GenomeNet

Database: RefSeq
Entry: NC_007285
LinkDB: NC_007285
Original site: NC_007285 
LOCUS       NC_007285            1583653 bp    DNA     linear   CON 18-JUN-2017
DEFINITION  Leishmania major strain Friedlin complete genome, chromosome 33.
ACCESSION   NC_007285 CT005270
VERSION     NC_007285.2
DBLINK      BioProject: PRJNA15564
            BioSample: SAMEA3138173
            Assembly: GCF_000002725.2
KEYWORDS    RefSeq; complete genome.
SOURCE      Leishmania major strain Friedlin
  ORGANISM  Leishmania major strain Friedlin
            Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae;
            Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Rogers,M.B., Hilley,J.D., Dickens,N.J., Wilkes,J., Bates,P.A.,
            Depledge,D.P., Harris,D., Her,Y., Herzyk,P., Imamura,H., Otto,T.D.,
            Sanders,M., Seeger,K., Dujardin,J.C., Berriman,M., Smith,D.F.,
            Hertz-Fowler,C. and Mottram,J.C.
  TITLE     Chromosome and gene copy number variation allow major structural
            change between species and strains of Leishmania
  JOURNAL   Genome Res. 21 (12), 2129-2142 (2011)
   PUBMED   22038252
REFERENCE   2
  AUTHORS   Ivens,A.C., Peacock,C.S., Worthey,E.A., Murphy,L., Aggarwal,G.,
            Berriman,M., Sisk,E., Rajandream,M.A., Adlem,E., Aert,R.,
            Anupama,A., Apostolou,Z., Attipoe,P., Bason,N., Bauser,C., Beck,A.,
            Beverley,S.M., Bianchettin,G., Borzym,K., Bothe,G., Bruschi,C.V.,
            Collins,M., Cadag,E., Ciarloni,L., Clayton,C., Coulson,R.M.,
            Cronin,A., Cruz,A.K., Davies,R.M., De Gaudenzi,J., Dobson,D.E.,
            Duesterhoeft,A., Fazelina,G., Fosker,N., Frasch,A.C., Fraser,A.,
            Fuchs,M., Gabel,C., Goble,A., Goffeau,A., Harris,D.,
            Hertz-Fowler,C., Hilbert,H., Horn,D., Huang,Y., Klages,S.,
            Knights,A., Kube,M., Larke,N., Litvin,L., Lord,A., Louie,T.,
            Marra,M., Masuy,D., Matthews,K., Michaeli,S., Mottram,J.C.,
            Muller-Auer,S., Munden,H., Nelson,S., Norbertczak,H., Oliver,K.,
            O'neil,S., Pentony,M., Pohl,T.M., Price,C., Purnelle,B.,
            Quail,M.A., Rabbinowitsch,E., Reinhardt,R., Rieger,M., Rinta,J.,
            Robben,J., Robertson,L., Ruiz,J.C., Rutter,S., Saunders,D.,
            Schafer,M., Schein,J., Schwartz,D.C., Seeger,K., Seyler,A.,
            Sharp,S., Shin,H., Sivam,D., Squares,R., Squares,S., Tosato,V.,
            Vogt,C., Volckaert,G., Wambutt,R., Warren,T., Wedler,H.,
            Woodward,J., Zhou,S., Zimmermann,W., Smith,D.F., Blackwell,J.M.,
            Stuart,K.D., Barrell,B. and Myler,P.J.
  TITLE     The genome of the kinetoplastid parasite, Leishmania major
  JOURNAL   Science 309 (5733), 436-442 (2005)
   PUBMED   16020728
REFERENCE   3  (bases 1 to 1583653)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 1583653)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR796429.
            On Jun 1, 2012 this sequence version replaced NC_007285.1.
            Data release policy www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1583653
                     /organism="Leishmania major strain Friedlin"
                     /mol_type="genomic DNA"
                     /strain="Friedlin"
                     /db_xref="taxon:347515"
                     /chromosome="33"
     gene            complement(<2078..>4546)
                     /locus_tag="LMJF_33_0010"
                     /db_xref="GeneID:5654754"
     mRNA            complement(<2078..>4546)
                     /locus_tag="LMJF_33_0010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685674.1"
                     /db_xref="GeneID:5654754"
     CDS             complement(2078..4546)
                     /locus_tag="LMJF_33_0010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685726.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654754"
                     /db_xref="InterPro:IPR018392"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4M2"
                     /translation="MRRCTVARYYWSRYRIPSQMPKFDGPAPVAAPQNMNSTKTNEFI
                     DPIDDKFPVTIRGNLVRPDVPEDQYVDSWYVCTSMTHHLGDFRPWSASAPANAYRFRP
                     YNEFDSKGREYVEHLRKYSRYTPQASRGKGANGFPFREAFLTKMNTAETAAVNPTRET
                     VMTRAVAERLHHARVLSPLEVQRDVGRLEEPLPCAGKIPAERSTFPFRWNTEDWYEYE
                     VAKARNKRFVFENTNDNGVCASEVTYRIVLEGFWDHHVMKLADDVVMFLKDVGRQVVD
                     EKLKSVRASLESLSSGGAVDPELVAAFNASLKGPFGGADRYDADEVAHFLRSELERLE
                     EQCVGLINRANVPIPGTSNIYDANVSWPHVEKMEPWTRMAEFWTSSSDTSFTELEMST
                     AHYEFRKYFRVVVVKMPFQSTEFEQRMYGIRHWLHRQTSCEFHTTYRRNVVHDSAVFP
                     TEHDPETKPSHEHHRLFSFALDWQSAPVDYLSVELAREGDSWSSLAKRLGCSESELKA
                     ANGAMEEVVAGVAVSVPGSATRRLTSFSTTPSVLPLQQGDGKPAITSWRRAAEVLGCS
                     VEELQQANGAAALTYMAAAESGDGAFDPAIKELVVPHTATAASPESSFAAFEPVFEGD
                     TWTSIAARLGCSEADLRACNDVDGSVADVSSCASVSVPASATRPRRIIHPQLRPQAAT
                     DALLARTLGEQAVSAMGDIPSLPANAHKFPHEYHTPTSRFPTTPQQSPASDNWIAYTA
                     KYLDKQLALQDEPATVYNVNKLWPMQQVPGKVDQTPFEEDQTWLMHPIPVHQMQQHHP
                     EKDLQDLPFVNHEQFPRSLEWTAP"
     gene            complement(<5088..>5417)
                     /locus_tag="LMJF_33_0020"
                     /db_xref="GeneID:5654342"
     mRNA            complement(<5088..>5417)
                     /locus_tag="LMJF_33_0020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685675.1"
                     /db_xref="GeneID:5654342"
     CDS             complement(5088..5417)
                     /locus_tag="LMJF_33_0020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685727.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654342"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4M1"
                     /translation="MGEVLVTATTISGDTVALDTSAENVYGFQPGQIVHFTKSLRNGK
                     VALIRGISEGLLWFAVLPDVASAASEQALQAPVSTVSCRGKEELIRQYGWMVDDTSNP
                     FAVAPAL"
     gene            complement(<6016..>7686)
                     /locus_tag="LMJF_33_0030"
                     /db_xref="GeneID:5654343"
     mRNA            complement(<6016..>7686)
                     /locus_tag="LMJF_33_0030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685676.1"
                     /db_xref="GeneID:5654343"
     CDS             complement(6016..7686)
                     /locus_tag="LMJF_33_0030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685728.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654343"
                     /db_xref="GOA:Q4Q4M0"
                     /db_xref="InterPro:IPR004340"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4M0"
                     /translation="MLWCKDTFEEQFDPSECRLFPVQQQLFDFVDKAGGGCDGGSSRA
                     PHWLCFSIEFPSASEVSHLLSRHAPTNLFRRRQESSNALAAQRKRVREDFSLLYGATP
                     LSQQSRMFLAATLDGVRSILSRIDPRQLHLYEIIREGSPCHLYLDVERESNHTALQHV
                     IAVDDDSTSSSVEEADSLVQVEEDVGGTRRIVFQCCQSRYQELRRLAVRDPTDVCGLD
                     CRIEPDNRNTCDVLLSALNSFVRDRHPSWVPPGLQAEGPGSVFADAWVLESVPLSGAA
                     TKFSQHYILKLHGRMFESTNSVKAFVRDFVAHVRERAAHDSQLHGALFFHKPPAWYPV
                     FRELPLDYPRTTFPYLPRRCVIDEAVYSKNRMMRCVGSCKLGKQSVLLPYRHYVAGSC
                     VEYFSNSANAASVSLDVFLSTLIAHRFAKDVAPVSLIKLTEEIEAPKNTRACALPASV
                     SEGTAPATLHTVSLDVDIALLTSSLQRAYSQVANRACTVAQPHSLHGRFLSFSVRGTR
                     YCQHIGREHKSNNVYLVVDTERMTFVQKCFDPDCASYRSPPRLLGGTP"
     gene            complement(<8814..>10376)
                     /locus_tag="LMJF_33_0040"
                     /db_xref="GeneID:5654344"
     mRNA            complement(<8814..>10376)
                     /locus_tag="LMJF_33_0040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685677.1"
                     /db_xref="GeneID:5654344"
     CDS             complement(8814..10376)
                     /locus_tag="LMJF_33_0040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685729.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654344"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4L9"
                     /translation="MRCGRILRATRVNSAAYRCFLQALRQCGVEYAPALPESTSDSLS
                     HTSAALFSPLFTTQFDVHQHQLTTLGDALVDRYLSSAVLKYCSRRGITLTTNAASELN
                     AVLHNHFALRLFAKELNFDAMGLTREEVDPASSDPSAAHSLHFLEAETPLLRSQDVAG
                     TSYQVALLPCGQSALGWKFSHFVGAVHQSLGLDAATRVLEHVYQLHDEPNVPRQASRL
                     LLRALEHFPAMNVAEAILAVQGLSVHYTTRSRVLPGNSEQSAESTRAAQAASSERPPP
                     SHGVGVGSSREGDADELAFVAGFSPTGTKARDITLESLTGGSPLSSSLASGPGLMDAV
                     DVWRRRTQELVGRQLEPAPEAAAAPASSTAATDGWLSAQERATYQRGPAFAGWVEVAS
                     TPSFADIYGTSQPEDGRIVRRTKFKKQVRDPRFYDKMSDARNGVPFDTNGEPLTEYLD
                     RFATPHQRIFEVTMQCGAGGELKLVGRAISTRYTTARESACRSFIGGVLHDILTLAGA
                     TDAAGAATGQDA"
     gene            complement(<11121..>11819)
                     /locus_tag="LMJF_33_0050"
                     /db_xref="GeneID:5654345"
     mRNA            complement(<11121..>11819)
                     /locus_tag="LMJF_33_0050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685678.1"
                     /db_xref="GeneID:5654345"
     CDS             complement(11121..11819)
                     /locus_tag="LMJF_33_0050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685730.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654345"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4L8"
                     /translation="MDEFRPDDTTQIEEGSESNAALLQLQDALVSALTASGTLGKIRA
                     QLRATALALIRGDDELQNAAVGPFIRPRTLTTHAKVSLLLLHDFLQHYHLQQTAGVLD
                     VESSVHLLFNERSVLLGDLARLPGDGSLLERLVRLYEPTRQIPAVGPSGATAVTTASQ
                     TSVSIPAAKLPASPVASSSSSASQEQTVAMAQPQDADVQYELDAYEDSIPFSDTEGTI
                     DGNVHCDEVERLTQ"
     gene            complement(<12401..>13711)
                     /locus_tag="LMJF_33_0060"
                     /db_xref="GeneID:5654346"
     mRNA            complement(<12401..>13711)
                     /locus_tag="LMJF_33_0060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685679.1"
                     /db_xref="GeneID:5654346"
     CDS             complement(12401..13711)
                     /locus_tag="LMJF_33_0060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685731.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654346"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4L7"
                     /translation="MSYHGPNREGLGEDLEEAEEAFIDLEDPNIEILDEAALPEEDGD
                     DASDVVDNHAGMDVQDRGNEEEGEGLHLGVEVEDLNAAPDYEPEHDDAFATFVAPAKK
                     PLHAIAVHPQNERIFAVGGEGEEVYILEMDHAGKEPALKATLTGHTDTVSLLSFSPNG
                     QWLASGSLDSSVAVWSTETWERKHTLGDLYGEIMTLLWHPSSLILAAGADDAQAAMWN
                     VVKGTLIMYFVGHRGAVTCTAWSPDVKKLVTGSSDGTVAVFNPKTGDQELCISKDLSP
                     DNAGITALQFVNADQCVVGCEDGTLHVISLRSGKVATHFEDLHEQAIESLAINRSSLL
                     LLTASCDCRVIVWNVADFSPRATVEVGESVIPALWSHSNLIAAGCSDGNIRVWDGRSS
                     AQEPLALLMGHRRMVLGLVTTSTVLASTSDDGTAKFYRFAETFR"
     gene            complement(<14375..>16462)
                     /locus_tag="LMJF_33_0070"
                     /db_xref="GeneID:5654347"
     mRNA            complement(<14375..>16462)
                     /locus_tag="LMJF_33_0070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685680.1"
                     /db_xref="GeneID:5654347"
     CDS             complement(14375..16462)
                     /locus_tag="LMJF_33_0070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685732.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654347"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4L6"
                     /translation="MSVALPYDVLFCTSEDPHHPVSELGGCNGEVKPGSPIPAGWQSA
                     RHGKTPQTLVIRFQGNVWLQQLRILSHEAKIATKVEVRVAKLSEGDDWDNPPSFRNVR
                     FVKLGSVDFNSNEQSHFKSKERKTVHLKTEAYFLKLLFDRPFVNAYNTGHQVGIYSLE
                     CSGYLIEPIAFHADRLPGVETPPQRRSSATPPTKQAAMKRPSSGAPPALVSLDGQRAR
                     SASNVDGGGEKSVPLASLTSPPQARLSYGVSAPSHAAPSGIFRSVRILEFEDFFLRRS
                     EELVSLKAEAVAIEDYHVAAECRDKLALLNNRARKIYELEQDKVQAIIDEHFDTAQKL
                     KMRMNTLVEQLFEETSLPSPAAEPPSARSGDRVSGVASHPRYNASLPSTPVSMAGTPH
                     ADEAVENVKSPASDAIEANEQEGQVITVDTLEPREKAVAHAILSCAGSEEVASVALAN
                     PGFDIQFLIAAVGSFTVACLFSRSFKLRESALIVLTEKMDTLPSPAQAVEDALLRFLD
                     LNAYGLQDPIPNVVFAACTFVRMCLDDTSKCIGGVLSPLVALLPRLLTRCSDNLQRIR
                     DEALTTLTLYVKTPAIPSSSILTAALMEPTDKERRNLLLSNARAQLARLSLFQLLVEK
                     GRLHVDSAGFNSEQVLHKLLLPTVNHPNPEVRDLAVSILGKLVAGHQLAVRDKDLAKI
                     THAGIRETIASKR"
     gene            complement(<17272..>17823)
                     /locus_tag="LMJF_33_0080"
                     /db_xref="GeneID:5654348"
     mRNA            complement(<17272..>17823)
                     /locus_tag="LMJF_33_0080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685681.1"
                     /db_xref="GeneID:5654348"
     CDS             complement(17272..17823)
                     /locus_tag="LMJF_33_0080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685733.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654348"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4L5"
                     /translation="MRPSALCLGGFTMKYKRGTGLWDEDHVNDFDANKYLSARSTMRW
                     YYGMERLQTRNNMNARRATQSYNNNMGLHHSGRGAFERELERRGIQVDKYPLTTTTGA
                     ARVAEMVLLRRQELEAHAKKAMESQRQARRRDAPSEWYDETEGPLNPRFLASMQSNYT
                     QVITELPSSPVTGRRELPGASFA"
     gene            complement(<18395..>20239)
                     /locus_tag="LMJF_33_0090"
                     /db_xref="GeneID:5654349"
     mRNA            complement(<18395..>20239)
                     /locus_tag="LMJF_33_0090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685682.1"
                     /db_xref="GeneID:5654349"
     CDS             complement(18395..20239)
                     /locus_tag="LMJF_33_0090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685734.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654349"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4L4"
                     /translation="MPLAQRTEWRPRPTVPIEHNSTLSTGCQPAAITDVFFSCCASPL
                     CQESALLSIFKQLSADQQCDILSMILTSATSFSKPQLASYVEEALQNDSFLPVHWVRL
                     ATNLPGISHVPPLPWVRITERVLCSSAAPFSSRDDAWTFIARVLGCMEDGGIPRDTIA
                     QCLERCGLFYEACAYASSSSNFVPPPTRLVPDGGWGYGDVIHSMCALPEPPMRWFSAT
                     RSGMPPVLRRYSTLVLLRSVVRKWGVTDNGHNDRWRTFAEAYMTTLEAASAVHFLFGE
                     GNAVTGRFLLPHCHTQQQIATVIRYTCRVGVALALAGLTRSVELLTAHRSLAHVHLTH
                     RRTGQKAHWLFWAQAERSSAALSSCDVSDSTAVALFSPTFFFGIHDRGVLRRCLREVL
                     ATGALAKGDRSLARLFSAIPVSAVEHAVKLLGTVESDALSWWASLYTEAGNFEGAFAV
                     LEATAARGCLPHMGVLVMLLEALRDDRQNFLRAVALLRSSFSQVSETVLRAFVERTAA
                     GITHTTPLALSTRQAMQALNTLDLMSAAHRPATTPDATTDDASSTTAPLLAFAEVADS
                     LKMPIPLHVGAIEGLIAASLKLDYDVSLTVDVVSASGECCWSWTSTPE"
     gene            complement(<21452..>22444)
                     /locus_tag="LMJF_33_0100"
                     /db_xref="GeneID:5654350"
     mRNA            complement(<21452..>22444)
                     /locus_tag="LMJF_33_0100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685683.1"
                     /db_xref="GeneID:5654350"
     CDS             complement(21452..22444)
                     /locus_tag="LMJF_33_0100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685735.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654350"
                     /db_xref="GOA:Q4Q4L3"
                     /db_xref="InterPro:IPR003689"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4L3"
                     /translation="MSSVGVWLPIFFARRGRDERATALLAARARGRRPHTTATLATTK
                     LWLSLANFVSAGMLLTIALLHFFPEALEVESGASPDSVTLCGWMLFGVLIPAVLERSI
                     KAGGAHSHGATLDIEEEHAHGSGTGSSGSTSKLLILLMCFHGMTEGLLLGFENSAAAL
                     LSATVPLSGHKFCDGLVIGVSVAKEMYSEMEEDAVSDEADVEPCIKANRSSNRFWRLL
                     IQGPVGVWLLLTPMTVFCVVMCAALLNGATTAVTSAGFDAAAPAASSVPSMATTSSSV
                     SILAAVQAIGSGSFVYIGLTILCSEKLKGIAANAALLTGVGLTAALFYTTRGYH"
     gene            complement(<25109..>26167)
                     /locus_tag="LMJF_33_0110"
                     /db_xref="GeneID:5654351"
     mRNA            complement(<25109..>26167)
                     /locus_tag="LMJF_33_0110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685684.1"
                     /db_xref="GeneID:5654351"
     CDS             complement(25109..26167)
                     /locus_tag="LMJF_33_0110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685736.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654351"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4L2"
                     /translation="MMEVRCKTAVNTRASLASRLPKIREEAPGTSASLHRKIETTYDA
                     AYAARPASCLTNTHSAHTTTECAVAADGAALANGEQTYILHHHPTSAWESTSHAAARN
                     LQAERPLDFYASARKIEREDDDRRGGLVGRMQRSLDIRTKRAEDARLHPPTPTYHTIE
                     PRSMPAAMVHEKFGVKSNYLDIVECTQLKPETEEQIGYDTAPLTRLPGTTLSQELKVQ
                     SKVITQMGTSNELFRGTPKYLADASVSYMGHVPVAQHNASCIHHGDDTRRLYAKSTMT
                     MSEHGGGVDIAVISSNLAIRHRGGKNARAPRALEPKTTDAINQTVEGRMLQQTLYGTL
                     ERERRMNIRDDSQGHRYF"
     gene            complement(26836..27679)
                     /locus_tag="LMJF_33_0115"
                     /pseudo
                     /db_xref="GeneID:12980790"
     misc_feature    complement(26836..27679)
                     /locus_tag="LMJF_33_0115"
                     /pseudo
                     /db_xref="GeneID:12980790"
     gene            complement(<28433..>29533)
                     /locus_tag="LMJF_33_0120"
                     /db_xref="GeneID:5654352"
     mRNA            complement(<28433..>29533)
                     /locus_tag="LMJF_33_0120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685685.1"
                     /db_xref="GeneID:5654352"
     CDS             complement(28433..29533)
                     /locus_tag="LMJF_33_0120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685737.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654352"
                     /db_xref="InterPro:IPR029412"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4L1"
                     /translation="MGVDDMGAELWALVHHLFRKYRRDPRKAVQELALRTHAEWTSEP
                     GVPLPTIALDVKESPWYHKMCSRHASLLEELHAKHKRDIADAQELVSSLYPDGCNLSE
                     YAEALRTSAALLPCLVPSDTIDHLIQKRGADFQEKGRHEVSNDELVSDVIEGLMIRVL
                     TPRQWWCRGASSVARATRTGIQSNPPTLYVEYERPAGVPHVRRIHLRTNLRPDMPTAQ
                     LARRLAKTHEALLSEAQFQSLLIRCQRLQGQSPVPSVATAPPTGTVAPTAIAALLPTI
                     ANTSSPDAPTARSGKPQKADLGLLYRDPDAALENVDLNDADEVTLQEFKEVMNERFKA
                     KVVKPGDPGYVYDKRVEVSKPTQSSGWDDDSD"
     gene            complement(<30142..>31167)
                     /locus_tag="LMJF_33_0130"
                     /db_xref="GeneID:5654353"
     mRNA            complement(<30142..>31167)
                     /locus_tag="LMJF_33_0130"
                     /product="putative trans-splicing factor"
                     /transcript_id="XM_001685686.1"
                     /db_xref="GeneID:5654353"
     CDS             complement(30142..31167)
                     /locus_tag="LMJF_33_0130"
                     /codon_start=1
                     /product="putative trans-splicing factor"
                     /protein_id="XP_001685738.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654353"
                     /db_xref="GOA:Q4Q4L0"
                     /db_xref="InterPro:IPR002687"
                     /db_xref="InterPro:IPR012976"
                     /db_xref="InterPro:IPR027105"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4L0"
                     /translation="MEEGFDAHVATVTLEEIPAYEENEVTLLSDDDALRYDSVTEVTK
                     LLRSSYLSGMLRRLSDYEQTTGRGRNCIPSDDPEYQYVSDCSSLVLRIEVEKSRVHVF
                     LRAQYSIRFPELAMFFSDSVLYAKVVKIIQNSVDLSSVVGQLDELIPSQLLVVVVACA
                     STTSGRDLSPEELSRVLEACEELENLEMAKQTFLEYIQCSMPLICPNLCAFLGTGITS
                     QLFAISGSVAKLSIMDPADLARLGSRRSNDSGIAIKTTGFLSNCDLVANLPPQLRPKA
                     LRLISSVTLTLARIDANRRAPTNYEGVRERRLACNRMRAWLDPPVLRGAGHNMYERRG
                     RKRRRAS"
     gene            complement(<32010..>33236)
                     /locus_tag="LMJF_33_0140"
                     /db_xref="GeneID:5654354"
     mRNA            complement(<32010..>33236)
                     /locus_tag="LMJF_33_0140"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685687.1"
                     /db_xref="GeneID:5654354"
     CDS             complement(32010..33236)
                     /locus_tag="LMJF_33_0140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685739.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654354"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4K9"
                     /translation="MASAVEAPAGSPAPVYRLPQRDLLDLVATNDVASLLILVRGDNP
                     FDVSPGMELIRYKMSVRRFANMARAENAYVVSNALPQVEAAQIPRIRDASGNSATHVA
                     ASLGFSCMVDILVTECGCAVDEYNASGLTPLHLAALHGHVDAARLLRDLGADPLNPTY
                     CNLPSTAGRHRGFCGRTTLFLAHSKQQAAVVALLVPLYHEFIATTFRGKTATEVWKTA
                     AAGQDVKSLSLLLDVLECRGTVIGALPVSIDFEVEDALWEVLPAVLETILPSRREMTL
                     CQLFFFERLVHLGYVDDTTVVGSSDTVLERVLSTAHVRAWRALVEHGLVQPHKCTLDA
                     VHSSERGDASEAELRALIEEAKAYFSYQVAKKSYVEKGDSHRRRSTLLNRRSVWKQLQ
                     KGLKQLSLSPARCPQS"
     gene            complement(<34049..>34888)
                     /locus_tag="LMJF_33_0150"
                     /db_xref="GeneID:5654355"
     mRNA            complement(<34049..>34888)
                     /locus_tag="LMJF_33_0150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685688.1"
                     /db_xref="GeneID:5654355"
     CDS             complement(34049..34888)
                     /locus_tag="LMJF_33_0150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685740.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654355"
                     /db_xref="InterPro:IPR013883"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4K8"
                     /translation="MGPLPPVLQASLSCRTKFVFRRLRHMGAEHSTGMTKVLMPQFST
                     KRQTGPFLSPVERVTASGQSVVIECGDGVSRVDDGTAVVELFALDSKATEEDAMVEAF
                     GEFAITKDDLIGRTRSSLKRGRVEEDEDLPCYFLAPRRRSCSVGGHNSADADSVLASP
                     SRWGAVETDADGAMWRLLQEYDELLCVEAIGDATEDLYCYPDHRKDDEFDSNAEDFSG
                     NDYPDDADERSGESAERAEEEASGFSTERRGGRVASHSTYGMFCEEGYSERSLSSVWN
                     SDG"
     gene            complement(<36858..>37874)
                     /locus_tag="LMJF_33_0160"
                     /db_xref="GeneID:5654356"
     mRNA            complement(<36858..>37874)
                     /locus_tag="LMJF_33_0160"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685689.1"
                     /db_xref="GeneID:5654356"
     CDS             complement(36858..37874)
                     /locus_tag="LMJF_33_0160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685741.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654356"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4K7"
                     /translation="MALVAAVILFAISFLGCITVFFIAPSFTTSLATRIEKSLDQVVS
                     ETEMSTLPTSWIPHVVGMVQHGLRVLLIPSVLIGAVGVWVLGNPERRRPGKWLMGYGL
                     LVLVHGCVLLYFLLRVFFTGQLGVWQNTSLQLFHDVLEKLDDEASKCLWEYAYPCSGF
                     TSCCVTNTSSLNMSEEELMMDEEVWSSLCFVTTQSGKAVRRRRDPDNTDVLEEVTKVV
                     QEQCGQITAHIGLTEDYPLYSTACALANRSIRITPAHFTTCEDYFIGHFSSTIGFDLC
                     LFFGMTVCSLVAGIVALITNHQRPRSSDFTPLNSPSSSAKETVMMLKGESSDDCRGAN
                     RKRS"
     gene            complement(<40410..>41336)
                     /locus_tag="LMJF_33_0170"
                     /db_xref="GeneID:5654357"
     mRNA            complement(<40410..>41336)
                     /locus_tag="LMJF_33_0170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685690.1"
                     /db_xref="GeneID:5654357"
     CDS             complement(40410..41336)
                     /locus_tag="LMJF_33_0170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685742.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654357"
                     /db_xref="GOA:Q4Q4K6"
                     /db_xref="InterPro:IPR018499"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4K6"
                     /translation="MSILDSARLLTEEGEPNALASGASMEVEENDDIEWVNDVYRQLN
                     GAPNFNQSTWWQRLNKYRALVGLFSGVLSLFGAGVVVWFSSCFSSTLPSFRATCFTSD
                     VLVLAVGMLILATGVLGCVASCCCKHSSLLMILAALFFSYALVCGTCVSYMTYARFHD
                     LHGLQAVWAKMVAVEPAVVCDIENKLECSGFKKGQCCRGAALDEVPLRGAVMMPTACY
                     LEAANGTTFDIDTREEVEWPHTMCASRCSAENAKYDQTCEAVLTSLLRSRFYFLITLP
                     LSCTIFFLILSSITMASVRWKPRIDNRMLHRF"
     gene            complement(<42915..>43403)
                     /locus_tag="LMJF_33_0180"
                     /db_xref="GeneID:5654358"
     mRNA            complement(<42915..>43403)
                     /locus_tag="LMJF_33_0180"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685691.1"
                     /db_xref="GeneID:5654358"
     CDS             complement(42915..43403)
                     /locus_tag="LMJF_33_0180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685743.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654358"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4K5"
                     /translation="MRLRLSSLPNIMHSAWARLCLSLSLSLRHTERTLGDSIAHNGLS
                     TYELSGMHFTSDHVVSLLLFRVAYLQFVPQPVAGEDATVPGSDFGFATVYAMLQHYTT
                     FFLEDCRSPVRLSAALCALPSFESDSSARRVPRSRPLFFGEPRPLRNRLVSGVAAQQR
                     HS"
     gene            complement(<45953..>47503)
                     /locus_tag="LMJF_33_0190"
                     /db_xref="GeneID:5654359"
     mRNA            complement(<45953..>47503)
                     /locus_tag="LMJF_33_0190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685692.1"
                     /db_xref="GeneID:5654359"
     CDS             complement(45953..47503)
                     /locus_tag="LMJF_33_0190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685744.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654359"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4K4"
                     /translation="MGGYIGYNLVYNQQASVSQALWSREDEDVAPVSMPVRPRVALVN
                     MTENLRSCAMGGLRAWLDVADEVELEFPTVTFVEDDEAGAIAGLAAEVRRAALFAWVE
                     LKERHEMDAPFGVKPLCCVVFRSITEVDGQALDAWDVQEVELRRWHGKRFVTRHCVGA
