAZ14604.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722775.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980536"
                     /db_xref="UniProtKB/TrEMBL:E9AFK5"
                     /translation="MSQLWVKRAKAEMTRHSRVLETINRVFPMPFEERRSRVGMTSYA
                     TYRWLRYFPVILVPVVVMGTLLETRDNPQEHVFTSLHLWLADHGVFRHDTVKALNPAF
                     EDERRSIEWKANDRKWRFTGTDMPSEREIREFAAINIDHQSRRQL"
     gene            complement(<1523295..>1524257)
                     /locus_tag="LMJF_35_3820"
                     /db_xref="GeneID:12980537"
     mRNA            complement(<1523295..>1524257)
                     /locus_tag="LMJF_35_3820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722728.1"
                     /db_xref="GeneID:12980537"
     CDS             complement(1523295..1524257)
                     /locus_tag="LMJF_35_3820"
                     /note="previous protein_id=AAZ14605.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722776.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980537"
                     /db_xref="UniProtKB/TrEMBL:E9AFK6"
                     /translation="MAEPTTTAERQMAGIKSRERLRRDQERQLRQLPFLYHRVKDLQD
                     TCERLEQELASSHQRVAAFQQEAFALRSLIKFTEHPELAAAAKNDAAKHVLQEEVREL
                     RNQVQRLRREKELSLRQSEEACEAAEFYKELCDQLYEESLRAAEAIAVGGATSGLESV
                     VTPLPNRNVDDMTLAVSTAPSTATSMEAQMRQLHGALELERARSSALVETVSLLHTAM
                     KATTAAGTKRSTPAPDSSAGWAERRREDDTSGICASRSRVFADDTRKSRTRLKRLAAV
                     LRVENRLLTQRVTEVVARNMRCVKEISALKLANKRLELNQRQES"
     gene            complement(<1525539..>1526489)
                     /locus_tag="LMJF_35_3830"
                     /db_xref="GeneID:12980538"
     mRNA            complement(<1525539..>1526489)
                     /locus_tag="LMJF_35_3830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722729.1"
                     /db_xref="GeneID:12980538"
     CDS             complement(1525539..1526489)
                     /locus_tag="LMJF_35_3830"
                     /note="previous protein_id=AAZ14606.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722777.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980538"
                     /db_xref="UniProtKB/TrEMBL:E9AFK7"
                     /translation="MGGVRIARCNPKLLDFVTWAVMKGCRLFQRVHVTPLGLVATERI
                     PEFDFVAVVPVEATQSLLSIADDPSFALKVSAERHGEPVPFWEDLTRGSFAFLGFLTK
                     ALLTGHPRGVQTYLDVLPFDPAMPIGKMADAAQTTKGYKEWAAPLVAQCKVEESDFNA
                     AFRHAYCLFRRHAIPLWSTSDASGSGHPYFQQSPYARRGQGELMGMVPVMDLALHSPQ
                     PNAMIGYPDEEMLQWLSLHKKAAVQQEKGYFVMQAFRDIEEGEVISVNKNAYFNFDDD
                     AFEAWFGYPNVSQVPAEGSGELSSGCKPNGGEGAAVNCAL"
     gene            complement(<1527758..>1528522)
                     /locus_tag="LMJF_35_3840"
                     /db_xref="GeneID:12980539"
     mRNA            complement(<1527758..>1528522)
                     /locus_tag="LMJF_35_3840"
                     /product="putative proteasome beta 2 subunit"
                     /transcript_id="XM_003722730.1"
                     /db_xref="GeneID:12980539"
     CDS             complement(1527758..1528522)
                     /locus_tag="LMJF_35_3840"
                     /note="previous protein_id=AAZ14607.1"
                     /codon_start=1
                     /product="putative proteasome beta 2 subunit"
                     /protein_id="XP_003722778.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980539"
                     /db_xref="GOA:E9AFK8"
                     /db_xref="InterPro:IPR000243"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:E9AFK8"
                     /translation="MPGFNFENVQRNLNLENEGYSAPRTLKTGTTIVGVVYKDGVVLG
                     ADTRATEGSIVADKCCRKIHYMAPNIMCCGAGTSADTEAVTNMVSSHLALHRLETGKQ
                     SRVLEALTLLKRHLYRYQGHVSAALVLGGVDVEGPFLATIAPHGSTDRLPFVTMGSGS
                     IAAMAQLEAAYKDNMTCEEAKELVTSAIHKGIFNDPYSGTQVDVCVITKGKTELTIGY
                     HTPNKRMHPRQEVMLPPGTTPVLKEEIRHLVDIVDV"
     gene            complement(<1529682..>1530620)
                     /locus_tag="LMJF_35_3850"
                     /db_xref="GeneID:12980540"
     mRNA            complement(<1529682..>1530620)
                     /locus_tag="LMJF_35_3850"
                     /product="30S Ribosomal protein S17-like protein"
                     /transcript_id="XM_003722731.1"
                     /db_xref="GeneID:12980540"
     CDS             complement(1529682..1530620)
                     /locus_tag="LMJF_35_3850"
                     /note="previous protein_id=AAZ14608.1"
                     /codon_start=1
                     /product="30S Ribosomal protein S17-like protein"
                     /protein_id="XP_003722779.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980540"
                     /db_xref="GOA:E9AFK9"
                     /db_xref="InterPro:IPR000266"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:E9AFK9"
                     /translation="MFRQSLLRLPWWNFQTEHRQRCVMMYGGARTKNTHNANHRVYVR
                     KFKRNAFPNRTRHHWAVSMTGVQGQRPRRMPWPYDLTSMIFNQPRQGSDKIGYVVGTS
                     MLKTAVVAANHMVYYPKFNQRVSRTSRFFAHDEDLACVEGDLVHIKQSRKISKYKHYY
                     VFSILEPNIEGRERLKLGLKAVPPPLFGYPVSRRVVKLNLTNTEGTKEKLAAAIQEHV
                     QDAYRFAGPTPDQPRAKLTDSASFDEANKMIAPNSSVTAELPPGAEPAFLGDGQPVAE
                     EFSEVEEDSRHKKGDDYWMNLQPSDKYDFKNLKKSP"
     gene            complement(<1532610..>1534322)
                     /locus_tag="LMJF_35_3860"
                     /db_xref="GeneID:12980541"
     mRNA            complement(<1532610..>1534322)
                     /locus_tag="LMJF_35_3860"
                     /product="putative T-complex protein 1, eta subunit"
                     /transcript_id="XM_003722732.1"
                     /db_xref="GeneID:12980541"
     CDS             complement(1532610..1534322)
                     /locus_tag="LMJF_35_3860"
                     /note="previous protein_id=AAZ14609.1"
                     /codon_start=1
                     /product="putative T-complex protein 1, eta subunit"
                     /protein_id="XP_003722780.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980541"
                     /db_xref="GOA:E9AFL0"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012720"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:E9AFL0"
                     /translation="MIQPQLVLLREGTDTSQGKPQLISNINACISIVDTVKSTLGPCG
                     MDKLIHNGRDVQISNDGATIMNLLEIVHPAAKSLVDIARAQDNEVGDGTTSVVVLAGE
                     LLKESKQCVEDGIAPQVIVKAYRNSLSIAMKALDELCVPFKAEDNSNGENLIRCAETA
                     LNSKLINTERRFFAEMAVKAVMALNEDMNLDLIGIKKVAGGCMRDSMLVDGVAFKKTF
                     SYAGFEQQRKKFDNPKVLLLNVELELKAEKDNAEVRLKDPKQYQSIVDAEWKIIFDKL
                     DKCVATGANVVLSRLPIGDLATQYFADRDIFCAGRVANDDMTRMCMATGGVVQSTLNN
                     VPAEVLGTCGTFEERQVGTERFNFFTGCKTSKTSTVILRGGAQQFIEEADRSLHDAIC
                     IVKRAIKTGSVVGGGGAIEMELSRKLREYSRTIKGKEQMVVSGYARALEIIPRQLAEN
                     AGHDSTDTVNKLRQKHYATSEKDSQWYGVDIFNGGVCDTFANFVWEPTLVKRNALQSA
                     TEAACLILSIDETVTNPESDAAKKQAVGSGGRGGNMAMSKAGMGGMFAGAPGVTRMKG
                     GRGK"
     gene            complement(<1535487..>1536500)
                     /locus_tag="LMJF_35_3870"
                     /db_xref="GeneID:12980542"
     mRNA            complement(<1535487..>1536500)
                     /locus_tag="LMJF_35_3870"
                     /product="putative nucleoside diphosphate kinase"
                     /transcript_id="XM_003722733.1"
                     /db_xref="GeneID:12980542"
     CDS             complement(1535487..1536500)
                     /locus_tag="LMJF_35_3870"
                     /EC_number="2.7.4.6"
                     /note="previous protein_id=AAZ14610.1"
                     /codon_start=1
                     /product="putative nucleoside diphosphate kinase"
                     /protein_id="XP_003722781.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980542"
                     /db_xref="GOA:E9AFL1"
                     /db_xref="InterPro:IPR001564"
                     /db_xref="InterPro:IPR006602"
                     /db_xref="UniProtKB/TrEMBL:E9AFL1"
                     /translation="MVGEQRDTFVVEYFDPQASLSRTYQFCYFTDDKTIEMYNLKTKR
                     LFLKRCAYPSLSPNELYVGATINVFSRPLRIVDYGDDATRKRLTANSGECMITVDMQH
                     NSAAAGSVIEALTTQGLRITFIRLVELSKSLAARVASKAQRCLAVLVSGAGAREKVAS
                     VAASFSAAVTQISSESAVQELKEAVMGPGESTAALKNCAVCVIKPHAITSGHQGPILH
                     RLVEEGFYISALGSYQLTVADAEDFLEVYNGVLPEYKKLVEQMSSGPCWAVEVCAENA
                     VPALRAVCGPQDPEVCHVLFPHTLRSMYGVDRIRNAVHCTDLEEDGPLESEFFFSLLQ
                     NKR"
     gene            complement(<1537328..>1538662)
                     /locus_tag="LMJF_35_3880"
                     /db_xref="GeneID:12980543"
     mRNA            complement(<1537328..>1538662)
                     /locus_tag="LMJF_35_3880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722734.1"
                     /db_xref="GeneID:12980543"
     CDS             complement(1537328..1538662)
                     /locus_tag="LMJF_35_3880"
                     /note="previous protein_id=AAZ14611.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722782.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980543"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR007287"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:E9AFL2"
                     /translation="MVKIKTISRSELEWTKDRATEVPKVNRNYDPKFNPMAKQVEFTR
                     AVVAAKMDRMFAKPFVAALPGHQDTIQSIATDITSLSTVATGSVDGGLIVWDAMKRKQ
                     RAVINAHRHSVDGVAISPDGVACFSASRDKTVKMWDLDFDPDEERIEPVAEFLGEFPF
                     SSIDHHFHKSWFATSSDVVNIWDVNRTQPLQRFSWGDDTVSSCRFNKIETNLVACCMA
                     DRGVFLYDVRSQSAHSKIVMEMCSTSLSWNPMDPNVFVTGSDDRNCYLFDIRVPGRPR
                     NVFQGHIRPVTCVDFSPTGTMFAAGSQDASLRIWDLHQTSKSDSIEMFHTKRMAGVYA
                     VKWSPDNSYIYSGSEDAVLRVWKSDASKPIRPLRGPEKHKFNYMRSLKNKYSNFVEVK
                     RISNQRNAPKAILRTSRRIKKAEKREAVKEMSRIHGDNVKPLAKRKTYGYVE"
     gene            complement(<1539167..>1539586)
                     /locus_tag="LMJF_35_3890"
                     /db_xref="GeneID:12980544"
     mRNA            complement(<1539167..>1539586)
                     /locus_tag="LMJF_35_3890"
                     /product="calmodulin-like protein"
                     /transcript_id="XM_003722735.1"
                     /db_xref="GeneID:12980544"
     CDS             complement(1539167..1539586)
                     /locus_tag="LMJF_35_3890"
                     /note="previous protein_id=AAZ14612.1"
                     /codon_start=1
                     /product="calmodulin-like protein"
                     /protein_id="XP_003722783.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980544"
                     /db_xref="GOA:E9AFL3"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:E9AFL3"
                     /translation="MKEAFELLQRDGKIPKASVPTALRAAGLNPSEEKIKEIMVTASD
                     VDMAGYEALVEKHDDKMDTAEAVKEAFRVFDKDLDGTVSVAEFRHIMTTMGEKYHEEE
                     FRDLIHGFEDNGVIHYEKFVDKMLAPFTEHGSAEDAH"
     gene            complement(<1540120..>1541145)
                     /locus_tag="LMJF_35_3900"
                     /db_xref="GeneID:12980545"
     mRNA            complement(<1540120..>1541145)
                     /locus_tag="LMJF_35_3900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722736.1"
                     /db_xref="GeneID:12980545"
     CDS             complement(1540120..1541145)
                     /locus_tag="LMJF_35_3900"
                     /note="previous protein_id=AAZ14613.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722784.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980545"
                     /db_xref="UniProtKB/TrEMBL:E9AFL4"
                     /translation="MQQKNLVRAMQKERYKMEKGFVAYTKDLIEFFRSTRASKNEKGS
                     QTSEPAKQENTSRALEQFYESEELIKRMKWKRVTWDEEADYTSFSKRILDNDSMFKRT
                     TAFSFLSIHVVKDPCNTDLVTIPLAQKTIATGTLTNWLLQEREPKTVDLYPVRGASER
                     RSAFHVDWTSGAVKILDTASAQEILTFLSTVAPRLQAVQLMMEAQQTRQTADIEKVRV
                     RVGATLKFNSYETSFWDDPKRKTSPDFVNPDELEQFLSGMLKSAFLYRWFLKGQEIRV
                     IPPGRPYYLDMEKKEVQIPANFAEYNWLKAHSHFEGVERIADSFRRFWWFWFCFGMIL
                     VGDVELV"
     gene            complement(<1541842..>1542420)
                     /gene="PFP1"
                     /locus_tag="LMJF_35_3910"
                     /db_xref="GeneID:12980546"
     mRNA            complement(<1541842..>1542420)
                     /gene="PFP1"
                     /locus_tag="LMJF_35_3910"
                     /product="putative PFPI/DJ-1-like protein"
                     /transcript_id="XM_003722737.1"
                     /db_xref="GeneID:12980546"
     CDS             complement(1541842..1542420)
                     /gene="PFP1"
                     /locus_tag="LMJF_35_3910"
                     /note="previous protein_id=AAZ14614.1"
                     /codon_start=1
                     /product="putative PFPI/DJ-1-like protein"
                     /protein_id="XP_003722785.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980546"
                     /db_xref="InterPro:IPR002818"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:E9AFL5"
                     /translation="MLDPCADSAQLLYPCVLFSKQRFCLSKKRNDKKVLMPVGDCMEG
                     YEVIVPFQALESLGVIVDVICSGTKKGNAITTAIQDFTGCQIYVEMRGHSFIIRKTFD
                     EVDVVECQGLYITGGRVPQYIRLKQKVLEFTRRFFNHNLPVAALCHGIRVLVAAGVTE
                     SRTLTCYPALSPGVRVAGGKYKEVLPTETVND"
     gene            <1543928..>1546342
                     /locus_tag="LMJF_35_3920"
                     /db_xref="GeneID:12980788"
     mRNA            <1543928..>1546342
                     /locus_tag="LMJF_35_3920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722738.1"
                     /db_xref="GeneID:12980788"
     CDS             1543928..1546342
                     /locus_tag="LMJF_35_3920"
                     /note="previous protein_id=AAZ14615.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722786.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980788"
                     /db_xref="UniProtKB/TrEMBL:E9AFL6"
                     /translation="MMDFRDVAAEEQIRSFVEYFDRVNYPLQPLSTETKAFFGRFFGG
                     NGFVTFCDLLLGSYCERYLAEDEEMCWMDYANLEPTKSFAVTLLSLIHPSSTFISTLE
                     ALSTPSATFGARLKKGWKNSTAARSSSFYSLDLPLVALHPQFFKLMGEPADLNLYALP
                     RSRCHPILLVPFWDPPVVTRRESSQQQVMTSLPCLPMGYFLFRLLLFGMKRVQRNSAD
                     FLAWRKKGNIAAWMWRAKDELYSAFYKRIPVDMPFYAQLLQSYIQIYVSATLSRHLCS
                     KRSIADIIWTTNDATASVLILAPELLAHRELLQPVSENDRVSCKNPETLAQILFVVPL
                     YTRMVYAMSEESTSSPFMDCAAITSSDYSVGFLSKAQADIENIRKTLYRNCLTVLREC
                     FLSLELEPYCKNSHFTYCLELWAVLMNPFEKQQKMAPPQYVAQHFESFGFLAVDVLNM
                     IVKSSFVYSMTEAGAKVLKKCFLLLSQDPVVTLLVEINASQPSSHTVAEMLARHFVLD
                     WIGSDGGIQLPNLHGSTTCSLAARAYVSLERLINDDTTEVMRGELKETLSLMECVFPR
                     ITQFLDTWRASEKATPKNSKSASVPTMTVARPLTESEKLHFFRGGKGNPKIFAKGLRL
                     PIRNGRVPGNRDAVLKTSLRNEIPALLGFSRFLDSLIAKILEEYYSSVIPKCDHGHNL
                     YLTYSKNYACTHHAREPAIWECSICEKVYGSCCRGLPCRANGERLVTCNGASSAAQQC
                     IVCGQVVWEDSLMFCLQHGTGAYFCPDCASRPFSHLSMRWIASYRTWAVVVGLFFLSI
                     FISFLA"
     gene            <1547275..>1548705
                     /locus_tag="LMJF_35_3925"
                     /db_xref="GeneID:12980547"
     mRNA            <1547275..>1548705
                     /locus_tag="LMJF_35_3925"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722739.1"
                     /db_xref="GeneID:12980547"
     CDS             1547275..1548705