                     SVDGKRAMVLMHDVEGVIDVGPAAALAGGRVSDCGALVRQYGAPSTASFRRWKLSAEA
                     QSSSTPVQPPAKSLQGLGIRLRDGQRCQLWQSPLHIFAALGAVLRYNRADAAVYPNHI
                     TTPVPVSQSASAVSASLWGCVKEWALRCTPTLLHWYTARQAERMERQRQLSSTFVVVV
                     RLAEERAAVTSDVLRVVEEHVAEWMRDMNGASPMKTSLSTANRVCVRDAAARPEELMA
                     APTIQVDLTDTVCSVIAAEWLLIRLTSLFAALGLEPALAQLVAVPGPQASTSLLYPTP
                     NTAHLRHLWLSRSATTSSSTITDNDAKSPRVTWSGRTTQGEHIAGCAATMPIEAGYVV
                     SEHYFSAF"
     gene            complement(<49259..>53713)
                     /locus_tag="LMJF_33_0200"
                     /db_xref="GeneID:5654360"
     mRNA            complement(<49259..>53713)
                     /locus_tag="LMJF_33_0200"
                     /product="putative zinc carboxypeptidase"
                     /transcript_id="XM_001685693.1"
                     /db_xref="GeneID:5654360"
     CDS             complement(49259..53713)
                     /locus_tag="LMJF_33_0200"
                     /codon_start=1
                     /product="putative zinc carboxypeptidase"
                     /protein_id="XP_001685745.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654360"
                     /db_xref="GOA:Q4Q4K3"
                     /db_xref="InterPro:IPR000834"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4K3"
                     /translation="MVQGMLFSSLQSGSAADAVSPPTPKRDAAGAQLHHTRSHSWNPQ
                     RGLTFTPAGSGAFMSKKERRKAWALFLHKNTHAFALIVNACRSSLAVRELQVGSVLLT
                     FLYNVLRHMSGDKQRKAVVLCEKLGVFRVCTSVLQEGKRRLRPGDVDAAFVASLRACE
                     AAALLFTLGSTFNVKLWTLFRLSQSLECTFACASVTFRLLEAEFARYHASLQSDLCQT
                     TTAAALQEYTRKHTRKETLTTLRRFQSRTQWTCTAFSHFCFTLFAFTGNSASAVDLGA
                     RGTELCATAIAMSTFFLTQIAPLLLMSVKYDAPEKTRHPDVRSLVSVDAEHWVPSWVM
                     RLMRRVEFMLLWCVVLMQRLTSFDKVSQMTAEVALRFHVPRGIVFYLLPPSRHMLQMP
                     PRRECVHVILLLLNALLAADRETVLADIKDLGGLKVVVASVLALSEKSSQQWHHFYLQ
                     LCSMYGYTMLPSWNGRPACYVDERLPASLRRQFDVAKSPGGKSHLSEPVSSCHSAVDT
                     RADASQACLSSTQASLAQCVGRSTGTVLDSIISSSLTAARSGRGSLDNFLLLVDIRPD
                     VFSPELRSGDVDPVSELVAFDCSQLPWPFKDAAPPTTAESWYGAPSSVAAAVEDAHLS
                     VPLINVCEEDRVRVLRHHIARLTLLDEATCDGGPTPHVHKVVFERLSSASPGAAGDAP
                     STVEGSADGVEFFSDYESGNLQRAIEVTDSEYDLVLSWDTATNSYTQWFSFGMRHFTP
                     GKTYRFNILNMEKGDSTFNEGQKPLLLHVPDGGNPSDPSAPRSKWTRAGEGIFYFGNA
                     FLRPARAHYFGKNGETASAPAASPLSTSPRPLSTSVNTCAPVSHLGGRAPPPVIAKKR
                     TPAFPTLSPPPTTPPPFTAATSAESGVVKQKCYFTVTFSVTMPTTATGTVYLANCFPF
                     TYTEMREHLAWLAREAHTCPTRSLLPQCLCWTPGGLQVPLLTVTALRNRDTGEPYTTD
                     EIRRRPIALLVARVHPGETNASWVMQGLLDTLLCPPAVAAEYASHLCENFVFKVIPML
                     NADGVIMGNHRCSFAGVDLNRDYTNPKADFNPTLYTMKQLLRYWTGEEKRQVVMFADF
                     HGHSRAKNFLVYGCTMNTIRGIATHSRHKGTRGGDGGRRRRTRKASRTAPAGPEKVMA
                     ALLSQLFPSFSLSQSSFAVTKDKKGSARVVLYDEFGVRMSYGFEATMVGGLVCVPELL
                     RVSAGTHDDDAAAPVSAVCKAEVHYSPTVFRAMGDVFLRALSILFRQWAALTALAVDS
                     GCSDRKSSPSDVLTSTVLQLSWSMTAAAGGDRDPPKNPFSPSSRESGAVLPRAGQYAA
                     ATRGDRRVGSPVRTGASAAPNEPGSGLSVVPVAGQAEALDYLFMADCREGATSAKDED
                     DKDEEGSIASASDISTEEDSEDAEMEEDELLTTTSEKHTRRRRSEAQYAGNASEVSEH
                     SASSPVASGSDDQDWSGCNSSGSAAGDSDDSRSSVSSVDEEIPTNLFT"
     gene            complement(<60139..>62880)
                     /locus_tag="LMJF_33_0210"
                     /db_xref="GeneID:5654361"
     mRNA            complement(<60139..>62880)
                     /locus_tag="LMJF_33_0210"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685694.1"
                     /db_xref="GeneID:5654361"
     CDS             complement(60139..62880)
                     /locus_tag="LMJF_33_0210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685746.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654361"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4K2"
                     /translation="MSLTAEDVKQIIAWFIGIPPAIFYVALAVVCRLHHRWIAFAFSA
                     ASALTLCVWFAMNCLSIVSAILLARSNICAAKRNMENIDDEQKSPDPGRENPQTHCVP
                     INTDGGPMVAQQSEDEGVLSSILDSSKANVNAFEGSTTSSIQGSSSRASANPFHSPCQ
                     ASPAVNVGPQGSAPPRGELVVAPLRETGMLSSPSLLKHPYTKDAAPAISACPPMKPGN
                     LQLYPTQCLNADTDFSGSGEQEKCTPKDHALPLAGRMPISMHTPTDARHTPTPLTIVS
                     ARVAKPSKPLRIALMMPLVSLYMTIIITILTLIGSFMCEYDTHCLFLASPVLGVPWLW
                     ANLLLIKKAFYNTPHMWRSFHCRLVSVLTRWFVFLIVYAASVGVFAAACALEVMYWTP
                     YSIDGEATPLGIRVMGYFAPTLIMLSIGVFLNNLKAMLGIKWETHESEMVANEAPAAT
                     DYHECPQENMALRVLTPEIVPHDGVGRPSPSVGIGSVSGSSSVRTAGNVSAAEVHARL
                     QSQMMPPNFPQTLPEETCSTLSSIVRSLAGGSLFIPHINAPSSAKLSVSMSLLRGTHS
                     NANGSPDHYSSPQPVTFMTSVPQLKTVTMLYVAYRDIYDEEEDAVLSVNASDQRGGMA
                     ATRNKQQTVSVNFEAVMEALEDAKGQDSADANSYVLTAYEDAICVVWGLIPFSSEPVL
                     LAIEKARKIMKAFESRPKPPTSFSNARQELVAAVVSAPHSLVGLVGSGSCRGIHFFNP
                     RQHELGAKMLRRGLAMHRRLPSLQAPLDEPQNPFHCILLDGRSWNSTTSQILARPCGI
                     SGGDQAKTAAKQPKQRGLPVNASSKSTKNQFVIIYNFMEVLQTIEEEWHLVVQRQEHL
                     GSKFSFLSEAVQLLHQGDQSGAQQVLKGAVQSMTASSDADNITLAQMLLEDLDSTEE"
     gene            complement(<64689..>65111)
                     /locus_tag="LMJF_33_0220"
                     /db_xref="GeneID:5654362"
     mRNA            complement(<64689..>65111)
                     /locus_tag="LMJF_33_0220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685695.1"
                     /db_xref="GeneID:5654362"
     CDS             complement(64689..65111)
                     /locus_tag="LMJF_33_0220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685747.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654362"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4K1"
                     /translation="MDQHSISQMQNTLRANMTPEMRESMASMLQSALQGGDGMPGGSV
                     GMMAFGMGENEKGKKVARAAKVYYDLKTGKVDKDFVEKELEPDDLSLPKETVEDYSTE
                     GALEVEFVEDQGKVDACAGKAETISAAEIEVEPTNTTL"
     gene            complement(<66788..>68506)
                     /locus_tag="LMJF_33_0230"
                     /db_xref="GeneID:5654363"
     mRNA            complement(<66788..>68506)
                     /locus_tag="LMJF_33_0230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685696.1"
                     /db_xref="GeneID:5654363"
     CDS             complement(66788..68506)
                     /locus_tag="LMJF_33_0230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685748.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654363"
                     /db_xref="GOA:Q4Q4K0"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4K0"
                     /translation="MVCCCERSWSDIVVVTALVCTTMYSAHSFYTYLFPNTLEALATA
                     FLHPFINMSADELLSKANATHSTSGTSSRWSRLLPMSMTTLCGVRLWGWLLFLTSAFL
                     LLMDMWAYTMAVIIPPGRVPAVFRQRATKSASLALSTFYEPLTRSDTPVALYPSSRTG
                     FRAQKHGRLRAFGADAAMEEGVSQSAQPPADGVAPPNQPPHELFFFNPKANSYTSVQN
                     NHLNFCPMCVTYKPPRAHHCSRCNCCILKYDHHCPWLGQCVGFYNYKNYLLVLLYTWL
                     LTAWALTLLSIALTVYVLEVKENLFGRAPTPKTTAAASAETPPRRTGLGVGANIAEEL
                     DVGPPFFGVMVCIAQSLLFFAMTTYLLKRHFTYARHNITTIDMVIYENERRLFSHGTS
                     EDSDVETDTTKPRVDSNPATYRARTLRSYMRRNIYDLGVQRNLLQVFGDAQLNNPGED
                     VDGNPLPRRCYTDWMESDIPRHRHFVVRWFFRLLPTAAYPPQRTWAQIDMSSRSASSS
                     IHMSARSHASYGTMEGREEGAGAAAPGRVTDASLLTELGVEEEHLLGLRFPTRSSMGI
                     DVDEQP"
     gene            complement(<71532..>73337)
                     /locus_tag="LMJF_33_0235"
                     /db_xref="GeneID:5654364"
     mRNA            complement(<71532..>73337)
                     /locus_tag="LMJF_33_0235"
                     /product="adenosine deaminase-like protein"
                     /transcript_id="XM_001685697.1"
                     /db_xref="GeneID:5654364"
     CDS             complement(71532..73337)
                     /locus_tag="LMJF_33_0235"
                     /codon_start=1
                     /product="adenosine deaminase-like protein"
                     /protein_id="XP_001685749.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0235"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0235"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654364"
                     /db_xref="GOA:Q4Q4J9"
                     /db_xref="InterPro:IPR002466"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4J9"
                     /translation="MEANGAGTPEERAGQLRWIADHLWSDTPHGAVHRAVEAQPQSVW
                     LQLWHRAIADGARRPGPSCAVAAASEQEANWKGKESAIVVAAFVLSIPYRECPCAEEA
                     GVVESGAKAAVRRYVCVSLGSGSRCLAAHDAPPSDAGAKMRRLLELRDGHAEVMARRG
                     FIAFLLGIAEASARCSDRAYADLFLRRRSGDCDVATAVGASGSPQWELRETAAVHFVC
                     TRWMCGSLAAVAGGSGRSGHLLLRAACGCWLDPTVQSEVSANEADCESCTVTHVDRHT
                     LAAHYSPLNGAAPLLHAARVKPGKGRANLSMSCTDKVWRWYALGVQGRRRAPIFPVPM
                     RLSSIHVLHPPFKELGDLQAAVDNAAVTFQWRSRRWWPHKDRDVSLPPTPKLAFFSSA
                     DFAATSPLVAAKLHDASVSIDSSYSRSRWLCVRSAVASRKRGRDEEAEVPALGSAMCS
                     WQCFRSGGDHDCSLVLNTKAGLPRGMTGRALARRCSTSLEIPWQQCPLSRPWMHHRVR
                     QLQASLTEIALISASVKANAAPASYATAAAGERDAQTIIADAEDLSMSQRVHHHHLQP
                     LGTGEDSIRLLWASSSHMDGADLPLDATENFKGSP"
     gene            complement(<75087..>76439)
                     /gene="TDR1"
                     /locus_tag="LMJF_33_0240"
                     /db_xref="GeneID:5654365"
     mRNA            complement(<75087..>76439)
                     /gene="TDR1"
                     /locus_tag="LMJF_33_0240"
                     /product="thiol-dependent reductase 1"
                     /transcript_id="XM_001685698.1"
                     /db_xref="GeneID:5654365"
     CDS             complement(75087..76439)
                     /gene="TDR1"
                     /locus_tag="LMJF_33_0240"
                     /EC_number="1.8.5.1"
                     /codon_start=1
                     /product="thiol-dependent reductase 1"
                     /protein_id="XP_001685750.1"
                     /db_xref="GeneID:5654365"
                     /db_xref="GOA:Q70GE8"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR011767"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q70GE8"
                     /translation="MAARALKLYVSATCPFCHRVEIVAREKQVSYDRVAVGLREEMPQ
                     WYKQINPRETVPTLEVGNAEKRFVFESMLIAQYLDNSGAPAGALMGASSAQRHQIEFF
                     LAQVGDFIAAAHGLLRDPLSGEKRKAVDDNAAYVDGLLAANQTTGPYYCDGEFTMADV
                     ALVPFLVRLKPALMYYAGYDVFCKAPRMKVLWAAAAQRTSVRETSPTAAQCIENYRHL
                     VPESAPMMGANGGHVLYSNLFCPFVDRARLACELRKFQVHTVEVPLHPEPEWYKYINP
                     RDTVPALFTPSGEAVHESQLIVQYIDCVATEGTALVPRGDAEKEYEVGFFVENAGYFV
                     GGLMSWIIRGGEDAKAELQWAAGELEQQLAKHPFGEGPFFGGKRMNAGDVAILPFLVR
                     AKAFMPEFSGGYDLFAHFPLLNVLAEAGMAAPEAKAVFRTLEEYKEHIRQRQRRAQGG
                     "
     gene            complement(<77182..>78198)
                     /locus_tag="LMJF_33_0250"
                     /db_xref="GeneID:5654366"
     mRNA            complement(<77182..>78198)
                     /locus_tag="LMJF_33_0250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685699.1"
                     /db_xref="GeneID:5654366"
     CDS             complement(77182..78198)
                     /locus_tag="LMJF_33_0250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685751.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654366"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4J5"
                     /translation="MKAGQRVQFSLTKPRVEKVIVCLGLREGLDARESRGAVATRVSQ
                     HLLLQCRPSPSDVHNPDTTRTHARDRQGRARNFYEAHTMQARRGRRGRTETLRSPQTW
                     DSSRVVDYLGVWCDRLLLGDARHPARCALLEPHVPEVMWGEAVARVAQSHRHLGSADV
                     LLVSAWEALPFGVVRLCTDAAESGNASPPTSNLAVPGIATLEDALRLFTRSNNGPSRL
                     HIGIGSEHGTCAPFVQHEAPHVQRFLVPLCSFVAALWSVNPVKASEYIASVTATPETL
                     TEGTAKRRLWRTMQHSMLSTRDSAVLNAYYNDDVLDARLSRNHTRYLAETLLRRLAEE
                     DSVA"
     gene            complement(<79750..>80805)
                     /locus_tag="LMJF_33_0260"
                     /db_xref="GeneID:5654367"
     mRNA            complement(<79750..>80805)
                     /locus_tag="LMJF_33_0260"
                     /product="putative RNA-binding protein"
                     /transcript_id="XM_001685700.1"
                     /db_xref="GeneID:5654367"
     CDS             complement(79750..80805)
                     /locus_tag="LMJF_33_0260"
                     /codon_start=1
                     /product="putative RNA-binding protein"
                     /protein_id="XP_001685752.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654367"
                     /db_xref="GOA:Q4Q4J4"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4J4"
                     /translation="MLRRSFAPLLTRASAVCLQGWGKTGSGSGWGSAGDSTSAGGWGS
                     AGDSTSAGGWGSAGDSTSAGGWGSAGDSTSAGGWGSAGDSTSAGRWGSAGDSTSAGGW
                     GSAGDSTSAGRWGSAGGRGRGRGSRGKSGWGARDSSDGWGGGRGGGHSGWGGDGGWKD
                     APTGDRQRGARGSFRRGRGGSGGGVWGQPAAADEDAWNAAPPSFQPPVRRVDPLTLTA
                     VEVEVDGVKKLVGQRVQVSGLSDETTWHTLKDHLRQAGDITFCRLFSGGRGMVEFAVP
                     EDAARCITELQASELEGATLYLREDREDTVLINTRRKIRDARDSQLRARKAEAEKSRR
                     EKAIAQGDVTNDSAAAQ"
     gene            complement(<84524..>85591)
                     /locus_tag="LMJF_33_0270"
                     /db_xref="GeneID:5654368"
     mRNA            complement(<84524..>85591)
                     /locus_tag="LMJF_33_0270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685701.1"
                     /db_xref="GeneID:5654368"
     CDS             complement(84524..85591)
                     /locus_tag="LMJF_33_0270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685753.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654368"
                     /db_xref="GOA:Q4Q4J3"
                     /db_xref="InterPro:IPR007248"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4J3"
                     /translation="MKFILHSLSYYLKEYPLRTNMALSTTIGFCGDIVCQTIYEPWLQ
                     SRPPLTRERLPNESQNSPFLITVQSPFLCARQRWRACQADRGTAVSSPADGATKNASL
                     LASSSAAGGNTTILLDLRRSMIFCSFTFLFGVPYFLWVYRHLDRLIDPAAITKRRAIG
                     KGFLSYIAAQLTSPIYLTYVTAMDHFFIYRDGRDGRRRVMAIPMNTVTKAREHVVVAG
                     DDDAGMADAQKGTGRFRFVFSPFCNTMSELDQATIHKMGYHYRIVDNHSFNFHEYFTC
                     VSLDVRRKLIYDLPDIMKYALAFWSVNWLPMFYYIPGHFRLAYSSGLQVVWSGIMSFI
                     LHRSKKVDGGDASMKQPLHTL"
     gene            complement(<86822..>88357)
                     /locus_tag="LMJF_33_0280"
                     /db_xref="GeneID:5654369"
     mRNA            complement(<86822..>88357)
                     /locus_tag="LMJF_33_0280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685702.1"
                     /db_xref="GeneID:5654369"
     CDS             complement(86822..88357)
                     /locus_tag="LMJF_33_0280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685754.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654369"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4J2"
                     /translation="MAGGSQPHRKRPRQGVLVDPLSREIYQMVVRQLHHDGFLAAASA
                     VCDATGVVVGNVEDEGDRLARVVAAGLSVNEMERRAEEEFRYTQVVERFLSASKLYMP
                     LSLSSRWSVGRRCLRMRERFMSASLGGVVRDICFSPDGAYIACAGTNGLAAIFSLETI
                     EDVSALEEARAANRARALDGSRDAGSFGSGETAPKGSAIRNANEVTELAMVRRFHEHT
                     QSVEVMRFHPTSPLVLSGGREGVLYLRNYAYPDSKVVLKIHDTVPIRDASFHPSGEYI
                     VVAANHHLPRLINVRTEKVLTPPGTYASSTAHTGPQWESEDSGAAATSYRPTDRGAQH
                     SAALSSVSFAPDGRTMMSTSLDGTWMLYDGVSGRVIYRAENAHSGVPVTSVVYSRTGN
                     VVLTAGMDSTARLWDLRRLHATSRNYQSPEVTSFGEPTKCECRSIRAVFSANESHVHC
                     HDSTLLAVHSYCVYTGAVDSTVTTQPSFMQRGLAASPWANCIVTGGDDSRLRLWTPAW
                     LPS"
     gene            complement(89650..89751)
                     /gene="LM33Cs1C4.1"
                     /locus_tag="LMJF_33_snoRNA0001"
                     /old_locus_tag="LMJF_33_snoRNA0108"
                     /db_xref="GeneID:12980791"
     ncRNA           complement(89650..89751)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C4.1"
                     /locus_tag="LMJF_33_snoRNA0001"
                     /old_locus_tag="LMJF_33_snoRNA0108"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460998.1"
                     /db_xref="GeneID:12980791"
     ncRNA           complement(89650..89749)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C4.1"
                     /locus_tag="LMJF_33_snoRNA0001"
                     /old_locus_tag="LMJF_33_snoRNA0108"
                     /transcript_id="XR_002460999.1"
                     /db_xref="GeneID:12980791"
     gene            complement(89829..89931)
                     /gene="LM33Cs1C3.1"
                     /locus_tag="LMJF_33_snoRNA0002"
                     /old_locus_tag="LMJF_33_snoRNA0099"
                     /db_xref="GeneID:12981206"
     ncRNA           complement(89829..89931)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C3.1"
                     /locus_tag="LMJF_33_snoRNA0002"
                     /old_locus_tag="LMJF_33_snoRNA0099"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461000.1"
                     /db_xref="GeneID:12981206"
     ncRNA           complement(89829..89929)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C3.1"
                     /locus_tag="LMJF_33_snoRNA0002"
                     /old_locus_tag="LMJF_33_snoRNA0099"
                     /transcript_id="XR_002461001.1"
                     /db_xref="GeneID:12981206"
     gene            complement(89974..90041)
                     /gene="LM33Cs1H1.1"
                     /locus_tag="LMJF_33_snoRNA0093"
                     /db_xref="GeneID:12981207"
     ncRNA           complement(89974..90041)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1H1.1"
                     /locus_tag="LMJF_33_snoRNA0093"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461064.1"
                     /db_xref="GeneID:12981207"
     gene            complement(90096..90189)
                     /gene="LM33Cs1C2.1"
                     /locus_tag="LMJF_33_snoRNA0004"
                     /old_locus_tag="LMJF_33_snoRNA0115"
                     /db_xref="GeneID:12981282"
     ncRNA           complement(90096..90189)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C2.1"
                     /locus_tag="LMJF_33_snoRNA0004"
                     /old_locus_tag="LMJF_33_snoRNA0115"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461002.1"
                     /db_xref="GeneID:12981282"
     ncRNA           complement(90096..90187)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C2.1"
                     /locus_tag="LMJF_33_snoRNA0004"
                     /old_locus_tag="LMJF_33_snoRNA0115"
                     /transcript_id="XR_002461003.1"
                     /db_xref="GeneID:12981282"
     gene            complement(90225..90319)
                     /gene="LM33Cs1C1.1"
                     /locus_tag="LMJF_33_snoRNA0005"
                     /old_locus_tag="LMJF_33_snoRNA0121"
                     /db_xref="GeneID:12981208"
     ncRNA           complement(90225..90319)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C1.1"
                     /locus_tag="LMJF_33_snoRNA0005"
                     /old_locus_tag="LMJF_33_snoRNA0121"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461004.1"
                     /db_xref="GeneID:12981208"
     ncRNA           complement(90225..90317)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C1.1"
                     /locus_tag="LMJF_33_snoRNA0005"
                     /old_locus_tag="LMJF_33_snoRNA0121"
                     /transcript_id="XR_002461005.1"
                     /db_xref="GeneID:12981208"
     gene            complement(90479..90580)
                     /gene="LM33Cs1C4.2"
                     /locus_tag="LMJF_33_snoRNA0006"
                     /old_locus_tag="LMJF_33_snoRNA0109"
                     /db_xref="GeneID:12981209"
     ncRNA           complement(90479..90580)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C4.2"
                     /locus_tag="LMJF_33_snoRNA0006"
                     /old_locus_tag="LMJF_33_snoRNA0109"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461006.1"
                     /db_xref="GeneID:12981209"
     ncRNA           complement(90479..90578)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C4.2"
                     /locus_tag="LMJF_33_snoRNA0006"
                     /old_locus_tag="LMJF_33_snoRNA0109"
                     /transcript_id="XR_002461007.1"
                     /db_xref="GeneID:12981209"
     gene            complement(90658..90760)
                     /gene="LM33Cs1C3.2"
                     /locus_tag="LMJF_33_snoRNA0007"
                     /old_locus_tag="LMJF_33_snoRNA0100"
                     /db_xref="GeneID:12981210"
     ncRNA           complement(90658..90760)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C3.2"
                     /locus_tag="LMJF_33_snoRNA0007"
                     /old_locus_tag="LMJF_33_snoRNA0100"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461008.1"
                     /db_xref="GeneID:12981210"
     ncRNA           complement(90658..90758)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C3.2"
                     /locus_tag="LMJF_33_snoRNA0007"
                     /old_locus_tag="LMJF_33_snoRNA0100"
                     /transcript_id="XR_002461009.1"
                     /db_xref="GeneID:12981210"
     gene            complement(90803..90870)
                     /gene="LM33Cs1H1.2"
                     /locus_tag="LMJF_33_snoRNA0094"
                     /db_xref="GeneID:12981211"
     ncRNA           complement(90803..90870)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1H1.2"
                     /locus_tag="LMJF_33_snoRNA0094"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461065.1"
                     /db_xref="GeneID:12981211"
     gene            complement(90913..91006)
                     /gene="LM33Cs1C2.2"
                     /locus_tag="LMJF_33_snoRNA0009"
                     /old_locus_tag="LMJF_33_snoRNA0116"
                     /db_xref="GeneID:12981283"
     ncRNA           complement(90913..91006)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C2.2"
                     /locus_tag="LMJF_33_snoRNA0009"
                     /old_locus_tag="LMJF_33_snoRNA0116"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461010.1"
                     /db_xref="GeneID:12981283"
     ncRNA           complement(90913..91004)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C2.2"
                     /locus_tag="LMJF_33_snoRNA0009"
                     /old_locus_tag="LMJF_33_snoRNA0116"
                     /transcript_id="XR_002461011.1"
                     /db_xref="GeneID:12981283"
     gene            complement(91042..91136)
                     /gene="LM33Cs1C1.2"
                     /locus_tag="LMJF_33_snoRNA0010"
                     /old_locus_tag="LMJF_33_snoRNA0122"
                     /db_xref="GeneID:12981212"
     ncRNA           complement(91042..91136)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C1.2"
                     /locus_tag="LMJF_33_snoRNA0010"
                     /old_locus_tag="LMJF_33_snoRNA0122"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461012.1"
                     /db_xref="GeneID:12981212"
     ncRNA           complement(91042..91134)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C1.2"
                     /locus_tag="LMJF_33_snoRNA0010"
                     /old_locus_tag="LMJF_33_snoRNA0122"
                     /transcript_id="XR_002461013.1"
                     /db_xref="GeneID:12981212"
     gene            complement(91296..91397)
                     /gene="LM33Cs1C4.3"
                     /locus_tag="LMJF_33_snoRNA0011"
                     /old_locus_tag="LMJF_33_snoRNA0110"
                     /db_xref="GeneID:12981213"
     ncRNA           complement(91296..91397)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C4.3"
                     /locus_tag="LMJF_33_snoRNA0011"
                     /old_locus_tag="LMJF_33_snoRNA0110"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461014.1"
                     /db_xref="GeneID:12981213"
     ncRNA           complement(91296..91395)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C4.3"
                     /locus_tag="LMJF_33_snoRNA0011"
                     /old_locus_tag="LMJF_33_snoRNA0110"
                     /transcript_id="XR_002461015.1"
                     /db_xref="GeneID:12981213"
     gene            complement(91475..91577)
                     /gene="LM33Cs1C3.3"
                     /locus_tag="LMJF_33_snoRNA0012"
                     /old_locus_tag="LMJF_33_snoRNA0101"
                     /db_xref="GeneID:12981229"
     ncRNA           complement(91475..91577)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C3.3"
                     /locus_tag="LMJF_33_snoRNA0012"
                     /old_locus_tag="LMJF_33_snoRNA0101"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461016.1"
                     /db_xref="GeneID:12981229"
     ncRNA           complement(91475..91575)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C3.3"
                     /locus_tag="LMJF_33_snoRNA0012"
                     /old_locus_tag="LMJF_33_snoRNA0101"
                     /transcript_id="XR_002461017.1"
                     /db_xref="GeneID:12981229"
     gene            complement(91620..91687)
                     /gene="LM33Cs1H1.3"
                     /locus_tag="LMJF_33_snoRNA0095"
                     /db_xref="GeneID:12981230"
     ncRNA           complement(91620..91687)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1H1.3"
                     /locus_tag="LMJF_33_snoRNA0095"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461066.1"
                     /db_xref="GeneID:12981230"
     gene            complement(91736..91829)
                     /gene="LM33Cs1C2.3"
                     /locus_tag="LMJF_33_snoRNA0014"
                     /old_locus_tag="LMJF_33_snoRNA0117"
                     /db_xref="GeneID:12981284"
     ncRNA           complement(91736..91829)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C2.3"
                     /locus_tag="LMJF_33_snoRNA0014"
                     /old_locus_tag="LMJF_33_snoRNA0117"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461018.1"
                     /db_xref="GeneID:12981284"
     ncRNA           complement(91736..91827)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C2.3"
                     /locus_tag="LMJF_33_snoRNA0014"
                     /old_locus_tag="LMJF_33_snoRNA0117"
                     /transcript_id="XR_002461019.1"
                     /db_xref="GeneID:12981284"
     gene            complement(91865..91959)
                     /gene="LM33Cs1C1.3"
                     /locus_tag="LMJF_33_snoRNA0015"
                     /old_locus_tag="LMJF_33_snoRNA0123"
                     /db_xref="GeneID:12981231"
     ncRNA           complement(91865..91959)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C1.3"
                     /locus_tag="LMJF_33_snoRNA0015"
                     /old_locus_tag="LMJF_33_snoRNA0123"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461020.1"
                     /db_xref="GeneID:12981231"
     ncRNA           complement(91865..91957)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C1.3"
                     /locus_tag="LMJF_33_snoRNA0015"
                     /old_locus_tag="LMJF_33_snoRNA0123"
                     /transcript_id="XR_002461021.1"
                     /db_xref="GeneID:12981231"
     gene            complement(92119..92220)
                     /gene="LM33Cs1C4.4"
                     /locus_tag="LMJF_33_snoRNA0016"
                     /old_locus_tag="LMJF_33_snoRNA0111"
                     /db_xref="GeneID:12981232"
     ncRNA           complement(92119..92220)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C4.4"
                     /locus_tag="LMJF_33_snoRNA0016"
                     /old_locus_tag="LMJF_33_snoRNA0111"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461022.1"
                     /db_xref="GeneID:12981232"
     ncRNA           complement(92119..92218)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C4.4"
                     /locus_tag="LMJF_33_snoRNA0016"
                     /old_locus_tag="LMJF_33_snoRNA0111"
                     /transcript_id="XR_002461023.1"
                     /db_xref="GeneID:12981232"
     gene            complement(92298..92400)
                     /gene="LM33Cs1C3.4"
                     /locus_tag="LMJF_33_snoRNA0017"
                     /old_locus_tag="LMJF_33_snoRNA0102"
                     /db_xref="GeneID:12981233"
     ncRNA           complement(92298..92400)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C3.4"
                     /locus_tag="LMJF_33_snoRNA0017"
                     /old_locus_tag="LMJF_33_snoRNA0102"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461024.1"
                     /db_xref="GeneID:12981233"
     ncRNA           complement(92298..92398)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C3.4"
                     /locus_tag="LMJF_33_snoRNA0017"
                     /old_locus_tag="LMJF_33_snoRNA0102"
                     /transcript_id="XR_002461025.1"
                     /db_xref="GeneID:12981233"
     gene            complement(92443..92510)
                     /gene="LM33Cs1H1.4"
                     /locus_tag="LMJF_33_snoRNA0096"
                     /db_xref="GeneID:12981234"
     ncRNA           complement(92443..92510)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1H1.4"
                     /locus_tag="LMJF_33_snoRNA0096"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461067.1"
                     /db_xref="GeneID:12981234"
     gene            complement(92565..92658)
                     /gene="LM33Cs1C2.4"
                     /locus_tag="LMJF_33_snoRNA0019"
                     /old_locus_tag="LMJF_33_snoRNA0118"
                     /db_xref="GeneID:12981285"
     ncRNA           complement(92565..92658)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C2.4"
                     /locus_tag="LMJF_33_snoRNA0019"
                     /old_locus_tag="LMJF_33_snoRNA0118"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461026.1"
                     /db_xref="GeneID:12981285"
     ncRNA           complement(92565..92656)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C2.4"
                     /locus_tag="LMJF_33_snoRNA0019"
                     /old_locus_tag="LMJF_33_snoRNA0118"
                     /transcript_id="XR_002461027.1"
                     /db_xref="GeneID:12981285"
     gene            complement(92694..92788)
                     /gene="LM33Cs1C1.4"
                     /locus_tag="LMJF_33_snoRNA0020"
                     /old_locus_tag="LMJF_33_snoRNA0124"
                     /db_xref="GeneID:12981235"
     ncRNA           complement(92694..92788)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C1.4"
                     /locus_tag="LMJF_33_snoRNA0020"
                     /old_locus_tag="LMJF_33_snoRNA0124"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461028.1"
                     /db_xref="GeneID:12981235"
     ncRNA           complement(92694..92786)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C1.4"
                     /locus_tag="LMJF_33_snoRNA0020"
                     /old_locus_tag="LMJF_33_snoRNA0124"
                     /transcript_id="XR_002461029.1"
                     /db_xref="GeneID:12981235"
     gene            complement(92948..93049)
                     /gene="LM33Cs1C4.5"
                     /locus_tag="LMJF_33_snoRNA0021"
                     /old_locus_tag="LMJF_33_snoRNA0112"
                     /db_xref="GeneID:12981236"
     ncRNA           complement(92948..93049)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C4.5"
                     /locus_tag="LMJF_33_snoRNA0021"
                     /old_locus_tag="LMJF_33_snoRNA0112"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461030.1"
                     /db_xref="GeneID:12981236"
     ncRNA           complement(92948..93047)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C4.5"
                     /locus_tag="LMJF_33_snoRNA0021"
                     /old_locus_tag="LMJF_33_snoRNA0112"
                     /transcript_id="XR_002461031.1"
                     /db_xref="GeneID:12981236"
     gene            complement(93127..93229)
                     /gene="LM33Cs1C3.5"
                     /locus_tag="LMJF_33_snoRNA0022"
                     /old_locus_tag="LMJF_33_snoRNA0103"
                     /db_xref="GeneID:12981237"
     ncRNA           complement(93127..93229)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C3.5"
                     /locus_tag="LMJF_33_snoRNA0022"
                     /old_locus_tag="LMJF_33_snoRNA0103"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461032.1"
                     /db_xref="GeneID:12981237"
     ncRNA           complement(93127..93227)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C3.5"
                     /locus_tag="LMJF_33_snoRNA0022"
                     /old_locus_tag="LMJF_33_snoRNA0103"
                     /transcript_id="XR_002461033.1"
                     /db_xref="GeneID:12981237"
     gene            complement(95481..97247)
                     /locus_tag="LMJF_33_ncRNA1"
                     /db_xref="GeneID:12981238"
     ncRNA           complement(95481..97247)
                     /ncRNA_class="other"
                     /locus_tag="LMJF_33_ncRNA1"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460995.1"
                     /db_xref="GeneID:12981238"
     gene            complement(<99629..>101413)
                     /locus_tag="LMJF_33_0290"
                     /db_xref="GeneID:5654392"
     mRNA            complement(<99629..>101413)
                     /locus_tag="LMJF_33_0290"
                     /product="putative glucose transporter/membrane
                     transporter D2"
                     /transcript_id="XM_001685703.1"
                     /db_xref="GeneID:5654392"
     CDS             complement(99629..101413)
                     /locus_tag="LMJF_33_0290"
                     /codon_start=1
                     /product="putative glucose transporter/membrane
                     transporter D2"
                     /protein_id="XP_001685755.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654392"
                     /db_xref="GOA:Q4Q4J1"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4J1"
                     /translation="MTSANMSRKEQLSNRKSTTEANVDLPLIAAAANSPSTTLKKGSS
                     VPELPTSLDEDEEEDSPQPLPNTPFFSMKNLIVAIPIILTPLLYGYNLGFVGPYSTMY
                     GYASNCQLYNAKRSCETLTAAKCRWFNASAYVSNTTYGEVCGWADRTTCFLRYSDEAG
                     CLSDSACKWSYSANTCGNQVGYSSIESGVFAGSLVIGSTMGALMGGYLTKRLDYCKSF
                     MCIGILSVIGNVLTHVATGLFHYWLLFVARIVLGFPLGWQSITSSHYTDKFAPANHAK
                     TLGTLFQVSVSTGIFVTSFFGLVLGNTIQYDEASNANTMGRMQGLVSVSTLLSIFVVF
                     LPLITKDGYSKSRRGDYEEENSEDASRKAAEEYTMTQMIGPILNGVAMGCVTQLTGIN
                     ANMNFAPTIMSNLGLQPLVGNIIVMTWNMLATFCVIPLSRRFSMRTLFLFCGFVGSLC
                     CVFLGGIPVYPGVTKSDKAVSGIAITGIAIFIALYEMGVGPCFYVLAVDVFPESFRPI
                     GSSITVGVMFIFNLVINICYPIATESISGGPSGNPNKGQAVAFIFFGCIGVVACVVEY
                     FFLQPWEEPGAKMTDDLDGAAVPEGKHD"
     gene            complement(102076..102177)
                     /gene="LM33Cs1C4.6"
                     /locus_tag="LMJF_33_snoRNA0023"
                     /old_locus_tag="LMJF_33_snoRNA0113"
                     /db_xref="GeneID:12980792"
     ncRNA           complement(102076..102177)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C4.6"
                     /locus_tag="LMJF_33_snoRNA0023"
                     /old_locus_tag="LMJF_33_snoRNA0113"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461034.1"
                     /db_xref="GeneID:12980792"
     ncRNA           complement(102076..102175)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C4.6"
                     /locus_tag="LMJF_33_snoRNA0023"
                     /old_locus_tag="LMJF_33_snoRNA0113"
                     /transcript_id="XR_002461035.1"
                     /db_xref="GeneID:12980792"
     gene            complement(102255..102357)
                     /gene="LM33Cs1C3.6"
                     /locus_tag="LMJF_33_snoRNA0024"
                     /old_locus_tag="LMJF_33_snoRNA0104"
                     /db_xref="GeneID:12981239"
     ncRNA           complement(102255..102357)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C3.6"
                     /locus_tag="LMJF_33_snoRNA0024"
                     /old_locus_tag="LMJF_33_snoRNA0104"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461036.1"
                     /db_xref="GeneID:12981239"
     ncRNA           complement(102255..102355)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C3.6"
                     /locus_tag="LMJF_33_snoRNA0024"
                     /old_locus_tag="LMJF_33_snoRNA0104"
                     /transcript_id="XR_002461037.1"
                     /db_xref="GeneID:12981239"
     gene            complement(102400..102467)
                     /gene="LM33Cs1H1.5"
                     /locus_tag="LMJF_33_snoRNA0097"
                     /db_xref="GeneID:12981240"
     ncRNA           complement(102400..102467)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1H1.5"
                     /locus_tag="LMJF_33_snoRNA0097"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461068.1"
                     /db_xref="GeneID:12981240"
     gene            complement(102522..102615)
                     /gene="LM33Cs1C2.5"
                     /locus_tag="LMJF_33_snoRNA0026"
                     /old_locus_tag="LMJF_33_snoRNA0119"
                     /db_xref="GeneID:12981286"
     ncRNA           complement(102522..102615)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C2.5"
                     /locus_tag="LMJF_33_snoRNA0026"
                     /old_locus_tag="LMJF_33_snoRNA0119"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461038.1"
                     /db_xref="GeneID:12981286"
     ncRNA           complement(102522..102613)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C2.5"
                     /locus_tag="LMJF_33_snoRNA0026"
                     /old_locus_tag="LMJF_33_snoRNA0119"
                     /transcript_id="XR_002461039.1"
                     /db_xref="GeneID:12981286"
     gene            complement(102651..102745)
                     /gene="LM33Cs1C1.5"
                     /locus_tag="LMJF_33_snoRNA0027"
                     /old_locus_tag="LMJF_33_snoRNA0125"
                     /db_xref="GeneID:12981241"
     ncRNA           complement(102651..102745)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C1.5"
                     /locus_tag="LMJF_33_snoRNA0027"
                     /old_locus_tag="LMJF_33_snoRNA0125"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461040.1"
                     /db_xref="GeneID:12981241"
     ncRNA           complement(102651..102743)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C1.5"
                     /locus_tag="LMJF_33_snoRNA0027"
                     /old_locus_tag="LMJF_33_snoRNA0125"
                     /transcript_id="XR_002461041.1"
                     /db_xref="GeneID:12981241"
     gene            complement(102905..103006)
                     /gene="LM33Cs1C4.7"
                     /locus_tag="LMJF_33_snoRNA0028"
                     /old_locus_tag="LMJF_33_snoRNA0114"
                     /db_xref="GeneID:12981242"
     ncRNA           complement(102905..103006)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C4.7"
                     /locus_tag="LMJF_33_snoRNA0028"
                     /old_locus_tag="LMJF_33_snoRNA0114"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461042.1"
                     /db_xref="GeneID:12981242"
     ncRNA           complement(102905..103004)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C4.7"
                     /locus_tag="LMJF_33_snoRNA0028"
                     /old_locus_tag="LMJF_33_snoRNA0114"
                     /transcript_id="XR_002461043.1"
                     /db_xref="GeneID:12981242"
     gene            complement(103084..103186)
                     /gene="LM33Cs1C3.7"
                     /locus_tag="LMJF_33_snoRNA0029"
                     /old_locus_tag="LMJF_33_snoRNA0105"
                     /db_xref="GeneID:12981243"
     ncRNA           complement(103084..103186)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C3.7"
                     /locus_tag="LMJF_33_snoRNA0029"
                     /old_locus_tag="LMJF_33_snoRNA0105"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461044.1"
                     /db_xref="GeneID:12981243"
     ncRNA           complement(103084..103184)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C3.7"
                     /locus_tag="LMJF_33_snoRNA0029"
                     /old_locus_tag="LMJF_33_snoRNA0105"
                     /transcript_id="XR_002461045.1"
                     /db_xref="GeneID:12981243"
     gene            complement(103229..103296)
                     /gene="LM33Cs1H1.6"
                     /locus_tag="LMJF_33_snoRNA0098"
                     /db_xref="GeneID:12981244"
     ncRNA           complement(103229..103296)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1H1.6"
                     /locus_tag="LMJF_33_snoRNA0098"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461069.1"
                     /db_xref="GeneID:12981244"
     gene            complement(103357..103450)
                     /gene="LM33Cs1C2.6"
                     /locus_tag="LMJF_33_snoRNA0031"
                     /old_locus_tag="LMJF_33_snoRNA0120"
                     /db_xref="GeneID:12981287"
     ncRNA           complement(103357..103450)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C2.6"
                     /locus_tag="LMJF_33_snoRNA0031"
                     /old_locus_tag="LMJF_33_snoRNA0120"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461046.1"
                     /db_xref="GeneID:12981287"
     ncRNA           complement(103357..103448)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C2.6"
                     /locus_tag="LMJF_33_snoRNA0031"
                     /old_locus_tag="LMJF_33_snoRNA0120"
                     /transcript_id="XR_002461047.1"
                     /db_xref="GeneID:12981287"
     gene            complement(103486..103580)
                     /gene="LM33Cs1C1.6"
                     /locus_tag="LMJF_33_snoRNA0032"
                     /old_locus_tag="LMJF_33_snoRNA0126"
                     /db_xref="GeneID:12981245"
     ncRNA           complement(103486..103580)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C1.6"
                     /locus_tag="LMJF_33_snoRNA0032"
                     /old_locus_tag="LMJF_33_snoRNA0126"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461048.1"
                     /db_xref="GeneID:12981245"
     ncRNA           complement(103486..103578)
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs1C1.6"
                     /locus_tag="LMJF_33_snoRNA0032"
                     /old_locus_tag="LMJF_33_snoRNA0126"
                     /transcript_id="XR_002461049.1"
                     /db_xref="GeneID:12981245"
     gene            complement(<104701..>105528)
                     /locus_tag="LMJF_33_0295"
                     /db_xref="GeneID:5654403"
     mRNA            complement(<104701..>105528)
                     /locus_tag="LMJF_33_0295"
                     /product="putative autophagocytosis protein"
                     /transcript_id="XM_001685704.1"
                     /db_xref="GeneID:5654403"
     CDS             complement(104701..105528)
                     /locus_tag="LMJF_33_0295"
                     /codon_start=1
                     /product="putative autophagocytosis protein"
                     /protein_id="XP_001685756.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0295"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0295"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654403"
                     /db_xref="GOA:Q4Q4J0"
                     /db_xref="InterPro:IPR007134"
                     /db_xref="InterPro:IPR007135"
                     /db_xref="InterPro:IPR019461"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4J0"
                     /translation="MSLRRSLYEGFKNVHNKLHNVKTTSDFQTTGRLTPKEFVEAGDE
                     LVQKNPVWQWVGGPESVQDYLPKEKKCIVYRGAPSTERAPVDPTNASPEAVDEDDFVL
                     TEAPKVALPATVIEEEKVLTWDEDDDDSGEDDVVATATDNSNMRVYDVYIVYDKYYQT
                     PRMYLVGYASDHVTPLSMDQMKEDVYRSNYGKTVTIDPHPVLSIPCISIHPCRHAETM
                     RSLIHRMQENYNREKANDPSAEPFVFPTHLALLLFLKFISTVLPAIQYDVSSGFHLV"
     gene            complement(106657..106729)
                     /locus_tag="LMJF_33_TRNAARG_01"
                     /db_xref="GeneID:12980793"
     tRNA            complement(106657..106729)
                     /locus_tag="LMJF_33_TRNAARG_01"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:12980793"
     gene            complement(106789..106861)
                     /locus_tag="LMJF_33_TRNAARG_02"
                     /db_xref="GeneID:12981251"
     tRNA            complement(106789..106861)
                     /locus_tag="LMJF_33_TRNAARG_02"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:12981251"
     gene            106938..107009
                     /locus_tag="LMJF_33_TRNAALA_01"
                     /db_xref="GeneID:12981252"
     tRNA            106938..107009
                     /locus_tag="LMJF_33_TRNAALA_01"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:12981252"
     gene            complement(<107455..>108837)
                     /gene="LPG1R"
                     /locus_tag="LMJF_33_0300"
                     /db_xref="GeneID:5654407"
     mRNA            complement(<107455..>108837)
                     /gene="LPG1R"
                     /locus_tag="LMJF_33_0300"
                     /product="beta-galactofuranosyltransferase-like protein"
                     /transcript_id="XM_001685705.1"
                     /db_xref="GeneID:5654407"
     CDS             complement(107455..108837)
                     /gene="LPG1R"
                     /locus_tag="LMJF_33_0300"
                     /codon_start=1
                     /product="beta-galactofuranosyltransferase-like protein"
                     /protein_id="XP_001685757.1"
                     /db_xref="GeneID:5654407"
                     /db_xref="GOA:Q6XFB5"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6XFB5"
                     /translation="MKRGQRSHARGFSPARRCLLFVACVLLVASITLLILYSLPDAAV
                     GAIDGGKEVWVTAPSDQPVTDEELFACTLRWLQTDGVPADTVIPFVIVPLTLEWEDFR
                     MFMCRVHARARYLYILQNGSVEEMTALLTKLRAAVPSERLIIEHRPQNIGYAAAVNEG
                     YRVALQKPHAEVPFIGVFNCDVYFERRYFGRYIPVVYKMLAPDAARIRALEEVVEQEE
                     RAARAAGRQTLRASVATTPGLSISMLLPDRIRYSSFAEQQDEFKGHVGMFYYETKSMC
                     AFLVSRLALLVGGFLDENFYPAYFEDYDWQFRLANLGFKTFTGSSAQFGGFFHRMGGN
                     IRVINKGPAGKSISYDMAAIRVERMLNAKPGIDYGETKWAWHREALVAMSATPFPQLG
                     FIVPLDVWVLDAARHQLIIDIGTGRRPSVEMSNTYNVSLLSSLRRFALADGKDFWGSG
                     IITTEPDWRK"
     gene            complement(<109719..>111722)
                     /gene="ABCF2"
                     /locus_tag="LMJF_33_0310"
                     /db_xref="GeneID:5654408"
     mRNA            complement(<109719..>111722)
                     /gene="ABCF2"
                     /locus_tag="LMJF_33_0310"
                     /product="putative ATP-binding cassette protein subfamily
                     F,member 3"
                     /transcript_id="XM_001685706.1"
                     /db_xref="GeneID:5654408"
     CDS             complement(109719..111722)
                     /gene="ABCF2"
                     /locus_tag="LMJF_33_0310"
                     /codon_start=1
                     /product="putative ATP-binding cassette protein subfamily
                     F,member 3"
                     /protein_id="XP_001685758.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654408"
                     /db_xref="GOA:Q4Q4I8"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4I8"
                     /translation="MEGASHEAAEHTSASAMTRKERKKIEKSEKQAEELRQLSKKANA
                     VNGDTDNPFSVTLETDQIAEGSRNITFNKVSVSVNGKTLFKDTTVKLSAGSRYGLMGP
                     NGRGKSTILRLLASRELPVQSNLDLLLVEQEQEFTASELSAVDAVLQSHKKQNACADE
                     AKALGAKAELSEAEMERLHFLEEELDIMGAAQADARARRILFGLGFPTEWHERPTSSF
                     SGGWRKRIALASAVFIEPDVLMLDEPTNHLDLNAVIWLESYLTKAYSEMARRPKTLIV
                     VSHDAGFLDEVCTHMVHVENYMLNYYRGSYSSFDEQLQQRHQELDKKYESVAKTIRDK
                     KRNGMSNAQVEVWIKDQVNSGRLDPLFLEKRRDYTVNFPFPDPPELRDGCVCKLDSVS
                     FNYPGGPVLFQNVSCALWTDSRITLCGPNGIGKSTLLNLMTGVLEPTAGYITLNRQVR
                     IGRYNQHFVDKLPLEKTPVECIQALGIPEEDKARRLLGSFGLEGIVHKNQIATLSGGQ
                     KARVAFAAISAESPHFLLFDEPTNHLDVESIDALCTAIRNFKGGVLVVTHDARLIEST
                     EMQIWVAGDKNVMPFNGSLDDYKNVVRAEFEKEEAMRLEERKQLLEHKTEARQLKQSG
                     VADVTTALQEKKEKKQHEHAQGLDAFLTAAAKKKKPKKAKEES"
     gene            complement(<113895..>116000)
                     /gene="HSP83"
                     /locus_tag="LMJF_33_0312"
                     /db_xref="GeneID:5654409"
     mRNA            complement(<113895..>116000)
                     /gene="HSP83"
                     /locus_tag="LMJF_33_0312"
                     /product="heat shock protein 83-1"
                     /transcript_id="XM_001685707.1"
                     /db_xref="GeneID:5654409"
     CDS             complement(113895..116000)
                     /gene="HSP83"
                     /locus_tag="LMJF_33_0312"
                     /codon_start=1
                     /product="heat shock protein 83-1"
                     /protein_id="XP_001685759.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0312"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0314"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0316"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0320"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0323"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0326"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0333"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0336"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0340"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0343"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0346"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0350"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0355"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0360"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0365"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0312"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0314"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0316"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0323"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0326"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0333"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0336"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0343"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0346"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0355"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0365"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654409"
                     /db_xref="GOA:Q4Q4I6"
                     /db_xref="InterPro:IPR001404"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR019805"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020575"
                     /db_xref="PDB:3H80"
                     /db_xref="PDB:3HJC"
                     /db_xref="PDB:3Q5J"
                     /db_xref="PDB:3Q5K"
                     /db_xref="PDB:3Q5L"
                     /db_xref="PDB:3U67"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4I6"
                     /translation="MTETFAFQAEINQLMSLIINTFYSNKEIFLRELISNASDACDKI
                     RYQSLTDPSVLGESPRLCIRVVPDKENKTLTVEDNGIGMTKADLVNNLGTIARSGTKA
                     FMEALEAGGDMSMIGQFGVGFYSAYLVADRVTVTSKNNSDESYVWESSAGGTFTITST
                     PESDMKRGTRITLHLKEDQMEYLEPRRLKELIKKHSEFIGYDIELMVEKTTEKEVTDE
                     DEEDTKKADEDGEEPKVEEVKEGDEGKKKKTKKVKEVTKEYEVQNKHKPLWTRDPKDV