                     /locus_tag="LMJF_35_3925"
                     /note="previous protein_id=AAZ14616.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722787.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3925"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3925"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980547"
                     /db_xref="InterPro:IPR010736"
                     /db_xref="UniProtKB/TrEMBL:E9AFL7"
                     /translation="MEELPLLRAKEKQVRETTGPSVGPGSYDLNKRAVANFSCAPFNS
                     TSLRQNLLSADREFPGPGAYNVLAAPSSQAFGFGSQPFVSESSRFVAANCNDTPGPGS
                     YDVTNYGSTRKNPRSYTFSGPYESALDSGLAGSIGPGSYNPNYAAADRRFPKAAEFAK
                     YSGRKPMRLPAAPGPGSYDPLLEPRSLAAMKPSSVFVTKTNRSLCGVNGLRDSPGPGT
                     YEIGMGSERGGTIPREYFSAFGSSSSRFFHGKEGDAPGPGAYTGEIAPRRFRPIARSS
                     SAAFVSAYQRFPGLMAAPTPGPGAYDARRPRRHQDFGEPMPFGSTVPRFSPVWSQRPQ
                     SEPLIFSGDPYNGRAPSKRRARPFIPGKIQPSSAPPPLQDRSYDVRYDWPKPASTVNT
                     TFGASERPPLHCTNAVPGPGSYGELGDTAPASRRYGNSNWGRDVRFTEVAPFSGAPDP
                     GKYYHASTFLKKTFNSTIGSDTVWIE"
     gene            <1549734..>1550504
                     /locus_tag="LMJF_35_3930"
                     /db_xref="GeneID:12980548"
     mRNA            <1549734..>1550504
                     /locus_tag="LMJF_35_3930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722740.1"
                     /db_xref="GeneID:12980548"
     CDS             1549734..1550504
                     /locus_tag="LMJF_35_3930"
                     /note="previous protein_id=AAZ14617.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722788.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980548"
                     /db_xref="InterPro:IPR007881"
                     /db_xref="UniProtKB/TrEMBL:E9AFL8"
                     /translation="MLSQCTFVMSRWTSRLPPFARRAVQVDQMEIDSALSQMYSLCLN
                     PSLVSKMSRARKMTKGHYYRDDPAFLMLQLVFVVVVSVAQWLLLGMKRSLLGTVFAAI
                     TWYVLSGLGMASVWRAVAVIYLSPSSKSTQSGVLTEAASALGVDSAVDYLHPDLDWRY
                     AFDVHCNGYFTFFMWTEVTAYFLAPLMSVSWVSNALVAIGATTYLYSVFLGYLEIPSL
                     SCQQRLLYPVLIIGVLFLLLSLSDVNVGLTLWLLQCAE"
     gene            <1551567..>1553381
                     /locus_tag="LMJF_35_3940"
                     /db_xref="GeneID:12980549"
     mRNA            <1551567..>1553381
                     /locus_tag="LMJF_35_3940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722741.1"
                     /db_xref="GeneID:12980549"
     CDS             1551567..1553381
                     /locus_tag="LMJF_35_3940"
                     /note="previous protein_id=AAZ14618.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722789.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980549"
                     /db_xref="InterPro:IPR022006"
                     /db_xref="UniProtKB/TrEMBL:E9AFL9"
                     /translation="MLRRSALARRYPFTKRGPRERKSWKHHVLTEPPKPVEWRDPKVW
                     TKDLSQMKSFDAPQWDLWLNRSRSQDMDEALQPFMDMPQSLKDRRYDIPWWANPFGAW
                     YLQNVLSVELMKLPGRTNAEKIAIYRGRKRPATWDKSKEGLMDDEVLLKQIVKERWRT
                     LEFGDRDAGYPCTFSDYIQFLNEWFKSLDEEGLQRLREHFDRKIRPLLAVMTHVDLMW
                     LEALTQNSVQNKEQLERRIGFQTSLGTPEFFDMSKRLRYEINEDYKVRDELGPELFAL
                     WSKAPERWPPERLAKMYGLDFTLVRKILVWHHFKACYDACVEPDWTLPKRLFALEWIR
                     DVRARKQGLFYGKLRFAEQKITFYSDKFLFRDLVNRREASYANVWEMDDPYRFLQTEQ
                     DYEDYWGDNYDVYRRMFPEMIGKSGEPVQQYSQMPVWAGPHRDHANKSEHNWMFAEIG
                     VNVGHEPLKKLELDPTNEKRRRFVIRQPDGSLRSAKMSEMRAWYWKEEWADFRFWAPH
                     MEWGVENTPSMEQYQEHVPDTPDADYRKQRRIQSRPVKWFYESHYSRSGSFAGFQPLR
                     FMQRRTQREVRWPDVINAAVQIEKSKPSSYVFKAIPEI"
     gene            <1554920..>1562203
                     /locus_tag="LMJF_35_3950"
                     /db_xref="GeneID:12980550"
     mRNA            <1554920..>1562203
                     /locus_tag="LMJF_35_3950"
                     /product="U5 snRNA-associated splicing factor"
                     /transcript_id="XM_003722742.1"
                     /db_xref="GeneID:12980550"
     CDS             1554920..1562203
                     /locus_tag="LMJF_35_3950"
                     /note="previous protein_id=AAZ14619.1"
                     /codon_start=1
                     /product="U5 snRNA-associated splicing factor"
                     /protein_id="XP_003722790.1"
                     /db_xref="GeneID:12980550"
                     /db_xref="GOA:E9AFM0"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR012591"
                     /db_xref="InterPro:IPR012592"
                     /db_xref="InterPro:IPR012984"
                     /db_xref="InterPro:IPR019580"
                     /db_xref="InterPro:IPR019581"
                     /db_xref="InterPro:IPR019582"
                     /db_xref="InterPro:IPR021983"
                     /db_xref="InterPro:IPR027652"
                     /db_xref="UniProtKB/TrEMBL:E9AFM0"
                     /translation="MSVSVPPGFEDDDDLVAVDPALLAEMEEEEQKESRKQQILTWQR
                     MNTERYGFRAAYRAAVGEKDLMPPEFIRKVVKDNGDLGGKRFKSERKLCVGMLPYIPL
                     ALFKLLENMPMPWEEARYVTVVYHVGGVLTIVDDTPTVAEPLYVSQWGSMWTKMRANK
                     VELLQEGGGFRRAVHKGDENEPPLDFADYFMDRVPPPPVLDDLDEEDNAGIVGWFYDP
                     FPRLVAPNQIRGPRRPNGYYFTLDVMEALYRNASPILPTLDDRNYFYLWDLKSFYAAK
                     AMHLSIPRGPKFEAPPAIRVKQDEDDDWTEFNDLRRIIHRDNPRKPRFTMLTERQIAF
                     PFLYGSVVDGVELAPYHYPATVRVENNDPELPCFTFHPSLNAIKAVEKNYTDVSRAQA
                     ALCSSTWHRAGGQHLETAADVPLELPDDFEPFLSSLPLEQPNTKTGLSLLFAPAPYNS
                     FEGGMKRRIDVPLCGKWYQDPPDLLTTDDRDKILRSYTQLLKHHVKRSLQHAVRQRRS
                     AAAAATEAEGAGTMDMSAMQEKRRLEKMAGMRYFSKTRMEWLEAALQVMRQGHNMLVQ
                     LINMKCLPYVHIDYNFEAKPTRTLTTKEIKKSRLGPAFHMIRELLGFMKRLIDMHVMY
                     RLGSTDALQLADATQYLFSHVGVLTGVYRYKLRAMRQIKRSRDLKHMLYSKFNVGGVP
                     SGPGNGFWGPAWRVWVFFMRGMTPLLQRYLSNLTDRVLHGRLQKGKMSGKKITRQRVE
                     PDKDVNIKEAFRRELREMLPDNVKASVIVTMDQHMNEAFRHWRAGLPWSVPGLAKPLT
                     DLVGKYVKLRSEEYIRTTQLQRRRIAEGDTVDKQAFMKNLGRLTRLKLMDEQRRQRRY
                     VTGEDAAAIMAPAEATEIYRMMANWLNDRGFKKISFPDPSKTAELSLLQLSLNRLRDQ
                     HNIANRLTANQREEQARIEESFNAPHEALSGIVDALAHQRRFKNVEVEYMDNFSHLYP
                     LYTVVPQEKLIDSFLDQYLWYKAMNVQRLFPNWVKPSDVEPLPQLVYKWCEGINNIPD
                     IWDVSHDESVVLLHSNLEDAFYDNVDWNFFRPMLELIMDKSLVDYIVSRHDVVVEFKD
                     MSYHHYKGLIRGFMFSSFLAQYWGLVMDVLLLGTQRSKEIAGTALKPNPFMSFFRDPY
                     LAASHPIRAYCRYKNEVYIVVRYTKTEADEVRRRYLEETKSDPEMRAINASVYGFKNA
                     KEWPRDARMRLFLSDVNLARAVLWEFRSRLPPSMATINDANSFVSVYSKDNPNLLFEM
                     AGFSVRLLPVVRTEADILESESMWSLRNHTTKDISCRAFLQVTKEHINMIRNKARRTV
                     MMVGSSTFHSIAAKWNALITEIVPYYREAILGTEELQATLARAEHRMQARVMMALNSR
                     AKSRFPPAMFYAPSDLGGLGMLSVGHSLIPAKDTIYSKTTSTGVQFFYAGLTNEEGIP
                     IPNVLQYYTPWETEIRESEKAWLEFRTREREAKARGSRVSLDDIEDIIDKGIPRIRVR
                     FSRHAPLFHFDTGFRARMEFQRYLAGKYLKNWWFHMEHDGNICGGVMERYRADMNNAL
                     GGVEAILEHSLFKGTGFPSWEGIEFDRSGGFENSKKDTKLAKQQRAGLSKVPNQRFAL
                     WWSPTINRSDIQAGFESKVETTGVFMCGKLETIKKSLIKIFSGSLWEKSHGAVVNDVA
                     SKLKDSLMDLGAASITLQQQHPQKSYTFTSSAADVILVSAARWSVTSKPTSLADLVGD
                     VYQHSTTSKFWIDVQLRWGNYDSHNIAEYARKKFYEYSTARMYPFPAGIVVAIDLAYN
                     CHSAFGYWIPGMKPFMSKLMPVIMKNNITLNTLRDRMKRDLGLFSSAPTEASLSDTNI
                     AELFSSGMRTWIVDDSATYVTSEQPTPDGGKKFKSENGAVLVFEPVSGSLKMSVVHRS
                     VFSGQKRRSKLAREKAAEEIASWLRSCPPSERPSKIIVTRSRFRQTLHNMLVLDYPNI
                     IIGQSDLNLPLPMVLRHSRLVELRIAAMESKGWEFCIYDDWQQSLQFQPITCFNLLNL
                     VLRGYHINLQRTRQILVPDLHVEVSASHFWPTYATRQEWEQVSIRLQEMIIADAARRM
                     NVSPKDFTEKEKEGILLGKRMTNVEIQQEEMKEIEAMQRTKLAETQTVNVVTSSGDVV
                     KRKVKAAFDFGATALNNNWRPRSLADAAFLDENTPITFDAAGATGASDQLIFSEDAIQ
                     KLLACCDVKVQCCAYMLGHALPDSPNIKEVLCVMIPPQFGTAVEARTPPRIPFDAAAL
                     QEANLSFLGLMRIGESEAQLTSHDLALQARALIANEGMVPQGFVTAVLEMSEEGVMAR
                     CYSTTADGIAWAQSEYERLLKRTPEATDPSFSTPCRGALSSEARCFFLVPADRVWNYF
                     FKGALWRENTEYDVVVDVPLPFFHALHRPDHFLNFTRIGDGAEVVDEADPNDVFGNEA
                     GLAGD"
     gene            <1563887..>1564909
                     /locus_tag="LMJF_35_3960"
                     /db_xref="GeneID:12980551"
     mRNA            <1563887..>1564909
                     /locus_tag="LMJF_35_3960"
                     /product="protein kinase A catalytic subunit isoform 2"
                     /transcript_id="XM_003722743.1"
                     /db_xref="GeneID:12980551"
     CDS             1563887..1564909
                     /locus_tag="LMJF_35_3960"
                     /note="previous protein_id=AAZ14620.1"
                     /codon_start=1
                     /product="protein kinase A catalytic subunit isoform 2"
                     /protein_id="XP_003722791.1"
                     /db_xref="GeneID:12980551"
                     /db_xref="GOA:E9AFM1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9AFM1"
                     /translation="MFPSTWYSALKPKVACNFAKPDTSSWKLSDFELKNTLGTGSFGR
                     VRIAHRKGTEEYYAIKCLRKREIIKMKQQQHVAQEKGILMELCHPFIVNMMCSFQDEK
                     KVYFLLEFVMGGEMFTHLRTAGRFPNDVAKFYHAELVLAFEYLHSLDVIYRDLKPENL
                     LLDNKGHVKMTDFGFAKKVPDRTFTLCGTPEYLAPEVIQSKGHGKAVDWWTMGVLLYE
                     FIAGYPPFYDDTPFRIYEKILAGRLKFPNWFDGRARDLVKGLLQTDHTKRLGTLKGGP
                     ADVKNHPYFHGANWDKLYARYYPAPIPVRVKSPGDTSNFEKYPDSPVDRTPALTSAQQ
                     AELKGF"
     gene            <1569040..>1571154
                     /locus_tag="LMJF_35_3970"
                     /db_xref="GeneID:12980552"
     mRNA            <1569040..>1571154
                     /locus_tag="LMJF_35_3970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722744.1"
                     /db_xref="GeneID:12980552"
     CDS             1569040..1571154
                     /locus_tag="LMJF_35_3970"
                     /note="previous protein_id=AAZ14621.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722792.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980552"
                     /db_xref="GOA:E9AFM2"
                     /db_xref="InterPro:IPR004181"
                     /db_xref="UniProtKB/TrEMBL:E9AFM2"
                     /translation="MTESDWRRLHSRVIPNRVSLPEFKSIVSDGTVHDHYLAKDLHKI
                     MQELRDLLYEHGELREASVLPLNGKKQELSRAAATAVRLIDRSGDGIPALRRPSDISL
                     GATGALGDRQGSTSPTLGSASDPRLSDGGKRSAADALSLQPPQATASTLSISPRRSSR
                     VLPLTDHIQEEGQSIASAHSLNTAPQPTVLPPSSTRASSASSPPSTRAREEAAPRDGS
                     TCPTHASASTASSGLSTRFRTSRTANARVSSTVAHNAATSYAVVGAPSTSASPVAPPS
                     LLTVPLSTSSSNEIAQLNESAPPFFRILSVPRRFQLRFGSSMLRFEIPVQYVDGVNSR
                     QLRIYMIPLRHPNTPARWPTAKEIVVYVNKQCVMTPWKRSWPDREREVAETYLPLDIT
                     YLLSRNTDAQHVQVDIHNKEYQTPAILAVAQLRPLEEVTEWMLSSRLGCRNAVQARQM
                     LLSSSSSANALASTSSSLLLSNNAAIQRTYAAIMADDEDDDGLEVDDPVITTKCPISQ
                     LPLSVPVRGSRCTHLQCVDLNAFLVSSNKASYWNCALCDAEMRPCDVRVDTILWSYLC
                     TFSSVDAYPLYLRLSARASPKEGETKYHWHPSTRTGEDADVVLDDSESDGENERTRDS
                     PSVSGPAAASVSASSMEATAPCSEATSVSAPNGARLPAPPAVSHRGEAWAEGLGHSRK
                     RGRDNDTPTEEPRGTADDPIEL"
     gene            <1578666..>1581056
                     /locus_tag="LMJF_35_3980"
                     /db_xref="GeneID:12980553"
     mRNA            <1578666..>1581056
                     /locus_tag="LMJF_35_3980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722745.1"
                     /db_xref="GeneID:12980553"
     CDS             1578666..1581056
                     /locus_tag="LMJF_35_3980"
                     /note="previous protein_id=AAZ14622.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722793.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980553"
                     /db_xref="GOA:E9AFM3"
                     /db_xref="UniProtKB/TrEMBL:E9AFM3"
                     /translation="MPSVRTMYTREELLRIATLASAMDLGPEVLRKFDVIEVAEPVPT
                     PKRRDAESNFKGSVFTDNFSTSTTITNLGPNGGGNSGGKGGHNSGMNGGGSSSNHPGS
                     SSTPVYGSGGGRGGDNRRGGGGGGGNGGRDDSSNSNSVRQSGYDRFAPPEGRFNRGNR
                     NQETFEEGIEYELRQSALQKKRVAETMEREDRKGENLRQALEKFKQEGNDAEAAEAEK
                     ETDEIERLLAGITIVDDAPKAVVRSRFFSAQGPTATSAEHPATTQPSPPPPQASTTLS
                     FGAPASSIAPATTGTPQASVLPTPANSGTQGYARGPWSSMKSDSNLWSTAPSMASALK
                     QSLQHSLPPADASPSVPIKPPQPASQQSQPSSCPASTSHQATSMGAAAANASANSTGA
                     PSASGPASFGVPAPAPASPPAPPQSSVLGPANGHSSTNIATAMGAKTGVSSSAAQPQA
                     PPHTPPQTPHHSQSQPSRPAPATAIKAAPRSSGSTGVPTGAWSAADLELLLKKGATMI
                     SSAPAPPPSTAASATAAPKTQPITAAELESMLMQRARQGRGVTGNGMSTVPPSPPQFQ
                     QPPPPRQAPLLFANPSKTPPMPANSNPTSAPLSSPQQLPASMKMAPNGAMLQPKQPHQ
                     QQQPLPPPPPPMPSQMPAHSQPQSQPQPQPQIQPQIQPQQHQTPWMAMPRPPQAPPAP
                     QPNSNGSPMHNTPPLQPLAAKMPQPAPMMQNGLQMPMQMNAQGQYFVDPAQLQRVYMT
                     GQPMMFRRPDGTVFMQAHPMPQPQPQQAPPQQQPPFNPFGTNAQFLFQQQQQQQRR"
     gene            <1589615..>1590325
                     /locus_tag="LMJF_35_3990"
                     /db_xref="GeneID:12980554"
     mRNA            <1589615..>1590325
                     /locus_tag="LMJF_35_3990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722746.1"
                     /db_xref="GeneID:12980554"
     CDS             1589615..1590325
                     /locus_tag="LMJF_35_3990"
                     /note="previous protein_id=AAZ14623.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722794.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.3990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.3990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980554"
                     /db_xref="GOA:E9AFM4"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:E9AFM4"
                     /translation="MNATLQPLRAAAAATPSSVRFFVCGLAAETVSCVVWVPIDVAKE
                     RLQSQPPSLKGRYTSSLDALQRILVNEGARGLYKGYASTLSSFGPFSAVYFVFYEYFT
                     NMLAGLYTAASAAPTQGDRNGGSGKERFSLATFAVALGAGAGGNTVASLLTNPLELVK
                     TRIQVQRAVLHRRDGGASTPALFSYHYRGLREGLAALAKEKGIWALWKGVGSRIAYTA
                     PNAALTMGFFEFLKTTLM"
     gene            <1592754..>1596785
                     /locus_tag="LMJF_35_4000"
                     /db_xref="GeneID:12980555"
     mRNA            <1592754..>1596785
                     /locus_tag="LMJF_35_4000"
                     /product="putative protein kinase"
                     /transcript_id="XM_003722747.1"
                     /db_xref="GeneID:12980555"
     CDS             1592754..1596785
                     /locus_tag="LMJF_35_4000"
                     /note="previous protein_id=AAZ14624.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_003722795.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980555"
                     /db_xref="GOA:E9AFM5"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:E9AFM5"
                     /translation="MPDAQSASPGSVYSGGVPPMVWIQREQQRIPLQFSATGSPNLDG
                     TRLREEGNEAFKAGRYHEAIRYYTQAIEVDPDSEFLYTNRSFAYFNIKEFEKSAADAA
                     KAVEINANFFKGHYRLGLAQMSLNDFGHAMESLRKAWALAPSENKEAIRVAMAKCESK
                     MARAPVTPLLMSPGDSSSVPYTETGVSSRSSWPTAPVRPTDAQPALGSTSVDFCELQA
                     EIRHAATLRDQAAQYADTYRAQDAIVECSKRSDKIKSLMSIATSSELSALSKEADEKQ
                     SQLRRAVRDQDSNAYHKARCDRDATLSKLWDTAAQAGMAIAQLKKIAKEEQNFFSRFG
                     PASNRALSNVPTEGTSDTLTAVAAPVVAESPPASAPVPPNEAPADAGAPGTSLSRASC