                     TKEEYAAFYKAISNDWEDPAATKHFSVEGQLEFRSIMFVPKRAPFDMFEPNKKRNNIK
                     LYVRRVFIMDNCEDLCPDWLGFVKGVVDSEDLPLNISRENLQQNKILKVIRKNIVKKC
                     LEMFDEVAENKEDYKQFYEQFGKNIKLGIHEDTANRKKLMELLRFYSTESGEEMTTLK
                     DYVTRMKAGQKSIYYITGDSKKKLETSPFIEQARRRGLEVLFMTEPIDEYVMQQVKDF
                     EDKKFACLTKEGVHFEESEEEKQQREEEKAACEKLCKTMKEVLGDKVEKVIVSERLST
                     SPCILVTSEFGWSAHMEQIMRNQALRDSSMAQYMMSKKTMELNPRHPIIKELRRRVGA
                     DENDKAVKDLVFLLFDTSLLTSGFQLEDPTGYAERINRMIKLGLSLDEEEEEAAEAPV
                     AETAPAEVTAGTSSMEQVD"
     gene            complement(<117528..>119633)
                     /gene="HSP83-2"
                     /locus_tag="LMJF_33_0314"
                     /db_xref="GeneID:5654410"
     mRNA            complement(<117528..>119633)
                     /gene="HSP83-2"
                     /locus_tag="LMJF_33_0314"
                     /product="heat shock protein 83-1"
                     /transcript_id="XM_001685708.1"
                     /db_xref="GeneID:5654410"
     CDS             complement(117528..119633)
                     /gene="HSP83-2"
                     /locus_tag="LMJF_33_0314"
                     /codon_start=1
                     /product="heat shock protein 83-1"
                     /protein_id="XP_001685760.1"
                     /db_xref="GeneID:5654410"
                     /db_xref="GOA:Q4Q4I6"
                     /db_xref="InterPro:IPR001404"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR019805"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020575"
                     /db_xref="PDB:3H80"
                     /db_xref="PDB:3HJC"
                     /db_xref="PDB:3Q5J"
                     /db_xref="PDB:3Q5K"
                     /db_xref="PDB:3Q5L"
                     /db_xref="PDB:3U67"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4I6"
                     /translation="MTETFAFQAEINQLMSLIINTFYSNKEIFLRELISNASDACDKI
                     RYQSLTDPSVLGESPRLCIRVVPDKENKTLTVEDNGIGMTKADLVNNLGTIARSGTKA
                     FMEALEAGGDMSMIGQFGVGFYSAYLVADRVTVTSKNNSDESYVWESSAGGTFTITST
                     PESDMKRGTRITLHLKEDQMEYLEPRRLKELIKKHSEFIGYDIELMVEKTTEKEVTDE
                     DEEDTKKADEDGEEPKVEEVKEGDEGKKKKTKKVKEVTKEYEVQNKHKPLWTRDPKDV
                     TKEEYAAFYKAISNDWEDPAATKHFSVEGQLEFRSIMFVPKRAPFDMFEPNKKRNNIK
                     LYVRRVFIMDNCEDLCPDWLGFVKGVVDSEDLPLNISRENLQQNKILKVIRKNIVKKC
                     LEMFDEVAENKEDYKQFYEQFGKNIKLGIHEDTANRKKLMELLRFYSTESGEEMTTLK
                     DYVTRMKAGQKSIYYITGDSKKKLETSPFIEQARRRGLEVLFMTEPIDEYVMQQVKDF
                     EDKKFACLTKEGVHFEESEEEKQQREEEKAACEKLCKTMKEVLGDKVEKVIVSERLST
                     SPCILVTSEFGWSAHMEQIMRNQALRDSSMAQYMMSKKTMELNPRHPIIKELRRRVGA
                     DENDKAVKDLVFLLFDTSLLTSGFQLEDPTGYAERINRMIKLGLSLDEEEEEAAEAPV
                     AETAPAEVTAGTSSMEQVD"
     gene            complement(<121170..>123275)
                     /gene="HSP83-3"
                     /locus_tag="LMJF_33_0316"
                     /db_xref="GeneID:5654411"
     mRNA            complement(<121170..>123275)
                     /gene="HSP83-3"
                     /locus_tag="LMJF_33_0316"
                     /product="heat shock protein 83-1"
                     /transcript_id="XM_001685709.1"
                     /db_xref="GeneID:5654411"
     CDS             complement(121170..123275)
                     /gene="HSP83-3"
                     /locus_tag="LMJF_33_0316"
                     /codon_start=1
                     /product="heat shock protein 83-1"
                     /protein_id="XP_001685761.1"
                     /db_xref="GeneID:5654411"
                     /db_xref="GOA:Q4Q4I6"
                     /db_xref="InterPro:IPR001404"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR019805"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020575"
                     /db_xref="PDB:3H80"
                     /db_xref="PDB:3HJC"
                     /db_xref="PDB:3Q5J"
                     /db_xref="PDB:3Q5K"
                     /db_xref="PDB:3Q5L"
                     /db_xref="PDB:3U67"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4I6"
                     /translation="MTETFAFQAEINQLMSLIINTFYSNKEIFLRELISNASDACDKI
                     RYQSLTDPSVLGESPRLCIRVVPDKENKTLTVEDNGIGMTKADLVNNLGTIARSGTKA
                     FMEALEAGGDMSMIGQFGVGFYSAYLVADRVTVTSKNNSDESYVWESSAGGTFTITST
                     PESDMKRGTRITLHLKEDQMEYLEPRRLKELIKKHSEFIGYDIELMVEKTTEKEVTDE
                     DEEDTKKADEDGEEPKVEEVKEGDEGKKKKTKKVKEVTKEYEVQNKHKPLWTRDPKDV
                     TKEEYAAFYKAISNDWEDPAATKHFSVEGQLEFRSIMFVPKRAPFDMFEPNKKRNNIK
                     LYVRRVFIMDNCEDLCPDWLGFVKGVVDSEDLPLNISRENLQQNKILKVIRKNIVKKC
                     LEMFDEVAENKEDYKQFYEQFGKNIKLGIHEDTANRKKLMELLRFYSTESGEEMTTLK
                     DYVTRMKAGQKSIYYITGDSKKKLETSPFIEQARRRGLEVLFMTEPIDEYVMQQVKDF
                     EDKKFACLTKEGVHFEESEEEKQQREEEKAACEKLCKTMKEVLGDKVEKVIVSERLST
                     SPCILVTSEFGWSAHMEQIMRNQALRDSSMAQYMMSKKTMELNPRHPIIKELRRRVGA
                     DENDKAVKDLVFLLFDTSLLTSGFQLEDPTGYAERINRMIKLGLSLDEEEEEAAEAPV
                     AETAPAEVTAGTSSMEQVD"
     gene            complement(<124806..>126908)
                     /gene="HSP83-4"
                     /locus_tag="LMJF_33_0318"
                     /db_xref="GeneID:5654412"
     mRNA            complement(<124806..>126908)
                     /gene="HSP83-4"
                     /locus_tag="LMJF_33_0318"
                     /product="heat shock protein 83-1"
                     /transcript_id="XM_001685710.1"
                     /db_xref="GeneID:5654412"
     CDS             complement(124806..126908)
                     /gene="HSP83-4"
                     /locus_tag="LMJF_33_0318"
                     /codon_start=1
                     /product="heat shock protein 83-1"
                     /protein_id="XP_001685762.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0318"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0318"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654412"
                     /db_xref="GOA:Q4Q4I0"
                     /db_xref="InterPro:IPR001404"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR019805"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020575"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4I0"
                     /translation="MTETFAFQAEINQLMSLIINTFYSNKEIFLRELISNASDACDKI
                     RYQSLTDPSVLGESPRLCIRVVPDKENKTLTVEDNGIGMTKADLVNNLGTIARSGTKA
                     FMEALEAGGDMSMIGQFGVGFYSAYLVADRVTVTSKNNSDESYVWESSAGGTFTITST
                     PESDMKRGTRITLHLKEDQMEYLEPRRLKELIKKHSEFIGYDIELMVEKTTEKEVTDE
                     DEEDTKKADEDGEEPKVEEVKEGDEGKKKKTKKVKEVTKEYEVQNKHKPLWTRDPKDV
                     TKEEYAAFYKAISNDWEDPAATKHFSVEGQLEFRSIMFVPKRAPFDMFEPNKKRNNIK
                     LYVRRVFIMDNCEDLCPDWLGFVKGVVDSEDLPLNISRENLQQNKILKVIRKNIVKKC
                     LEMFDEVAENKEDYKQFYEQFGKNIKLGIHEDTANRKKLMELLRFYSTESGEEMTTLK
                     DYVTRMKAGQKSIYYITGDSKKKLETSPFIEQARRRGLEVLFMTEPIDEYVMQQVKDF
                     EDKKFACLTKEGVHFEESEEEKQQREEEKAACEKLCKTMKEVLGDKVEKVIVSERLST
                     SPCILVTSEFGWSAHMEQIMRNQALRDSSMAQYMMSKKTMELNPRHPIIKELRRRVGA
                     DENDKAVKDLVFLLFDTSLLTSGFQLEDPTGYAERINRMIKLGLSLDEEEEAAEAPVA
                     ETAPAEVTAGTSSMEQVD"
     gene            complement(<128438..>130543)
                     /gene="HSP83-5"
                     /locus_tag="LMJF_33_0320"
                     /db_xref="GeneID:5654413"
     mRNA            complement(<128438..>130543)
                     /gene="HSP83-5"
                     /locus_tag="LMJF_33_0320"
                     /product="heat shock protein 83-1"
                     /transcript_id="XM_001685711.1"
                     /db_xref="GeneID:5654413"
     CDS             complement(128438..130543)
                     /gene="HSP83-5"
                     /locus_tag="LMJF_33_0320"
                     /codon_start=1
                     /product="heat shock protein 83-1"
                     /protein_id="XP_001685763.1"
                     /db_xref="GeneID:5654413"
                     /db_xref="GOA:Q4Q4I6"
                     /db_xref="InterPro:IPR001404"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR019805"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020575"
                     /db_xref="PDB:3H80"
                     /db_xref="PDB:3HJC"
                     /db_xref="PDB:3Q5J"
                     /db_xref="PDB:3Q5K"
                     /db_xref="PDB:3Q5L"
                     /db_xref="PDB:3U67"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4I6"
                     /translation="MTETFAFQAEINQLMSLIINTFYSNKEIFLRELISNASDACDKI
                     RYQSLTDPSVLGESPRLCIRVVPDKENKTLTVEDNGIGMTKADLVNNLGTIARSGTKA
                     FMEALEAGGDMSMIGQFGVGFYSAYLVADRVTVTSKNNSDESYVWESSAGGTFTITST
                     PESDMKRGTRITLHLKEDQMEYLEPRRLKELIKKHSEFIGYDIELMVEKTTEKEVTDE
                     DEEDTKKADEDGEEPKVEEVKEGDEGKKKKTKKVKEVTKEYEVQNKHKPLWTRDPKDV
                     TKEEYAAFYKAISNDWEDPAATKHFSVEGQLEFRSIMFVPKRAPFDMFEPNKKRNNIK
                     LYVRRVFIMDNCEDLCPDWLGFVKGVVDSEDLPLNISRENLQQNKILKVIRKNIVKKC
                     LEMFDEVAENKEDYKQFYEQFGKNIKLGIHEDTANRKKLMELLRFYSTESGEEMTTLK
                     DYVTRMKAGQKSIYYITGDSKKKLETSPFIEQARRRGLEVLFMTEPIDEYVMQQVKDF
                     EDKKFACLTKEGVHFEESEEEKQQREEEKAACEKLCKTMKEVLGDKVEKVIVSERLST
                     SPCILVTSEFGWSAHMEQIMRNQALRDSSMAQYMMSKKTMELNPRHPIIKELRRRVGA
                     DENDKAVKDLVFLLFDTSLLTSGFQLEDPTGYAERINRMIKLGLSLDEEEEEAAEAPV
                     AETAPAEVTAGTSSMEQVD"
     gene            complement(<132070..>134175)
                     /gene="HSP83-6"
                     /locus_tag="LMJF_33_0323"
                     /db_xref="GeneID:5654414"
     mRNA            complement(<132070..>134175)
                     /gene="HSP83-6"
                     /locus_tag="LMJF_33_0323"
                     /product="heat shock protein 83-1"
                     /transcript_id="XM_001685712.1"
                     /db_xref="GeneID:5654414"
     CDS             complement(132070..134175)
                     /gene="HSP83-6"
                     /locus_tag="LMJF_33_0323"
                     /codon_start=1
                     /product="heat shock protein 83-1"
                     /protein_id="XP_001685764.1"
                     /db_xref="GeneID:5654414"
                     /db_xref="GOA:Q4Q4I6"
                     /db_xref="InterPro:IPR001404"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR019805"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020575"
                     /db_xref="PDB:3H80"
                     /db_xref="PDB:3HJC"
                     /db_xref="PDB:3Q5J"
                     /db_xref="PDB:3Q5K"
                     /db_xref="PDB:3Q5L"
                     /db_xref="PDB:3U67"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4I6"
                     /translation="MTETFAFQAEINQLMSLIINTFYSNKEIFLRELISNASDACDKI
                     RYQSLTDPSVLGESPRLCIRVVPDKENKTLTVEDNGIGMTKADLVNNLGTIARSGTKA
                     FMEALEAGGDMSMIGQFGVGFYSAYLVADRVTVTSKNNSDESYVWESSAGGTFTITST
                     PESDMKRGTRITLHLKEDQMEYLEPRRLKELIKKHSEFIGYDIELMVEKTTEKEVTDE
                     DEEDTKKADEDGEEPKVEEVKEGDEGKKKKTKKVKEVTKEYEVQNKHKPLWTRDPKDV
                     TKEEYAAFYKAISNDWEDPAATKHFSVEGQLEFRSIMFVPKRAPFDMFEPNKKRNNIK
                     LYVRRVFIMDNCEDLCPDWLGFVKGVVDSEDLPLNISRENLQQNKILKVIRKNIVKKC
                     LEMFDEVAENKEDYKQFYEQFGKNIKLGIHEDTANRKKLMELLRFYSTESGEEMTTLK
                     DYVTRMKAGQKSIYYITGDSKKKLETSPFIEQARRRGLEVLFMTEPIDEYVMQQVKDF
                     EDKKFACLTKEGVHFEESEEEKQQREEEKAACEKLCKTMKEVLGDKVEKVIVSERLST
                     SPCILVTSEFGWSAHMEQIMRNQALRDSSMAQYMMSKKTMELNPRHPIIKELRRRVGA
                     DENDKAVKDLVFLLFDTSLLTSGFQLEDPTGYAERINRMIKLGLSLDEEEEEAAEAPV
                     AETAPAEVTAGTSSMEQVD"
     gene            complement(<135709..>137814)
                     /gene="HSP83-7"
                     /locus_tag="LMJF_33_0326"
                     /db_xref="GeneID:5654415"
     mRNA            complement(<135709..>137814)
                     /gene="HSP83-7"
                     /locus_tag="LMJF_33_0326"
                     /product="heat shock protein 83-1"
                     /transcript_id="XM_001685713.1"
                     /db_xref="GeneID:5654415"
     CDS             complement(135709..137814)
                     /gene="HSP83-7"
                     /locus_tag="LMJF_33_0326"
                     /codon_start=1
                     /product="heat shock protein 83-1"
                     /protein_id="XP_001685765.1"
                     /db_xref="GeneID:5654415"
                     /db_xref="GOA:Q4Q4I6"
                     /db_xref="InterPro:IPR001404"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR019805"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020575"
                     /db_xref="PDB:3H80"
                     /db_xref="PDB:3HJC"
                     /db_xref="PDB:3Q5J"
                     /db_xref="PDB:3Q5K"
                     /db_xref="PDB:3Q5L"
                     /db_xref="PDB:3U67"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4I6"
                     /translation="MTETFAFQAEINQLMSLIINTFYSNKEIFLRELISNASDACDKI
                     RYQSLTDPSVLGESPRLCIRVVPDKENKTLTVEDNGIGMTKADLVNNLGTIARSGTKA
                     FMEALEAGGDMSMIGQFGVGFYSAYLVADRVTVTSKNNSDESYVWESSAGGTFTITST
                     PESDMKRGTRITLHLKEDQMEYLEPRRLKELIKKHSEFIGYDIELMVEKTTEKEVTDE
                     DEEDTKKADEDGEEPKVEEVKEGDEGKKKKTKKVKEVTKEYEVQNKHKPLWTRDPKDV
                     TKEEYAAFYKAISNDWEDPAATKHFSVEGQLEFRSIMFVPKRAPFDMFEPNKKRNNIK
                     LYVRRVFIMDNCEDLCPDWLGFVKGVVDSEDLPLNISRENLQQNKILKVIRKNIVKKC
                     LEMFDEVAENKEDYKQFYEQFGKNIKLGIHEDTANRKKLMELLRFYSTESGEEMTTLK
                     DYVTRMKAGQKSIYYITGDSKKKLETSPFIEQARRRGLEVLFMTEPIDEYVMQQVKDF
                     EDKKFACLTKEGVHFEESEEEKQQREEEKAACEKLCKTMKEVLGDKVEKVIVSERLST
                     SPCILVTSEFGWSAHMEQIMRNQALRDSSMAQYMMSKKTMELNPRHPIIKELRRRVGA
                     DENDKAVKDLVFLLFDTSLLTSGFQLEDPTGYAERINRMIKLGLSLDEEEEEAAEAPV
                     AETAPAEVTAGTSSMEQVD"
     gene            complement(<139347..>141449)
                     /gene="HSP83-8"
                     /locus_tag="LMJF_33_0330"
                     /db_xref="GeneID:5654416"
     mRNA            complement(<139347..>141449)
                     /gene="HSP83-8"
                     /locus_tag="LMJF_33_0330"
                     /product="heat shock protein 83-1"
                     /transcript_id="XM_001685714.1"
                     /db_xref="GeneID:5654416"
     CDS             complement(139347..141449)
                     /gene="HSP83-8"
                     /locus_tag="LMJF_33_0330"
                     /codon_start=1
                     /product="heat shock protein 83-1"
                     /protein_id="XP_001685766.1"
                     /db_xref="GeneID:5654416"
                     /db_xref="GOA:Q4Q4I0"
                     /db_xref="InterPro:IPR001404"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR019805"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020575"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4I0"
                     /translation="MTETFAFQAEINQLMSLIINTFYSNKEIFLRELISNASDACDKI
                     RYQSLTDPSVLGESPRLCIRVVPDKENKTLTVEDNGIGMTKADLVNNLGTIARSGTKA
                     FMEALEAGGDMSMIGQFGVGFYSAYLVADRVTVTSKNNSDESYVWESSAGGTFTITST
                     PESDMKRGTRITLHLKEDQMEYLEPRRLKELIKKHSEFIGYDIELMVEKTTEKEVTDE
                     DEEDTKKADEDGEEPKVEEVKEGDEGKKKKTKKVKEVTKEYEVQNKHKPLWTRDPKDV
                     TKEEYAAFYKAISNDWEDPAATKHFSVEGQLEFRSIMFVPKRAPFDMFEPNKKRNNIK
                     LYVRRVFIMDNCEDLCPDWLGFVKGVVDSEDLPLNISRENLQQNKILKVIRKNIVKKC
                     LEMFDEVAENKEDYKQFYEQFGKNIKLGIHEDTANRKKLMELLRFYSTESGEEMTTLK
                     DYVTRMKAGQKSIYYITGDSKKKLETSPFIEQARRRGLEVLFMTEPIDEYVMQQVKDF
                     EDKKFACLTKEGVHFEESEEEKQQREEEKAACEKLCKTMKEVLGDKVEKVIVSERLST
                     SPCILVTSEFGWSAHMEQIMRNQALRDSSMAQYMMSKKTMELNPRHPIIKELRRRVGA
                     DENDKAVKDLVFLLFDTSLLTSGFQLEDPTGYAERINRMIKLGLSLDEEEEAAEAPVA
                     ETAPAEVTAGTSSMEQVD"
     gene            complement(<142979..>145084)
                     /gene="HSP83-9"
                     /locus_tag="LMJF_33_0333"
                     /db_xref="GeneID:5654417"
     mRNA            complement(<142979..>145084)
                     /gene="HSP83-9"
                     /locus_tag="LMJF_33_0333"
                     /product="heat shock protein 83-1"
                     /transcript_id="XM_001685715.1"
                     /db_xref="GeneID:5654417"
     CDS             complement(142979..145084)
                     /gene="HSP83-9"
                     /locus_tag="LMJF_33_0333"
                     /codon_start=1
                     /product="heat shock protein 83-1"
                     /protein_id="XP_001685767.1"
                     /db_xref="GeneID:5654417"
                     /db_xref="GOA:Q4Q4I6"
                     /db_xref="InterPro:IPR001404"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR019805"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020575"
                     /db_xref="PDB:3H80"
                     /db_xref="PDB:3HJC"
                     /db_xref="PDB:3Q5J"
                     /db_xref="PDB:3Q5K"
                     /db_xref="PDB:3Q5L"
                     /db_xref="PDB:3U67"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4I6"
                     /translation="MTETFAFQAEINQLMSLIINTFYSNKEIFLRELISNASDACDKI
                     RYQSLTDPSVLGESPRLCIRVVPDKENKTLTVEDNGIGMTKADLVNNLGTIARSGTKA
                     FMEALEAGGDMSMIGQFGVGFYSAYLVADRVTVTSKNNSDESYVWESSAGGTFTITST
                     PESDMKRGTRITLHLKEDQMEYLEPRRLKELIKKHSEFIGYDIELMVEKTTEKEVTDE
                     DEEDTKKADEDGEEPKVEEVKEGDEGKKKKTKKVKEVTKEYEVQNKHKPLWTRDPKDV
                     TKEEYAAFYKAISNDWEDPAATKHFSVEGQLEFRSIMFVPKRAPFDMFEPNKKRNNIK
                     LYVRRVFIMDNCEDLCPDWLGFVKGVVDSEDLPLNISRENLQQNKILKVIRKNIVKKC
                     LEMFDEVAENKEDYKQFYEQFGKNIKLGIHEDTANRKKLMELLRFYSTESGEEMTTLK
                     DYVTRMKAGQKSIYYITGDSKKKLETSPFIEQARRRGLEVLFMTEPIDEYVMQQVKDF
                     EDKKFACLTKEGVHFEESEEEKQQREEEKAACEKLCKTMKEVLGDKVEKVIVSERLST
                     SPCILVTSEFGWSAHMEQIMRNQALRDSSMAQYMMSKKTMELNPRHPIIKELRRRVGA
                     DENDKAVKDLVFLLFDTSLLTSGFQLEDPTGYAERINRMIKLGLSLDEEEEEAAEAPV
                     AETAPAEVTAGTSSMEQVD"
     gene            complement(<146611..>148716)
                     /gene="HSP83-10"
                     /locus_tag="LMJF_33_0336"
                     /db_xref="GeneID:5654418"
     mRNA            complement(<146611..>148716)
                     /gene="HSP83-10"
                     /locus_tag="LMJF_33_0336"
                     /product="heat shock protein 83-1"
                     /transcript_id="XM_001685716.1"
                     /db_xref="GeneID:5654418"
     CDS             complement(146611..148716)
                     /gene="HSP83-10"
                     /locus_tag="LMJF_33_0336"
                     /codon_start=1
                     /product="heat shock protein 83-1"
                     /protein_id="XP_001685768.1"
                     /db_xref="GeneID:5654418"
                     /db_xref="GOA:Q4Q4I6"
                     /db_xref="InterPro:IPR001404"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR019805"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020575"
                     /db_xref="PDB:3H80"
                     /db_xref="PDB:3HJC"
                     /db_xref="PDB:3Q5J"
                     /db_xref="PDB:3Q5K"
                     /db_xref="PDB:3Q5L"
                     /db_xref="PDB:3U67"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4I6"
                     /translation="MTETFAFQAEINQLMSLIINTFYSNKEIFLRELISNASDACDKI
                     RYQSLTDPSVLGESPRLCIRVVPDKENKTLTVEDNGIGMTKADLVNNLGTIARSGTKA
                     FMEALEAGGDMSMIGQFGVGFYSAYLVADRVTVTSKNNSDESYVWESSAGGTFTITST
                     PESDMKRGTRITLHLKEDQMEYLEPRRLKELIKKHSEFIGYDIELMVEKTTEKEVTDE
                     DEEDTKKADEDGEEPKVEEVKEGDEGKKKKTKKVKEVTKEYEVQNKHKPLWTRDPKDV
                     TKEEYAAFYKAISNDWEDPAATKHFSVEGQLEFRSIMFVPKRAPFDMFEPNKKRNNIK
                     LYVRRVFIMDNCEDLCPDWLGFVKGVVDSEDLPLNISRENLQQNKILKVIRKNIVKKC
                     LEMFDEVAENKEDYKQFYEQFGKNIKLGIHEDTANRKKLMELLRFYSTESGEEMTTLK
                     DYVTRMKAGQKSIYYITGDSKKKLETSPFIEQARRRGLEVLFMTEPIDEYVMQQVKDF
                     EDKKFACLTKEGVHFEESEEEKQQREEEKAACEKLCKTMKEVLGDKVEKVIVSERLST
                     SPCILVTSEFGWSAHMEQIMRNQALRDSSMAQYMMSKKTMELNPRHPIIKELRRRVGA
                     DENDKAVKDLVFLLFDTSLLTSGFQLEDPTGYAERINRMIKLGLSLDEEEEEAAEAPV
                     AETAPAEVTAGTSSMEQVD"
     gene            complement(<150245..>152350)
                     /gene="HSP83-11"
                     /locus_tag="LMJF_33_0340"
                     /db_xref="GeneID:5654419"
     mRNA            complement(<150245..>152350)
                     /gene="HSP83-11"
                     /locus_tag="LMJF_33_0340"
                     /product="heat shock protein 83-1"
                     /transcript_id="XM_001685717.1"
                     /db_xref="GeneID:5654419"
     CDS             complement(150245..152350)
                     /gene="HSP83-11"
                     /locus_tag="LMJF_33_0340"
                     /codon_start=1
                     /product="heat shock protein 83-1"
                     /protein_id="XP_001685769.1"
                     /db_xref="GeneID:5654419"
                     /db_xref="GOA:Q4Q4I6"
                     /db_xref="InterPro:IPR001404"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR019805"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020575"
                     /db_xref="PDB:3H80"
                     /db_xref="PDB:3HJC"
                     /db_xref="PDB:3Q5J"
                     /db_xref="PDB:3Q5K"
                     /db_xref="PDB:3Q5L"
                     /db_xref="PDB:3U67"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4I6"
                     /translation="MTETFAFQAEINQLMSLIINTFYSNKEIFLRELISNASDACDKI
                     RYQSLTDPSVLGESPRLCIRVVPDKENKTLTVEDNGIGMTKADLVNNLGTIARSGTKA
                     FMEALEAGGDMSMIGQFGVGFYSAYLVADRVTVTSKNNSDESYVWESSAGGTFTITST
                     PESDMKRGTRITLHLKEDQMEYLEPRRLKELIKKHSEFIGYDIELMVEKTTEKEVTDE
                     DEEDTKKADEDGEEPKVEEVKEGDEGKKKKTKKVKEVTKEYEVQNKHKPLWTRDPKDV
                     TKEEYAAFYKAISNDWEDPAATKHFSVEGQLEFRSIMFVPKRAPFDMFEPNKKRNNIK
                     LYVRRVFIMDNCEDLCPDWLGFVKGVVDSEDLPLNISRENLQQNKILKVIRKNIVKKC
                     LEMFDEVAENKEDYKQFYEQFGKNIKLGIHEDTANRKKLMELLRFYSTESGEEMTTLK
                     DYVTRMKAGQKSIYYITGDSKKKLETSPFIEQARRRGLEVLFMTEPIDEYVMQQVKDF
                     EDKKFACLTKEGVHFEESEEEKQQREEEKAACEKLCKTMKEVLGDKVEKVIVSERLST
                     SPCILVTSEFGWSAHMEQIMRNQALRDSSMAQYMMSKKTMELNPRHPIIKELRRRVGA
                     DENDKAVKDLVFLLFDTSLLTSGFQLEDPTGYAERINRMIKLGLSLDEEEEEAAEAPV
                     AETAPAEVTAGTSSMEQVD"
     gene            complement(<153878..>155983)
                     /gene="HSP83-12"
                     /locus_tag="LMJF_33_0343"
                     /db_xref="GeneID:5654420"
     mRNA            complement(<153878..>155983)
                     /gene="HSP83-12"
                     /locus_tag="LMJF_33_0343"
                     /product="heat shock protein 83-1"
                     /transcript_id="XM_001685718.1"
                     /db_xref="GeneID:5654420"
     CDS             complement(153878..155983)
                     /gene="HSP83-12"
                     /locus_tag="LMJF_33_0343"
                     /codon_start=1
                     /product="heat shock protein 83-1"
                     /protein_id="XP_001685770.1"
                     /db_xref="GeneID:5654420"
                     /db_xref="GOA:Q4Q4I6"
                     /db_xref="InterPro:IPR001404"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR019805"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020575"
                     /db_xref="PDB:3H80"
                     /db_xref="PDB:3HJC"
                     /db_xref="PDB:3Q5J"
                     /db_xref="PDB:3Q5K"
                     /db_xref="PDB:3Q5L"
                     /db_xref="PDB:3U67"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4I6"
                     /translation="MTETFAFQAEINQLMSLIINTFYSNKEIFLRELISNASDACDKI
                     RYQSLTDPSVLGESPRLCIRVVPDKENKTLTVEDNGIGMTKADLVNNLGTIARSGTKA
                     FMEALEAGGDMSMIGQFGVGFYSAYLVADRVTVTSKNNSDESYVWESSAGGTFTITST
                     PESDMKRGTRITLHLKEDQMEYLEPRRLKELIKKHSEFIGYDIELMVEKTTEKEVTDE
                     DEEDTKKADEDGEEPKVEEVKEGDEGKKKKTKKVKEVTKEYEVQNKHKPLWTRDPKDV
                     TKEEYAAFYKAISNDWEDPAATKHFSVEGQLEFRSIMFVPKRAPFDMFEPNKKRNNIK
                     LYVRRVFIMDNCEDLCPDWLGFVKGVVDSEDLPLNISRENLQQNKILKVIRKNIVKKC
                     LEMFDEVAENKEDYKQFYEQFGKNIKLGIHEDTANRKKLMELLRFYSTESGEEMTTLK
                     DYVTRMKAGQKSIYYITGDSKKKLETSPFIEQARRRGLEVLFMTEPIDEYVMQQVKDF
                     EDKKFACLTKEGVHFEESEEEKQQREEEKAACEKLCKTMKEVLGDKVEKVIVSERLST
                     SPCILVTSEFGWSAHMEQIMRNQALRDSSMAQYMMSKKTMELNPRHPIIKELRRRVGA
                     DENDKAVKDLVFLLFDTSLLTSGFQLEDPTGYAERINRMIKLGLSLDEEEEEAAEAPV
                     AETAPAEVTAGTSSMEQVD"
     gene            complement(<157521..>159626)
                     /gene="HSP83-13"
                     /locus_tag="LMJF_33_0346"
                     /db_xref="GeneID:5654421"
     mRNA            complement(<157521..>159626)
                     /gene="HSP83-13"
                     /locus_tag="LMJF_33_0346"
                     /product="heat shock protein 83-1"
                     /transcript_id="XM_001685719.1"
                     /db_xref="GeneID:5654421"
     CDS             complement(157521..159626)
                     /gene="HSP83-13"
                     /locus_tag="LMJF_33_0346"
                     /codon_start=1
                     /product="heat shock protein 83-1"
                     /protein_id="XP_001685771.1"
                     /db_xref="GeneID:5654421"
                     /db_xref="GOA:Q4Q4I6"
                     /db_xref="InterPro:IPR001404"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR019805"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020575"