                     ISPGSSTPTAEAVAPHQPLTTQRAGEHHFTQSSTTAGAELDQLLRRRVEINEAVRKAQ
                     KCFAATDAAGQAFLHSLKAEAEAMKEVRSLLAEAVELDTQLETHARQVAQSTTKELSD
                     VRLQALDQMSSIVERVKADKEAFVKTMREGDGLLEEEAKLEQQRLLHERQRIQLQAEI
                     EWFKIRDEPENKIECLQVQVKRLHQRIAAIHEKQKAVQTRIMELVEQDHPELAWKSMA
                     NGSRILRLVKGSGLWQNLSFSDFQVLSTLSSTVNSKVYHALRRGEHVAVKEISIDDDA
                     ARRRFQREVNIVSTCNHPNIIRIKGVFFDGPFAYILLPYYHRGSLRALLSKQEPMSWV
                     AVQDMLRQLASGVAYLHEHGIVHGDLKPSNVLIADDGRPVISDFGIAKDHGALGVADM
                     TLTNTVTNTSNGYNSIVGTIQYMAPEQLLCETGSHTAKSTGMSDMWALGFTMLEVALE
                     NAFFHDASLGKPSLPLLLPEQKRIDVPAKAVGGDEKLAETIASVLVADPANRATAYDL
                     LAHPYFSSTLSSMNSNQNSSALAKSDERIDAVRSYIYAVRRSHQQKVLVSVSRNHMVE
                     SVRDIFQRLDNDDLLSPIMVVFQGEAGIDEGALTTEMLNLFYEQLILVKKALVCAASE
                     EAGAASPHPAGSLVSSSTAAASASAPNEPGIHSVLFSTVPYLPAPDADGIAPDLFVLL
                     GKVLLKSIIENRQIPLQLSSSVLKFLSGAEPSFVDLEEYDPSIASTLKRLRLLSAADL
                     EDAGLDFSYFTHEFLKAQADGRYTTDSPLTPESVSDYISLREKFDLVERRRTALEAMR
                     KGFYCEPSLDHHLKLLSPSDLLLLLCGQLHVSAQVIVDALEFQGFGRNSNTPKYLKEV
                     LLDMSQNNLRRFLQLCTATAAVPVSGAMKKIKVLRCADEGRLPVGHGCTNQLDLPDYN
                     DKQIIKEKLEIALAHASDGFHVV"
     gene            <1598490..>1599605
                     /locus_tag="LMJF_35_4010"
                     /db_xref="GeneID:12980556"
     mRNA            <1598490..>1599605
                     /locus_tag="LMJF_35_4010"
                     /product="protein kinase A catalytic subunit isoform 1"
                     /transcript_id="XM_003722748.1"
                     /db_xref="GeneID:12980556"
     CDS             1598490..1599605
                     /locus_tag="LMJF_35_4010"
                     /note="previous protein_id=AAZ14625.1"
                     /codon_start=1
                     /product="protein kinase A catalytic subunit isoform 1"
                     /protein_id="XP_003722796.1"
                     /db_xref="GeneID:12980556"
                     /db_xref="GOA:Q9GNR4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q9GNR4"
                     /translation="MSSAAKDSYPAESSGHLNNEKAQLSKIPSSHPDPSKVTVAPNVK
                     AAYYFAKPDTSSWKLSDFELKNTLGTGSFGRVRIAHRKGTEEYYAIKCLRKREIIKMK
                     QQQHVAQEKGILMELCHPFIVNMMCSFQDEKKVYFLLEFVMGGEMFTHLRTAGRFPND
                     VAKFYHAELVLAFEYLHSLDVIYRDLKPENLLLDNKGHVKMTDFGFAKKVPDRTFTLC
                     GTPEYLAPEVIQSKGHGKAVDWWTMGVLLYEFIAGYPPFYDDTPFRIYEKILAGRLKF
                     PNWFDGRARDLVKGLLQTDHTKRLGTLKGGPADVKNHPYFHGANWDKLYARYYPAPIP
                     VRVKSPGDTSNFEKYPDSPVDRTPALTSAQQAEFNGF"
     gene            <1605602..>1606786
                     /locus_tag="LMJF_35_4020"
                     /db_xref="GeneID:12980557"
     mRNA            <1605602..>1606786
                     /locus_tag="LMJF_35_4020"
                     /product="serine peptidase"
                     /transcript_id="XM_003722749.1"
                     /db_xref="GeneID:12980557"
     CDS             1605602..1606786
                     /locus_tag="LMJF_35_4020"
                     /note="previous protein_id=AAZ14626.1"
                     /codon_start=1
                     /product="serine peptidase"
                     /protein_id="XP_003722797.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980557"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="InterPro:IPR029059"
                     /db_xref="UniProtKB/TrEMBL:E9AFM7"
                     /translation="MSFGSFLLSAGLYLVLVAVFVSLFLHIMSYRYRSQQNQLLYYPH
                     IPPESREVCEDPVALGIPYAERVCVTTADKVRLWGYMLWPAPAPSAEKSGNASVPDSI
                     GRASSNVATAEGGMHVEVDAPGSATDSTSASNMVSGSSRSVTMSSGMPSFVMLYFHGN
                     AGNVGHRLPLAQAFVTHLKCAVMMVDYRGFGLSDDSEQTQETLELDAQACFDYLWQDP
                     RVPRDRIIVMGTSLGGAVSIHLAANERYGRRIAAVIVENSFSSISDMASALSRPILTK
                     LASRCPDLAVGIFEYYVKPLALRISWNSAQKITKVVVPMLFLSGMRDEIVPPEQMRTL
                     YKAATKCLRDGNGGELTIPLRRFLEFEDGRHNNLPLMPGYMSALQDFVTDVRNAGAAA
                     VV"
     gene            <1609076..>1611148
                     /locus_tag="LMJF_35_4030"
                     /db_xref="GeneID:12980558"
     mRNA            <1609076..>1611148
                     /locus_tag="LMJF_35_4030"
                     /product="putative ATP-dependent RNA helicase"
                     /transcript_id="XM_003722750.1"
                     /db_xref="GeneID:12980558"
     CDS             1609076..1611148
                     /locus_tag="LMJF_35_4030"
                     /note="previous protein_id=AAZ14627.1"
                     /codon_start=1
                     /product="putative ATP-dependent RNA helicase"
                     /protein_id="XP_003722798.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980558"
                     /db_xref="GOA:E9AFM8"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR025313"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9AFM8"
                     /translation="MKGAKLSEPTLSFLRDNMKFTTMAPVQARTIPLFLTNYDVVVEA
                     ITGSGKTLAYLIPCLEMLLRPRCREVAKEYKNAVFAVLVLPSRELAQQVFQIVKRMLH
                     FVTKGYKNGSPANGLPAYSYQCYIGGRDIKHDVEEFSKQGGNVLVGTPGRLYELLVSS
                     KYANLFHLSQFELLILDEADKLLEFGFRAKLDALLKRLPRQRRTGLFSATQTKELAEL
                     ARAGMRNPVSVTVRINPLNAPDSDTAKPQIPEQLSNFFAFTRASEKLDRLVEFLASHR
                     GEKVLVYVMTCASVEWLYEALSAVLLKDEADSVFALHGQMKLEKRQQVHRQVTRRSRC
                     VLVCTDVAARGLDIPEVGVVVQYDPPVDPNTFIHRIGRTARMGRSGKSVVFLMPQELE
                     YINFMRLQNVPLQSLDGEQDSVDVAKDAVRNMNARRTLLSSELPDKRKAIHQAHREKQ
                     LSRRERRQQLHEAHQAMVEGKSQRLAKRKEVLGDMCTSPSILALRREGCRNAKLLSLA
                     ARAFVSFLRAYKEHECRYIFQLQLIDLTDLTHGFALFKIPNCGEIKRMRVLRIPLQDE
                     FAPFVRQMVTELREKRQRAAEEQSAMAALDGGSDDGPGAKRHRTERNEKLETLKLLKM
                     SKSERSRAWKQAELDELLKDSYYVKMERRGKVNRHVVDEKMGVEAIENSFMSARERKE
                     AQLARKAR"
     gene            <1612357..>1613523
                     /locus_tag="LMJF_35_4040"
                     /db_xref="GeneID:12980559"
     mRNA            <1612357..>1613523
                     /locus_tag="LMJF_35_4040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722751.1"
                     /db_xref="GeneID:12980559"
     CDS             1612357..1613523
                     /locus_tag="LMJF_35_4040"
                     /note="previous protein_id=AAZ14628.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722799.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980559"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:E9AFM9"
                     /translation="MLKDYYAILDVLPRASGEEIRRAFKRLALQFHPDKTGGGAATEV
                     TSTVDADKHRVATKRDEHASANAGVAHSNAAGASCHPLSRDFTDIQEAYEVLGDVARR
                     YLYDMNYQELLAAQQQRQQEEQKRCVAHARAVAEAARQARERERLQQQQQQSPQPRNI
                     NTFPTLESSIAAGGFGTHAPGPSPPQHAAHPSLGRLAEETGIASPTLSPDDAPQRRRP
                     FQNLAPAEKEKDGDCSLRDLECDSSGGGGLSQARCCFTAPTRPREVGSRPRECRAKRQ
                     ECERDTNERLTSSQTQRRLSCADTKRARQHMAAAAPAIFVLSSSVPFSWGKTAAQTCP
                     SVVEPCGSRGRRWHRHTAPRNGGETEEPELPMEYYYQRSIERTLRVFFSVPHAE"
     gene            <1614650..>1614997
                     /locus_tag="LMJF_35_4045"
                     /db_xref="GeneID:12980560"
     mRNA            <1614650..>1614997
                     /locus_tag="LMJF_35_4045"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722752.1"
                     /db_xref="GeneID:12980560"
     CDS             1614650..1614997
                     /locus_tag="LMJF_35_4045"
                     /note="previous protein_id=AAZ14629.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722800.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4045"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4045"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980560"
                     /db_xref="UniProtKB/TrEMBL:E9AFN0"
                     /translation="MTTPAPSTAAAGFKERTEADMALRFLNHCLSNAVQVHYLVTSSL
                     QGGDWQTSTLLGAETQAYMRALLAVYATSSAYRRQLASGDSLYYLQCLTDETTRADFV
                     RVAAAPSFPFASS"
     gene            <1616510..>1620379
                     /locus_tag="LMJF_35_4050"
                     /db_xref="GeneID:12980561"
     mRNA            <1616510..>1620379
                     /locus_tag="LMJF_35_4050"
                     /product="putative protein kinase"
                     /transcript_id="XM_003722753.1"
                     /db_xref="GeneID:12980561"
     CDS             1616510..1620379
                     /locus_tag="LMJF_35_4050"
                     /EC_number="2.7.11.1"
                     /note="previous protein_id=AAZ14630.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_003722801.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980561"
                     /db_xref="GOA:E9AFN1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9AFN1"
                     /translation="MLGTVDAIDYDGDRLHKVVLRFPAVRSGESEIVKEVWPCERIGQ
                     GSFGTVYRAVSSGYPRLALKISTGKSTRLRQELDVLSRVCTKGRLLLPRFEFGALNKT
                     ADLIVIGMELCVPSTLHDLLLSTRITSEAEMLFMAHQAAQAVAYVHAEGCIHRDIKLQ
                     NFVFDLDGNLKLIDFGLACNSLKPPAGDVVAGTVSFMSPEMAHNALHKDRRVSVGVAA
                     DVWSLGIVLFSIFTQRNPYPAPAAGSTPGGADAAGVTGHGDTTHGAEGEKGNGLSQQH
                     RMNERLLRRVAAGDWQWPVGVTVSQDLKQLVNSILVVNPEERPHVNTILENKLWNLRR
                     RYPPAAVAAFLGVQDDFLLSHDEAHLLRAVEERSAGVTASLLNSRLHSPTSASNEDNS
                     ETDAQHSSSGSARDGGLHASGTTTSSPRGSLKVVQRSGEGGIDGAVTVQVYDVRASAR
                     KRSKPIREISVVMAEETAKTRRSKSARRAKSAVSAPSSRVGSRAASAENVRRIAPPAG
                     TRLQSSSAHACADSGDDEGEAEAVNRGACTSQRHSRGMSPVRLQDALETAGSVAAGQR
                     DSVGHPKAWVEPSCATPPLLPRDKQQPVSEPASSASTVDRAREHMRPGIQRSGSVELL
                     KDAEAPTEASAMPTSHKRAASGGKRSRNASLRQPSSLILKGGTRDLSSDAPDSTATTA
                     SAQVPASLLASRTTSSLSAVNPSPSSSRQALLRRQASASVAAVSSAQGRAGHRGSPPV
                     MKRAQRVALELGLDVIWQDEADHRRALSAMLLVEHAWLLASFRLTIEEDQERYSITWL
                     AEEQEKSAAHPHRFKEVMQVMSKKYQYGFVCDMCDYEFLPTGPGEKNLHFFHCPCGRD
                     LCPDCYTTYQRQCTCSCCRAVHSNSCVLREHLLRTGGGQYYSGSRKTNAAARADAVCG
                     SFQAAAILDEEAESGDEASAPPELPRRRGRPPKQDKNRSAVKEKGSRAAKDSSRRRRG
                     AQDTLDVNVDEAHEVAQINPPRISIAAMQQKEERSSNGSHRGGGTAAVGVAARPQRPE
                     DVEVKQRPVESVPEGPWQPFARFKKDRRDEVARQPTPEERDALLNGEWIRHFYLFPHA
                     ESERDAASGTCAEGEEEPYAFVYHAQPGRTGAIFLTSDFPMHSAVFSMLERQFFVVNQ
                     VDTVEGADSTCATSLLKAKGHPELRIAFHALQDIVAYDTNMMKQQRTPGTVSVYQAPR
                     SAYSCNGEPFLYVRWFRFNENRTLSAFLLSNGAVQVFVNNEYELRWFDESRKFLIRYN
                     GVCELVDDGTFALAPGINHLLYDSFDA"
     gene            <1621351..>1622190
                     /locus_tag="LMJF_35_4060"
                     /db_xref="GeneID:12980562"
     mRNA            <1621351..>1622190
                     /locus_tag="LMJF_35_4060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722754.1"
                     /db_xref="GeneID:12980562"
     CDS             1621351..1622190
                     /locus_tag="LMJF_35_4060"
                     /note="previous protein_id=AAZ14631.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722802.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980562"
                     /db_xref="GOA:E9AFN2"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR003117"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:E9AFN2"
                     /translation="MSSETFRERTLATQYQPRQHLPPNFSDVLKEYAREVLRNQPSDI
                     LEWSAAYFKKLALETDPLQAKQPPPDHYTPLVEDPERAILANKMVKVFSTMDVSESGR
                     LPVSEVRRALTEAFEMTESQALYLLTAPFTTIVEDNSSGMTGDAIEYSPFSHAAVRTI
                     QYFQQHRDFSFDVDSSDACATVHGMNRYDIEQGFLRIFRLLDEAGTGRLLLQDYQGAL
                     ENAPYHLTHRDIRVLRLECGTCGGEGDTGPREVEYEKELPHMFERLLLAEVFNLFEEE
                     GQS"
     gene            <1623416..>1624432
                     /locus_tag="LMJF_35_4070"
                     /db_xref="GeneID:12980563"
     mRNA            <1623416..>1624432
                     /locus_tag="LMJF_35_4070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722755.1"
                     /db_xref="GeneID:12980563"
     CDS             1623416..1624432
                     /locus_tag="LMJF_35_4070"
                     /note="previous protein_id=AAZ14632.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722803.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980563"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="UniProtKB/TrEMBL:E9AFN3"
                     /translation="MDTHALLALAQSAVDAGNVKAACEFYEVALAQSPNNDEVLEAYA
                     EVMIHYAQDIPRAQQMLRHAIDINPNQGYVKYLNLAQLCEAEEALKCYEKAYEIASLM
                     LHGCRKKKMKKTLQETMATMCCAVAELYLTDLCFAENAEQQCEQAVNRALELNSDLVE
                     PHQLQASLRLSQCRPDEALQSLRRAVDATHRLGEEHQPTYESKIELGRLLMQVDPAEA
                     FQFLLEVLQYGDNNPYVWFLLGESARMRRRYADAARLLRRARVMLVVSGGDATALSEV
                     DAAINVLVQEMGGPEEAAQVKDLDHPYPLELLEAEDDEGAEEDGEDDLEEPEREPCDD
                     EDDA"
     gene            <1625702..>1629016
                     /locus_tag="LMJF_35_4080"
                     /db_xref="GeneID:12980564"
     mRNA            <1625702..>1629016
                     /locus_tag="LMJF_35_4080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722756.1"
                     /db_xref="GeneID:12980564"
     CDS             1625702..1629016
                     /locus_tag="LMJF_35_4080"
                     /note="previous protein_id=AAZ14633.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722804.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980564"
                     /db_xref="UniProtKB/TrEMBL:E9AFN4"
                     /translation="MSLFTRRGCVEVSSGDSELDSIASTVVDSADELIEGLARMALAG
                     HYSSEPRAYETNQLLQGRGMSRRPREVAETGPSMGSSRQVTPTPCAVTTPPAYYACAR
                     SNRQGGTFVSTCTARDMDEAENDARAFEKMYRHLAREYLRGNSSAHRAVSETKAAGCV
                     EHDSVARRGIASPSPSMEPAPARKPCRKPDEQAQSRLLKPNQAQLARQNEKYERCKSR
                     DEEAQRYPKPVRVPAEAVKRGTRLFLEAQVKADNVKRAQEAQARQKAAQETKECTFRP
                     SVSAYAARFAAGGAYYPLGSRLEDRAAHDEKRLRMRLERMVEREKECTFKPTLSPGTE
                     ELMSSLRRRRQRCHYRRSFRTPEASERAKSSRRRRASPPRHEPFEPGERLYRDGGERL
                     LRQQVRLQRAAAKEQRHVVGCGLRLSHTDVQQLADRFMAWAATRAANREELRMALERQ
                     GRKTPRAAAKREATAGRGDGLLRSRSSTSKGSTAVPCFAHLARSSSGSTYPAATDASA
                     PLPLKINSDFASPGGSLKACVETDNRAASRAPSDRARSPRLPSDAVCVATATCTPRSL
                     AAPAACPAANASVHKELLRIRLGALFYKYAVSPTATAVCLAQVKQQVRCYYPEDAGIV
                     VALASSFADRQQPITKTEFMAALARYVAQYGIQPWCLPHHSDPNAIVGVPYSPSDSSA
                     AGSAGAVTSNGLVSSGDSLGAMDGDAPVSTPPWGGGTEAGSSAPGRRSEVGRSVVAPA
                     AARASEGASDEKPVRTHIYTVPVQADCSPGTSAPATVTPSCAAKASVVNTAVTLRRGA
                     AAGKSREPRCGSSQSRVASKDTPPTRIPTAAADFVRGYEDHVQRQRRAVDRARATSEA
                     GQKKASEECTFHPTLTPRSVVLSELNMEKRMAYARELQLRRPDLHSRSSTVLAARSGD
                     DELPRAAPSQRDARACDALASTQTPPATPSTKHPSVSLSSTSPPLGFSPSIELSSPSC
                     STPRHDNGSVSSKPAATPSPSQEEQFTRDAGTRRAVAELEQLLSDVAGKGRSTQPAQE
                     GAGTPPPYPPVHAAVSSMAHDGATTAKNGTDLAQTLSTAPLSCFFAMKPAQAVLHAEE
                     KYLESRHTVKASRVEN"
     gene            <1630054..>1630308
                     /locus_tag="LMJF_35_4090"
                     /db_xref="GeneID:12980565"
     mRNA            <1630054..>1630308
                     /locus_tag="LMJF_35_4090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722757.1"
                     /db_xref="GeneID:12980565"
     CDS             1630054..1630308
                     /locus_tag="LMJF_35_4090"
                     /note="previous protein_id=AAZ14634.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722805.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980565"
                     /db_xref="InterPro:IPR009846"
                     /db_xref="UniProtKB/TrEMBL:E9AFN5"
                     /translation="MGDPFVRPGLEYAPHVEQVLLKHEGTMTLETTKDDWMRYQHRDT
                     LATIIEHRDQLEYLCVAENLPPAKMERILLERMVAPIAKR"
     gene            <1631820..>1633088
                     /locus_tag="LMJF_35_4100"
                     /db_xref="GeneID:12980566"
     mRNA            <1631820..>1633088
                     /locus_tag="LMJF_35_4100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722758.1"
                     /db_xref="GeneID:12980566"
     CDS             1631820..1633088
                     /locus_tag="LMJF_35_4100"
                     /note="previous protein_id=AAZ14635.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722806.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980566"
                     /db_xref="UniProtKB/TrEMBL:E9AFN6"
                     /translation="MKDAMSTFGVDMHNVSADEDPPYVQEHQRQRMVQNIMSSTQNLK
                     SLSKMDRLRLALDQVRNEPAGHEKWNEVYLFLRTTEMCTEVLANDSDVFPKGKKLWIE
                     MEQCEEKRVPGLMVLPNGMPVLPIFTMEEYMDSYFSRTNVYDSCWFPVPRSGTQWEAF
                     CKLPFPVCVTGNIQHFSALATVALGSHQLGILVNPGMRSSKFITYPEMVTLTQQRQQK
                     SRNRRLAVTSATSADGSTAAAPGEERLFDENLMMTFDTNKLPLKRLELQDLAACMAQR
                     PPIPPVAELELHLLLHVYPEIEAVYIRTVDRPRWRRMLGSSEKMTQIDVVCSPPRKPD
                     KSFFEHLQQWSFMKEFNSDVHVELTSQAPAQEGSTDSFMRIYSNEVDGKLLRGMATFK
                     GRTLADQLGFNEPITDGHGNKPYERYVSYF"
     gene            <1633911..>1634528
                     /locus_tag="LMJF_35_4110"
                     /db_xref="GeneID:12980567"
     mRNA            <1633911..>1634528
                     /locus_tag="LMJF_35_4110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722759.1"
                     /db_xref="GeneID:12980567"
     CDS             1633911..1634528
                     /locus_tag="LMJF_35_4110"
                     /note="previous protein_id=AAZ14636.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722807.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980567"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR006674"
                     /db_xref="UniProtKB/TrEMBL:E9AFN7"
                     /translation="MSLTKGSKAAQDVISFLHTVGRLKVTARQGWVENQICSPESVSD
                     HMYRMSLMCMMCPDTSLNRDRMVKMALCHDTGESIIGDISPAMKVPKEVKKQQESQAV
                     QSLCKLVSSSPNTTFSKELGDLFEEYEAQETAESHFVKDMDLLEMVVQAHSYESANPG
                     KDLGSFFRSGANIHHPWARAIYETLLETRPYLAYKEEQAKEASSI"
     gene            <1635404..>1638598
                     /locus_tag="LMJF_35_4120"
                     /db_xref="GeneID:12980568"
     mRNA            <1635404..>1638598
                     /locus_tag="LMJF_35_4120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722760.1"
                     /db_xref="GeneID:12980568"
     CDS             1635404..1638598
                     /locus_tag="LMJF_35_4120"
                     /note="previous protein_id=AAZ14637.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722808.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980568"
                     /db_xref="UniProtKB/TrEMBL:E9AFN8"
                     /translation="MAHYGDPEAHQCILEEVSAISGAPRLMAYLKAAVMGSQGSDVGL
                     QELWRFPGDHKQQDPHLEVMLALLSLTVLASKAHPGFRAEQRRVQDLIRQRQAALRQQ
                     AEQIRSARSCSGGGSSKSGAVPWTSASSTGVTSFPAPFSSSDISSASPAAIASAAGEG
                     KEEKLTPVQRWEQSTDILNYCEAYANYLGGFTDLWYELFGPNYYYDAAANGVFDKDDD
                     EDDPEGTRARLSEAEEWASPRSPRFPLSSSPQQSRHHQPQHARRRQRPSRGPQVPPHL
                     YAVHWSDILTPQRRAWFHGLHNAVKELLVRILHRELPLELYILFIQYANLSLRVYLLQ
                     TLAEAFEWTSHFVDVIYYVHVMRHSYSIQCEMSQLQRVWSSFGLYDGRFLVDCREFNK
                     MYTESQGAFSEQWEVALDKPPRAPQTLNAQTAEVTTAVASTTIASVDIAHQSSSVTAD
                     TTARGSSCTPALSAASATTLSSDLAAIASARVQRMFPFREATGNTSFDAADGSNTTGS
                     RTQDDESLSSASDCEAAGTAAGGTKRAVYLPLFYTCCCFTWILQRTFWSMYGRCSLLL
                     ESCLGVEVAPQVSSVDGTGEVNGGDAPVLFATAQRGAQRRIGVIGSSGLPSSPASPPS
                     PIPRNDGGAAARTRSASTSAISITMTRNNVTSRLSALEVPTRDGGGTAAGRPPQAAQV
                     SACGTPSPPPSQKQPGFLVAAANIQVPPHVVVDDSQGDVFEVTPTRNAAAPELVDERG
                     REEGAAFSWGSVLDLFVQRGQRRHGCGATTEGGSCSAGDTASMTQRAHRISSFSLATP
                     AGTPPPAPAAGTGVRGERINSLFLKNSGAPFHLQYTHRAREIQLYDDPSVTFTNGGAD
                     NKDTNALFFEEFYFLRETGCYLLSHAVRNLTCYPRYPATLLILTDNTTRPGRVSWCDH
                     KFSVLSSPTDDGDGRQGLTPWVLSAVIPHTRLSSIRNVRARQEEALLKHVVFQVAGAK
                     SARVRFCTSNSIFFVLNSGSEMDGGRLYFALHLHVDLSSRKQLDLSIDTVMGVESQWA
                     FRALGELHISWAMSCTCNEALRVAFQIGSGEEVL"
     gene            <1639810..>1641576
                     /locus_tag="LMJF_35_4125"
                     /db_xref="GeneID:12980569"
     mRNA            <1639810..>1641576
                     /locus_tag="LMJF_35_4125"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722761.1"
                     /db_xref="GeneID:12980569"
     CDS             1639810..1641576
                     /locus_tag="LMJF_35_4125"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722809.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4125"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4125"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980569"
                     /db_xref="UniProtKB/TrEMBL:E9AFN9"
                     /translation="MSTAAAPAPKLRSRSVNTTQGSVPGAKPVPSGAAKVRTRSTRVT
                     PTPFSEVQPRGAATTSSSSVTRRTVRTVKPITQDRPPVTVVGESKLQACSGGEGFPSS
                     LPTSTSHVGDGVRAPLLTAGLSEMSANCAKLSSGVTVTTPQMGLHNSSTSRVDSTCSS
                     LRGSSDKGSSDRRQCPPPVPRVSQLSSNAPVMRFAAMETPLPLRRNATAATIITTASA
                     PGSQLCSRTSFMYEMAAPLSPRRAPPSARPYASAPASRVSSVNSRLAEGAARLVRQPP
                     QRLHTSSTRLFVGKRSNSAATTAASTPTPSPTAPSSYAVVATTESAGNTPSTALGVGV
                     APRSMGTRPLLGTRCASTPKSGGANGAPRLRALHPSTQPALRVDRGPRSARGGASNGN
                     HSFSASCTATRGTSRQAPARQQQHHQESLSARCAAGASLSRKTTRKLGGGGAPVAIPR
                     APPAPFQQTHTGCPPSLSFASCVKGSAASALTKDPVSPIKRTSTACPSAAQRYPASSA
                     DNPAHVSDGRASSINDAAFASPWIKPGMLSSPTNCGGGRDASEAPTIPYEGSTGQRGS
                     MSLSPRTDFDTLSVSGRLSYGI"
     gene            <1644108..>1645892
                     /gene="PABP2"
                     /locus_tag="LMJF_35_4130"
                     /db_xref="GeneID:12980570"
     mRNA            <1644108..>1645892
                     /gene="PABP2"
                     /locus_tag="LMJF_35_4130"
                     /product="poly(A)-binding protein 2"
                     /transcript_id="XM_003722762.1"
                     /db_xref="GeneID:12980570"
     CDS             1644108..1645892
                     /gene="PABP2"
                     /locus_tag="LMJF_35_4130"
                     /note="previous protein_id=AAZ14638.1"
                     /codon_start=1
                     /product="poly(A)-binding protein 2"
                     /protein_id="XP_003722810.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980570"
                     /db_xref="GOA:E9AFP0"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR002004"
                     /db_xref="InterPro:IPR006515"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9AFP0"
                     /translation="MAFTGPNPSIWVGGLDPDLQEQKLYDYFVRIGPVTSVRVCVDSA
                     TQKSLGYGYVNFQDPADAEKALDQAGSKLGSRYLRIAKIQRDPSKRRSGVNNILVKKL
                     PKSVDTYALKEMFSKFGRLTAIGLACDEKGESRGYARISFEREESAVDAVREMDGMEM
                     DGQAIVVERYQAQHRDELLKQFTNLYVKNLDPAVTDEKLRAFFAKYGEVSSAKVRDLG
                     AAQSEAGLGYVAFQKHENAARAVEELNGKECEIAKAGSPLDVSRFRSREERQRDRERQ
                     RRERAQQHSKYPNLYVKGFDDTVTSERLEELFQRYGETVSVTVMMDKETGVSRCFGFV
                     SMKDQNAASQAIQELNGSTFLSPRPLFVTYALRKDARRQNLEERSKQFRVRQNPMGGP
                     GMGAMPPIGFMGPQMFNNVNMPFMNPRVPIMPMNGMNGIGGMNGMGGMNGVGGVGGMG
                     GMGGMGGMGGMGGMGGMGGMGSMGGMGGMARPMAPNAMSQMRSRPMPQKPPMQSLMPQ
                     QHQQAPPQGQNLAAVLANLNPEQQKNVLGERLYSYIVRSHPSVAAKITGMLLEMDNAE
                     ILNMLDSPTMLDSKIAEAQDVLNRHMSV"
     gene            <1652815..>1653579
                     /locus_tag="LMJF_35_4140"
                     /db_xref="GeneID:12980787"
     mRNA            <1652815..>1653579
                     /locus_tag="LMJF_35_4140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722763.1"
                     /db_xref="GeneID:12980787"
     CDS             1652815..1653579
                     /locus_tag="LMJF_35_4140"
                     /note="previous protein_id=AAZ14639.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722811.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980787"
                     /db_xref="UniProtKB/TrEMBL:E9AFP1"
                     /translation="MFESLRLLVLSLLYYLGFAYAAFTALKQRSTTVVMAEPSALSPA
                     TANAPRPGTTVEIGIRALKLMIMLTTMALLSLVGADWFPLFAEMRVIFMYTLLYVPPF
                     AQQELYDQLFAPLLVRGCALAFSPQTREVVARTVSLFVVRRCIDVAIAAMDCTECRRV
                     LGADAARDISSSLQFCQRALQQAADRTRESGSAASAQIARDRNVAVGFFTSQVRRALM
                     ARKERGGFSARIPLGRVVRDEHVDPESSLSVATAAL"
     gene            <1655728..>1657671
                     /locus_tag="LMJF_35_4150"
                     /db_xref="GeneID:12980571"
     mRNA            <1655728..>1657671
                     /locus_tag="LMJF_35_4150"
                     /product="putative elongation factor 1-alpha"
                     /transcript_id="XM_003722764.1"
                     /db_xref="GeneID:12980571"
     CDS             1655728..1657671
                     /locus_tag="LMJF_35_4150"
                     /note="previous protein_id=AAZ14640.1"
                     /codon_start=1
                     /product="putative elongation factor 1-alpha"
                     /protein_id="XP_003722812.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980571"
                     /db_xref="GOA:E9AFP2"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9AFP2"
                     /translation="MNRHNKFYAEVADELEGEDYYDDDDDDYNNDEEYEEEGEYDEAA
                     YETTASAASPEPVHMPKSTTQATAPAAAAVRVNPYTTISPQVDDDYELLDVLLPQLHA
                     LWKTNAPTMLPLSEGEAVTALRASNYDVEPAFLQLKEKRDEERSKRGGGVLRVAAAAG
                     PAKRASTPPTVEPPEPGGEAASDNEGNSASPSASSGRTTITLRGWKGASQRRTKQMLE
                     MEPDKEKPDCTFVIAGHVDAGKSTTLGHLLLLLGRVSIQDVERNEKADRTHHKDSFKY
                     AWLLDQCEEERRRGVTIDSGSFCFETEHRRVHILDAPGHKDFVLNMISSATQADAALL
                     VVTATNSEFETGLHHGTKSHLLVLKTLGVGSIVVAVNKMDAVAYSQERYDYVVRELQL
                     LLKQTRIPEEAIIGFCPISGMTGVNITQRGAKETPWYHDLSLIEMIDRCPLESRLVNS
                     PLRLSLQDVQGTTLYAKVESGRLFTGDMVHFVPSEVRVTIKSIQKPTVAGPVLVAFAG
                     ETVEISTNSSVTGLYPGCVGCEPNLLIRSSTDFEAHIQTFRTLTKAILPGASFTIIVH
                     ALTVRVHVAALISKMDSKTGNWSKGMVKCVPPAAQAMMLFRAESPVALEPATECRALG
                     RFVLQQDGETVAGGLVTRVVDKA"
     gene            <1659462..>1660940
                     /locus_tag="LMJF_35_4160"
                     /db_xref="GeneID:12980572"
     mRNA            <1659462..>1660940
                     /locus_tag="LMJF_35_4160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722765.1"
                     /db_xref="GeneID:12980572"
     CDS             1659462..1660940
                     /locus_tag="LMJF_35_4160"
                     /note="previous protein_id=AAZ14641.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722813.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980572"
                     /db_xref="InterPro:IPR018553"
                     /db_xref="UniProtKB/TrEMBL:E9AFP3"
                     /translation="MGSLVMGRCRRGAEETFEFREEYALLDAPIANAEHIPLRLRPQE
                     RKIQRLMRGVILASSYTDKVDSASALKLKNRELLVVKELTNALTGLIVGLDMRKAASF
                     MRDHEFTPYQHEIRAAIEMCRRYKMMNPDLLRTDYVKFLYMIQDAVQSDMAREALGFN
                     VVKELVTVGRYCETHNMQDILQDTRLPHCITPVPVMKDRNMLNRCLRGKDAVVGKLVK
                     QYASEHRMHEDNVEVVVRSLNDANCFSNDNVETSERLLELLKQYFTPISCTELTSLAI
                     DEGADGSRLTHNHKMQYIFVLQSLSLWKNMCRKMYMLWSLAEEDMLNPNEKYELRMTG
                     QGLQRVQKAPQLFKAIQQVLQETKEELGEWVGSERIHLGDDQVPNAFHFIDKYGQVSR
                     IIIPILRTLGHIDQLERHADHAAYLREVWGGGEQAKRAILRDFFRHGFDGSGGDNMDD
                     AGSCIDGRLTSAWNWCNNIRFKEFYPLFLFSGFSSFDGDMGL"
     gene            <1661784..>1662878
                     /locus_tag="LMJF_35_4170"
                     /db_xref="GeneID:12980573"
     mRNA            <1661784..>1662878
                     /locus_tag="LMJF_35_4170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722766.1"
                     /db_xref="GeneID:12980573"
     CDS             1661784..1662878
                     /locus_tag="LMJF_35_4170"
                     /note="previous protein_id=AAZ14642.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722814.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980573"
                     /db_xref="GOA:E9AFP4"
                     /db_xref="InterPro:IPR007811"
                     /db_xref="UniProtKB/TrEMBL:E9AFP4"
                     /translation="MPPKAPNLKFKPKLVLREDDTAAHPPATQATGDLSLVQLARLQG
                     LYIEEQAPSSSEAVTGSGDRLAPASSSPAHGGGDGEGGGAAGSSFDPRGGQPQQRCAN
                     LSNNGDGARGIAASSLLHPKGRSHNLSAHAALEEASRKHVDISQYPEAAPPLPHNSMN
                     KIVAPSALCNDDLMHSGLYAPLPLDASLPSRLAAEERGALSAAQGAISGTSQPSAATP
                     MDVDGTAFLREAELEQQRTYAANIRFYEDSLRPMQASVPSATAAPGGLVWMQLPRFHE
                     NAPFSFFDLPPGKVGVLKVLRSGRMVLEIAGVYYDVAVEGYEDAGNDGACAMAVATQP
                     SAYPSNPSSKASCYELGLLQKKLICTPTLP"
     gene            <1663745..>1665523
                     /locus_tag="LMJF_35_4180"
                     /db_xref="GeneID:12980574"
     mRNA            <1663745..>1665523
                     /locus_tag="LMJF_35_4180"
                     /product="putative Bardet-Biedl syndrome 1 protein
                     (BBS1-like protein 1)"
                     /transcript_id="XM_003722767.1"
                     /db_xref="GeneID:12980574"
     CDS             1663745..1665523
                     /locus_tag="LMJF_35_4180"
                     /note="previous protein_id=AAZ14643.1"
                     /codon_start=1
                     /product="putative Bardet-Biedl syndrome 1 protein
                     (BBS1-like protein 1)"
                     /protein_id="XP_003722815.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980574"
                     /db_xref="GOA:E9AFP5"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR028784"
                     /db_xref="UniProtKB/TrEMBL:E9AFP5"
                     /translation="MSAPKEGNRGESKEKFWLYAFRDHLANLRAFSNCIETADVNGVG
                     DYQLLVADGSKRIKVYAGTSLQRELPLFGVPSAITSFFMDDADAFGKPVVAVATGPYI
                     FMYRSNKPLYRFMVPPVPLNPQESAIWQDLATEALTVEEAVKQLESLLDSGVETSSRT
                     LELLLETPEERGEFVSRLRSVPLIQMDVVCCLTSIPLNSLDEGGRSVLVIGTEAGFLY
                     VLKHNAAEVALKVVLPRTPVFLIAAGCFEVDYRMVVACRDGRVYSIKQGNLQNAVIQP
                     DAQPCAIARYNNLIAVATTANTLAYYNLKGKKQQSVFLPCSISGLSTINDTVTGEARG
                     LVVALSNGEIRVYVGTQLHHVSLAYGTVTAMKFGRYGRSDGALVLVLQNGSLVVELLH
                     RGVNLSCSKTVETGPPPQQDIPIPIPHLSSVFATQSSRERKHGVEMYQLFQYDLSQLR
                     LTTAKAYLDMIANGSVPSELGNVTQENEGVAEPSLRLNAVVQGLGPVFKVKVQLQNVG
                     EAPLHAVRVVFCLSEDNVYCMPQQIFLIPTLLPSVPLSCAAFVTTSEGEAKGNAILVV
                     ATGPKSRTPLARTLVDLPEVEAMAEV"
     gene            <1666379..>1667071
                     /locus_tag="LMJF_35_4190"
                     /db_xref="GeneID:12980575"
     mRNA            <1666379..>1667071
                     /locus_tag="LMJF_35_4190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722768.1"
                     /db_xref="GeneID:12980575"