                     /db_xref="PDB:3H80"
                     /db_xref="PDB:3HJC"
                     /db_xref="PDB:3Q5J"
                     /db_xref="PDB:3Q5K"
                     /db_xref="PDB:3Q5L"
                     /db_xref="PDB:3U67"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4I6"
                     /translation="MTETFAFQAEINQLMSLIINTFYSNKEIFLRELISNASDACDKI
                     RYQSLTDPSVLGESPRLCIRVVPDKENKTLTVEDNGIGMTKADLVNNLGTIARSGTKA
                     FMEALEAGGDMSMIGQFGVGFYSAYLVADRVTVTSKNNSDESYVWESSAGGTFTITST
                     PESDMKRGTRITLHLKEDQMEYLEPRRLKELIKKHSEFIGYDIELMVEKTTEKEVTDE
                     DEEDTKKADEDGEEPKVEEVKEGDEGKKKKTKKVKEVTKEYEVQNKHKPLWTRDPKDV
                     TKEEYAAFYKAISNDWEDPAATKHFSVEGQLEFRSIMFVPKRAPFDMFEPNKKRNNIK
                     LYVRRVFIMDNCEDLCPDWLGFVKGVVDSEDLPLNISRENLQQNKILKVIRKNIVKKC
                     LEMFDEVAENKEDYKQFYEQFGKNIKLGIHEDTANRKKLMELLRFYSTESGEEMTTLK
                     DYVTRMKAGQKSIYYITGDSKKKLETSPFIEQARRRGLEVLFMTEPIDEYVMQQVKDF
                     EDKKFACLTKEGVHFEESEEEKQQREEEKAACEKLCKTMKEVLGDKVEKVIVSERLST
                     SPCILVTSEFGWSAHMEQIMRNQALRDSSMAQYMMSKKTMELNPRHPIIKELRRRVGA
                     DENDKAVKDLVFLLFDTSLLTSGFQLEDPTGYAERINRMIKLGLSLDEEEEEAAEAPV
                     AETAPAEVTAGTSSMEQVD"
     gene            complement(<161153..>163258)
                     /gene="HSP83-14"
                     /locus_tag="LMJF_33_0350"
                     /db_xref="GeneID:5654422"
     mRNA            complement(<161153..>163258)
                     /gene="HSP83-14"
                     /locus_tag="LMJF_33_0350"
                     /product="heat shock protein 83-1"
                     /transcript_id="XM_001685720.1"
                     /db_xref="GeneID:5654422"
     CDS             complement(161153..163258)
                     /gene="HSP83-14"
                     /locus_tag="LMJF_33_0350"
                     /codon_start=1
                     /product="heat shock protein 83-1"
                     /protein_id="XP_001685772.1"
                     /db_xref="GeneID:5654422"
                     /db_xref="GOA:Q4Q4I6"
                     /db_xref="InterPro:IPR001404"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR019805"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020575"
                     /db_xref="PDB:3H80"
                     /db_xref="PDB:3HJC"
                     /db_xref="PDB:3Q5J"
                     /db_xref="PDB:3Q5K"
                     /db_xref="PDB:3Q5L"
                     /db_xref="PDB:3U67"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4I6"
                     /translation="MTETFAFQAEINQLMSLIINTFYSNKEIFLRELISNASDACDKI
                     RYQSLTDPSVLGESPRLCIRVVPDKENKTLTVEDNGIGMTKADLVNNLGTIARSGTKA
                     FMEALEAGGDMSMIGQFGVGFYSAYLVADRVTVTSKNNSDESYVWESSAGGTFTITST
                     PESDMKRGTRITLHLKEDQMEYLEPRRLKELIKKHSEFIGYDIELMVEKTTEKEVTDE
                     DEEDTKKADEDGEEPKVEEVKEGDEGKKKKTKKVKEVTKEYEVQNKHKPLWTRDPKDV
                     TKEEYAAFYKAISNDWEDPAATKHFSVEGQLEFRSIMFVPKRAPFDMFEPNKKRNNIK
                     LYVRRVFIMDNCEDLCPDWLGFVKGVVDSEDLPLNISRENLQQNKILKVIRKNIVKKC
                     LEMFDEVAENKEDYKQFYEQFGKNIKLGIHEDTANRKKLMELLRFYSTESGEEMTTLK
                     DYVTRMKAGQKSIYYITGDSKKKLETSPFIEQARRRGLEVLFMTEPIDEYVMQQVKDF
                     EDKKFACLTKEGVHFEESEEEKQQREEEKAACEKLCKTMKEVLGDKVEKVIVSERLST
                     SPCILVTSEFGWSAHMEQIMRNQALRDSSMAQYMMSKKTMELNPRHPIIKELRRRVGA
                     DENDKAVKDLVFLLFDTSLLTSGFQLEDPTGYAERINRMIKLGLSLDEEEEEAAEAPV
                     AETAPAEVTAGTSSMEQVD"
     gene            complement(<164787..>166892)
                     /gene="HSP83-15"
                     /locus_tag="LMJF_33_0355"
                     /db_xref="GeneID:5654423"
     mRNA            complement(<164787..>166892)
                     /gene="HSP83-15"
                     /locus_tag="LMJF_33_0355"
                     /product="heat shock protein 83-1"
                     /transcript_id="XM_001685721.1"
                     /db_xref="GeneID:5654423"
     CDS             complement(164787..166892)
                     /gene="HSP83-15"
                     /locus_tag="LMJF_33_0355"
                     /codon_start=1
                     /product="heat shock protein 83-1"
                     /protein_id="XP_001685773.1"
                     /db_xref="GeneID:5654423"
                     /db_xref="GOA:Q4Q4I6"
                     /db_xref="InterPro:IPR001404"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR019805"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020575"
                     /db_xref="PDB:3H80"
                     /db_xref="PDB:3HJC"
                     /db_xref="PDB:3Q5J"
                     /db_xref="PDB:3Q5K"
                     /db_xref="PDB:3Q5L"
                     /db_xref="PDB:3U67"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4I6"
                     /translation="MTETFAFQAEINQLMSLIINTFYSNKEIFLRELISNASDACDKI
                     RYQSLTDPSVLGESPRLCIRVVPDKENKTLTVEDNGIGMTKADLVNNLGTIARSGTKA
                     FMEALEAGGDMSMIGQFGVGFYSAYLVADRVTVTSKNNSDESYVWESSAGGTFTITST
                     PESDMKRGTRITLHLKEDQMEYLEPRRLKELIKKHSEFIGYDIELMVEKTTEKEVTDE
                     DEEDTKKADEDGEEPKVEEVKEGDEGKKKKTKKVKEVTKEYEVQNKHKPLWTRDPKDV
                     TKEEYAAFYKAISNDWEDPAATKHFSVEGQLEFRSIMFVPKRAPFDMFEPNKKRNNIK
                     LYVRRVFIMDNCEDLCPDWLGFVKGVVDSEDLPLNISRENLQQNKILKVIRKNIVKKC
                     LEMFDEVAENKEDYKQFYEQFGKNIKLGIHEDTANRKKLMELLRFYSTESGEEMTTLK
                     DYVTRMKAGQKSIYYITGDSKKKLETSPFIEQARRRGLEVLFMTEPIDEYVMQQVKDF
                     EDKKFACLTKEGVHFEESEEEKQQREEEKAACEKLCKTMKEVLGDKVEKVIVSERLST
                     SPCILVTSEFGWSAHMEQIMRNQALRDSSMAQYMMSKKTMELNPRHPIIKELRRRVGA
                     DENDKAVKDLVFLLFDTSLLTSGFQLEDPTGYAERINRMIKLGLSLDEEEEEAAEAPV
                     AETAPAEVTAGTSSMEQVD"
     gene            complement(<168420..>170525)
                     /gene="HSP83-16"
                     /locus_tag="LMJF_33_0360"
                     /db_xref="GeneID:5654424"
     mRNA            complement(<168420..>170525)
                     /gene="HSP83-16"
                     /locus_tag="LMJF_33_0360"
                     /product="heat shock protein 83-1"
                     /transcript_id="XM_001685722.1"
                     /db_xref="GeneID:5654424"
     CDS             complement(168420..170525)
                     /gene="HSP83-16"
                     /locus_tag="LMJF_33_0360"
                     /codon_start=1
                     /product="heat shock protein 83-1"
                     /protein_id="XP_001685774.1"
                     /db_xref="GeneID:5654424"
                     /db_xref="GOA:Q4Q4I6"
                     /db_xref="InterPro:IPR001404"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR019805"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020575"
                     /db_xref="PDB:3H80"
                     /db_xref="PDB:3HJC"
                     /db_xref="PDB:3Q5J"
                     /db_xref="PDB:3Q5K"
                     /db_xref="PDB:3Q5L"
                     /db_xref="PDB:3U67"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4I6"
                     /translation="MTETFAFQAEINQLMSLIINTFYSNKEIFLRELISNASDACDKI
                     RYQSLTDPSVLGESPRLCIRVVPDKENKTLTVEDNGIGMTKADLVNNLGTIARSGTKA
                     FMEALEAGGDMSMIGQFGVGFYSAYLVADRVTVTSKNNSDESYVWESSAGGTFTITST
                     PESDMKRGTRITLHLKEDQMEYLEPRRLKELIKKHSEFIGYDIELMVEKTTEKEVTDE
                     DEEDTKKADEDGEEPKVEEVKEGDEGKKKKTKKVKEVTKEYEVQNKHKPLWTRDPKDV
                     TKEEYAAFYKAISNDWEDPAATKHFSVEGQLEFRSIMFVPKRAPFDMFEPNKKRNNIK
                     LYVRRVFIMDNCEDLCPDWLGFVKGVVDSEDLPLNISRENLQQNKILKVIRKNIVKKC
                     LEMFDEVAENKEDYKQFYEQFGKNIKLGIHEDTANRKKLMELLRFYSTESGEEMTTLK
                     DYVTRMKAGQKSIYYITGDSKKKLETSPFIEQARRRGLEVLFMTEPIDEYVMQQVKDF
                     EDKKFACLTKEGVHFEESEEEKQQREEEKAACEKLCKTMKEVLGDKVEKVIVSERLST
                     SPCILVTSEFGWSAHMEQIMRNQALRDSSMAQYMMSKKTMELNPRHPIIKELRRRVGA
                     DENDKAVKDLVFLLFDTSLLTSGFQLEDPTGYAERINRMIKLGLSLDEEEEEAAEAPV
                     AETAPAEVTAGTSSMEQVD"
     gene            complement(<172063..>174168)
                     /gene="HSP83-17"
                     /locus_tag="LMJF_33_0365"
                     /db_xref="GeneID:5654425"
     mRNA            complement(<172063..>174168)
                     /gene="HSP83-17"
                     /locus_tag="LMJF_33_0365"
                     /product="heat shock protein 83-1"
                     /transcript_id="XM_001685723.1"
                     /db_xref="GeneID:5654425"
     CDS             complement(172063..174168)
                     /gene="HSP83-17"
                     /locus_tag="LMJF_33_0365"
                     /codon_start=1
                     /product="heat shock protein 83-1"
                     /protein_id="XP_001685775.1"
                     /db_xref="GeneID:5654425"
                     /db_xref="GOA:Q4Q4I6"
                     /db_xref="InterPro:IPR001404"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR019805"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020575"
                     /db_xref="PDB:3H80"
                     /db_xref="PDB:3HJC"
                     /db_xref="PDB:3Q5J"
                     /db_xref="PDB:3Q5K"
                     /db_xref="PDB:3Q5L"
                     /db_xref="PDB:3U67"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4I6"
                     /translation="MTETFAFQAEINQLMSLIINTFYSNKEIFLRELISNASDACDKI
                     RYQSLTDPSVLGESPRLCIRVVPDKENKTLTVEDNGIGMTKADLVNNLGTIARSGTKA
                     FMEALEAGGDMSMIGQFGVGFYSAYLVADRVTVTSKNNSDESYVWESSAGGTFTITST
                     PESDMKRGTRITLHLKEDQMEYLEPRRLKELIKKHSEFIGYDIELMVEKTTEKEVTDE
                     DEEDTKKADEDGEEPKVEEVKEGDEGKKKKTKKVKEVTKEYEVQNKHKPLWTRDPKDV
                     TKEEYAAFYKAISNDWEDPAATKHFSVEGQLEFRSIMFVPKRAPFDMFEPNKKRNNIK
                     LYVRRVFIMDNCEDLCPDWLGFVKGVVDSEDLPLNISRENLQQNKILKVIRKNIVKKC
                     LEMFDEVAENKEDYKQFYEQFGKNIKLGIHEDTANRKKLMELLRFYSTESGEEMTTLK
                     DYVTRMKAGQKSIYYITGDSKKKLETSPFIEQARRRGLEVLFMTEPIDEYVMQQVKDF
                     EDKKFACLTKEGVHFEESEEEKQQREEEKAACEKLCKTMKEVLGDKVEKVIVSERLST
                     SPCILVTSEFGWSAHMEQIMRNQALRDSSMAQYMMSKKTMELNPRHPIIKELRRRVGA
                     DENDKAVKDLVFLLFDTSLLTSGFQLEDPTGYAERINRMIKLGLSLDEEEEEAAEAPV
                     AETAPAEVTAGTSSMEQVD"
     gene            complement(<175240..>177426)
                     /locus_tag="LMJF_33_0370"
                     /db_xref="GeneID:5654426"
     mRNA            complement(<175240..>177426)
                     /locus_tag="LMJF_33_0370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685724.1"
                     /db_xref="GeneID:5654426"
     CDS             complement(175240..177426)
                     /locus_tag="LMJF_33_0370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685776.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654426"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4H0"
                     /translation="MQQWTLDRNSESPESSGRPSALSREARLFKAEGRSTRRSTLIEH
                     RRASREAFPTEPLSTPYRNDKGDDEDEEGRRSAPQRLSRHIPQRVGIDMTVSSFNLMS
                     STACGAQTSTGSPLRMRCCGGRDYGRNPYATAAPAGRHATPGNALLTSATVTNANGYA
                     ATAALTPPSSVLTSFSESMVSDDSSYMTSLYNDVLADHLIGHHGGVMTATSGGTADGS
                     GTTAYTRTLPTPGPSLSVCESSAAMPGERGVTSLSNEECGSGWRVSADGPVSSARRGL
                     GGEVLRFADTVSTEVTPRSLGVVSPTEASSLRLATLSAKGPTRGVGSTAIATSVGTGL
                     SSALPRVRSRTIYTSGSGSRGVCGARVFNTTPERVLDAPQFPSKATQLLDWGANNCIA
                     IGMGKSLYSWSGDSGEAEKVVELDGTMRIRCVQWLQKCSCVAMSVQDGTTAIFDSRTS
                     SFLRVVRLPSGLEVTGLSVKGPVLAMASGGPFGTTCAFDLRAKDALVATYEGHVGGVT
                     NLHYCAAEPFYLATGGSDGSVRVWDVRRASTPRYAFDGVHQGSVNAVRWDPQKRSRLF
                     TGGEDGVMCLIDTHAPKRTIEMDTTADEEGLGFGCNREHLTQYVARAVNAQHPISDLV
                     CNGAHGEVLTAHKNKGQLQLRKASTFHLLATFTAPHCDASLSCLTMAPDQERVCAAQA
                     DETLKFWRVFEKSAARGGERSGVQRVGQGWTPPHQDPSSFLDEPLR"
     gene            complement(<179436..>180416)
                     /locus_tag="LMJF_33_0380"
                     /db_xref="GeneID:5654427"
     mRNA            complement(<179436..>180416)
                     /locus_tag="LMJF_33_0380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685725.1"
                     /db_xref="GeneID:5654427"
     CDS             complement(179436..180416)
                     /locus_tag="LMJF_33_0380"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685777.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654427"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4G9"
                     /translation="MIRYSKQQLLSLRPAAIEHVMRGRVVDHPPFLKIPESFAPLLSL
                     PFAMEYVNVDAAMQLVEHRSYASRPASSPPTSVARTEDLDDEAQARLYTCPVCAQGRL
                     HSCTAIQHILQRTSRYFMSTKLGAALMQPALVVESLLQLALVFDAKQSSLRLRMLAEQ
                     SPRVVHLVEEYLCGEGYHLPLPPVTAHEDWAALNAMLRFDAIRDNKTRVITDLSKHWK
                     KRRTQFEQFVYFFAFRDARPVRPAKNIITKSAKPGMVAMLTGDVPAMVLLHRLGFFIP
                     PDYYWKVFPFLRQALGEGTLSYDVVRHLGLYLSSAQPADMYNPVEVPIHA"
     gene            complement(<182237..>183346)
                     /locus_tag="LMJF_33_0390"
                     /db_xref="GeneID:5654428"
     mRNA            complement(<182237..>183346)
                     /locus_tag="LMJF_33_0390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685726.1"
                     /db_xref="GeneID:5654428"
     CDS             complement(182237..183346)
                     /locus_tag="LMJF_33_0390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685778.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654428"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4G8"
                     /translation="MSALRDVPGYATMKDYYDSEYVPHDLLTRYHALQVELQKRREQH
                     FVTLSQTSGLAVPYDALAVTSTLPHLKVNLSSKTRCANPHQQQMSPRSLRSPHRVVQR
                     SGSSLVKSGSGGQTETCLGSGNRCVPRARTELEEIYAPRHRSHNGVLGGCTLMHDSVA
                     RGSSARRTASPSASSSVGADAASPLQAALPISAPQRRSRPQRQRCRSLPKACTEGLTP
                     SDPYEAAAEARRQERFLSESKRLGKPFVPSGSGGLDVPTRFMLGDCVKMLYRSIAPNW
                     WVAAPVVVSTAEDLIAVYFFLEKLSRKQVTELLQYMNACLKYNDAVREFSLSKVEEGW
                     DVLTDDGHVLYTFRPPWVKKRVFLPDTVSPPHVHE"
     gene            complement(<184306..>185526)
                     /locus_tag="LMJF_33_0400"
                     /db_xref="GeneID:5654429"
     mRNA            complement(<184306..>185526)
                     /locus_tag="LMJF_33_0400"
                     /product="putative serine peptidase"
                     /transcript_id="XM_001685727.1"
                     /db_xref="GeneID:5654429"
     CDS             complement(184306..185526)
                     /locus_tag="LMJF_33_0400"
                     /codon_start=1
                     /product="putative serine peptidase"
                     /protein_id="XP_001685779.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654429"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="InterPro:IPR029059"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4J7"
                     /translation="MLQSLVNSIVFVPPRDPNSLQRVQLLQRKRHMSFTSKKSGERIS
                     YFHFDPKGDLVTKDNPERVVRSSMVLLFHHGNAEDLGSAFSYAQSMACVFGVAVVVYD
                     YCGYGFSGFPDAAKPAEVTEKSVYSDADHMYAHLLSLGYPAHRIIIVGRSVGGGPACY
                     LAEKHHKKVGGLVLISTFTSCLRVVSSCCLPYLCCCVDLFPNYRRIEHIMECPVLVMH
                     GTHDNVVPHHCSSELLEDIVARRNNALQRLLKKREGARANQAKRSSVLGAASTGPTNT
                     TTASATIIVADEALVTAQPPLDGETVSVFDLYRRAYDGLPEAVRRVAEGRLDVTAADA
                     SIGVFHRWFAGCGHNDIEAREGHAFSDMFDYFVRFSTAFSMEREALLLAKPVTGAAKA
                     SRDSLNRADSEVRE"
     gene            complement(<187128..>189947)
                     /locus_tag="LMJF_33_0410"
                     /db_xref="GeneID:5654430"
     mRNA            complement(<187128..>189947)
                     /locus_tag="LMJF_33_0410"
                     /product="putative DNA mismatch repair protein"
                     /transcript_id="XM_001685728.1"
                     /db_xref="GeneID:5654430"
     CDS             complement(187128..189947)
                     /locus_tag="LMJF_33_0410"
                     /codon_start=1
                     /product="putative DNA mismatch repair protein"
                     /protein_id="XP_001685780.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654430"
                     /db_xref="GOA:Q4Q4J6"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="InterPro:IPR007696"
                     /db_xref="InterPro:IPR007861"
                     /db_xref="InterPro:IPR011184"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4J6"
                     /translation="MADERDGGVVQAFLALGADSSQCFRMFSRGSNSGCYVLGWWATF
                     VANEYIKSTAVLKKWSSASSSSATVDVVVVNDALCKEIIRDCLLRRGVSVEYFERETA
                     GGSYVCRQRGSPGNITDFEASLFEFEEAEIQLLASGSLVFGAKQATGTTIGFAALNNT
                     LRQLSFAEYTDTPQFTSLDALVAQTNLKELLLCVMTPAASAGAEATFSDDDRITAVRR
                     ICERCGVQLSVRTLREVQQLQKVEATAKGLEALAEILRVPEERLSLELCPIARQAVEN
                     ILGRIDVMDPSNQRAFYLRRTVPSTYVKLDSAAIEALNLVSKKPEPRGTLPTSVFSWL
                     NRCHTGMGARAMRQWLLQPLRCADDINQRLTMVELFVENPILRDMFTAQVLKRCSDMD
                     RLNRKLQRRSLALKDTQAFLEFVNVVPAALQVLGTYTGPQSKLLKDEYIAPMEDINDH
                     MANLKTLIEATVDFGDRNAVRMNATFDDELQDLHEQLTSTQRQIDKEYSRVLSKYGWN
                     EKQLKHEYHGTYGYVFRVSRKEDRQLRSTKELITVSTSKDGVRFVSEKMAALSEQYRR
                     ISDDYETRQMDLKRKLVDTIASYLPVLDDAKELIATLDVYVAWALVVKDCPRPMVRPV
                     VREAPGTVTLVKQEGTSARGADAAPLLSFKGLRHPLVELRQPGYKANPLHLTTHTNGL
                     LITGPNMGGKSTYMRSVGVAVVLAQAGCFVPADAAEVQVRDAVMCRVGATDHLAQGVS
                     TFMVEMLESASILTGATQDTLAIVDELGRGTSTYDGFGLAWAIAQDVAVRVRATLLFS
                     THFHELTQLPQQCSALQNMHFGAEVDESAGTLRFSYTLQPGPCGRSYGLYVASLAHLP
                     EPVIACAKVKVAEWETFEKEGAAKSSAGAALDEAVVRKVSAYAKRIRELEQLGPGDDH
                     DAAVQRLKLEIRQDADVRPYLCEAA"
     gene            complement(<196045..>196344)
                     /locus_tag="LMJF_33_0420"
                     /db_xref="GeneID:5654431"
     mRNA            complement(<196045..>196344)
                     /locus_tag="LMJF_33_0420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685729.1"
                     /db_xref="GeneID:5654431"
     CDS             complement(196045..196344)
                     /locus_tag="LMJF_33_0420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685781.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654431"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4G7"
                     /translation="MMFGRSHAPQKEWGSMYFYEKLRHLIDHTSNFVISKVDWWLPSV
                     AVGIALSLFVLGGPEALPQAASIVLPSATPAVTTPLFATPDGPQGGAAPEDDEEF"
     gene            complement(<197182..>200322)
                     /locus_tag="LMJF_33_0430"
                     /db_xref="GeneID:5654432"
     mRNA            complement(<197182..>200322)
                     /locus_tag="LMJF_33_0430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685730.1"
                     /db_xref="GeneID:5654432"
     CDS             complement(197182..200322)
                     /locus_tag="LMJF_33_0430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685782.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654432"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4G6"
                     /translation="MATASTSLAQSLQKLVDADTSLQLHILERVSAHVASHEPTAAIS
                     CSVGSKASLDDVPQWSRPDGFPPLPHSEHAKPQLESEPPLRWAPVEMALTLDVFEVAQ
                     RQPSGCQALFLTSSVCIEASASAAVAAWLSCYVTFFFEERRTEDAVEASCAGGRVRRL
                     PWPWPWCVDILYRRLKCQVRVLLLRVPSLYTAVTSGAGTRATSGRLGDAVPVTPVIAT
                     PPAPPSGEADFLTGQLSSIVPLSTELEQLPSARLTNTRSPCCAYPSDRFLECSHTVHM
                     IGVVHQVFYECHSAALPAPWVTVLLVPLTASLPRSAFAKCGKEPPRRREVDLSLLGAP
                     QRSAVAVIGGVIAVRGHTQVARRRACARAEAVAPLRFGEVAETSLEEYIVATWAAPVQ
                     LSTGVLQTHSCSWLSRNCADSVVEETAGAPPSATMVSPGSAARGPVAVPPYHIRSAAE
                     GADVGSSEHCDDAAVQLTVAEEEATARAALVFWEGARLALGMEAPGQAEGKGRATWAA
                     RLFSASLDFLVASQLALVSAQMADGVVVLAVDEAVPESLLTRLLRRLDRVVPGATLEV
                     PSSVLARAKPPFFLPSYRMQRVPAPPVSRANAPASAVYGVVGTSMGSPAARRARHHRV
                     CVGTAVAAPPPPCYPETLQGGVLTQANGRTLVLQRIEALPAPTLKLLQEALRDEASDV
                     EKVDVPLFGSHASERAFGSGVATSPCTASQRQREAAQTPSTNLAGATRRLIRREGGQT
                     AKYCATHSALCSVRQGASLTHKSQLVEFAERCDVVVRPAYDMHRQTAALQGSTVPAFC
                     ELLHSRGEAWLGLLGAALALPVHNATADGPSPNSFATPPSCSPSDAPALSEACSRLLS
                     TYFIAAKAQCVEGADASMMKTLVKLTLAHTEWRTRLAMALPQRTGHPTAASSPTRAVT
                     ALIDAVAAVGLCDATLHFFTAKTLLGECVFRLLESEAWPTWAPEYCSAPLPQQAEHGV
                     SGAFVHGEGGEPPDWQRLYAEVSHRTRLVPASMHTTEPPSPAFSILQLAQDLQDHLER
                     TVQQSHLALSFTEGGV"
     gene            complement(<200968..>201642)
                     /locus_tag="LMJF_33_0440"
                     /db_xref="GeneID:5654433"
     mRNA            complement(<200968..>201642)
                     /locus_tag="LMJF_33_0440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685731.1"
                     /db_xref="GeneID:5654433"
     CDS             complement(200968..201642)
                     /locus_tag="LMJF_33_0440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685783.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654433"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4G5"
                     /translation="MHDRTLSGSGHHRTAVATWSYLLHSLRQNVEQAVPDALYEKLLT
                     DEVPLTPAESRQLADAHRLLRFELQKRIGLLEDSLADAALPYLLQWPALFQRAWLRLP
                     MDQGRASVTEANHDAVVPAPPSFVHAPAALPVTEWAPTLSPASPPACSNGLIGRGALV
                     PRLAQLTRHVIRCVEEDLGRLEHVSEPREDGVPRSRRQVALEAAWRAQWASLLTWHAG
                     VSYGMG"
     gene            complement(<202505..>203155)
                     /locus_tag="LMJF_33_0450"
                     /db_xref="GeneID:5654434"
     mRNA            complement(<202505..>203155)
                     /locus_tag="LMJF_33_0450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685732.1"
                     /db_xref="GeneID:5654434"
     CDS             complement(202505..203155)
                     /locus_tag="LMJF_33_0450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685784.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654434"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4G4"
                     /translation="MLEKVVPIPFLGKEVSGWLYRYTRWTREHPYKAAAILAACIGGS
                     ILYEAQVTHKNRMPSPNVNNHLEYQLKEASLWERWFRRVSTAQQDMKAEEVASLENAG
                     DMLTPEEITRRQRLSQRTIANAERLLATTTDAAERQSLEKVIERENELMKGVNNTTML
                     VRSGQLEVRAPHWEIRNNERNWSILSRDQQQQKDHYWYRLERSREDDFARNTYSTP"
     gene            complement(<204351..>205217)
                     /locus_tag="LMJF_33_0460"
                     /db_xref="GeneID:5654435"
     mRNA            complement(<204351..>205217)
                     /locus_tag="LMJF_33_0460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685733.1"
                     /db_xref="GeneID:5654435"
     CDS             complement(204351..205217)
                     /locus_tag="LMJF_33_0460"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685785.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654435"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4G3"
                     /translation="MHQLRTFNYVASELGHDEPVLHAVFVTHRCLPPDPPEVNFTTAI
                     PQTVTAASRRTSSDDASIGAAVHVEKTVVLSVEDTLAAPLEVALTVEQELAQLSKKLD
                     AWKVQRLADLQARGGERSPSRLAQMEAAMERRLALRRIEEQDRAQKRVDALLSYLGPR
                     IDKQLQLVAREHDGEEALSSSYARVETTSDVKDSACADKSAASAATPSPPSPRARILC
                     DQQYFVKRQEIALEERGARQAVLRNMWDARRLAHLVEDEVSFRHSIEAREVVWRDRVH
                     SELRASVEMDHV"
     gene            complement(<207188..>208813)
                     /locus_tag="LMJF_33_0470"
                     /db_xref="GeneID:5654436"
     mRNA            complement(<207188..>208813)
                     /locus_tag="LMJF_33_0470"
                     /product="putative deoxyribodipyrimidine photolyase"
                     /transcript_id="XM_001685734.1"
                     /db_xref="GeneID:5654436"
     CDS             complement(207188..208813)
                     /locus_tag="LMJF_33_0470"
                     /EC_number="4.1.99.3"
                     /codon_start=1
                     /product="putative deoxyribodipyrimidine photolyase"
                     /protein_id="XP_001685786.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654436"
                     /db_xref="GOA:Q4Q4G2"
                     /db_xref="InterPro:IPR002081"
                     /db_xref="InterPro:IPR005101"
                     /db_xref="InterPro:IPR006050"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4G2"
                     /translation="MKRGRSCSPSTGSAAAEKRLHTEREEVALFLFRRDLRVVDNTGL
                     QALCDEAVRRSIPVLPAFFFNPIQCDKKRNAYFGDAFFQFFCESLVDLDGAAQLNGGL
                     VCLRGSDEDCLRRIRDSGYEVKVLGFNEDYTPFALARDRLLRDYADKQGIVCVTGPHD
                     YSLRPLDEVVKDSEQPYSVFTPFYNKFTAEHARKVAVPLMVNVSKVQAMLVSQPKKCL
                     EHHLVDPALVYTHMPQVQDHGGRTEGMKRLACVERLKQYADVRDDIAGDRTSHLSPHM
                     KCGTVSTREVWHASVQALGTGHAFTRQLVWREFYAMLAFTRPRLLQGQLNSFIGQQDI
                     VKATQPKQNAPFQPLYDNYKWSWKAEHFEAFKEGRTGVPLVDAAVRCLTATGWCHNRC
                     RLVISNFAVKVLGIDWRECERWFATVAVDYDVASNNGGWLWSSGQGADAQPYFRTFNA
                     FRQSERFDPDCKFIFQWVPELAKVPPSVVHHWEEYCAKARGRATATHSRKRSGQVKAK
                     EYPTSYPAPIVDIKAATKAIIEEFKKYGKYKEN"
     gene            complement(<209869..>211950)
                     /locus_tag="LMJF_33_0480"
                     /db_xref="GeneID:5654437"
     mRNA            complement(<209869..>211950)
                     /locus_tag="LMJF_33_0480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685735.1"
                     /db_xref="GeneID:5654437"
     CDS             complement(209869..211950)
                     /locus_tag="LMJF_33_0480"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685787.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654437"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4G1"
                     /translation="MCAQAHAHTNNLIMDAGTVLDNLLERHRAFVAAPEHATLAKVRR
                     RHGSTSSAVPPSKMVEAVERGVNPLILGVQAHKAESAAREKAKARRKGSGFDASRRSS
                     EPPTPSRTASSSPRKTSSQSRNASASAVTVLQTHTRLPAVPAASEMQRAREVAVSATL
                     TSRYQELRAKRQQEDKERKRSRADTASELHSAAAGAGGESAKSARKCVRMEEKRLPPQ
                     GPPLQMIASTTVSRTRRDVWRRRCTTRKILRLARGISRASALRRYWYTTLSGNRAGTG
                     DCGSFAPATHAAHAVDDSGRGENEEGVATAAWGSKATPKPTPEQLGRSTPPLSVFALN
                     DTTEKRCALRRLRAARRSVNDAHDSTQMSSKRGDVVADSKAAATTPETVQLPVATAQS
                     AADRTAPSRTSRRQRKQAIRCVLSFSVASMWTLAARIVAERLGTVSQLCLECMGTTVP
                     ASALAARSEGAGVLPLSLARLFPLFGALVEVQELELTTAPVRLRSSRNARRARGEGAR
                     GAPELRVLQQRKGVVMEEYSKTLGVLLLPPEGGPDVQAWTDEVARVLAQGQDTLACAS
                     RGDEAAPLLRVKSSPSIVRVPKHFPGASGSFAELLQRLLLRTPTTPSTSHGGREPTPI
                     ASTVTRTPATPLTDLRVLVAVFCGEVHAAAEGCNAAACHAHRCEEGPPVAAEGIRADA
                     YPLHRLLHRCL"
     gene            complement(<212698..>215940)
                     /locus_tag="LMJF_33_0490"
                     /db_xref="GeneID:5654438"
     mRNA            complement(<212698..>215940)
                     /locus_tag="LMJF_33_0490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685736.1"
                     /db_xref="GeneID:5654438"
     CDS             complement(212698..215940)
                     /locus_tag="LMJF_33_0490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685788.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654438"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4G0"
                     /translation="MHRSGHEVRHILARQYDMDAAALFHERQADVAAFAALVFRRPTS
                     AVHKPRLTSSLVSSAPHTSASETEAVTSSPPMIHVAAVTAAYRRPASANVPVSRVLRE
                     IKARAEREQRMARKTTKMTKSDADDLARGLPHLATSGSRSGASLRAMGFSAQEIRDRT
                     YLWMTGLRAHGSSADDVSRRAAEESAALAPEQQFQLRRLRLKRTHQRPLSHAQWALWL
                     RRRRRLWYRRRPVARRRHLVRQLALEYGRPIGLCRCCRRRRHPFKTSTPARKARPPFI
                     KAACKVVTQWLPSHSRLVKRFHYRIVFLAVQPGVTHVSLTSAASSIPSQHGGDAAGSS
                     TASCETRRAKRLRLCASSVARVAIPCEPARKDHRFLQRWVTALVVHHRRRLFCSPTAG
                     NAHPSHSQASLTASAPAETMLADLSHHCVYVLTPRKKWPFSGGVCTSPNLPHEAASAV
                     SSALASLLAVLGLHPDVEGVGAAPSGVVFALSPTARHQRTRRTRATVVHGHMWCAGAA
                     CLENAALKAADECRDSVSTLSRYTRVVPVVLVASLRARTAVAPMEVLLFSEGPVHFTR
                     RATTQLRIQLVSSWSPCSLSSTRVSAFEYWRCDPSAPSSQSEPEALSTLQGALQRCAR
                     VYRRLQLRSCSPRCNPRVRRGKLSASPPRKNAPRIGATVAGPRTTAHGPQQASSRLSL
                     VAFPSFSSPFLPYPHRTGSGEGRAAPYAWRLALLYRVPASSSRAACTRIRDGAARSAA
                     SPGVKRAMATPSLRRRCLLSWQARRTHFQLARRFFGFLLMAPPRTEPTCSGTAARGRC
                     RALGFQDRVTLLHLLGRPAYPLDYGLSRPSAAAQQRRQQRSRPTPKKSRVARQGTKRS
                     RTPTDGAPAAAAPACAPLPSYLHILEYYGNVSNAACRVFVRAAHTDRKLPTLHCSVGT
                     ILLQYRWLQRRGGGALRIPCVARIGVVTSSAFFAQRFGCMVAPVWCCFPPTTIKTGGG
                     AILAALDNEDEYAVPAAAPGVHWTAASLVDDTASASRALTYLLAPPEVADDLLRRSAL
                     LQRDALPRKRAHSRHQRVFDLGQGRTVRELETLLYDPLSCSPVQLIQWYA"
     gene            complement(<216405..>217325)
                     /locus_tag="LMJF_33_0500"
                     /db_xref="GeneID:5654439"
     mRNA            complement(<216405..>217325)
                     /locus_tag="LMJF_33_0500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685737.1"
                     /db_xref="GeneID:5654439"
     CDS             complement(216405..217325)
                     /locus_tag="LMJF_33_0500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685789.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654439"
                     /db_xref="InterPro:IPR006674"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4F9"
                     /translation="MEALHYELWDRCTSFVAAACAGRDASHGLGHMRKVTEQAILLYL
                     MDTAATVAPGEKAGMLYRIILVGMLHDVADHKYDAAGALLHRVKSFAATEAAALVAHA
                     ASTDPRLFCVPLPRANAGETEGSAQQVVQQVAQLLLTSLDAISYSKEVKRGMRWFVPA
                     LSEGVEAATKSSSWVAVRDYVSDADKLEAVGEEGLLRCYEYACVQYRSSALAQLASKS
                     PRPSVETAAPQATAVERQLEAVLLREVVAHFHEKLKRLLPIFIVTSSGKHLGIPRAAE
                     MAALLEEWQHRGPPPVTMYWRNAAAECTPT"
     gene            complement(<218078..>220741)
                     /locus_tag="LMJF_33_0510"
                     /db_xref="GeneID:5654440"
     mRNA            complement(<218078..>220741)
                     /locus_tag="LMJF_33_0510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685738.1"
                     /db_xref="GeneID:5654440"
     CDS             complement(218078..220741)
                     /locus_tag="LMJF_33_0510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685790.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654440"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4F8"
                     /translation="MPSAPLGRGPPHPFSPFNDEADDDAHEESWRLYGSTVALADCRV
                     STLLPSPPPQLTRSALTAVLELDCDALSGSDDRGALIDVVLSHLCAASSLPGADADAC
                     GGTERSAMAALSDTWREVKSRVPLKASPSIHLTGGHIRALLRMYAEASVELASITLLR
                     PLTAAAEPTAGAETEMAAAVAALGAVHEILGAQQVARITASHIASVPTDQTILDRIRT
                     LLLALLGASPLSSSRAQFYLHPHLELSIDPSRSVAGCGLVAIGTVGEGELLAREAALA
                     TVDGTEVRVFSRGDSETTSAVANTAEHMQDSTPIWKEGVRRCHSSAAAAPVAEEAANE
                     PIARTLQRKDSAPLITENGERSAAAQLLSLLARFPDLLRGGLHQWAERVMRDAFALQS
                     ASCVQQVQVSKAAKPQAEAAPQNSPCDTNLTADAPLRRARHSRGGVAHAFLPSAPQLL
                     LHVRGVDEFRIKPPPRSWRRKPCNEHHGCVNAGMTRGDGDCGVAACASPSASDVSVKA
                     LFPFLRHLNHACVPNAILVLDRTPTHLRRSGDDGVVASLVALRAIESGEEVTVSYVPA
                     TTALTVSQTELLETLGFRCRCLFCTQKAALLRGHVCGECGQLIYEPGIQGEPEALSSM
                     PAAAGASKRATVFRHEEHCSHRRRACEVHGVTEEKSSAAAQLQRQLDDVLVRLAKGED
                     EGEAGENVRDPVVAAVRHLVDLDACVARTLLPTHFLRLRLRLEAFAYSTVARGLGSTV
                     SAELIHLCASTLEELEMLMPANHPLLTGLRMYLVFSRGRHVRAVNAAEDLVHGTRHEE
                     CCGAVREQAALMQLPFVVDPLVRRCVVRCFQEHYVQLLRWRAEWLSRAGEVGTLMSFL
                     ARYSVELEACGVTTAEHMELLSCMEDGAEDA"
     gene            complement(<223247..>224296)
                     /locus_tag="LMJF_33_0520"
                     /db_xref="GeneID:5654441"
     mRNA            complement(<223247..>224296)
                     /locus_tag="LMJF_33_0520"
                     /product="putative d-xylulose reductase"
                     /transcript_id="XM_001685739.1"
                     /db_xref="GeneID:5654441"
     CDS             complement(223247..224296)
                     /locus_tag="LMJF_33_0520"
                     /EC_number="1.1.1.19"
                     /codon_start=1
                     /product="putative d-xylulose reductase"
                     /protein_id="XP_001685791.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654441"
                     /db_xref="GOA:Q4Q4F7"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4F7"
                     /translation="MVLMESLVLEKKGELTIREVDVCDELGPHDCRVKIHSVGICGSD
                     VHYYEHGHIGPFVVEKPMVLGHEASGTVVAVGAEVKNLKTGDRVALEPGIPRWNSAQT
                     LSGLYNLDPELTFFATPPVHGCMSTTIIHPAALCFKLPDNVSYEEGALCEPIAVGMHS
                     ATKASIKPGDVGLVIGCGTIGIVTALSALAGGCSEVIICGSRDERLEIARRYPGLRAV
                     NTSREGELKRAVAEATEGNGCDVVFECGGAASAFPLIYEHAAPGATCVLVGMPVEPVP
                     VDIVMAQAKEITFQTAFRYRNVYPRIIRLLSSGKMDVKPLISAKFVFKDSVKAYERAM
                     HRDPKDMKIMIQMEN"
     gene            complement(<224959..>229317)
                     /locus_tag="LMJF_33_0530"
                     /db_xref="GeneID:5654442"
     mRNA            complement(<224959..>229317)
                     /locus_tag="LMJF_33_0530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685740.1"
                     /db_xref="GeneID:5654442"
     CDS             complement(224959..229317)
                     /locus_tag="LMJF_33_0530"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685792.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654442"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4F6"
                     /translation="MTRPPASLQLKGRSESLPESAHPSPLLAYGGHPSDAQSGFTTTY
                     TVPLGAPIDMAAPLSPLMQPAPHSLYGANLNHSGRAHMISLQHYSSEIGSGLSQTPPQ
                     RNGGSNNARDSASQQSLLTLTPHDEATFLAMLCSRLSSLPPPLKAPMPLLHRTIAASG
                     MHTRAHVTVDGAFMSGQRSLPTPADALCNLFQQYLDAQRALQPDARQQLDGVSGTLTV
                     PLDTQELVLRQVQDFALQLDAAAHAHAPPHQQAVVGSSDQAPGAASGTGGRLGDVGSA
                     PLLSAPAAHKGDDIPWDTIFSYLADPPTAAHATLRAVSPASRRRLEQLGWRWMIAKVA
                     MSVCPFIQESGAGASVRDAYARLDGQERQYVGSVPVARRTPLLPPYRPTLAKSERLLD
                     GSALLHCERQSLLLDWAWREGWLHRLTCTHHAFVLPRLSGGRAVLSRIRVGGVLCDVL
                     RPKRNRLDGGAGEGKGGSGGALAASGGAGDMTAKAAYGAQLTPPPLPILEKRPTEAFN
                     ATRKLLDDAVSAISREWARSAGAPRSKQLQATLTLFSQPSRANTPSSTVTAAMDSSVA
                     NSPQETERGYRQDTFTDLQHHPHYGHALLPVLVEDVSGTAHLLCTNKTRLDTAEVRGW
                     VSSWLQHRHRLPRQPICTSAAEFLLVRSPSAPLRAADDEVSEGDRAVCTTAAAAAPSL
                     QADAGRTRRTDGTPPRAEDGAALGPPLLTDSVTPPKGGWEEDEDEESYGAAMPELVFA
                     LDGSRDHARMVNAEGLVGVVAVGEAGRAGCDPAAEYRFRVRLQDWRNKGYGVVRRMNE
                     VDPPWLMLGSASGPQPRPLALHLTEQHVPWLAHQLCPDSEGGGLLDLQELHLFVTESP
                     LPPGWAAAWRWCMDVLRDRKNLLVLSVAARPWAPVMAEGAALDVHSECKSHDVSEAIG
                     VLGAFTAHAAMFTAPLQVLSLQGAMADAAAPLFCDVNRGTHPEVDGEGGSPSLERLRE
                     LYVSVRSGQSAGGSPCSGGLDDVHVTATVYPVLQVLWLDAPRLRRIHLDGLLVLRELH
                     LISEALLACSALRGVELLPHLEVVHLERAIIDDCSFFGDCPALRELLLHACRLSLFLP
                     SLTVVRDGGSGRLEELRGVERAPRLETLSLCYTEEVRNLQNFAQCRSLRRILLTRCNG
                     ISSSSIAGLEHLPHLELLATEYTRVSGLSHFASTPALRVLRVDGCKRVLHSSVMGLEN
                     AAVLTELSLKNTNVSTVANFGGGCRSLRSLDLSGCRHLDVDGLQGIQALPQLEVLCLS
                     HMPITDVNFLADCVRLTALYLEGCTELLPTSLEGLQHAPRLRKIVANECPTLTRVGRL
                     GKCAALEVFAVAGATALTVEGLQGIEQGGHIEYLDISSTAVHTLHFLVGGCRALRYLS
                     VKGCRRITSMRALHGVEKLPRLQALNMESLDVHGPLDFLATSTSLRYVSYAGCARLSS
                     DDVQVLRRSGVQAAIP"
     gene            complement(<231288..>231896)
                     /locus_tag="LMJF_33_0535"
                     /db_xref="GeneID:5654443"
     mRNA            complement(<231288..>231896)
                     /locus_tag="LMJF_33_0535"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685741.1"
                     /db_xref="GeneID:5654443"
     CDS             complement(231288..231896)
                     /locus_tag="LMJF_33_0535"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685793.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0535"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0535"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654443"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4F5"
                     /translation="MREVLAAQRETFFQASVQDGEPYRWTALDTSLDVSGSLRLSHLV
                     YLPPPSLEVLRAYEASRGISPAATVHSVRAIVRTLTSNNKVEEYVVACFPLDVQRLAN
                     AQTFTVPSTEVDQSGAAAAAAAPLPKYTVASLLPRRHDTSAGLSSTFLLPCPTDIVTQ
                     LNIQLGLDGFTELRVDGPGTVVFTGEQRLTLVGHRRHERDAH"
     gene            complement(<234307..>235587)
                     /locus_tag="LMJF_33_0540"
                     /db_xref="GeneID:5654444"
     mRNA            complement(<234307..>235587)
                     /locus_tag="LMJF_33_0540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685742.1"
                     /db_xref="GeneID:5654444"
     CDS             complement(234307..235587)
                     /locus_tag="LMJF_33_0540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685794.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654444"
                     /db_xref="GOA:Q4Q4F4"
                     /db_xref="InterPro:IPR001075"
                     /db_xref="InterPro:IPR014824"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4F4"
                     /translation="MKIGGLDVSLIALLPVAPTTWRRGLGSRQSTSRPSFVSCCRVPQ
                     RTVFVRFQPTPNDACYKFYVDEMQFLPPNAHTMVFNSTNSYLSPLAHTLLEALPMVEE
                     VTVGTSFVTVKRVEEADAAAAARYFAMKFSTVQQNHGTDEEAAAARSQALQQHVANVL
                     KEDGEAAAEARSFNAASTAPVLSPADASFDVGEFTVSPSSQDEQIDEAALQSLIAETD
                     WSELKLHVSALLTDHICSGNPHVDPSAPHPHADTAPEEGDSEVVLMIKELVSTTIRPQ
                     LQDDGGDLRFVGFDPVLGDMHVELLGACRTCKSSKTTLVDLIERTTRHWIPEVSAVRD
                     VSRATSAFEDLAAHRSNAAAAGAAGLSSSPLTDQIAGEGDDGLLNAKGTVQFSPSPTS
                     MSASAASGAYKIVRKVQASSAGEAGAACGAAAPL"
     gene            complement(<236617..>242718)
                     /locus_tag="LMJF_33_0550"
                     /db_xref="GeneID:5654445"
     mRNA            complement(<236617..>242718)
                     /locus_tag="LMJF_33_0550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685743.1"
                     /db_xref="GeneID:5654445"
     CDS             complement(236617..242718)
                     /locus_tag="LMJF_33_0550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685795.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654445"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4F3"
                     /translation="MTAVDVATLMEDDISVCLGGFTKELVYQQLLHCSEEGSLLRLLT
                     VELVANDGRTLVLAAPQPSTAGSDAASASSLLMDIAGTGGESAMQPAATGDAAVAHPG
                     DLLLLRCQPRRPSENAAEASATASDSGAASGAAWATHQEFITYNTSLFTASDVDLWRE
                     AVEGSIVVVVRWLATLLEQPPGLAQLTFLEAAASSSSPGAGGNAGREGWRRTLQLPML
                     LSIKPDAMRGADAKTLDRLRRTVSFALRALLAVFLHVESAMRLPRLCHRLVYLFLASP
                     LYVDGASQVAMQLVAADSGASTRQLMANTLHSCLLLGLQYASGSAAVSMDAFLATAEV
                     RRSARQACNCVELVLARLSHVWLQQSHSGRSKEAAMDVSGSEEAISEVLEAVAATGIL
                     KEVLRWLQLEDDMRRSHDRLDTNRSGASDDVTDTLAELLVPPTLQRIQDGRHLQDRAV
                     TEQLAALRRTYNPYLSREVQQFIRGTALAAYAELYGSTARAVRRVTKLSGGSEELCRG
                     RVEGVIAVRVSGVEAVGPRSGGLAEYSLAEVQHYAAFGLPVHLCVQGSRERRHQDEIK
                     ALVSALQSARVSDTDASLFAYAVVQLNGQWVIFPLVLTHATSDRSAGEKGSSASTASS
                     RVTAHVLRDADMLADFVLTSAAASEDGQAQAWIVLGAEAAGHQRRGSRRRRAALLSAT
                     AAAPPERLLPAGTPALTYLDCLRRLHALSLSVRQAEAGVNGKGRINTGNGRGGSRSSG
                     QPFGADAVSGLWTEHFTDGAVPMQRYVSSLTAPVAALLSGSGNGLDAAVSSTSSGASG
                     KRLGDAPLISLQTLLASVNEAVGFSSAQVEALHSLTAGTGISRNGTGAAAQGSSGVPV
                     SVRVVDGCTGSGKTAVLYASALVRGKLHAAARQEQQRSVQGGIKHAMASVKQIVTALR
                     CATMEELFSIYAGGRAGGSLLDEASLIVAEARQLYQQLNEGFLYCSTPLLLRPAVATS
                     TVPASVGQFLFGSSKGLMDEEQERGRRNGARNTQVAWQLSDIASLAALVKESHTRSFN
                     APLTTQLNTELSRLEATGLWSGGCRAAVSVAAPLLSLTLSARDAADLMARASTSSSTA
                     QSWADFIVRDFWPDCDVATSLYLVASAAHGGASSATWELLNAAPEGRYAPVTMPPTTH
                     LSLLSKEQLEGWHIVYLEKQSELAQHIHAAVHESVKSLFQSFLDLVWGVAATSQSTRH
                     TVLTSTPTELTQGLLLPYLWCWQPSHMCIDDIDAVQDSIFAMLTPVSSFVYSLTSEVP
                     AFQERRRSHERIVLALLRSLHTELKRTGDLTTTVLRDSLRCRRAEVQALLRYTIEDTR
                     ALSKVTEEPANGEGDDAQQDGEDGEASGRLQGVTDTASPPPAFLGLASHSAVEVWSHG
                     VSMDNCVAADTAAAVFLMEYLSSYHPARCDDASTTTTPPAQTSFGIYTSTAGEAETIS
                     AALSRSALLLSPHFRRSVRVWKESLEDAGNEAVSPASAVMTAPPAGTTTMSYTSLEEA
                     ECEVEVGIVCLSGLLEVVIAALHKSRGGTSGTVADGGSHRPDVRHEQWQQLWAESSDG
                     SASLFVTRLQWWLWRLLRRVRHGVFLIGSRELFACIPLFAKAESLVQRQRRLLAPKDH
                     RGYWLPSEVGASVLAMVCPDHFKCRRIAVVREHDDAKAAPAPAPEGDEEDADAEEELV
                     TVQVHGPTECLSLCLQVYNACPNSSHACLKPCHAQHRIGTAHLEENGCTATNEITHAS
                     CPYPCGAVLPCGHTCHRVCSALCAPCAYTGLTELTCGQRVVSGTDSNQVIQYAFFHHF
                     QERRCGEPTGLCRTPVSVMCTRCGTRSTVACHCVTAQLSRRQLAAEEETGESAVADDG
                     TYVLDETACAGCVALYNKVAKKFGYELLATPPVDHAQSGHHGRMAVHPHGGVDADDGD
                     EEGEDGETMGTALPRHLLSTEAQTELRREFTIASKKSELLVRKEALEISSGRATEKTD
                     YEVYRAQYTALRTTLQSQEKASRDAYQAVLDGWAVKLRHALEVQTALNTELDTLMPRL
                     VAEATEEAQVQRLQFAE"
     gene            complement(<245192..>246247)
                     /locus_tag="LMJF_33_0560"
                     /db_xref="GeneID:5654446"
     mRNA            complement(<245192..>246247)
                     /locus_tag="LMJF_33_0560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685744.1"
                     /db_xref="GeneID:5654446"
     CDS             complement(245192..246247)
                     /locus_tag="LMJF_33_0560"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685796.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654446"
                     /db_xref="GOA:Q4Q4F2"
                     /db_xref="InterPro:IPR001233"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4F2"
                     /translation="MIAVETSLTAEDLPNSLEDLRLAIELSVPHGRTHGGYSGADAGS
                     WRNSVPTNVQQVWKKHLADDFEELCRRNAQVASTNNLNHLGTLGTGNHFIELCLDDQQ
                     PRRHAWVMLHSGSRGVGNRIGSLFIELAKKDMEARMLQLPDADLAYLDEGTAHFTDYI
                     FAVEWAQRYAWWNRQLMLDAVLVAMRGCIATPFTTVQAAVNCHHNYVERIRIPIREQG
                     QEAQAASSPGQGTFREQDVWLTRKGATSARMGELAVIPGSMGACSYIVRGKGSAASYC
                     SCSHGAGRRYSRGEARRRFTVADHEAATLGIECRKDSSVLDETPAAYKSIDAVMAAQD
                     DLVEVVTVLRQVLCVKG"
     gene            complement(<248591..>249025)
                     /locus_tag="LMJF_33_0565"
                     /db_xref="GeneID:5654447"
     mRNA            complement(<248591..>249025)
                     /locus_tag="LMJF_33_0565"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685745.1"
                     /db_xref="GeneID:5654447"
     CDS             complement(248591..249025)
                     /locus_tag="LMJF_33_0565"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685797.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0565"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0565"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654447"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4F1"
                     /translation="MGQSFDLLRTHDEVPDDVKAAIPPIEYTAAPEESRPHNREFCED
                     CGEYFGWFCWSTNCDWCGRQLCTRCCPNHHLLRGNPGCKACTRKAFCMRRQAMLEDHL
                     RGAGLPLQRPRGRAEEGAPTPTASSALESVDALALSKARTPA"
     gene            complement(<250984..>252732)
                     /locus_tag="LMJF_33_0570"
                     /db_xref="GeneID:5654448"
     mRNA            complement(<250984..>252732)
                     /locus_tag="LMJF_33_0570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685746.1"
                     /db_xref="GeneID:5654448"
     CDS             complement(250984..252732)
                     /locus_tag="LMJF_33_0570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685798.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654448"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4F0"
                     /translation="MPRNLSDAPSLSVATLPHKAVVMGFGSKLIIGRYPLDDEASPSP
                     HNSVLVDDGQIVRAVAFLHIPDGPLCVVSAGDNKLINVYNVSSWKQNNPNALQNSSDD
                     DDDDDEGSMDTADILDDEARRKSKANAQPVTLKKQQLAKAEYWKPSYQYGPHTKRITS
                     LATCPEGMIVFADKFGEVYRIRLSWSPSHTIEVDGDATKPARFLLQHFSTISTLCLTA
                     PVPRIEPVAASEERSGVARRRLFTCDKDRHARVSRFPETYVVEQFLWTRNSVQSAVTC
                     VAEISYVEDEAVYDSSYHHNAACVNKHNKSLNAPYSYYVTGTHAGDVHFWAAKNNVPI
                     ESDNETFHLIGTFRPRAPGGQPENFGPVVGLTVLTSVMDGFGHLLHPRDCPRGVLIAY
                     EQCSDVFFVPIYDNVGAHAMHPAMVSASRTSLDARPVAMVGCNEATAFVLKRNGHVSF
                     VHLCIVSPSENGMPTKTCSFNANMPTEVQELPVRMPYLEERIKAVMCGPAAVEEGVQT
                     AAEADRLSELEALDLCASWRYEVVDPRTRRRGNSEVDGDDGSNESGGDESEETGSAPK
                     KGNGKKKARVETERAH"
     gene            complement(<253652..>254794)
                     /locus_tag="LMJF_33_0580"
                     /db_xref="GeneID:5654449"
     mRNA            complement(<253652..>254794)
                     /locus_tag="LMJF_33_0580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685747.1"
                     /db_xref="GeneID:5654449"
     CDS             complement(253652..254794)
                     /locus_tag="LMJF_33_0580"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685799.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654449"
                     /db_xref="InterPro:IPR009269"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4E9"
                     /translation="MEQIICRSLEENAYSVQGFWLWQSNFIQLRRRREQHRRRPRNDA
                     ASLTEEVSGETASTRSQTEAASLQRADEIREYVSAVLHATGYPYRSASTADDAREGAD
                     DSAPPSVTDAQAPATSAGLTWALRSPVVTDPAGVSGEPPRKVSHGEGTDAISRIPAAP
                     TSALAKLVAKARAQHRDLVEHAPAVVATAPARRAPPDEPGSQSGMGRKRIQFAGDPPL
                     ANNPQLSRGRHIRSDNHGSDDDDSFTIQLPAQMGSQASSDAGESGGHNVDAVAGVAGG
                     ADAVAAKHPSQMTRAEFLSQFKRAPRRGEVGQTAEEIAAAEKLGYVMSGSRSVASRMY
                     VDRIQRQLHEHEAAKLQQQFRKVEDERMDDQLVLELAQFINSKKKS"
     gene            complement(<255824..>257857)
                     /locus_tag="LMJF_33_0585"
                     /db_xref="GeneID:5654450"
     mRNA            complement(<255824..>257857)
                     /locus_tag="LMJF_33_0585"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685748.1"
                     /db_xref="GeneID:5654450"
     CDS             complement(255824..257857)
                     /locus_tag="LMJF_33_0585"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685800.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0585"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0585"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654450"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4E8"
                     /translation="MLNGVNDILTPWTAPRILQIMEATSASRNASGCAPRGGIATDDA
                     ADTESLLRLSNQLPDVAGRVMAAPLFAQRPLVESQNGGSTSLTTAAPGASSDGASSVS
                     IIYEDAQHMCTAALAVRRSPWKVEASNDGEPSKTDAKAYCSLPHTEPQTAAAELEEVG
                     FAAEFSEPCIRGSFPDAAAALRHVLPEVNGGLASNSDGVHVQRASKHGAADSFQGALR
                     FVLRPPSVSHAAPLAENASSPSASQKRASATSHRLHLVQPSPSAASAAPQSLVLDTIP
                     SPSLLPIEARGPPGHRVFDRGCVAYTFSADEREELLASLCAEPPPLQVFSREEVEGRC
                     RPGSLIYRQAPAPQSAGSAAAAAATAHFPRRGLPPSADRGLHGSCINEDDGWSASSGW
                     SSRSGSEPRSDMHSNNAKEETLQDIERADEANTEARPESCAVACVVDGPTSEVASATH
                     PPSTAGTTRTWVDDDDDLVLENGHITIRKRRMRPARNLPAALSLPTVASSPLVNPSLT
                     TTVVNATPADEQHFTSSATDGADYADAAGDGSTADAALHGRKRVAGAKRSRGSMTASA
                     LADDYATARSAEPPEKATTAEAAKELKRRAAPAETSDEVARTSTPINTKRVVRLSQEE
                     MLEFIEGLRVSDTLRRALLIGVVTPAVIEAAPVNSPGAVGDGKSEPDGSDEAR"
     gene            complement(<259256..>261883)
                     /locus_tag="LMJF_33_0590"
                     /db_xref="GeneID:5654451"
     mRNA            complement(<259256..>261883)
                     /locus_tag="LMJF_33_0590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685749.1"
                     /db_xref="GeneID:5654451"
     CDS             complement(259256..261883)
                     /locus_tag="LMJF_33_0590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685801.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654451"
                     /db_xref="InterPro:IPR013956"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4E7"
                     /translation="MRSPNESVANESDSDVSEIDPESDVLAPVQRRIEEQLRKHLQEL
                     SQQIHETNNELSGVEKERESCGVDLYNAQQHLATLQKTLEGYHEKHAAIQQQHEDKLR
                     AREELSSAAESAQKKVDDMQKQYTRYHNELAKLTETLMKVERFNQELKDEVELERRAA
                     HKTEDDITNLERAKLRQDSLILSMQKRIETLENESAMLDEQIGNQREETKRARETLAD
                     AASEMEAIVMEKKQLVQQWRSSLIGMQRRQDAVRKTEEALQQQKNELLVLENEITGYR
                     HDIRTSQAENAKLTAFMSRIDNEIIILERQMDGLLLKKEEATKAYALLEQSIASSVEE
                     RKAIEQKMKLKAAELSEVEKQIAKHAKAIVEMENEMLVHLSKESTLKQESKGALQEIR
                     KIKESIRAKEQKVTQMENELARIRVDTLQSKAYNETLATTLADLEKELQSRSAMIEKM
                     QVDIRRRNNEIDRKQNQLDQLNHQYEQILAAHNDLQGDHVGPLEATINSLSRAIATKS
                     TVNEALQQEWIRLQTELVNYKNSMNDINEAILDAQAKATILTQKKDRLLANISEGKQQ
                     VANLQNKSNAMHLEMKRVNTLLSQNNGAQQSASDDVFFLENDLVRRLEERKREAIQLE
                     KKVEDMRQSKSDIVEQILSCERDIMFWERKLQVARETEMALDPTIGCAEMEKMKKEIT
                     FMEQRMSQLQREQKFLIEEMQKMIDHRDIIRTKGKAIQIASEKNKNGVTRLAVEKENM
                     RLFKELNAKRQESRRKEKLVKESMAEMDRIAADVDRTQHEIQSLDAQIEDLQGQIAAA
                     KKERNRAEDEKRLRQNNLQRLRDGEAGTYRLLCYPEEAATEAARLDEGRRAVVNIMEE
                     LSAQFPDLAPALQDLMTSV"
     gene            complement(<262377..>262949)
                     /locus_tag="LMJF_33_0600"
                     /db_xref="GeneID:5654452"
     mRNA            complement(<262377..>262949)
                     /locus_tag="LMJF_33_0600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685750.1"
                     /db_xref="GeneID:5654452"
     CDS             complement(262377..262949)
                     /locus_tag="LMJF_33_0600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685802.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654452"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4E6"
                     /translation="MRYTARFLDQTTGPHKAYKYTYMPDPRKLAPIETSMRSEVLPVV
                     IRPPTSYVPNHEVFLEKADVHRLAPTSDFKATFKDWNDLMTCSKRELRTRGVPLLTRR
                     AIRAAVLAFQNGNPPERFDTKEEWLYYKQFKTKDYSYRVVPELPEKYRPHQNGIDQAP
                     VPNYGEINQMPQWAVEEEKRLTGKISAASK"
     gene            <265955..>267238
                     /locus_tag="LMJF_33_0605"
                     /db_xref="GeneID:5654453"
     mRNA            <265955..>267238
                     /locus_tag="LMJF_33_0605"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685751.1"
                     /db_xref="GeneID:5654453"
     CDS             265955..267238
                     /locus_tag="LMJF_33_0605"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685803.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0605"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0605"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654453"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4E5"
                     /translation="MFLGITGGSLTSSSHLLAATWENALKHFRRALLECGSPLEIEHS
                     QRIGLLFSQPTGNTNELKRWASIFDAEAVPATALILKALVNHGQWQTAVKLLELNKES
                     GVACELSEVLGQCLVARGLWQQTLRLADFLQLQHDAAPRGKSLALSNTLLLSTKEQND
                     SHQMASNPAFLPEEERTTYCGFVSAVARAYPSKRDWKEAVRILQDLEQLVDGETKRKL
                     YEYRIARLVHDGQAYKNVIEKSQCELGFRTSPSLVRSLLHCAIATSNCSLTMNCLKLL
                     CSFGPTAVSVRLFETACRLLMESDETWTKADLVRFQSVVCENATLVKDRKLQKLISAF
                     CADYDLKIPIFLSSISMLASSSKTAVAPSLVNSITNLDRLASTLIYQSRWEEALRVAT
                     LIRNGAAKSDHERIIVDMLRGSCSSWVKTLQFFRS"