     CDS             1666379..1667071
                     /locus_tag="LMJF_35_4190"
                     /note="previous protein_id=AAZ14644.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722816.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980575"
                     /db_xref="UniProtKB/TrEMBL:E9AFP6"
                     /translation="MPIETAATLPPPPSEAALATPTASHSQVQSTGTPEATPAASSSP
                     KPAAIISQREGSANDSGTPVTATAPRTTRFLNDVEAEENRYLYETLYKSLAEPADTAI
                     RDELTVGDTVRFARDAKREFIAAATMPMGEKVKNCSALARSFLQKKNQQVAHVFIVFS
                     VLMTTMPVIVLLIGMRLIAPRLDMDPTLCGGGLAVFTAISLMGSYVVYAMVEEAQCGR
                     QNASETESKKER"
     gene            1670548..1670651
                     /gene="LM35Cs3C1.1"
                     /locus_tag="LMJF_35_snoRNA0183"
                     /db_xref="GeneID:12980576"
     ncRNA           1670548..1670651
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C1.1"
                     /locus_tag="LMJF_35_snoRNA0183"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461116.1"
                     /db_xref="GeneID:12980576"
     gene            1670979..1671073
                     /gene="LM35Cs3C4.1"
                     /locus_tag="LMJF_35_snoRNA0208"
                     /db_xref="GeneID:12980718"
     ncRNA           1670979..1671073
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C4.1"
                     /locus_tag="LMJF_35_snoRNA0208"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461140.1"
                     /db_xref="GeneID:12980718"
     gene            1671201..1671272
                     /gene="LM35Cs3C5.1"
                     /locus_tag="LMJF_35_snoRNA0151"
                     /db_xref="GeneID:12980733"
     ncRNA           1671201..1671272
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C5.1"
                     /locus_tag="LMJF_35_snoRNA0151"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461084.1"
                     /db_xref="GeneID:12980733"
     gene            1671306..1671378
                     /gene="LM35Cs3H1.1"
                     /locus_tag="LMJF_35_snoRNA0217"
                     /db_xref="GeneID:12980741"
     ncRNA           1671306..1671378
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3H1.1"
                     /locus_tag="LMJF_35_snoRNA0217"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461149.1"
                     /db_xref="GeneID:12980741"
     gene            1671497..1671628
                     /gene="LM35Cs3C6.1"
                     /locus_tag="LMJF_35_snoRNA0172"
                     /db_xref="GeneID:12980764"
     ncRNA           1671497..1671628
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C6.1"
                     /locus_tag="LMJF_35_snoRNA0172"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461105.1"
                     /db_xref="GeneID:12980764"
     gene            1671719..1671796
                     /gene="LM35Cs3H3.1"
                     /locus_tag="LMJF_35_snoRNA0191"
                     /db_xref="GeneID:12980749"
     ncRNA           1671719..1671796
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3H3.1"
                     /locus_tag="LMJF_35_snoRNA0191"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461124.1"
                     /db_xref="GeneID:12980749"
     gene            1671827..1671917
                     /gene="LM35Cs3C2.1"
                     /locus_tag="LMJF_35_snoRNA0198"
                     /db_xref="GeneID:12980778"
     ncRNA           1671827..1671917
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C2.1"
                     /locus_tag="LMJF_35_snoRNA0198"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461131.1"
                     /db_xref="GeneID:12980778"
     gene            1671970..1672051
                     /gene="LM35Cs3C3.1"
                     /locus_tag="LMJF_35_snoRNA0159"
                     /db_xref="GeneID:12980719"
     ncRNA           1671970..1672051
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C3.1"
                     /locus_tag="LMJF_35_snoRNA0159"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461092.1"
                     /db_xref="GeneID:12980719"
     gene            1672075..1672169
                     /gene="LM35Cs3C4.2"
                     /locus_tag="LMJF_35_snoRNA0209"
                     /db_xref="GeneID:12980726"
     ncRNA           1672075..1672169
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C4.2"
                     /locus_tag="LMJF_35_snoRNA0209"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461141.1"
                     /db_xref="GeneID:12980726"
     gene            1672265..1672336
                     /gene="LM35Cs3C5.2"
                     /locus_tag="LMJF_35_snoRNA0152"
                     /db_xref="GeneID:12980734"
     ncRNA           1672265..1672336
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C5.2"
                     /locus_tag="LMJF_35_snoRNA0152"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461085.1"
                     /db_xref="GeneID:12980734"
     gene            1672370..1672442
                     /gene="LM35Cs3H1.2"
                     /locus_tag="LMJF_35_snoRNA0218"
                     /db_xref="GeneID:12980742"
     ncRNA           1672370..1672442
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3H1.2"
                     /locus_tag="LMJF_35_snoRNA0218"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461150.1"
                     /db_xref="GeneID:12980742"
     gene            1672561..1672692
                     /gene="LM35Cs3C6.2"
                     /locus_tag="LMJF_35_snoRNA0173"
                     /db_xref="GeneID:12980765"
     ncRNA           1672561..1672692
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C6.2"
                     /locus_tag="LMJF_35_snoRNA0173"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461106.1"
                     /db_xref="GeneID:12980765"
     gene            1672783..1672860
                     /gene="LM35Cs3H3.2"
                     /locus_tag="LMJF_35_snoRNA0192"
                     /db_xref="GeneID:12980750"
     ncRNA           1672783..1672860
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3H3.2"
                     /locus_tag="LMJF_35_snoRNA0192"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461125.1"
                     /db_xref="GeneID:12980750"
     gene            1672891..1672981
                     /gene="LM35Cs3C2.2"
                     /locus_tag="LMJF_35_snoRNA0199"
                     /db_xref="GeneID:12980779"
     ncRNA           1672891..1672981
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C2.2"
                     /locus_tag="LMJF_35_snoRNA0199"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461132.1"
                     /db_xref="GeneID:12980779"
     gene            1673034..1673115
                     /gene="LM35Cs3C3.2"
                     /locus_tag="LMJF_35_snoRNA0160"
                     /db_xref="GeneID:12980720"
     ncRNA           1673034..1673115
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C3.2"
                     /locus_tag="LMJF_35_snoRNA0160"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461093.1"
                     /db_xref="GeneID:12980720"
     gene            1673139..1673233
                     /gene="LM35Cs3C4.3"
                     /locus_tag="LMJF_35_snoRNA0210"
                     /db_xref="GeneID:12980727"
     ncRNA           1673139..1673233
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C4.3"
                     /locus_tag="LMJF_35_snoRNA0210"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461142.1"
                     /db_xref="GeneID:12980727"
     gene            1673343..1673414
                     /gene="LM35Cs3C5.3"
                     /locus_tag="LMJF_35_snoRNA0153"
                     /db_xref="GeneID:12980735"
     ncRNA           1673343..1673414
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C5.3"
                     /locus_tag="LMJF_35_snoRNA0153"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461086.1"
                     /db_xref="GeneID:12980735"
     gene            1673448..1673520
                     /gene="LM35Cs3H1.3"
                     /locus_tag="LMJF_35_snoRNA0219"
                     /db_xref="GeneID:12980743"
     ncRNA           1673448..1673520
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3H1.3"
                     /locus_tag="LMJF_35_snoRNA0219"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461151.1"
                     /db_xref="GeneID:12980743"
     gene            1673640..1673771
                     /gene="LM35Cs3C6.3"
                     /locus_tag="LMJF_35_snoRNA0174"
                     /db_xref="GeneID:12980766"
     ncRNA           1673640..1673771
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C6.3"
                     /locus_tag="LMJF_35_snoRNA0174"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461107.1"
                     /db_xref="GeneID:12980766"
     gene            1673810..1673882
                     /gene="LM35Cs3H2.1"
                     /locus_tag="LMJF_35_snoRNA0185"
                     /db_xref="GeneID:12980751"
     ncRNA           1673810..1673882
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3H2.1"
                     /locus_tag="LMJF_35_snoRNA0185"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461118.1"
                     /db_xref="GeneID:12980751"
     gene            1673927..1674002
                     /gene="LM35Cs3C7.1"
                     /locus_tag="LMJF_35_snoRNA0166"
                     /db_xref="GeneID:12980772"
     ncRNA           1673927..1674002
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C7.1"
                     /locus_tag="LMJF_35_snoRNA0166"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461099.1"
                     /db_xref="GeneID:12980772"
     gene            1674097..1674174
                     /gene="LM35Cs3H3.3"
                     /locus_tag="LMJF_35_snoRNA0193"
                     /db_xref="GeneID:12980758"
     ncRNA           1674097..1674174
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3H3.3"
                     /locus_tag="LMJF_35_snoRNA0193"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461126.1"
                     /db_xref="GeneID:12980758"
     gene            1674205..1674295
                     /gene="LM35Cs3C2.3"
                     /locus_tag="LMJF_35_snoRNA0200"
                     /db_xref="GeneID:12980780"
     ncRNA           1674205..1674295
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C2.3"
                     /locus_tag="LMJF_35_snoRNA0200"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461133.1"
                     /db_xref="GeneID:12980780"
     gene            1674348..1674429
                     /gene="LM35Cs3C3.3"
                     /locus_tag="LMJF_35_snoRNA0161"
                     /db_xref="GeneID:12980721"
     ncRNA           1674348..1674429
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C3.3"
                     /locus_tag="LMJF_35_snoRNA0161"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461094.1"
                     /db_xref="GeneID:12980721"
     gene            1674453..1674547
                     /gene="LM35Cs3C4.4"
                     /locus_tag="LMJF_35_snoRNA0211"
                     /db_xref="GeneID:12980728"
     ncRNA           1674453..1674547
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C4.4"
                     /locus_tag="LMJF_35_snoRNA0211"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461143.1"
                     /db_xref="GeneID:12980728"
     gene            1674629..1674700
                     /gene="LM35Cs3C5.4"
                     /locus_tag="LMJF_35_snoRNA0154"
                     /db_xref="GeneID:12980736"
     ncRNA           1674629..1674700
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C5.4"
                     /locus_tag="LMJF_35_snoRNA0154"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461087.1"
                     /db_xref="GeneID:12980736"
     gene            1674734..1674806
                     /gene="LM35Cs3H1.4"
                     /locus_tag="LMJF_35_snoRNA0220"
                     /db_xref="GeneID:12980744"
     ncRNA           1674734..1674806
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3H1.4"
                     /locus_tag="LMJF_35_snoRNA0220"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461152.1"
                     /db_xref="GeneID:12980744"
     gene            1674927..1675058
                     /gene="LM35Cs3C6.4"
                     /locus_tag="LMJF_35_snoRNA0175"
                     /db_xref="GeneID:12980767"
     ncRNA           1674927..1675058
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C6.4"
                     /locus_tag="LMJF_35_snoRNA0175"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461108.1"
                     /db_xref="GeneID:12980767"
     gene            1675097..1675169
                     /gene="LM35Cs3H2.2"
                     /locus_tag="LMJF_35_snoRNA0186"
                     /db_xref="GeneID:12980752"
     ncRNA           1675097..1675169
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3H2.2"
                     /locus_tag="LMJF_35_snoRNA0186"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461119.1"
                     /db_xref="GeneID:12980752"
     gene            1675222..1675297
                     /gene="LM35Cs3C7.2"
                     /locus_tag="LMJF_35_snoRNA0167"
                     /db_xref="GeneID:12980773"
     ncRNA           1675222..1675297
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C7.2"
                     /locus_tag="LMJF_35_snoRNA0167"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461100.1"
                     /db_xref="GeneID:12980773"
     gene            1675392..1675469
                     /gene="LM35Cs3H3.4"
                     /locus_tag="LMJF_35_snoRNA0194"
                     /db_xref="GeneID:12980759"
     ncRNA           1675392..1675469
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3H3.4"
                     /locus_tag="LMJF_35_snoRNA0194"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461127.1"
                     /db_xref="GeneID:12980759"
     gene            1675500..1675590
                     /gene="LM35Cs3C2.4"
                     /locus_tag="LMJF_35_snoRNA0201"
                     /db_xref="GeneID:12980781"
     ncRNA           1675500..1675590
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C2.4"
                     /locus_tag="LMJF_35_snoRNA0201"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461134.1"
                     /db_xref="GeneID:12980781"
     gene            1675643..1675724
                     /gene="LM35Cs3C3.4"
                     /locus_tag="LMJF_35_snoRNA0162"
                     /db_xref="GeneID:12980722"
     ncRNA           1675643..1675724
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C3.4"
                     /locus_tag="LMJF_35_snoRNA0162"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461095.1"
                     /db_xref="GeneID:12980722"
     gene            1675748..1675842
                     /gene="LM35Cs3C4.5"
                     /locus_tag="LMJF_35_snoRNA0212"
                     /db_xref="GeneID:12980729"
     ncRNA           1675748..1675842
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C4.5"
                     /locus_tag="LMJF_35_snoRNA0212"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461144.1"
                     /db_xref="GeneID:12980729"
     gene            1675942..1676013
                     /gene="LM35Cs3C5.5"
                     /locus_tag="LMJF_35_snoRNA0155"
                     /db_xref="GeneID:12980737"
     ncRNA           1675942..1676013