     gene            <267459..>268040
                     /locus_tag="LMJF_33_0610"
                     /db_xref="GeneID:5654454"
     mRNA            <267459..>268040
                     /locus_tag="LMJF_33_0610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685752.1"
                     /db_xref="GeneID:5654454"
     CDS             267459..268040
                     /locus_tag="LMJF_33_0610"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685804.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654454"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4E4"
                     /translation="MAFVSVHEMALSHFSPAYVSRLFTDVIVSRPRSKLIAITLLPQA
                     KQSPKIATPSKDYIKVHEPITCTMSRNMIVNMSFNSPEIQILGPVQESTIERLNEVLP
                     DSTTSTRSIRSNQPKFEYVSNPDHWRIKLGNQFCDSEGVSRLIVLLLDALEEEGGWTL
                     ISSQASSSSHGGALQQDFVWNYKLFFSKYQDDE"
     gene            <268992..>269900
                     /locus_tag="LMJF_33_0620"
                     /db_xref="GeneID:5654455"
     mRNA            <268992..>269900
                     /locus_tag="LMJF_33_0620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685753.1"
                     /db_xref="GeneID:5654455"
     CDS             268992..269900
                     /locus_tag="LMJF_33_0620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685805.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654455"
                     /db_xref="GOA:Q4Q4E3"
                     /db_xref="InterPro:IPR016137"
                     /db_xref="InterPro:IPR019530"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4E3"
                     /translation="MNIAIANIAPTRLKQGSGEAVLAVLSALVNAALSSTGYGFQQID
                     YGQVERYDELAAVADAEDEQGEDEIEDNVVIDSDDDDEVYVRAVSGNRSAKNDADRPP
                     TPKVDVEEWKMEVERVAPLLQVRQSSLDDWRSRIESATVLLKAVENMYPDVKQMLERL
                     AGDMDKSRDRIQKREQTLAQQFSDQVEDYRVKLRELNTSRDSANVAQQTVQQMTVELN
                     QISELLDQTKRDIAERQAKISDTTPLIQVKEAVVKVQAEIKLMSLRIGILQNGVLQHV
                     MKQTKARREGPTAEGTEMYSGEIMFS"
     gene            <270951..>272423
                     /locus_tag="LMJF_33_0630"
                     /db_xref="GeneID:5654456"
     mRNA            <270951..>272423
                     /locus_tag="LMJF_33_0630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685754.1"
                     /db_xref="GeneID:5654456"
     CDS             270951..272423
                     /locus_tag="LMJF_33_0630"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685806.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654456"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4E2"
                     /translation="MLTEVLETELDRMRAVVQRQLNETKQFLVTCKEDSVAGMDRLDP
                     GKRTLTQAGERAIRTEELQGAKETADFASEQLMCATATRAANNSAREGATPRSTGTAK
                     TTYPSVLSTQCSAARDAAGGDGFTARDAIQGLLPRVEQVFDFYAASHVTDAQLLYPAM
                     HLPQFTTMVRDGALDRRRRPLLPELLWMTALRDLPSTGGRERTDRRHGSTLLLPRVFD
                     GDSLFQPVTARRDLFVHERLQAITKAEFPRVLYVIFRVAVHNGHEGAAADEAFCAYLS
                     ERFLPTVERCIRRRKTARTLLIDGKAACFDPSAPSPRAGVPNTLAASDLLRTATGVCS
                     PLPPFADIVAAYGSDAGVQRVVQQFTPRLKRCFRHVVRCPPTCRTEDARMSIDALVES
                     ARQHHLLPLISREQLRNIFLFCLTLDGDSAPGAAGSGGLSTKQAASLTARDSITCFSF
                     VTAAVYCLAEVIYGGSPSLRQQYASPCARTSKLLVKMFVL"
     gene            <273777..>274130
                     /locus_tag="LMJF_33_0640"
                     /db_xref="GeneID:5654457"
     mRNA            <273777..>274130
                     /locus_tag="LMJF_33_0640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685755.1"
                     /db_xref="GeneID:5654457"
     CDS             273777..274130
                     /locus_tag="LMJF_33_0640"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685807.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654457"
                     /db_xref="GOA:Q4Q4E1"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4E1"
                     /translation="MMTGTLGGPTLHAFAAENRAATTSASEDGPVRLSAERLANFVPS
                     VCVRGEEVTLLRAFEALDKEQKGYLEEVELRAAMMEGDECFSSEEVDDMWMAMLDPET
                     NRAHYRDFAEILARE"
     gene            <275983..>280188
                     /locus_tag="LMJF_33_0650"
                     /db_xref="GeneID:5654458"
     mRNA            <275983..>280188
                     /locus_tag="LMJF_33_0650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685756.1"
                     /db_xref="GeneID:5654458"
     CDS             275983..280188
                     /locus_tag="LMJF_33_0650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685808.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654458"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4E0"
                     /translation="MMRGASQLAARSVHLSAASRATAASLLSPLRFFGSKYTDDLGNY
                     KRPNTYESRSAAHRHPTRKEMLEGQRTAAAASTNSASGTTEFSKAYAFAGEAEAEEPV
                     QRCNKYEGLFKKKSEQRIAFTSNFREPDMKPILGAADEAPHPDMAWRHSSAPAAADRD
                     ETDVTRIYSKEEVRNMQQKGKVSTGEAAKVKTSSGGLGGISPAPETVQRTAAEVEAQA
                     PEDDEDEFAEIRSHPFFMDMLRRVERNMIRFRKETRAAGRYSLEAVNECVRPLLQLTD
                     YPLTARQLSHLSHSISPAVLKSSLRDRAACKHLQLYRSQDTDLLLDWSKEDFLRRRYE
                     SVHLSWEPMDVICRRFGWTPDMMSDRDYLLYFSAFPEYVEMAEMQTTAKGAPKAIPID
                     DPVARAAEDPIPASRLLLRRKASVDAEPSLTESIRLMGSPALATPAKGKKAQRMRQHG
                     GDSVADYFGAVEATASAVDGDETAKLQHAAENVPPLRQASHPGGRTIREFSIPKSHLP
                     EASKAPPAMPSETDMRSEASFDQKTFEELSNAYHNIKVENSLLRRRMLGTDSVDKAQE
                     MQSKLASGRREQLRLEQELERMRELKRNTPISKNGPHFAVPRGQPQYPEAPEHTTEYS
                     KNGNAVEDIDDDEIEQALKEFKENEALRLMERRSMATAARSAPSSSPDNAIATTTSAD
                     AAVDDGSEEVEEVIEVVEDEDEDLVASGDAAAVGPQTGAQDDALTAESEVDDSADAHY
                     GASADAAANESPERGDQPWQDELSAAVEQHEAEMEEQGSDLTAAFSDTPATTPASRLE
                     QLASLHDRLSSAADRARRYVATVQIRRQDVLKRLDCQLADANTKVEQLEDQLDAVEEE
                     QTTLRDTLAREEAERKALEVETQLKAQRERRLAELEQQRERARLAQEAAARALERQKK
                     AEREALEMEEELQRKLREVQAKLRDLHDGKSTANDSAAAGTPHASAAEELGVEDAAEE
                     EHAVTAQAGSSPSRSRAPESAARVTASVLPAATEETPNAVEGVHDAFAAPASTGQFMC
                     TPEQYDGLHLAAERLKREIAALEAQMEEAGDEDDETLMAVLAASRSDLEELEECIDSV
                     QANAPWAATHDAKRAREKALSSEVASTDAHRLQSCIDNHRFQISLLEKRLQHASKKAV
                     ITKLKDRIAQARKSITHLRIEQDRLRRAGRDSMGLPQSMSIAETLAHELKDEEEARLE
                     EAREASGEDNCGSPVAAKKSGLDTDAQTPDDDESYDAVSDATSPDLVGESPSAVHTPS
                     APNSDAEKLRLRLDSMVKDIQHLQDSIAAQERTTDYDDDETEVVLREMKDKLSQLLRL
                     RDQVQRSLLEESVNSPDTAGGPTPVIRPASAAASAPPVVARGSAAVHSGPSTSQHRRL
                     DRVPIASKRLRTTARSFTTQRHP"
     gene            <281959..>282417
                     /locus_tag="LMJF_33_0660"
                     /db_xref="GeneID:5654459"
     mRNA            <281959..>282417
                     /locus_tag="LMJF_33_0660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685757.1"
                     /db_xref="GeneID:5654459"
     CDS             281959..282417
                     /locus_tag="LMJF_33_0660"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685809.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654459"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4D9"
                     /translation="MLRFTQVIRKNPVVFKQGQGMFSHQLKRILNKKSLHKYNWDPLH
                     MYDPRKLVHANRYVDHDTYEEKYDPHWEHNAHLVPDQQFYNIPVPKEYKDAYWWRDLQ
                     ARRVQCPTEWVHFRMHTKDKLKYDFQDLAFRKKFEYSYEDVVANAKDMCS"
     gene            <283155..>285785
                     /locus_tag="LMJF_33_0670"
                     /db_xref="GeneID:5654460"
     mRNA            <283155..>285785
                     /locus_tag="LMJF_33_0670"
                     /product="putative protein phosphatase 2A regulatory
                     subunit"
                     /transcript_id="XM_001685758.1"
                     /db_xref="GeneID:5654460"
     CDS             283155..285785
                     /locus_tag="LMJF_33_0670"
                     /codon_start=1
                     /product="putative protein phosphatase 2A regulatory
                     subunit"
                     /protein_id="XP_001685810.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654460"
                     /db_xref="GOA:Q4Q4D8"
                     /db_xref="InterPro:IPR000009"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4D8"
                     /translation="MLTSFIHRGVMSVTMHLPPATRHLASMLVVVRFLLVAPRFHVSA
                     HLSLLPTPSHHPEVQSDATTQRHRPSLVRVGTLLAPALCLAVSLAATHSFLTMLPKLN
                     LDGTLSTRASSVQERMTEEGQPGMYSPRVASSQAAKGLGGPSHADGASPTRLSSSAPS
                     VLGHTGSLSPPHLSSHDISLLEDGVMGISDPEMAAILASKSRHGPGERSPPLDRLSGM
                     GPGGYLTSSKRRAAPLTTLVDHQQARQAIPQHSKDGDAAASARCNADCASEGSSPVLR
                     AASTSPQCVKRRGASPSALSHVSNESAPAVGGASLGATSLSAPTQSTISIMTAEQLYI
                     FGKPFQAYMSATSTRPSSTDAQVTVAATSSSGAPAAKAAAASGTHIATTFHHNPSQYI
                     SALTSQGDFVAVGDRTGHVVVMRQREMAAGPRRTLLDIIQRSGEAEEDEAAKRRSLAT
                     SAASSLFSPSRHTTALNHVRDPYDFYVAQQAYVPVIDTLNSVEVSPTVTALAFLPQSG
                     PTTYLLAANEKVPKLYKIMSVRESANPFRAVDKLGTKTIGPLTASSRTSTVAMKPVYR
                     YAMNHEYNINSICPIAYSDQFATADDATVLLWCTEYPDTSIETHDMRSPYEDGPRETI
                     CAVRNFPHEPFLFFVATSGGSVRVVDTRQTLRWGDQAAQAFINPPREEDEPFSNVTNS
                     ICDCALSPSGRYIAGRDFMSICLWDIRMAGSGGARNAPATPRRQAPAARGGDGNPECS
                     MVRRWALHPHLRDDLDTIYQSNLLFDKFDVQFLSSRQVCTGGFNNTLYTMDVEGTSAD
                     AASDIRTFQLLKTEGISEFRRTTVSAHRRGEDRISTGQGLGSRMTLMSRPYMSMSGAC
                     GMMVACGQAVLQLSYNGLSK"
     gene            <287058..>288383
                     /locus_tag="LMJF_33_0680"
                     /db_xref="GeneID:5654461"
     mRNA            <287058..>288383
                     /locus_tag="LMJF_33_0680"
                     /product="putative sterol C-24 reductase"
                     /transcript_id="XM_001685759.1"
                     /db_xref="GeneID:5654461"
     CDS             287058..288383
                     /locus_tag="LMJF_33_0680"
                     /EC_number="1.3.1.71"
                     /codon_start=1
                     /product="putative sterol C-24 reductase"
                     /protein_id="XP_001685811.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654461"
                     /db_xref="GOA:Q4Q4D7"
                     /db_xref="InterPro:IPR001171"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4D7"
                     /translation="MWRGNWEFNGPLGVLGIMITSHVLIYYFYVCIELFQGTIIYPGH
                     PMLKGEKMQKVFFSFLVEHACPTMQTFCIFLGFLLLEYFLALVLPGLYVKGLPLPSEN
                     GYRLTYKCNAVTAWYCLLIIVGLLHYYGVYPITELRRNYGHFLTAATIVADIIAVWVY
                     IAGCKRPIRMTGNFIYDFFMGSGLNFRLPGNIDVKLFAECRNSWVLLMMLTLSCAAEQ
                     YNELGYLTGNMVFMIGAHLLYVNAVEKGEECVISTWDIYYEKFGWMLAYWNTCGVPFL
                     YCMQSMYIQTVLKNKEHPRWVLVLMACILLLAYYLWDAINSQKNHFRMHRSGVPMEII
                     RNNAFPQVPWCYIENPRTLKSATGELLVDGFYRYGRKLHYTVDLVMAFLWGSACGFES
                     FIPFFYFFFFLGHLIDRERRDDHRCRAKYGKMWDEYVKLVPYKFIPYIY"
     gene            <291831..>292301
                     /locus_tag="LMJF_33_0690"
                     /db_xref="GeneID:5654462"
     mRNA            <291831..>292301
                     /locus_tag="LMJF_33_0690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685760.1"
                     /db_xref="GeneID:5654462"
     CDS             291831..292301
                     /locus_tag="LMJF_33_0690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685812.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654462"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4D6"
                     /translation="MLHRSCVLVDSFKEHYHRVHLPRRLALQRYIKREEARLSRHKGK
                     AVAAAAAAGVQPGEVAYKYNRWWVSNDHEFVHQFAFVEDPDVTREKRNTLPLVTKENI
                     WKEPQQTFFLPFAPFVRVVDYAKDPDTKFLKPVNIPRWKDYMQRTKPIVPRTWY"
     gene            <293165..>294334
                     /locus_tag="LMJF_33_0700"
                     /db_xref="GeneID:5654463"
     mRNA            <293165..>294334
                     /locus_tag="LMJF_33_0700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685761.1"
                     /db_xref="GeneID:5654463"
     CDS             293165..294334
                     /locus_tag="LMJF_33_0700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685813.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654463"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4D5"
                     /translation="MLRGLVNADALTSEQEEHIDQLQHEIDEIWNRRGNYQVDPDAWE
                     TMPFFMENITEEDIDKNANCAALASIVYEEVPPDEIAENRKEHGNRALNMALNPNQER
                     RENLARAACYSYTEALQAKGKNTKLSSTIYANRSLAQFIVGNYGHALADAQRSIILDP
                     NYRKAYYRAAKCAFALKKYDMGLQMLEKGRRVVDPPMDAAAQAEFLEMETNCLQGKEQ
                     QASEEAKQRRAARSQAAKVSNVARAITSSGIKISSRAEVTSEQMGVYGNPKPYFDTDG
                     MLHVPLLFMYDEYQQTDIMHDVACDVCAAELLDELMPFPWDDRGRYQRLADIVVFFKI
                     DDGANDVQYYEVDQSWPLLEVFREETYEMPQLMPVLHVVCKTSELVDRLEIHRVA"
     gene            <295257..>297146
                     /locus_tag="LMJF_33_0710"
                     /db_xref="GeneID:5654464"
     mRNA            <295257..>297146
                     /locus_tag="LMJF_33_0710"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685762.1"
                     /db_xref="GeneID:5654464"
     CDS             295257..297146
                     /locus_tag="LMJF_33_0710"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685814.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654464"
                     /db_xref="GOA:Q4Q4D4"
                     /db_xref="InterPro:IPR000109"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4D4"
                     /translation="MCLFLGLPSSVWALLGIEFVERFGYYAVAFSLFTYCTIMLRTGP
                     AAANALINMVYILVPAAAFLASGVADSRVGRPRVLVTALAVYTASLLLLCVSATPWLY
                     TAFPLNANCGSKALFAVALLGFSAGYGSMKVCTNPIMADCVVLHYRSDLIRLPTIVDA
                     GNGEAEESDSCVAKAADLSTRRIASLPGAAREGVAADAAAKVGEAPRYDASLYGTTTN
                     TGATASLYEEEHVKAALSRLFVYAYWVGNIGGLVGGFVAPLLRNFDSHHLLQGSEEHT
                     TGYYYSFLLAAFSVGLGGAFLYGCVDGLPRNAPAPTFVLVRVTVLALQNRWAVLRGSA
                     RIVPDSRGGISDPHDWLDYACVKLQSVSSETRGISAAHQAAPDEAAAASQCSGLAACG
                     PSSSTSVADLGVDAAGTSLWVADCRATLRICKAFIALPIYWLICNQLSTNLMYQAAAL
                     DMPLTIPAELFNNINTVTMLLFLVLWDQWLLPRVLRYRVPSACLRILAGFACMYVSML
                     WCGFLQRTINSRGCYDGEDNYIVREGQRKLSAGWLVMPYILQGFASAFVDPTVMEVAY
                     YDAPERMKGTVMGLYWVASSASGFLGFVLSPVMRPQNAAALFFSFATAQMAVSVLFYI
                     INCSR"
     gene            <298187..>298774
                     /locus_tag="LMJF_33_0720"
                     /db_xref="GeneID:5654465"
     mRNA            <298187..>298774
                     /locus_tag="LMJF_33_0720"
                     /product="putative 60S ribosomal protein L6"
                     /transcript_id="XM_001685763.1"
                     /db_xref="GeneID:5654465"
     CDS             298187..298774
                     /locus_tag="LMJF_33_0720"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L6"
                     /protein_id="XP_001685815.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654465"
                     /db_xref="GOA:Q4Q4D3"
                     /db_xref="InterPro:IPR000915"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4D3"
                     /translation="MAATKSAVSAAKRKAAKKVSRKSPEYTTLRKSCAPGAIAIILAG
                     RFRGRRAVILKQLPHNGPLVVSGPMKYNGVPIRRIDSRYVIATSTTVDISSVDTAPIT
                     AEVFQRPKAEKPTKSEGDFMGDKQKAKAEKAAKKTSKAGKKTLVSDARAQLQKKIDAA
                     LIAAIKKDAQGKEKAGYLRSVFTVKPGDAPHRWNW"
     gene            <299372..>301051
                     /locus_tag="LMJF_33_0730"
                     /db_xref="GeneID:5654466"
     mRNA            <299372..>301051
                     /locus_tag="LMJF_33_0730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685764.1"
                     /db_xref="GeneID:5654466"
     CDS             299372..301051
                     /locus_tag="LMJF_33_0730"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685816.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654466"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4D2"
                     /translation="MMLHTRRTVYSCICVHTHTHTHTCGCPPPTLSQKKKRSRLFMSS
                     SSGDEYDPAEVTVHTTVASPSLSDTVVPSAAPFLRSAAGNASAATVAAAPALASLPKT
                     AASVLPSSSSPTPPNTGNDVDGGYRLHSNIKGRIRCLTLNTAGTTLCAGSEDGQLCMW
                     DFTVPLKSYRVQPTRVLTPFVNRISGLQPIIALTCASDDSYFVACQDGDSPVLVRASG
                     EQLGYCAIGERGLMDVIQCKGHRAPVTCVAAHTHDAAAFFTGSQDGTVRLWNTATFKQ
                     RSVYAVKHGSGQLTDTHAVESVASLDSFHNGLGRVFASGGQDGRVQIWDSRVKYRPGG
                     AIATVDMYAAAAPAGPDKVTEDPFMEKHVGGMMELHQKDAGASNASGSYGLAVRLGSA
                     VKIIDLRQLSHSDGTTAPKAVLQEAATGLPHVLDTSALSIGRGGGSSTMMTCTSRVGY
                     RHTKGGHVVQYRYADGDRLVPTLVWRAGKQDEDVLCACADISRADGCVFAGLSSGDVV
                     VHGAFSSGAAAPQPMEAWLQTRPQREGYERAVGVKAPRAVEDDADLLRDLF"
     gene            <301852..>302982
                     /locus_tag="LMJF_33_0740"
                     /db_xref="GeneID:5654467"
     mRNA            <301852..>302982
                     /locus_tag="LMJF_33_0740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685765.1"
                     /db_xref="GeneID:5654467"
     CDS             301852..302982
                     /locus_tag="LMJF_33_0740"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685817.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654467"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4D1"
                     /translation="MPCHRLGGSFRTPPSQHARPPTKEEIEAFMLRHTAHLPFVLHAE
                     DLRQGGENDSGSSADNRHTHSARWIAPYLYTGADYALVLAACFPSHCIDLSLLNWSTN
                     PLLSQRQGNLRVFCQAARALALPDAPLSALQPELLQSSAACIVGHLKVQHWLYSLSLR
                     FTPATNHDAATLRAVHRHLQSGEPYLKRRRGEDDEDGVCASVRDCPPLPAEHLLRCAP
                     ALTPIPSFTDATASALLSSTTAVSAEEANLKEGAAASIALASHFAGDAAEFAKKQKPW
                     LNYSKPWLLPSLRAAEAKKTASEAAAAKRAQEERERNSRYTAFVAQAKNVHEQYVVSC
                     TAAAEKRDQLRAIKALLLQDIMEGKTVDFKDYAARLRECHGG"
     gene            <304244..>306562
                     /locus_tag="LMJF_33_0750"
                     /db_xref="GeneID:5654468"
     mRNA            <304244..>306562
                     /locus_tag="LMJF_33_0750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685766.1"
                     /db_xref="GeneID:5654468"
     CDS             304244..306562
                     /locus_tag="LMJF_33_0750"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685818.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654468"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4D0"
                     /translation="MWMRMHPVERWTLLVDLGRRGAYLIEKPAQLSPSAAREVADKST
                     PISSDNRGSASVLGSADPKVRFTPEATEAHRQLCHTLPYAARLHLCLSVLLWIRCLQD
                     VQDTLARVRLPFAAVRRPERYAVADVFPTRLREYWVDAHTTVSTKMSAQLNSTAEQIP
                     APHAWDAETSETIEDAATEATMTLDAGRVLHGRHQARRSGKTLLHQVQGLQPRASAED
                     DIAARLTSTGSPSGRRRRRRRLPSASSLAPNALSVESAPASSAWPGSLEFASDASRHV
                     PPVSLEPEPLEDAAYHGNDNRGEGCPLNQDGKASPTPIFICVPPAMHNAAAASPGSAL
                     PTEAELLVRYCVMAHAAVLSSLFIEGRVVDFGSNHPLVVAYVRWLLDELVLEHFVSVS
                     LLAEAEVAGYRPYYPPWCWRSVLVLMPPKHCGGYSAMLLRDWAARIVQAAPCSVVVEG
                     NAGAGYVEQLKAEVRLLQSALDDAEGMRAVAWVAVGVTVPVETAPRGSAASAAGAAAS
                     DSNHNDKAEAKVSQFRPQHCPRAAPSLSTFISEASLASIRWLGEWLKPGLSEAAAHST
                     SRQAAFLEAVRETLEDRFYTCEVLYSPAQSCLNPYRFERWVLEQLPGNVRVVGINTSP
                     LDVLYFFPQGVFLSQKVGNAFRYRAVERTVVAKDVTPSSRTHPLRHAVTQLKRLSRRW
                     RRRGDDVASGLHAEFSPSDLAELRRAARAIALSTPNPDAAPFRDAEGIPPETSAAENA
                     SHALVRERTVEYLAEPSKRTLLGLAVARFFRV"
     gene            307173..307242
                     /gene="LM33Cs2H1.1"
                     /locus_tag="LMJF_33_snoRNA0106"
                     /db_xref="GeneID:12980805"
     ncRNA           307173..307242
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs2H1.1"
                     /locus_tag="LMJF_33_snoRNA0106"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461070.1"
                     /db_xref="GeneID:12980805"
     gene            307368..307505
                     /gene="LM33Cs2C1about:.1"
                     /locus_tag="LMJF_33_snoRNA0036"
                     /old_locus_tag="LMJF_33_snoRNA0089"
                     /db_xref="GeneID:12981290"
     ncRNA           307368..307505
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs2C1about:.1"
                     /locus_tag="LMJF_33_snoRNA0036"
                     /old_locus_tag="LMJF_33_snoRNA0089"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461052.1"
                     /db_xref="GeneID:12981290"
     ncRNA           307369..307504
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs2C1about:.1"
                     /locus_tag="LMJF_33_snoRNA0036"
                     /old_locus_tag="LMJF_33_snoRNA0089"
                     /transcript_id="XR_002461053.1"
                     /db_xref="GeneID:12981290"
     gene            307643..307723
                     /gene="LM33Cs2C2.1"
                     /locus_tag="LMJF_33_snoRNA0035"
                     /old_locus_tag="LMJF_33_snoRNA0133"
                     /db_xref="GeneID:12981247"
     ncRNA           307643..307721
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs2C2.1"
                     /locus_tag="LMJF_33_snoRNA0035"
                     /old_locus_tag="LMJF_33_snoRNA0133"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461050.1"
                     /db_xref="GeneID:12981247"
     ncRNA           307646..307723
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs2C2.1"
                     /locus_tag="LMJF_33_snoRNA0035"
                     /old_locus_tag="LMJF_33_snoRNA0133"
                     /transcript_id="XR_002461051.1"
                     /db_xref="GeneID:12981247"
     gene            307818..307887
                     /gene="LM33Cs2H1.2"
                     /locus_tag="LMJF_33_snoRNA0107"
                     /db_xref="GeneID:12981246"
     ncRNA           307818..307887
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs2H1.2"
                     /locus_tag="LMJF_33_snoRNA0107"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461071.1"
                     /db_xref="GeneID:12981246"
     gene            <308472..>309593
                     /locus_tag="LMJF_33_0760"
                     /db_xref="GeneID:5654473"
     mRNA            <308472..>309593
                     /locus_tag="LMJF_33_0760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685767.1"
                     /db_xref="GeneID:5654473"
     CDS             308472..309593
                     /locus_tag="LMJF_33_0760"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685819.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654473"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4C9"
                     /translation="MLPGCPPPPPTAAYSAQPSVASGGSIAGYAASVSALEQRRRMAG
                     LDAARRLNRGAQWRNELLGPPAVAERSLSAAPSSAQPKSASPTSADAGKFGNSIAAAL
                     SLRREEREKTLLKRLQQQRKAEEEGSGSRALAEKDMEVGVFVTASYKALLQRNLHPTE
                     KASGGQGAQPSKNADGADDEGSSDDEGPLAAYLRQLESTRQSATVASEASPAVSGVAT
                     GDHYERIMKAPLLDEKNASGTAVAMAGSVGDAGCLAEATPKVIPSAGGSDAASLAAPT
                     LNELQDLMEHTSAGPSPTPGSLGAPQTETEEIGTAKPAGAAAETEAANVHSAVLAHAQ
                     LLFDTRQAKGRRGANPTTLVAAARRCDERIGASLFASLS"
     gene            <311022..>312284
                     /locus_tag="LMJF_33_0765"
                     /db_xref="GeneID:12980806"
     mRNA            <311022..>312284
                     /locus_tag="LMJF_33_0765"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722342.1"
                     /db_xref="GeneID:12980806"
     CDS             311022..312284
                     /locus_tag="LMJF_33_0765"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722390.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0765"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0765"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980806"
                     /db_xref="UniProtKB/TrEMBL:E9AEH0"
                     /translation="MFTDPLTELLTEAQNESGRSVPRSNCETPGQISMTEVFPAPGTP
                     SSTTAGALGRAYSPHSGDHGRRRASSSLQTAGGIISVATHDGEELHYPVVQGRAGGSL
                     SPHLHSAESSPIIVARSTLAARVHRHTSITSRSTSSLSILPGAIDSGGADEGETSADA
                     REAYRHSRLTPSSIQRHRRVSSLTSRTPPAALALRSEPVEESAQLSPTKFATPSWSMP
                     STPHHSIPRTPPSGRQADWPSLTADRVQGCSADVGRSQYSAPEGAPIRVEEMGVSTPE
                     MAEYFAESALDAARRRESSGMLSNSSSASWPLFYEQAVPRRSLPESSSHPASHNDKHT
                     FLEHLMRFMEDQSASMQRLHQRMDALESTSNSLLARVRKIESDTSADAGGINRVSAES
                     VSPSATRTSDSLESAPRPSTRAPSKAVN"
     gene            314433..315902
                     /locus_tag="LMJF_33_ncRNA2"
                     /db_xref="GeneID:12980807"
     ncRNA           314433..315902
                     /ncRNA_class="other"
                     /locus_tag="LMJF_33_ncRNA2"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460996.1"
                     /db_xref="GeneID:12980807"
     gene            <319591..>322239
                     /gene="CYC5"
                     /locus_tag="LMJF_33_0770"
                     /db_xref="GeneID:5654474"
     mRNA            <319591..>322239
                     /gene="CYC5"
                     /locus_tag="LMJF_33_0770"
                     /product="putative CYC2-like cyclin"
                     /transcript_id="XM_001685768.1"
                     /db_xref="GeneID:5654474"
     CDS             319591..322239
                     /gene="CYC5"
                     /locus_tag="LMJF_33_0770"
                     /codon_start=1
                     /product="putative CYC2-like cyclin"
                     /protein_id="XP_001685820.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654474"
                     /db_xref="GOA:Q4Q4C8"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4C8"
                     /translation="MGLRQLYSLPGSRVGSSLGISTHAQRGTAQSSAAADAFSMERFA
                     AFYEVALEELMGECVRRVANAPAAWRDSQRQLIGGDMNRDLATSTHSFDSPRSSAMPP
                     FGGAPSSVALSCGTPVYSPRFANPLHNIHGLHVRELSSDVAAAQSRTSTPLPPPSLHA
                     NTVFFSAAGQERQAEQAKSVVDEGAVSTLLAALGRHHGKMAPMVFIAGLAYLARVTAQ