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C5.5"
                     /locus_tag="LMJF_35_snoRNA0155"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461088.1"
                     /db_xref="GeneID:12980737"
     gene            1676047..1676119
                     /gene="LM35Cs3H1.5"
                     /locus_tag="LMJF_35_snoRNA0221"
                     /db_xref="GeneID:12980745"
     ncRNA           1676047..1676119
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3H1.5"
                     /locus_tag="LMJF_35_snoRNA0221"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461153.1"
                     /db_xref="GeneID:12980745"
     gene            1676238..1676369
                     /gene="LM35Cs3C6.5"
                     /locus_tag="LMJF_35_snoRNA0176"
                     /db_xref="GeneID:12980768"
     ncRNA           1676238..1676369
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C6.5"
                     /locus_tag="LMJF_35_snoRNA0176"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461109.1"
                     /db_xref="GeneID:12980768"
     gene            1676408..1676480
                     /gene="LM35Cs3H2.3"
                     /locus_tag="LMJF_35_snoRNA0187"
                     /db_xref="GeneID:12980754"
     ncRNA           1676408..1676480
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3H2.3"
                     /locus_tag="LMJF_35_snoRNA0187"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461120.1"
                     /db_xref="GeneID:12980754"
     gene            1676533..1676608
                     /gene="LM35Cs3C7.3"
                     /locus_tag="LMJF_35_snoRNA0168"
                     /db_xref="GeneID:12980774"
     ncRNA           1676533..1676608
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C7.3"
                     /locus_tag="LMJF_35_snoRNA0168"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461101.1"
                     /db_xref="GeneID:12980774"
     gene            1676703..1676780
                     /gene="LM35Cs3H3.5"
                     /locus_tag="LMJF_35_snoRNA0195"
                     /db_xref="GeneID:12980760"
     ncRNA           1676703..1676780
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3H3.5"
                     /locus_tag="LMJF_35_snoRNA0195"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461128.1"
                     /db_xref="GeneID:12980760"
     gene            1676811..1676902
                     /gene="LM35Cs3C2.5"
                     /locus_tag="LMJF_35_snoRNA0050"
                     /old_locus_tag="LMJF_35_snoRNA0202"
                     /db_xref="GeneID:12980782"
     ncRNA           1676811..1676902
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C2.5"
                     /locus_tag="LMJF_35_snoRNA0050"
                     /old_locus_tag="LMJF_35_snoRNA0202"
                     /transcript_id="XR_002461082.1"
                     /db_xref="GeneID:12980782"
     ncRNA           1676811..1676901
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C2.5"
                     /locus_tag="LMJF_35_snoRNA0050"
                     /old_locus_tag="LMJF_35_snoRNA0202"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461083.1"
                     /db_xref="GeneID:12980782"
     gene            1676954..1677035
                     /gene="LM35Cs3C3.5"
                     /locus_tag="LMJF_35_snoRNA0163"
                     /db_xref="GeneID:12980723"
     ncRNA           1676954..1677035
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C3.5"
                     /locus_tag="LMJF_35_snoRNA0163"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461096.1"
                     /db_xref="GeneID:12980723"
     gene            1677059..1677153
                     /gene="LM35Cs3C4.6"
                     /locus_tag="LMJF_35_snoRNA0213"
                     /db_xref="GeneID:12980730"
     ncRNA           1677059..1677153
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C4.6"
                     /locus_tag="LMJF_35_snoRNA0213"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461145.1"
                     /db_xref="GeneID:12980730"
     gene            1677269..1677340
                     /gene="LM35Cs3C5.6"
                     /locus_tag="LMJF_35_snoRNA0156"
                     /db_xref="GeneID:12980738"
     ncRNA           1677269..1677340
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C5.6"
                     /locus_tag="LMJF_35_snoRNA0156"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461089.1"
                     /db_xref="GeneID:12980738"
     gene            1677374..1677446
                     /gene="LM35Cs3H1.6"
                     /locus_tag="LMJF_35_snoRNA0222"
                     /db_xref="GeneID:12980746"
     ncRNA           1677374..1677446
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3H1.6"
                     /locus_tag="LMJF_35_snoRNA0222"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461154.1"
                     /db_xref="GeneID:12980746"
     gene            1677567..1677698
                     /gene="LM35Cs3C6.6"
                     /locus_tag="LMJF_35_snoRNA0177"
                     /db_xref="GeneID:12980769"
     ncRNA           1677567..1677698
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C6.6"
                     /locus_tag="LMJF_35_snoRNA0177"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461110.1"
                     /db_xref="GeneID:12980769"
     gene            1677737..1677809
                     /gene="LM35Cs3H2.4"
                     /locus_tag="LMJF_35_snoRNA0188"
                     /db_xref="GeneID:12980755"
     ncRNA           1677737..1677809
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3H2.4"
                     /locus_tag="LMJF_35_snoRNA0188"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461121.1"
                     /db_xref="GeneID:12980755"
     gene            1677862..1677937
                     /gene="LM35Cs3C7.4"
                     /locus_tag="LMJF_35_snoRNA0169"
                     /db_xref="GeneID:12980775"
     ncRNA           1677862..1677937
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C7.4"
                     /locus_tag="LMJF_35_snoRNA0169"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461102.1"
                     /db_xref="GeneID:12980775"
     gene            1678032..1678109
                     /gene="LM35Cs3H3.6"
                     /locus_tag="LMJF_35_snoRNA0196"
                     /db_xref="GeneID:12980761"
     ncRNA           1678032..1678109
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3H3.6"
                     /locus_tag="LMJF_35_snoRNA0196"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461129.1"
                     /db_xref="GeneID:12980761"
     gene            1678140..1678230
                     /gene="LM35Cs3C2.6"
                     /locus_tag="LMJF_35_snoRNA0203"
                     /db_xref="GeneID:12980783"
     ncRNA           1678140..1678230
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C2.6"
                     /locus_tag="LMJF_35_snoRNA0203"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461135.1"
                     /db_xref="GeneID:12980783"
     gene            1678283..1678364
                     /gene="LM35Cs3C3.6"
                     /locus_tag="LMJF_35_snoRNA0164"
                     /db_xref="GeneID:12980724"
     ncRNA           1678283..1678364
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C3.6"
                     /locus_tag="LMJF_35_snoRNA0164"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461097.1"
                     /db_xref="GeneID:12980724"
     gene            1678388..1678482
                     /gene="LM35Cs3C4.7"
                     /locus_tag="LMJF_35_snoRNA0214"
                     /db_xref="GeneID:12980731"
     ncRNA           1678388..1678482
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C4.7"
                     /locus_tag="LMJF_35_snoRNA0214"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461146.1"
                     /db_xref="GeneID:12980731"
     gene            1678580..1678651
                     /gene="LM35Cs3C5.7"
                     /locus_tag="LMJF_35_snoRNA0157"
                     /db_xref="GeneID:12980739"
     ncRNA           1678580..1678651
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C5.7"
                     /locus_tag="LMJF_35_snoRNA0157"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461090.1"
                     /db_xref="GeneID:12980739"
     gene            1678685..1678757
                     /gene="LM35Cs3H1.7"
                     /locus_tag="LMJF_35_snoRNA0223"
                     /db_xref="GeneID:12980747"
     ncRNA           1678685..1678757
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3H1.7"
                     /locus_tag="LMJF_35_snoRNA0223"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461155.1"
                     /db_xref="GeneID:12980747"
     gene            1678878..1679009
                     /gene="LM35Cs3C6.7"
                     /locus_tag="LMJF_35_snoRNA0178"
                     /db_xref="GeneID:12980770"
     ncRNA           1678878..1679009
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C6.7"
                     /locus_tag="LMJF_35_snoRNA0178"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461111.1"
                     /db_xref="GeneID:12980770"
     gene            1679048..1679120
                     /gene="LM35Cs3H2.5"
                     /locus_tag="LMJF_35_snoRNA0189"
                     /db_xref="GeneID:12980756"
     ncRNA           1679048..1679120
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3H2.5"
                     /locus_tag="LMJF_35_snoRNA0189"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461122.1"
                     /db_xref="GeneID:12980756"
     gene            1679173..1679248
                     /gene="LM35Cs3C7.5"
                     /locus_tag="LMJF_35_snoRNA0170"
                     /db_xref="GeneID:12980776"
     ncRNA           1679173..1679248
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C7.5"
                     /locus_tag="LMJF_35_snoRNA0170"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461103.1"
                     /db_xref="GeneID:12980776"
     gene            1679452..1679542
                     /gene="LM35Cs3C2.7"
                     /locus_tag="LMJF_35_snoRNA0204"
                     /db_xref="GeneID:12980762"
     ncRNA           1679452..1679542
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C2.7"
                     /locus_tag="LMJF_35_snoRNA0204"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461136.1"
                     /db_xref="GeneID:12980762"
     gene            1679595..1679676
                     /gene="LM35Cs3C3.7"
                     /locus_tag="LMJF_35_snoRNA0165"
                     /db_xref="GeneID:12980725"
     ncRNA           1679595..1679676
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C3.7"
                     /locus_tag="LMJF_35_snoRNA0165"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461098.1"
                     /db_xref="GeneID:12980725"
     gene            1679700..1679794
                     /gene="LM35Cs3C4.8"
                     /locus_tag="LMJF_35_snoRNA0215"
                     /db_xref="GeneID:12980732"
     ncRNA           1679700..1679794
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C4.8"
                     /locus_tag="LMJF_35_snoRNA0215"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461147.1"
                     /db_xref="GeneID:12980732"
     gene            1679878..1679949
                     /gene="LM35Cs3C5.8"
                     /locus_tag="LMJF_35_snoRNA0158"
                     /db_xref="GeneID:12980740"
     ncRNA           1679878..1679949
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C5.8"
                     /locus_tag="LMJF_35_snoRNA0158"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461091.1"
                     /db_xref="GeneID:12980740"
     gene            1679983..1680055
                     /gene="LM35Cs3H1.8"
                     /locus_tag="LMJF_35_snoRNA0224"
                     /db_xref="GeneID:12980748"
     ncRNA           1679983..1680055
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3H1.8"
                     /locus_tag="LMJF_35_snoRNA0224"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461156.1"
                     /db_xref="GeneID:12980748"
     gene            1680176..1680307
                     /gene="LM35Cs3C6.8"
                     /locus_tag="LMJF_35_snoRNA0179"
                     /db_xref="GeneID:12980771"
     ncRNA           1680176..1680307
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C6.8"
                     /locus_tag="LMJF_35_snoRNA0179"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461112.1"
                     /db_xref="GeneID:12980771"
     gene            1680346..1680418
                     /gene="LM35Cs3H2.6"
                     /locus_tag="LMJF_35_snoRNA0190"
                     /db_xref="GeneID:12980757"
     ncRNA           1680346..1680418
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3H2.6"
                     /locus_tag="LMJF_35_snoRNA0190"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461123.1"
                     /db_xref="GeneID:12980757"
     gene            1680471..1680546
                     /gene="LM35Cs3C7.6"
                     /locus_tag="LMJF_35_snoRNA0171"
                     /db_xref="GeneID:12980777"
     ncRNA           1680471..1680546
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3C7.6"
                     /locus_tag="LMJF_35_snoRNA0171"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461104.1"
                     /db_xref="GeneID:12980777"
     gene            1680641..1680718
                     /gene="LM35Cs3H3.7"
                     /locus_tag="LMJF_35_snoRNA0197"
                     /db_xref="GeneID:12980763"
     ncRNA           1680641..1680718
                     /ncRNA_class="snoRNA"
                     /gene="LM35Cs3H3.7"
                     /locus_tag="LMJF_35_snoRNA0197"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461130.1"
                     /db_xref="GeneID:12980763"
     gene            <1681862..>1683859
                     /locus_tag="LMJF_35_4200"
                     /db_xref="GeneID:12980784"
     mRNA            <1681862..>1683859
                     /locus_tag="LMJF_35_4200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722769.1"
                     /db_xref="GeneID:12980784"
     CDS             1681862..1683859
                     /locus_tag="LMJF_35_4200"
                     /note="previous protein_id=AAZ14645.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722817.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980784"
                     /db_xref="UniProtKB/TrEMBL:E9AFP7"
                     /translation="MQMRRDALGNGKALEFAKELSLAYKQVIQATQHIGKQRQALTGC
                     TDLSVKTREWAAAEHDIAGALEKYGAAPYWVEQRGWRPGRLQSFEAAHSRASSGTEVS
                     YLCSRLRGYVKAAFTAHVTKPPKLNASEVDVAELLTFFTGSGDGALVVEVALAKFFVV
                     ENMHVRAPELWVMNYLLHCYGVEEGIMLAHEADVVDGGFKQQGGGAFEEQFLIQKNIW
                     AVSQVLVPHCYAVTRCDEATAKAGVEACVRCEGTEGQGTEGAFPTWPGTPPASLPPAY
                     RLARSVNDYGKEAGEDKTSRIIGELDGVIYDASARQVLLVLEAKQNIDVCKAFKQKER
                     LYNALDATRKTLSQASQGAALTAVQLSAENETNTATTTAAGRNATPAAEAACAASTKL
                     HTDPVVLRFFVTPTPAAEAARENFSVNGCSLVTGVGAEPAANFQDMRNSGDMASAAAP
                     PVRSKAAAARLATAGNPFFTQDNFAAFFGATASAVQGDSTAPSPTPTRSDSMTPRHLG
                     RDQRWIYLTSLSTGNSPGARTTVPAPGGTIHMVELTLVKTACNFVAEAYDSYFQISTL
                     PPTATPALQSLVSAMRVCSAYAPETEPMALFHLFLELPPQECISARAETAAVSRSDPC
                     EYVLHLFRHDVRCKDGAAALEQVWLRENFIDGLVLSEHSFI"
     gene            <1688133..>1690238
                     /locus_tag="LMJF_35_4210"
                     /db_xref="GeneID:12980577"
     mRNA            <1688133..>1690238
                     /locus_tag="LMJF_35_4210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722770.1"
                     /db_xref="GeneID:12980577"
     CDS             1688133..1690238
                     /locus_tag="LMJF_35_4210"
                     /note="previous protein_id=AAZ14646.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722818.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980577"
                     /db_xref="UniProtKB/TrEMBL:E9AFP8"
                     /translation="MSTPSICKSATSIADSLDGEEFLAASPFHPGNADLRSMVQDSPR
                     TSFQPRFARIDSMDYRGQSIVEHVNNTAPTSCVSSRMPQRSHPRKPVAPNWRAEAATN
                     TLPPHSDHTRPRDKPRSGFGLDTRDLRAEYSSAPARPKCATSSVPVLPSTAAKVAAAG
                     SSCQALKTSKSSSQTASGSERTLSSGGVSDLPLTSPFSCSDSAKDVQEEHTASLCGTS
                     KRSTNGSESREATLRNHPLRRSAGATATASVDAPGSDIAVHMRPECEDVDLIHSDDAR
                     LTGAPRRGTVPAPTTGAKLTPTLSNALSPHSSSPVTRAPSAPSPISRFRSVLVESRSS
                     LGVAASSPWRTSPEKGTATERSGASVQLVAAGAASLAAVSPVSPKHVSPMPPSNLQTA
                     ESDASAGSAPLRQNVSKHRHSMRLLPQCSTDVHTTEKSDAAAVSIPVVSKALRRNSTS
                     PLQTVVATSSVAPDSAKVTRSSDGGPSEIARVPRLSAKMHSLKVNAPRPAPDRQLRVA
                     PLQMAARKTLERIPARVALTKGPEQRGAQTPRDNPHQEHRSRIDLVEGRETVSVKTST
                     SQKSGSLRNVGVVDVSNSKQRIYYCTPSLGDEIMPNFARDAADLHLKVNRPSIFTSAI
                     RTTVKGSGKLRDAKVAPLAHLQPLPNLSSRRPSKDSASPVSLTPPRADLATAPPSPQP
                     YSLVGSPLRSDSHSAQAPL"
     gene            <1693485..>1695293
                     /locus_tag="LMJF_35_4220"
                     /db_xref="GeneID:12980578"
     mRNA            <1693485..>1695293
                     /locus_tag="LMJF_35_4220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722771.1"
                     /db_xref="GeneID:12980578"
     CDS             1693485..1695293
                     /locus_tag="LMJF_35_4220"
                     /note="previous protein_id=AAZ14647.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722819.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980578"
                     /db_xref="UniProtKB/TrEMBL:E9AFP9"
                     /translation="MADFPEWNSGEIVEEDVGEYLDPRSALAAKVPPKMRRQGRLPPK
                     KDTTLSASPKAIVGFVPMMECDVLDDEFADKGLGGLPLELCVDSRQSSKLSPPHHAVP
                     QPKGLPASANGSEAAPTQLASPSLAMRVPPCAASASGVSAADRGSRAAAAPQRLSSAV
                     RASSETGRPNAAPQNTDPSRPPPSKLRSMSGVQSMKSTMPLPAGRPNGSKPSKPSKRV
                     FRVSSSGASVSSADGSTTSECDSSIREAPLPLSAPAGMSLPALQGKAARARPDTLRKS
                     FSAETPAPLQAKIPSHASLSSRASGVRGPQSMPTDRAVSCGVPAPASSSRVANPHSSL
                     KGPVSGSYAVRSSRVAPSVAAPAPTGPTRSSAASTIRTHATRSSSITRSTSQQRTVLN
                     LKSEPEPSSGDYAYGGFFVCERTVEHQSKDSLAGTQVLTAASSAASSTDYSVLRGTYD
                     PYAYGPGTTGSSIAAPRIGSAPGSAMSEQRDTTARLPVLPAFSGQRSNAMLSALLQHP
                     RPPRHAASAGTTASRTHSFSHQGPVSKAAMTGTKALLAASSLAEGSEDEEVKEEEEEE
                     NKMSVSSDRQNADKHRKAEPHKKREVRRRGTDFDKI"
     gene            <1699749..>1702781
                     /locus_tag="LMJF_35_4230"
                     /db_xref="GeneID:12980579"
     mRNA            <1699749..>1702781
                     /locus_tag="LMJF_35_4230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722772.1"
                     /db_xref="GeneID:12980579"
     CDS             1699749..1702781
                     /locus_tag="LMJF_35_4230"
                     /note="previous protein_id=AAZ14648.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722820.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980579"
                     /db_xref="GOA:E9AFQ0"
                     /db_xref="InterPro:IPR002013"
                     /db_xref="UniProtKB/TrEMBL:E9AFQ0"
                     /translation="MSRPTWSHGGRILFNASRVYYVPDEPCLPPLRWMPERQRFEYLR
                     KDIEEDVSLRASLAELAEACSQLYQLQPLQQQLPAASLNGYLPCEALYGVLPLGEASN
                     SALLYVTEKEYVCTLCVGGAEHDVFAVRGLQWLFLPCATSALSGRRQSGRPLRHHRDC
                     LRSGNRNDGGGGEMLDGANDDAESGMYGRHLCNSPNSDSTSETDEEENDNAENGSSVM
                     QRLPTKTLNEYLAVLNRFCESINIEDRGQRARAAAAAAANAHTNGGVQERSSQLPGIV
                     GPANRFSYLYYSPTLDLSADPVHLLALITHSAHPHVEDGAASTSGGAVSDTTNGSLSS
                     NTNRESSGTTTEFSDQPRLSKRALQSAASHLWGERRAAALTRQLYQWNGPLIGDAFAL
                     PTLAVLREEQVRGRAEASKEPSVLEESRREPWRRVCADELLRDELAQYQQRGGQGGGA
                     VSLPAGTMPATSFSSLPLYIPSYIRGLVAQAVAPPSARMTLVTRMCCRWAGTRYNRRG
                     LEPGHSGVVANMAMTSLWVTPQSATSAAPSMEKSEVTSGARRFAVYSMLRGSVPRRWE
                     QPANLSLKPTIKIAPVGNAAEELGRHVRLLKQCLPQLHALYCLDTMSTSELEEPLSEA
                     FATAVRRYNEDPPSPFMAAKSGTYLATSSAGAPAEEKDGAAAAMTAGNGEDLAGASNT
                     PTRDPMVTLVKYNVQRAMKTLPYAGMMRECIAKLDSESGGDTWLDFTKGEAHAPRAGD
                     DRASMSGGESTLHDSSSLTGTGADAGHRDAAPRLSLTHVQSRLVRVNCLDCLDRTNLV
                     QSFLCCAALPQMIEYVEGRSQGLDQPSTSAERLSRGDGDLAQVFDRLRLLLVAQGTAV
                     AQLYAGTKPHFVPYMLNGHYHWSHKARESVLALLRWYQQNFFDGVKQDGVSLVTRQHD
                     PQVFNADIESPFSRDLSGMNHQVLCGVLLGVMPCFYSLLMCVSERGGFSSFVFQLHFG
                     ICMCWIAYLSVLYNKLMRYRVTYTNRPLLLYTRQADWC"
     gene            <1705016..>1705912
                     /locus_tag="LMJF_35_4240"
                     /db_xref="GeneID:12980580"
     mRNA            <1705016..>1705912
                     /locus_tag="LMJF_35_4240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722773.1"
                     /db_xref="GeneID:12980580"
     CDS             1705016..1705912
                     /locus_tag="LMJF_35_4240"
                     /note="previous protein_id=AAZ14649.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722821.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980580"
                     /db_xref="UniProtKB/TrEMBL:E9AFQ1"
                     /translation="MPRVFARPCVTLSAFQMKPYSTMECGAERQTHDMLRHTVERLWH
                     PFTQGHRGADLNIYRFRENLAGLCCPGNIFTCQVNGIVGGTRVLEDFFATLLSGFDIV
                     HTSVEGSRGKPLSNPADICNYTGYYVLAHTRPFLGWKPSATSLRSTGPTSALPETTTR
                     SNVQYEFNGATPETASRSAFLLNDFDGVEAAETTATVDSEPEASSKISTLVVPFTTYV
                     EGLVDHSRLSHLVLRTPVMELLRTRPTCPEAVQKCLESREALKIFATLRRAGVKPELI
                     TATTLLSASKRDPAWMSALGIL"
     gene            <1715055..>1716020
                     /locus_tag="LMJF_35_4250"
                     /db_xref="GeneID:12980581"
     mRNA            <1715055..>1716020
                     /locus_tag="LMJF_35_4250"
                     /product="putative 3-demethylubiquinone-9
                     3-methyltransferase"
                     /transcript_id="XM_003722774.1"
                     /db_xref="GeneID:12980581"
     CDS             1715055..1716020
                     /locus_tag="LMJF_35_4250"
                     /EC_number="2.1.1.64"
                     /note="previous protein_id=AAZ14650.1"
                     /codon_start=1
                     /product="putative 3-demethylubiquinone-9
                     3-methyltransferase"
                     /protein_id="XP_003722822.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980581"
                     /db_xref="GOA:E9AFQ2"
                     /db_xref="InterPro:IPR010233"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9AFQ2"
                     /translation="MRGVAADEVAKFAALQKHWWDPTGPLRSLHLLNPIRVRYVNSIV
                     RSFGNVGGSSCDTSIGFSRDSGLTPQHQVLDVGCGGGILAESLARIGGTVTGIDACAE
                     SIEVAEKRRQQLAANFNASSQVFNWPQRLSYRHVSLFDVVEQEKRQFDVVVASEVIEH
                     VSDARAFLQALCEATKPGGLLFLSTMDKSLKTVIAYIGVAEMLTGLVEPGTHDWRKFI
                     PPDDVTKFAQRFGVRKVDQHYIVTYPDVCQSVVSCNFQVNFFLSKNVNTGHYLWAGRK
                     SSLEAGKQASVPSGEGCVPHAPEYKKQELSLQPHGNGRPDATESS"
     gene            <1717097..>1718230
                     /locus_tag="LMJF_35_4260"
                     /db_xref="GeneID:12980582"
     mRNA            <1717097..>1718230
                     /locus_tag="LMJF_35_4260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722775.1"
                     /db_xref="GeneID:12980582"
     CDS             1717097..1718230
                     /locus_tag="LMJF_35_4260"
                     /note="previous protein_id=AAZ14651.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722823.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980582"
                     /db_xref="GOA:E9AFQ3"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017455"
                     /db_xref="UniProtKB/TrEMBL:E9AFQ3"
                     /translation="MSSSLSSPRPPQAEALPAPRGTIRFEDLGEPVQRLLRSLKGDVS
                     EEDMALLEYVSVKDMAKIYSEMATDRHAEEIWQELRSALQARKEKIARREAELAEKQR
                     ALEAEQEAEEQRLRQQLEEEERERISAEEARQQRREERRRRKAEKAAAAAAAEEEAAE
                     QAAAAAEEAAEEAAAAAEETERQRKAEKKRKRREARARELQEEQDALTAERARHETKK
                     QQKSLNQQKDWSEFVQSHPLEYAQSETLDGAQQQLPAVIEQKELKHTLNAPPVVSEQL
                     LSRTYSPACGACGTRFDRPPPEWNCPMCERRYKKVVKVWQPDDDMENCMMCKEPIGRW
                     SRHHCRNCGRLVCANCSDKRAIIEDLGYDTPVRVCYDCFRLRS"
     gene            <1719780..>1720289
                     /locus_tag="LMJF_35_4270"
                     /db_xref="GeneID:12980583"
     mRNA            <1719780..>1720289
                     /locus_tag="LMJF_35_4270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722776.1"
                     /db_xref="GeneID:12980583"
     CDS             1719780..1720289
                     /locus_tag="LMJF_35_4270"
                     /note="previous protein_id=AAZ14652.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722824.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980583"
                     /db_xref="UniProtKB/TrEMBL:E9AFQ4"
                     /translation="MDQIAVSVSALVHRMEELRLPVVPYSAYIKAVCIGIPLAVLVHD
                     TAEYWLPTKVRVPVLSWFVRRWRQNPEAKHVHLRVIRNLVLFAFFVVLRMDSAANEEA
                     EPSDYVSQRLTSASGQRAVNQEIYKSRRAAFNAATAVLGEEEMNMEGVQQQRDAVLRR
                     RRLHDPNVA"
     gene            <1722216..>1724666
                     /locus_tag="LMJF_35_4280"
                     /db_xref="GeneID:12980584"
     mRNA            <1722216..>1724666
                     /locus_tag="LMJF_35_4280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722777.1"
                     /db_xref="GeneID:12980584"
     CDS             1722216..1724666
                     /locus_tag="LMJF_35_4280"
                     /note="previous protein_id=AAZ14653.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722825.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980584"
                     /db_xref="PDB:4CKM"
                     /db_xref="PDB:4CKN"
                     /db_xref="PDB:4CKP"
                     /db_xref="UniProtKB/TrEMBL:E9AFQ5"
                     /translation="MINSYHQNSSVVSTEDGSSSTVFGNPRIEQRRRHAQQQQQQQQV
                     SRLPGSYERFSETLPPSSKIQQDPVTEYAARRDGEGSIPMLLRNEGSRSQMHHMEAVE
                     SGVAPPPAVRTARTDLPALASPKHSAEEPQTLLETTVMVSTKMPPHEPQVRPLGVYVR
                     TGRGGPNGVTRVVLVRLTDPTDPFFLFELELLEDDYNAFKQHLELLVDFHGFPRYLVG
                     MLRDIADGASAYELSFVLNSAAVGDSNRGTLRVLETTDFKTVEHISLVLLRQGDAGLK
                     RYLAERFQHYEQSFRASEASRAVITAELQEKIGDLQAANDALRASLRKAEEEMRFMMT
                     DAEKEQLVALNRLRDHHTKEMNGARESFDKKVEQLSHALEEKTRQLRDTTHEKDAALA
                     ESHVRTSQLEAKVASLQSQLRSAQDTVSVQTKELATLREMNDELANFKAEATKAMSEN
                     ELNYVTVAERLRGTSTALQSREEKMAALQAHYEKQDEYIRILAEQNRQQADRAHEAEK
                     NLDKAHHIIANQLQAIKNAKGRYHIAMDQLRTQETLLQERDGAARRQQEELTTATERV
                     QELLRKNSDLREQLETTNNAREKLVQEVKLSQQALLRLQQTTSINGRHWGVLSSAYHS
                     REGAAAGVSALNPATGASTADFMREFSAHTQVLSQPGYHGSNLPSRTSLYRSTNLGKA
                     GFVAASNGLAPSTMATATDSATVIQRPSLFAAKAASPSLAHSSQERASSAETAGLTEP
                     HGRASMSSLRKTEPASGAAAASAVQPPVKHLSLDKQSPHTEHFSFNGLAIKSFFGEGD
                     ASQRATVTAGPALESAYF"
     gene            <1728818..>1729795
                     /locus_tag="LMJF_35_4290"
                     /db_xref="GeneID:12980585"
     mRNA            <1728818..>1729795
                     /locus_tag="LMJF_35_4290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722778.1"
                     /db_xref="GeneID:12980585"
     CDS             1728818..1729795
                     /locus_tag="LMJF_35_4290"
                     /note="previous protein_id=AAZ14654.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722826.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980585"
                     /db_xref="UniProtKB/TrEMBL:E9AFQ6"
                     /translation="MEGNQSALTSARSLFQLLNYRNGLEELLLMYWWVIVLGNLVLFA
                     FAKHSLMCWELHRDRRRLECCHMRHCQRRRAAHQSKSVTACRSHRTHTEEAANTTSNA
                     PTETSSSSKDQTEARVTAKHAVDYVSKNEKTTWFPLLVPIVPTLNKYVSPPRTAELMA
                     KAALCRNCSEQEEATATVHQNDTRPPSLLLPLPSVTSSDLSSSSPLSTAQASTSATTR
                     LLNRLGFMSPDLKQTNAERFDISRYSSSSNASSRLSNCCPRYSADEQRLIDQKRQENV
                     RAWMEAKRALELTESLAAGSCGVIPLSSVNAREFQPRRKKGEIETELVS"
     gene            <1737509..>1738258
                     /locus_tag="LMJF_35_4300"
                     /db_xref="GeneID:12980586"
     mRNA            <1737509..>1738258
                     /locus_tag="LMJF_35_4300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722779.1"
                     /db_xref="GeneID:12980586"
     CDS             1737509..1738258
                     /locus_tag="LMJF_35_4300"
                     /note="previous protein_id=AAZ14655.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722827.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980586"
                     /db_xref="UniProtKB/TrEMBL:E9AFQ7"
                     /translation="MKRFPSVLPAAVLCYGSATALQAHRRCAAAVADADERVNAQQQQ
                     DEKPETHQQQQQRTAARENALGSTADEEPPRRRNIVVLSNTTKAVYVHPTNHIASWYW
                     FITDFHKWFVGIVFLFVGTQVIARYRVSKLQTATQAQLGENLLDQRTRDLLSDIEVLR
                     KKDPIRLEHEANIYHEQFWKRRALAVASSRNEVRSLEIQRGKMQGEARGTDMTEWLGA
                     KAKDDEEREVARRTQDYIQGFHQHLKSKRLI"
     gene            <1739192..>1739617
                     /locus_tag="LMJF_35_4310"
                     /db_xref="GeneID:12980587"
     mRNA            <1739192..>1739617
                     /locus_tag="LMJF_35_4310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722780.1"
                     /db_xref="GeneID:12980587"
     CDS             1739192..1739617
                     /locus_tag="LMJF_35_4310"
                     /note="previous protein_id=AAZ14656.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722828.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980587"
                     /db_xref="UniProtKB/TrEMBL:E9AFQ8"
                     /translation="MWDSLVFSGSLIVTALVVVSCGLLYLFLGLAQLTSMLGELFKPS
                     PDQPPNGLQQLIDAVSHMLLSGEVLMHLNQSAFAAAAVLFSLVVLLIFVEEALLRVKE
                     KVRQWGRLPSPQVLHYYNQNSYDTALAQAGRGLSLKKAM"
     gene            <1740416..>1742065
                     /locus_tag="LMJF_35_4320"
                     /db_xref="GeneID:12980588"
     mRNA            <1740416..>1742065
                     /locus_tag="LMJF_35_4320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722781.1"
                     /db_xref="GeneID:12980588"
     CDS             1740416..1742065
                     /locus_tag="LMJF_35_4320"
                     /note="previous protein_id=AAZ14657.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722829.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980588"
                     /db_xref="InterPro:IPR006353"
                     /db_xref="InterPro:IPR006357"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:E9AFQ9"
                     /translation="MRASSWLYRGLLRRTPFYCRRFVPPWEKDGKTAEELFGGILQSS
                     NPIQKQRREAERQRQLEEAAAVEDTLSPEEHRRLEAMEAHNAAVAEERRNFLPYGATP
                     HKYFETSNMAAWGEYKTALRAVANVSASSQSPSNSEDSYSPSVQHQLVEDMEDKIPYK
                     YDTYVEPAASPSSSSAHKPPQWPLHGSVGLVMDIDGVVYRSHRLIPGADTAVRKLSTL
                     RIPFVFMTNSGHQSEADKAEELSALLGCDISANQVLLAHSPMRLLAPEYGEERVLVVG
                     APHCANIAREYGFRRAISAQQYQCEHPEMVPFKKWGALKRAAPGTVLFPAISAILQMS
                     DPEDAFNDIQTVLDVLLAPGGQVGPYVSGSQTTPYFAAADDLLWATEAPLPRLGQGAF
                     REMLASVYESVTGQGMQLQQYGKPRAIAYAFAEKRLKEVSASLGWDPNQFRSIFMIGD
                     NIESDIVGANAAGGLWTSVHVLSGIGRAPAARRTLSVDDFELEWIESCVSKTPHYVAP
                     TLDHFVRELLAFPEAALLQSKAPYHGKPNPVDLQGAYNFRE"
     gene            <1742607..>1744514
                     /locus_tag="LMJF_35_4330"
                     /db_xref="GeneID:12980589"
     mRNA            <1742607..>1744514
                     /locus_tag="LMJF_35_4330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722782.1"
                     /db_xref="GeneID:12980589"
     CDS             1742607..1744514
                     /locus_tag="LMJF_35_4330"
                     /note="previous protein_id=AAZ14658.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722830.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980589"
                     /db_xref="InterPro:IPR012981"
                     /db_xref="UniProtKB/TrEMBL:E9AFR0"
                     /translation="MNPNDAAQQLLQNEKFLELFQRALGNGGGNGNGGDISDMLQSMP
                     EEGDPKREEWLRTLQSRLQEEATKEAKEDLEQVHSDEQGQWMFVLPDPGFCIKTNVAG
                     GAKVFINVCQHARIGEPVPMEPENGSAGQGDTAEMRYRIPISCGQARPGKDKGGKPCK
                     VYDVIVNPSTMQRCGKDHEFRRFVAALCMQWIKQKSEPTLNADEFRNLSFKCKGKLEP
                     QRIRLSTQPKERNVMGDEIRLPTAAGSATAPSQVTGSQGNGKLIQEVLPPTNTNAGPS
                     ASSTEAATPGTAALKPEPVVKSVIAEGVYSWALHKRPTSNPYFKENVPSYFAITLYLP
                     GVQTIREVDVRIGYRRVDCYYIDEVADGEERDEEAAASAEGGERGAAAANKGSGASPF
                     LSLTLDYPVSDDVVEAKYVRKTSLLKLKLAVQLPDEMQAPATRPDRDVTEVEMEEQQR
                     DHLAREEEWAAAKARNERRQQEEAAVMAERRSYVENLSAVKSGDIPPIIRDEVDQMPR
                     EQLPGMLYRLERRIRKGDSIDMLLEKLPEPMLNALIDYICEKLSLEPRQRKASAVKGE
                     HHTASSSSLHEGNPTAAVSPLAAKAAEAEDSNKRPPTESQPAMQVFHATTQSEALFGV
                     QLHNRYLFALD"
     gene            <1745755..>1746783
                     /locus_tag="LMJF_35_4340"
                     /db_xref="GeneID:12980590"
     mRNA            <1745755..>1746783
                     /locus_tag="LMJF_35_4340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722783.1"
                     /db_xref="GeneID:12980590"
     CDS             1745755..1746783
                     /locus_tag="LMJF_35_4340"
                     /note="previous protein_id=AAZ14659.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722831.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980590"
                     /db_xref="UniProtKB/TrEMBL:E9AFR1"
                     /translation="MLRHTCLARVHLFSALVPQVKVQAPHFLSAEGVATAKVALEERK
                     SYMDYPELVECIDALGNIDSALKMSDVAKKLSKCVDALRAQLYRKDSTDPRRRLELHE
                     AVMAAGFYERVISVTQLEGEGIRYVMNHFNFDVRRDTLITRKVHETLAEEKKTTPESE
                     QLLRDLLLLERRLTGKYRFSQLGGRRWFALGMPLSEIKTEKEARRLLDISVIKKDGNF
                     TLCEVDSEKLWKTITIKPNEEPHVTFAEAGNIFTDIRETDMIFELRVQKPQTPPDFWE
                     RLRETLLRYWVLWFAAWVTFFMVDEEIITLVALIFMKHWQTKMLEEEAQKTGGKVYIA
                     SAVGRSRE"
     gene            <1747875..>1751750
                     /locus_tag="LMJF_35_4350"
                     /db_xref="GeneID:12980592"
     mRNA            <1747875..>1751750
                     /locus_tag="LMJF_35_4350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722784.1"
                     /db_xref="GeneID:12980592"
     CDS             1747875..1751750
                     /locus_tag="LMJF_35_4350"
                     /note="previous protein_id=AAZ14660.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722832.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980592"
                     /db_xref="GOA:E9AFR2"
                     /db_xref="InterPro:IPR012908"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:E9AFR2"
                     /translation="MDAPRRLTGGRLLKAVYVFFLLLFGLFATGAYNWAFKVYRTQPQ
                     NINPVMYPLFTEINVSAFAPTMREKYYRLWRTYDWMADSYAAPRVDGVYARVPIVYVH
                     GNGGSYYCARSLARFVYESNARLRQHAMREYRRHVKRQLFQEYRTNQSLEEPEEGARI
                     PEWLQHRVEEKIVREEVPLLGAELFSVDFLEESSTQSASITLKEARFVNHSVHLVMSG
                     FLRTYADVLAAPPAPAFDSDTLDKNDTRRTSGTATLSAATMKLLKEVEREYWQSVCSH
                     SSIAADEKMCRQAKHLTKRFSTLERVRAEVQRVQQQGIWIWAESLGGVTTLLAAILAP
                     HLYAGVVMVGTPMHYPPLFFDHASVWIYEILNAAVLRRYPAPEDVQRVRDSTINWADM
                     VADRKRPNDLLRDLRAVPPAELNHRLRNLTLLGINGGTLDDVIPSISGYLQRSQPRAP
                     GTLVNRSSLLQDGGYRRDISTETLRGCGTAMDHRGLVYGLQFLQHSADSLVRAALLPN
                     ANAYFGREERLPSLHRDRLFPTVVETLGAHRFEEQRLEHIFMSSVRDSLTGKYVKETK
                     FRALSEQLKQVCVDSDAPIDYNDLPVYDEADSRSGYYDGTKVLNVLIGVTTLSPEQVF
                     APNIQLFYDQARETPTLDSEVHERAATLLHLPTMYKGTKPIPGRTLQTAVSFAIYRRM
                     KKHRHQTWLWPRFCMLVGIDQGLGATRTYLQHDKIDLSAFADLSSNHLLSRLLRSFGG
                     GVQVHTQPGYALVRGVDSALLEPQLQVRTDAAAEVFPLVMCGSLHSFYLALRGHGSLP
                     ADEPEHQLQYFYGPFHENLHHFTYRWKPFSTYPPTLNETYLVYTLTDNHGARPDVHLP
                     TYTMLQNASVVSPEYWVWLLVLWPQRWLAAFSMYTGIVRLAGGSVVLFFTLFFALGML
                     DEKMCASETLKAALWRRSPFRRIRVLPPLAGMVVITFVLELVTGLWASTALVVCLSTD
                     PPPYVTDAEMTARMSIWEKFTLVALYGISPSYRACRFSWISMQGVPVWSVFVEQMATV
                     YLGFGMASVFFMLLFGYLAVIGAVTWPLRRLVLLPLLRCAPLLLALLLGLGWAAPTVL
                     LLTCPSFPLCFVDVVGPSLLAVPVWMLPRWTRSGYDYRLVLLFVCLACIFPSHFNGLV
                     LTIRNAILMRKNPAAVGDAERYTPSGSQLIIFGVVQASLACAYASLFCILRNEETLQM
                     AHKNKQKSDDTSAPTSQSGARNDYVLGDLGRRAPRLRSFVEVLNTAFIFASVWVSVVA
                     MRRPIEGGVSLLGNMTLLGYLSTRLLIVL"
     gene            <1753106..>1760020
                     /locus_tag="LMJF_35_4360"
                     /db_xref="GeneID:12980593"
     mRNA            <1753106..>1760020
                     /locus_tag="LMJF_35_4360"
                     /product="putative DNA polymerase epsilon catalytic
                     subunit"
                     /transcript_id="XM_003722785.1"
                     /db_xref="GeneID:12980593"
     CDS             1753106..1760020
                     /locus_tag="LMJF_35_4360"
                     /EC_number="2.7.7.7"
                     /note="previous protein_id=AAZ14661.1"
                     /codon_start=1
                     /product="putative DNA polymerase epsilon catalytic
                     subunit"
                     /protein_id="XP_003722833.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980593"
                     /db_xref="GOA:E9AFR3"
                     /db_xref="InterPro:IPR006133"
                     /db_xref="InterPro:IPR006134"
                     /db_xref="InterPro:IPR006172"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013697"
                     /db_xref="InterPro:IPR029703"
                     /db_xref="UniProtKB/TrEMBL:E9AFR3"
                     /translation="MSTRLESGTRVGWLFNYHPTTEVLQEEEDAFTGEGAQRAVLVLL
                     FQDLAGDTFYVHLHYDPYILVQAVEGHEREVELGLMSTFGQQIISEIVAVEKEDLDLV
                     NHLSGKKRVYLKVVFRNVQDLTTVRGRLEKTVKLNASLGSENPLRSQFSGSLGDAMAK
                     TFAEDPLYSAAGSGRWMDWVQDIREYDVKYHMRVAIDMKVYCGLWYDVTVTEGGARVQ
                     RCDDSRYAPAMPRVIAFDIETTKAPLRFPQPEVDEVYMISYMLDGRGYLIINREIVTE
                     DIAPFEYTPKPEYEGFFDTFNEENEAATLRRFFDEMRKYKPNVYVTYNGDYFDFPFIH
                     ARALYHGMNMRNEIGFTQMADGAFLNKQIPHLDCFYWVKRDSYLPQGSQGLKAVTKYK
                     LGYEPIEVDPEDMLPLAQSQPQRMASYSVSDAVSTWYLYQKYVHPFIFSLATIIPMPP
                     DDVLRKGSGGLCESLLMVQAEANNVVFPNKKEIERERFYEGHLIDTETYIGGRVEALR
                     SGVYRSDIPMTFDMNPDTYQSLMDDVDEALRFTLEVENGVKVEEVTNLEEVRAAVLAK
                     LTNLRDRPHQQEKPFIYHLDVGAMYPNIILTNRLQPYAIARPDVCAGCCFNSPNNEAQ
                     CKRVMSWKWRAELFTAGRYEFQRVKAQLENESFAAGVIEQANLAAVQKKVYGNRKGNV
                     LEGTSYERKDDWKKNQSSLKGAGGAGYRQESRQQQREAADALLQRELGADRAGGGGTS
                     DSDDDADDGPKAYHKLNENTQFNMLKRRLSEYSRKAYGKIHETREVMRSNVVCQRENS
                     FYVDTVRLFRDRRYEYKAALKTWKKRLDAAKDSDERKVCQSRCVQMESLQLAHKCILN
                     SFYGYVMRKGSRWSSMEMAGIVTYLGATLIQMARSLVQQIGVTLELDTDGIWCCLPNT
                     FPENFTLTTTNPSKPKISISYPCVVLNKMVHDRYSNHQYQDLVSTGVYKTHSECSIYF
                     EVDGPYLAMLLPASREEGKSIKKRYAVFNPDGSLAELKGFELKRRGELMLVKDFQSQV
                     FRRFLDGSTLADAYASAAVVADAALDMLESQGEGYDTEEILEKITESSNMTRRLAEYP
                     ESQKSLAITTARRIAEFLGPQMVKDKGLACHFIISRMPTGRPVTERAIPVTIFRADPA
                     VRTHFLRKWTADATVPSELNLKTLLDWDYYTARFSACVQKIVSIPAALQSLPNPVPRV
                     EHPDWLEKRIRHRNSRYRQVSLLGMLSKAQVKNETLAGVSAAAAAAAAVRVDEDEDVV
                     VLKHGGGAGAVEGELQDLEDIVDGAGSSTVRHAPKTQKAGAARAGERRCAAGADAEAD
                     WDEDNADCEGESEDDMERLQREADAELDALAHDVKQRYFAPKSANALDADFFADRGAK
                     RWLAQRKDTWLQRARLRRELALENGLSEVALGGENSDAAALGLATVPDAAGMSSPFID
                     LKSRALATVWNVLEVRDNEESPGTVQVLAALEHSLYSFRVQVRRTVLLDADPALRLEA
                     FDATEVSGRVLPRRAAAGRLYQVNVPPGEEGEQCLNALHVMEGVRQIYEEHRTRVDAF
                     VEQLGCCVSVDSARHLRNARRRPPSKRELFGIDEMNMHTYTNYLSCGAADRAVFVFHA
                     VTEQRGLIATVYPQTNTAFVVFIQPAEAAKPVINWGSICAESAKRLHTSTPEPIQVTS
                     AVAVDQRAAWRQVHQHLSAALESTKAPLLAVLQSCQPTSTLLHQRALPVGLPYLRVLG
                     AAEDERLLSDPFRWTRLLARRLFERFFASLLWVEERLALSRVSGIPLCNIAQDSCVHV
                     LDVLYSRALHRRHHVLWCSSDPLITFDTVEERPREVCMTGGYTSWCVEFSLSRLDVVA
                     LLFSQAIEEGDDPNARVLSDRGVSTHFNILRDLVADLLGQAMENILADTLLNNVARWL
                     RDPASSCYEPRLVELLSSLAHRALTGILLRLAKLGGRAVKVDGSSVTVLTSKYSLQEA
                     VSFARFMTASLQDQPMLLLLSLQPLRYWCPYVVLDPCDYAGLFITEDAIKLKDGEEPT
                     RSDLHVAHQLTMASRLPSRVRSTFAKRVVETLYQLNASTRHVYCGTVADHTVTLATRH
                     EHLTRRLLQDSQKLFEGDLQTEIMDEVQRVTDTRDLYTEEEHAAHERGELTLWSSGAV
                     ALEYAKCVCRVLELIPCNGAVGKVRNNCMRLCGISPFSAQSQFQADPFLAHRLQSVTC
                     SFCNSHILIDLLVRRKSVTSPFTCTACAAPIAAASMEGTLVRHVSQLLRVYNQQDFVC
                     TKCREMTTTYVAERCCGALVGKAAPVEGELRAVHHIAKIQGFAWLAESVEAALLCT"
     gene            <1761027..>1761371
                     /locus_tag="LMJF_35_4370"
                     /db_xref="GeneID:12980594"
     mRNA            <1761027..>1761371
                     /locus_tag="LMJF_35_4370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722786.1"
                     /db_xref="GeneID:12980594"
     CDS             1761027..1761371
                     /locus_tag="LMJF_35_4370"
                     /note="previous protein_id=AAZ14662.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722834.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980594"
                     /db_xref="InterPro:IPR027377"
                     /db_xref="UniProtKB/TrEMBL:E9AFR4"
                     /translation="MLRLSLLLQLRPRHIMFTPPPLAKRTGKFRCKVCQHSWFSDEVW
                     VTKTTQRVYQGESCETCGTTNKPYYVGRPEETIFNRARTPHPVKRGVSSSRSERKLKH
                     SRFDWRVQKGRH"
     gene            <1762158..>1763645
                     /locus_tag="LMJF_35_4380"
                     /db_xref="GeneID:12980595"
     mRNA            <1762158..>1763645
                     /locus_tag="LMJF_35_4380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722787.1"
                     /db_xref="GeneID:12980595"
     CDS             1762158..1763645
                     /locus_tag="LMJF_35_4380"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722835.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4380"
                     /db_xref="EnsemblGenomes-Tr:pseudogenic_transcript"
                     /db_xref="GeneID:12980595"
                     /db_xref="UniProtKB/TrEMBL:E9AFR5"
                     /translation="MSLRLPKDELEAHIYLYLKDSRYTSAAQALEEANPKAVTHSRKI
                     GTSALTAASKELVAAADSDSSDDEPVRKPVAKKASPKMAPKKAPVADSDSDDDVPVRK
                     PVAKKPVADSSSDEEDAPKKPATKRPSPRPSPKQATKKAPVADSDSDDDVPVRKPVAK
                     KPVADSSSDEEDAPKKPATKRPSPKPSPKQAPKKAPVADSDSDDDVPVRKPVAKKPVA
                     DSSSDEEDAPKKPATKRPSPKPSPKQAPKKAPVADSDSDDDEPVRKPVAKKPVADSSS
                     DEEDAPKKPATKRPSPRPSPKQAPIADSDSDDEEERQPVQKRHMAEEDDEEDQPMRQV
                     SRTEAQSSNGSYGGRGGRGGDRGGFRGGDRGGFRGGDRGGFRGGRGGDGGGFRGGDRG
                     GFRGGDRGGFRGGDRGGFRGGDRGGFRGGDRGGFRGGRGGDGGGFRGGDRGGFRGGDR
                     GGFRGGRGGDRGGFRGGRGGAPQIGLSTPSLNTRNQSVKLGSDSD"
     gene            <1765133..>1766368
                     /locus_tag="LMJF_35_4390"
                     /db_xref="GeneID:12980596"
     mRNA            <1765133..>1766368
                     /locus_tag="LMJF_35_4390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722788.1"
                     /db_xref="GeneID:12980596"
     CDS             1765133..1766368
                     /locus_tag="LMJF_35_4390"
                     /note="previous protein_id=AAZ14663.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722836.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980596"
                     /db_xref="UniProtKB/TrEMBL:E9AFR6"
                     /translation="MSYPFIATPGDTATTATGGSTKCGRNKSGGSLAAAAYEKSQYDI
                     TNVTWGTLESRFDELVALMNTPITGVNALTVRATNRQRIGSAIAALLDKAQEECRQLL
                     LDGDAEAAEKAGVLVLRLREKFYKPNHVELIPAYLHLSRTKQFLKRYGDAEDMLSLAQ
                     YIMLKHPDEVTLTLKADLHQAFGLLYAADSKLEAAVQQLSRATYYLSLLHGARHVLTT
                     FSYFDLGNVMAAKASMERAMALYDAVKEIWYAHLVKALADVVARREDMQVQLRYSENT
                     PAQELRQACYATAHAFGRENLADASKMLHGIARLQQKRFQSAHPSTVRAEFILGLFLL
                     WTDNEPAAQRHLLNARVASQHFYGPRHPVVQEIEDWCAKFDLSYENTEDELAKGQEAS
                     ALETTVTTHDYNAEAPHIS"
     gene            <1767346..>1767966
                     /locus_tag="LMJF_35_4400"
                     /db_xref="GeneID:12980597"
     mRNA            <1767346..>1767966
                     /locus_tag="LMJF_35_4400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722789.1"
                     /db_xref="GeneID:12980597"
     CDS             1767346..1767966
                     /locus_tag="LMJF_35_4400"
                     /note="previous protein_id=AAZ14664.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722837.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.35.4400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.35.4400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980597"
                     /db_xref="GOA:E9AFR7"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:E9AFR7"
                     /translation="MSVEKLYDIQFQLKFTAKQFLKNASRCEKEQKQEMNKCKQAMEK
                     NNMEGARIYAQNSIRKKNEALNHLRLSARMDAVVARLDTAIKMKMVTKNMGQMVKGMD
                     KVLQSMDPATISRLMDTFEQQFETMDVTSAYMEGAIGQSTAVTTPEDEVNNLMSQVAD
                     EHGLDIREQLNDNLQIKNTNLTAQKAEEKQVEEDDLEAKFAQLRGR"
     gene            <1770522..>1772075
                     /gene="AAT11"
                     /locus_tag="LMJF_35_4410"
                     /db_xref="GeneID:12980598"
     mRNA            <1770522..>1772075
                     /gene="AAT11"
                     /locus_tag="LMJF_35_4410"
                     /product="putative amino acid permease"
                     /transcript_id="XM_003722790.1"
                     /db_xref="GeneID:12980598"
     CDS             1770522..1772075
                     /gene="AAT11"
                     /locus_tag="LMJF_35_4410"
                     /EC_number="3.6.3.-"
                     /note="previous protein_id=A