                     CASEFLSVTHANWYRLTTTAILVAAKVYDEHSSPRLNACFARSSGIPLSEMTRMELDF
                     LYLLDFDLLLKESEVEQWLIWMETLALRRDLMTPLNTYVLDTSASTPAVQFASTPKPS
                     FTSCTALTEYGERSKTCAICETGRTPGLSCEVPEGEEETVGTSLFSAVVPRSVPQMRV
                     ACSCAMTAPCAVSSAAHSRCPTGAAVATDAPFLTAPLADLSSLPPRSSASSVLLPASV
                     LDGTFSAVSAASVPGRASSSLNDRRAFVPPLPILGALPLRPPTAKRRLFSVVHGTAEP
                     PSPISVRQLGRLGGSPPSPLRPPSVGRHPSVRFFKSQATHAHGPHRHASGTAGRAELG
                     TNGAEDGGGKVSRRSCQDQLTRAGSASATGQTPAPAAASYQQKRRWGPLGMVQHVRDV
                     LGVTASLVRGQLNVLAPSAHAEELSRLPPPQQNKHQPASQALRSSTNSLSGRGARTSL
                     QPQSSAAPPRRTNSGGTYPPFPENWMDERKPQACNAPPAAVASRGSTDSHPQPSPTAP
                     ARDRCGPATPGVVTRRSPMPRSSPQQVDPCSSAGTQPYTSTVANAAAAQPTAAAAANG
                     AYADGDDSHDEDDEGYVECEYGYYTEDGYFHYYDDDEGADGEYDEYYGEEDEEDEEGA
                     WYEDDEDEAAYFQRCRPPLTHSPPSL"
     gene            <327802..>331614
                     /locus_tag="LMJF_33_0780"
                     /db_xref="GeneID:5654475"
     mRNA            <327802..>331614
                     /locus_tag="LMJF_33_0780"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685769.1"
                     /db_xref="GeneID:5654475"
     CDS             327802..331614
                     /locus_tag="LMJF_33_0780"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685821.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654475"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4C7"
                     /translation="MHAHSPSQSVVALLSASQTPRRPVIASEVRSRCLPAPQTSQLHK
                     KSQIARTGEEATCTALRSSLPAASYGAPIYKARPVPAFPPPPPEHAPVNAHPAQTLPH
                     PCTSSAGEDGPPSSAAPLDAAAGGSTEQQPSKGPQRCSGFSCTPERGSSLEHRSSASS
                     ESSAADAAVDSPVSAQDQPLSKESIRSASLETAASAHLSPRSPSAPRSPSTSAVTPPS
                     SVSPAAQLSLSMDCVHNDVEEETPVARSTPPQPAPMRLLEPHVVAGPVVSAASERSLS
                     SHRSDSRSTPLESFAALLEDLHVLWQEEEEPLTGEVSPVSHASNGACDGCTSRSTARV
                     MAEPKDDESGSLMYPADTSDPNQEGLEEAEQVPKSSLDGPLRGTDTTGHAPITPRLRR
                     CIKDQQRELEMLRAVTKERHPAILGLLDSPETLMRELERMDVDSDGQGDGDRGTTPNA
                     TDEVETPPAARPSQKRPPAVSAPSRTSPTSLAAQGSRAKPEGRLPVRDAGRAAAPTTE
                     KSCTTESSARKDRPSVSAASTPGARPRERSQAVLRSSRRTNASENGTTGNGDGVSIST
                     PRGRAAGEAGSGARGTGMSPSGAMGGAAPPLSTTALNSQLTAAAPGTSGSIRDSRRRS
                     PAPAMTASGGSEQLSRMTARRGDGPSGLSSGAGTSPPQKAAATSSEDLLPELFSAQEA
                     ANTITIVFDLDETLCNNRCFTGPILRPGAALLLHTLRGLCPSPRYKLIDTHTRSQHAS
                     NRLYDEAMHRMGVTPLYRSRVMQRQSANGYRRTNSTAPGSTVAASGADEAGVSGTTCS
                     TGLCSTGEARPATAKDTNPLRLELVLWTASEESLARRAMRHIDPVNKIFDEAIYRDTR
                     WYRDSHYTKELCRLGRCMSRVVIVENSIESVVRNRQNSILVTSFVRNRLDRQLFLVRE
                     VLRDWVCGMKARLAAQQYASHAPSSLRESVEHAADGNATSHAFREDSVDTRAGESVEE
                     GGESPVPPHSTRPPARVGRSESMPVIMGHAGTHIGDVDPINDSSDGNGSQRGATPELA
                     LSAPCRSSVHAASVPSSPPVSAPRPLSAMARRAPNIVEFLQNHRLIFPDSNFLRFQLT
                     SDVMKHLQTKEAALIAAALHPPPTAAEQADARAVRSIGCGPASRTTRSVREPPNATPS
                     STPPVTTTAPTTANPAGPAPRTPQSRAAGRASPSGGGAAVDSVAAAATRPRIPGKEVG
                     TVRTPAAVATPTSPLGGSVVGATWNSRPGNSSSNGVARAANAHRNPAVRPQRTVSAPP
                     KRSVTNET"
     gene            <333889..>338760
                     /locus_tag="LMJF_33_0790"
                     /db_xref="GeneID:5654476"
     mRNA            <333889..>338760
                     /locus_tag="LMJF_33_0790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685770.1"
                     /db_xref="GeneID:5654476"
     CDS             333889..338760
                     /locus_tag="LMJF_33_0790"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685822.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654476"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4C6"
                     /translation="MRASSSTAGAPLTGDFAAAQDMFLHHIFDDVKEAALYSTTRRPE
                     AFLRPEQAATDAAPAGGFQWQLMPLSAALKDMEAVLQDMLLREQGGCFKGEPAGLPAD
                     AVVVFWRAMLEQAFLGQYCELAALNAGDVAAPGPPQHWLHHIYPYDYSRQPAGLRRRL
                     ERGIRALICSSAYTLHMHWEQHMARHPPSDDAARILGLEFVMLWWWANPDQMPIEVSL
                     AAARLPPPTRQSLRQREPPAEAASLGHHGDGRQQPAASPRRAVDTSMALLSVEQHLQR
                     YLAQHLGLGSANAHTHPQHEQQLQQQRRRHAVLRDGGLLCPAAVFPPAYQDALRAHLA
                     RVRQRKNLTTCPLFLRLVEVALTVATSDAAAVSGGNVPNSSTHPAQCKPLSAAARRGR
                     EIAIQLCQKWLWPVVCGRASPLTMSSIGQAPQRCSTAVVHAPPHAASMETFEDWAVLI
                     AAVAAVSQMRGSLLALRRAGGASARGRREGAHCATISGAGGSSTEDAAAATLDKGTSL
                     AHVRDHLYMPLMRALLADPEDVPASDGERPVDVYGVTVPDDMPGWVALVFARVSACFE
                     EAGMLQRDVARQPATPARLWCLLFHAMCEAFPGVFHSRNTVTVMWTLLALEGVCAAPS
                     LYYSTYRATNAGKTQTMSAWLSTLAAWNGSSVLATELAQLETLPSCADETEAVAACAL
                     CPRTERCQRTAFVLSTAVVETSANDGGLRDSRVGASPAHSRQGRRHGRVTSLPSFASA
                     LSPALPLQWSSAAALAQARAHLTSCAELSDEVVKVSIEVFRRYATLPVPLPAVGTLPS
                     IEAAASVSHVGEERHRYDGDRLPSEAALLRPRGHPSLMVLLRLLQVVALFGEAGSPAS
                     VGDPGLVQCVVDDVMRACHPVVAAYLRKLRVYAAAASGRSGALALLHNETLQSALDSL
                     PPSLGRQRLMKALLWSGLPASALEEGKATEAALFGSGSLAWYVLERNQQHFLAFNLHN
                     TSAAASMDTADDRHPKQQPFSTYQGSERGSGAGDGTNSFAEVVSCLDEVVRHLWQLAI
                     SIPDTARAALFLHPYMNNDSVRRNGPDTAVNSPETVVKCSDDGASVPTSCDKDGVAGN
                     EYESARVSSDEDTSPTLPTAAAGEDVPNALECESGALLESTADECLDAEVEDVDATAD
                     WGTSTLPEEDEFDDDVAAVVPAAEDAQTPLIAASLWDSRAAIRFSVTRDAMQREDDIT
                     SMHSHDEPGVKHGDSTESADSCNTPTHHDDYRALAHALLLATPAAQHIFSSLLEVLSW
                     TVTPQTSSTDSETSWASVCPLGHAQLPGDTGRHWRARLAANYGTCVSVWQAHCHLTSA
                     SAAATSGAAVLCRPQTMERVALLLLQSCPDVYALGLLLLAMAGDTADTHDVSRSAAEA
                     FARRLRRTGSLLPWSVESSLAQLLFHAGVTAESVRRWRAARGLTDGSALRCGTVDPAS
                     AALLHVADHRRLLQRVQKNPYRVDCGGGNSNANYEVKRDLLLSMGSLLLCSLQQRGAA
                     GSQCHALYRYNAYVNEFLLHHLPAADGGRFSPSSSSPDRHITALRVLLPSAQLSSPSP
                     STMPPQQVVSLRIAWQRRIGRSDRAALRSCFQKRDTCATTVEPDDTYCNNYATLQKKQ
                     PLGEDDDYAAAFA"
     gene            <339439..>340770
                     /locus_tag="LMJF_33_0792"
                     /db_xref="GeneID:5654477"
     mRNA            <339439..>340770
                     /locus_tag="LMJF_33_0792"
                     /product="beta tubulin"
                     /transcript_id="XM_001685771.1"
                     /db_xref="GeneID:5654477"
     CDS             339439..340770
                     /locus_tag="LMJF_33_0792"
                     /codon_start=1
                     /product="beta tubulin"
                     /protein_id="XP_001685823.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0792"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0794"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0796"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0798"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0800"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0802"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0804"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0806"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0808"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0810"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0812"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0814"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0816"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0818"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0819"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0792"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0794"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0796"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0798"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0802"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0804"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0806"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0808"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0812"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0814"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0816"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0818"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0819"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654477"
                     /db_xref="GOA:Q4Q4C4"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002453"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR013838"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4C4"
                     /translation="MREIVSCQAGQCGNQIGSKFWEVIADEHGVDPTGSYQGDSDLQL
                     ERINVYFDESAGGRYVPRAVLMDLEPGTMDSVRAGPYGQLFRPDNFIFGQSGAGNNWA
                     KGHYTEGAELIDSVLDVCRKEAESCDCLQGFQLSHSLGGGTGSGMGTLLISKLREEYP
                     DRIMMTFSVIPSPRVSDTVVEPYNTTLSVHQLVENSDESMCIDNEALYDICFRTLKLT
                     TPTFGDLNHLVAAVMSGVTCCLRFPGQLNSDLRKLAVNLVPFPRLHFFMMGFAPLTSR
                     GSQQYRGLSVAELTQQMFDAKNMMQAADPRHGRYLTASALFRGRMSTKEVDEQMLNVQ
                     NKNSSYFIEWIPNNIKSSICDIPPKGLKMSVTFIGNNTCIQEMFRRVGEQFTGMFRRK
                     AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATVEEEGEYDEEEEAY"
     gene            <343026..>344357
                     /locus_tag="LMJF_33_0794"
                     /db_xref="GeneID:5654478"
     mRNA            <343026..>344357
                     /locus_tag="LMJF_33_0794"
                     /product="beta tubulin"
                     /transcript_id="XM_001685772.1"
                     /db_xref="GeneID:5654478"
     CDS             343026..344357
                     /locus_tag="LMJF_33_0794"
                     /codon_start=1
                     /product="beta tubulin"
                     /protein_id="XP_001685824.1"
                     /db_xref="GeneID:5654478"
                     /db_xref="GOA:Q4Q4C4"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002453"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR013838"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4C4"
                     /translation="MREIVSCQAGQCGNQIGSKFWEVIADEHGVDPTGSYQGDSDLQL
                     ERINVYFDESAGGRYVPRAVLMDLEPGTMDSVRAGPYGQLFRPDNFIFGQSGAGNNWA
                     KGHYTEGAELIDSVLDVCRKEAESCDCLQGFQLSHSLGGGTGSGMGTLLISKLREEYP
                     DRIMMTFSVIPSPRVSDTVVEPYNTTLSVHQLVENSDESMCIDNEALYDICFRTLKLT
                     TPTFGDLNHLVAAVMSGVTCCLRFPGQLNSDLRKLAVNLVPFPRLHFFMMGFAPLTSR
                     GSQQYRGLSVAELTQQMFDAKNMMQAADPRHGRYLTASALFRGRMSTKEVDEQMLNVQ
                     NKNSSYFIEWIPNNIKSSICDIPPKGLKMSVTFIGNNTCIQEMFRRVGEQFTGMFRRK
                     AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATVEEEGEYDEEEEAY"
     gene            <346609..>347940
                     /locus_tag="LMJF_33_0796"
                     /db_xref="GeneID:5654479"
     mRNA            <346609..>347940
                     /locus_tag="LMJF_33_0796"
                     /product="beta tubulin"
                     /transcript_id="XM_001685773.1"
                     /db_xref="GeneID:5654479"
     CDS             346609..347940
                     /locus_tag="LMJF_33_0796"
                     /codon_start=1
                     /product="beta tubulin"
                     /protein_id="XP_001685825.1"
                     /db_xref="GeneID:5654479"
                     /db_xref="GOA:Q4Q4C4"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002453"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR013838"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4C4"
                     /translation="MREIVSCQAGQCGNQIGSKFWEVIADEHGVDPTGSYQGDSDLQL
                     ERINVYFDESAGGRYVPRAVLMDLEPGTMDSVRAGPYGQLFRPDNFIFGQSGAGNNWA
                     KGHYTEGAELIDSVLDVCRKEAESCDCLQGFQLSHSLGGGTGSGMGTLLISKLREEYP
                     DRIMMTFSVIPSPRVSDTVVEPYNTTLSVHQLVENSDESMCIDNEALYDICFRTLKLT
                     TPTFGDLNHLVAAVMSGVTCCLRFPGQLNSDLRKLAVNLVPFPRLHFFMMGFAPLTSR
                     GSQQYRGLSVAELTQQMFDAKNMMQAADPRHGRYLTASALFRGRMSTKEVDEQMLNVQ
                     NKNSSYFIEWIPNNIKSSICDIPPKGLKMSVTFIGNNTCIQEMFRRVGEQFTGMFRRK
                     AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATVEEEGEYDEEEEAY"
     gene            <350192..>351523
                     /locus_tag="LMJF_33_0798"
                     /db_xref="GeneID:5654480"
     mRNA            <350192..>351523
                     /locus_tag="LMJF_33_0798"
                     /product="beta tubulin"
                     /transcript_id="XM_001685774.1"
                     /db_xref="GeneID:5654480"
     CDS             350192..351523
                     /locus_tag="LMJF_33_0798"
                     /codon_start=1
                     /product="beta tubulin"
                     /protein_id="XP_001685826.1"
                     /db_xref="GeneID:5654480"
                     /db_xref="GOA:Q4Q4C4"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002453"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR013838"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4C4"
                     /translation="MREIVSCQAGQCGNQIGSKFWEVIADEHGVDPTGSYQGDSDLQL
                     ERINVYFDESAGGRYVPRAVLMDLEPGTMDSVRAGPYGQLFRPDNFIFGQSGAGNNWA
                     KGHYTEGAELIDSVLDVCRKEAESCDCLQGFQLSHSLGGGTGSGMGTLLISKLREEYP
                     DRIMMTFSVIPSPRVSDTVVEPYNTTLSVHQLVENSDESMCIDNEALYDICFRTLKLT
                     TPTFGDLNHLVAAVMSGVTCCLRFPGQLNSDLRKLAVNLVPFPRLHFFMMGFAPLTSR
                     GSQQYRGLSVAELTQQMFDAKNMMQAADPRHGRYLTASALFRGRMSTKEVDEQMLNVQ
                     NKNSSYFIEWIPNNIKSSICDIPPKGLKMSVTFIGNNTCIQEMFRRVGEQFTGMFRRK
                     AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATVEEEGEYDEEEEAY"
     gene            <353778..>355109
                     /locus_tag="LMJF_33_0800"
                     /db_xref="GeneID:5654481"
     mRNA            <353778..>355109
                     /locus_tag="LMJF_33_0800"
                     /product="beta tubulin"
                     /transcript_id="XM_001685775.1"
                     /db_xref="GeneID:5654481"
     CDS             353778..355109
                     /locus_tag="LMJF_33_0800"
                     /codon_start=1
                     /product="beta tubulin"
                     /protein_id="XP_001685827.1"
                     /db_xref="GeneID:5654481"
                     /db_xref="GOA:Q4Q4C4"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002453"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR013838"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4C4"
                     /translation="MREIVSCQAGQCGNQIGSKFWEVIADEHGVDPTGSYQGDSDLQL
                     ERINVYFDESAGGRYVPRAVLMDLEPGTMDSVRAGPYGQLFRPDNFIFGQSGAGNNWA
                     KGHYTEGAELIDSVLDVCRKEAESCDCLQGFQLSHSLGGGTGSGMGTLLISKLREEYP
                     DRIMMTFSVIPSPRVSDTVVEPYNTTLSVHQLVENSDESMCIDNEALYDICFRTLKLT
                     TPTFGDLNHLVAAVMSGVTCCLRFPGQLNSDLRKLAVNLVPFPRLHFFMMGFAPLTSR
                     GSQQYRGLSVAELTQQMFDAKNMMQAADPRHGRYLTASALFRGRMSTKEVDEQMLNVQ
                     NKNSSYFIEWIPNNIKSSICDIPPKGLKMSVTFIGNNTCIQEMFRRVGEQFTGMFRRK
                     AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATVEEEGEYDEEEEAY"
     gene            <357361..>358692
                     /locus_tag="LMJF_33_0802"
                     /db_xref="GeneID:5654482"
     mRNA            <357361..>358692
                     /locus_tag="LMJF_33_0802"
                     /product="beta tubulin"
                     /transcript_id="XM_001685776.1"
                     /db_xref="GeneID:5654482"
     CDS             357361..358692
                     /locus_tag="LMJF_33_0802"
                     /codon_start=1
                     /product="beta tubulin"
                     /protein_id="XP_001685828.1"
                     /db_xref="GeneID:5654482"
                     /db_xref="GOA:Q4Q4C4"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002453"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR013838"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4C4"
                     /translation="MREIVSCQAGQCGNQIGSKFWEVIADEHGVDPTGSYQGDSDLQL
                     ERINVYFDESAGGRYVPRAVLMDLEPGTMDSVRAGPYGQLFRPDNFIFGQSGAGNNWA
                     KGHYTEGAELIDSVLDVCRKEAESCDCLQGFQLSHSLGGGTGSGMGTLLISKLREEYP
                     DRIMMTFSVIPSPRVSDTVVEPYNTTLSVHQLVENSDESMCIDNEALYDICFRTLKLT
                     TPTFGDLNHLVAAVMSGVTCCLRFPGQLNSDLRKLAVNLVPFPRLHFFMMGFAPLTSR
                     GSQQYRGLSVAELTQQMFDAKNMMQAADPRHGRYLTASALFRGRMSTKEVDEQMLNVQ
                     NKNSSYFIEWIPNNIKSSICDIPPKGLKMSVTFIGNNTCIQEMFRRVGEQFTGMFRRK
                     AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATVEEEGEYDEEEEAY"
     gene            <360948..>362279
                     /locus_tag="LMJF_33_0804"
                     /db_xref="GeneID:5654483"
     mRNA            <360948..>362279
                     /locus_tag="LMJF_33_0804"
                     /product="beta tubulin"
                     /transcript_id="XM_001685777.1"
                     /db_xref="GeneID:5654483"
     CDS             360948..362279
                     /locus_tag="LMJF_33_0804"
                     /codon_start=1
                     /product="beta tubulin"
                     /protein_id="XP_001685829.1"
                     /db_xref="GeneID:5654483"
                     /db_xref="GOA:Q4Q4C4"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002453"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR013838"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4C4"
                     /translation="MREIVSCQAGQCGNQIGSKFWEVIADEHGVDPTGSYQGDSDLQL
                     ERINVYFDESAGGRYVPRAVLMDLEPGTMDSVRAGPYGQLFRPDNFIFGQSGAGNNWA
                     KGHYTEGAELIDSVLDVCRKEAESCDCLQGFQLSHSLGGGTGSGMGTLLISKLREEYP
                     DRIMMTFSVIPSPRVSDTVVEPYNTTLSVHQLVENSDESMCIDNEALYDICFRTLKLT
                     TPTFGDLNHLVAAVMSGVTCCLRFPGQLNSDLRKLAVNLVPFPRLHFFMMGFAPLTSR
                     GSQQYRGLSVAELTQQMFDAKNMMQAADPRHGRYLTASALFRGRMSTKEVDEQMLNVQ
                     NKNSSYFIEWIPNNIKSSICDIPPKGLKMSVTFIGNNTCIQEMFRRVGEQFTGMFRRK
                     AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATVEEEGEYDEEEEAY"
     gene            <364528..>365859
                     /locus_tag="LMJF_33_0806"
                     /db_xref="GeneID:5654484"
     mRNA            <364528..>365859
                     /locus_tag="LMJF_33_0806"
                     /product="beta tubulin"
                     /transcript_id="XM_001685778.1"
                     /db_xref="GeneID:5654484"
     CDS             364528..365859
                     /locus_tag="LMJF_33_0806"
                     /codon_start=1
                     /product="beta tubulin"
                     /protein_id="XP_001685830.1"
                     /db_xref="GeneID:5654484"
                     /db_xref="GOA:Q4Q4C4"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002453"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR013838"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4C4"
                     /translation="MREIVSCQAGQCGNQIGSKFWEVIADEHGVDPTGSYQGDSDLQL
                     ERINVYFDESAGGRYVPRAVLMDLEPGTMDSVRAGPYGQLFRPDNFIFGQSGAGNNWA
                     KGHYTEGAELIDSVLDVCRKEAESCDCLQGFQLSHSLGGGTGSGMGTLLISKLREEYP
                     DRIMMTFSVIPSPRVSDTVVEPYNTTLSVHQLVENSDESMCIDNEALYDICFRTLKLT
                     TPTFGDLNHLVAAVMSGVTCCLRFPGQLNSDLRKLAVNLVPFPRLHFFMMGFAPLTSR
                     GSQQYRGLSVAELTQQMFDAKNMMQAADPRHGRYLTASALFRGRMSTKEVDEQMLNVQ
                     NKNSSYFIEWIPNNIKSSICDIPPKGLKMSVTFIGNNTCIQEMFRRVGEQFTGMFRRK
                     AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATVEEEGEYDEEEEAY"
     gene            <368107..>369438
                     /locus_tag="LMJF_33_0808"
                     /db_xref="GeneID:5654485"
     mRNA            <368107..>369438
                     /locus_tag="LMJF_33_0808"
                     /product="beta tubulin"
                     /transcript_id="XM_001685779.1"
                     /db_xref="GeneID:5654485"
     CDS             368107..369438
                     /locus_tag="LMJF_33_0808"
                     /codon_start=1
                     /product="beta tubulin"
                     /protein_id="XP_001685831.1"
                     /db_xref="GeneID:5654485"
                     /db_xref="GOA:Q4Q4C4"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002453"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR013838"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4C4"
                     /translation="MREIVSCQAGQCGNQIGSKFWEVIADEHGVDPTGSYQGDSDLQL
                     ERINVYFDESAGGRYVPRAVLMDLEPGTMDSVRAGPYGQLFRPDNFIFGQSGAGNNWA
                     KGHYTEGAELIDSVLDVCRKEAESCDCLQGFQLSHSLGGGTGSGMGTLLISKLREEYP
                     DRIMMTFSVIPSPRVSDTVVEPYNTTLSVHQLVENSDESMCIDNEALYDICFRTLKLT
                     TPTFGDLNHLVAAVMSGVTCCLRFPGQLNSDLRKLAVNLVPFPRLHFFMMGFAPLTSR
                     GSQQYRGLSVAELTQQMFDAKNMMQAADPRHGRYLTASALFRGRMSTKEVDEQMLNVQ
                     NKNSSYFIEWIPNNIKSSICDIPPKGLKMSVTFIGNNTCIQEMFRRVGEQFTGMFRRK
                     AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATVEEEGEYDEEEEAY"
     gene            <371693..>373024
                     /locus_tag="LMJF_33_0810"
                     /db_xref="GeneID:5654486"
     mRNA            <371693..>373024
                     /locus_tag="LMJF_33_0810"
                     /product="beta tubulin"
                     /transcript_id="XM_001685780.1"
                     /db_xref="GeneID:5654486"
     CDS             371693..373024
                     /locus_tag="LMJF_33_0810"
                     /codon_start=1
                     /product="beta tubulin"
                     /protein_id="XP_001685832.1"
                     /db_xref="GeneID:5654486"
                     /db_xref="GOA:Q4Q4C4"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002453"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR013838"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4C4"
                     /translation="MREIVSCQAGQCGNQIGSKFWEVIADEHGVDPTGSYQGDSDLQL
                     ERINVYFDESAGGRYVPRAVLMDLEPGTMDSVRAGPYGQLFRPDNFIFGQSGAGNNWA
                     KGHYTEGAELIDSVLDVCRKEAESCDCLQGFQLSHSLGGGTGSGMGTLLISKLREEYP
                     DRIMMTFSVIPSPRVSDTVVEPYNTTLSVHQLVENSDESMCIDNEALYDICFRTLKLT
                     TPTFGDLNHLVAAVMSGVTCCLRFPGQLNSDLRKLAVNLVPFPRLHFFMMGFAPLTSR
                     GSQQYRGLSVAELTQQMFDAKNMMQAADPRHGRYLTASALFRGRMSTKEVDEQMLNVQ
                     NKNSSYFIEWIPNNIKSSICDIPPKGLKMSVTFIGNNTCIQEMFRRVGEQFTGMFRRK
                     AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATVEEEGEYDEEEEAY"
     gene            <375277..>376608
                     /locus_tag="LMJF_33_0812"
                     /db_xref="GeneID:5654487"
     mRNA            <375277..>376608
                     /locus_tag="LMJF_33_0812"
                     /product="beta tubulin"
                     /transcript_id="XM_001685781.1"
                     /db_xref="GeneID:5654487"
     CDS             375277..376608
                     /locus_tag="LMJF_33_0812"
                     /codon_start=1
                     /product="beta tubulin"
                     /protein_id="XP_001685833.1"
                     /db_xref="GeneID:5654487"
                     /db_xref="GOA:Q4Q4C4"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002453"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR013838"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4C4"
                     /translation="MREIVSCQAGQCGNQIGSKFWEVIADEHGVDPTGSYQGDSDLQL
                     ERINVYFDESAGGRYVPRAVLMDLEPGTMDSVRAGPYGQLFRPDNFIFGQSGAGNNWA
                     KGHYTEGAELIDSVLDVCRKEAESCDCLQGFQLSHSLGGGTGSGMGTLLISKLREEYP
                     DRIMMTFSVIPSPRVSDTVVEPYNTTLSVHQLVENSDESMCIDNEALYDICFRTLKLT
                     TPTFGDLNHLVAAVMSGVTCCLRFPGQLNSDLRKLAVNLVPFPRLHFFMMGFAPLTSR
                     GSQQYRGLSVAELTQQMFDAKNMMQAADPRHGRYLTASALFRGRMSTKEVDEQMLNVQ
                     NKNSSYFIEWIPNNIKSSICDIPPKGLKMSVTFIGNNTCIQEMFRRVGEQFTGMFRRK
                     AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATVEEEGEYDEEEEAY"
     gene            <378862..>380193
                     /locus_tag="LMJF_33_0814"
                     /db_xref="GeneID:5654488"
     mRNA            <378862..>380193
                     /locus_tag="LMJF_33_0814"
                     /product="beta tubulin"
                     /transcript_id="XM_001685782.1"
                     /db_xref="GeneID:5654488"
     CDS             378862..380193
                     /locus_tag="LMJF_33_0814"
                     /codon_start=1
                     /product="beta tubulin"
                     /protein_id="XP_001685834.1"
                     /db_xref="GeneID:5654488"
                     /db_xref="GOA:Q4Q4C4"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002453"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR013838"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4C4"
                     /translation="MREIVSCQAGQCGNQIGSKFWEVIADEHGVDPTGSYQGDSDLQL
                     ERINVYFDESAGGRYVPRAVLMDLEPGTMDSVRAGPYGQLFRPDNFIFGQSGAGNNWA
                     KGHYTEGAELIDSVLDVCRKEAESCDCLQGFQLSHSLGGGTGSGMGTLLISKLREEYP
                     DRIMMTFSVIPSPRVSDTVVEPYNTTLSVHQLVENSDESMCIDNEALYDICFRTLKLT
                     TPTFGDLNHLVAAVMSGVTCCLRFPGQLNSDLRKLAVNLVPFPRLHFFMMGFAPLTSR
                     GSQQYRGLSVAELTQQMFDAKNMMQAADPRHGRYLTASALFRGRMSTKEVDEQMLNVQ
                     NKNSSYFIEWIPNNIKSSICDIPPKGLKMSVTFIGNNTCIQEMFRRVGEQFTGMFRRK
                     AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATVEEEGEYDEEEEAY"
     gene            <382449..>383780
                     /locus_tag="LMJF_33_0816"
                     /db_xref="GeneID:5654489"
     mRNA            <382449..>383780
                     /locus_tag="LMJF_33_0816"
                     /product="beta tubulin"
                     /transcript_id="XM_001685783.1"
                     /db_xref="GeneID:5654489"
     CDS             382449..383780
                     /locus_tag="LMJF_33_0816"
                     /codon_start=1
                     /product="beta tubulin"
                     /protein_id="XP_001685835.1"
                     /db_xref="GeneID:5654489"
                     /db_xref="GOA:Q4Q4C4"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002453"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR013838"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4C4"
                     /translation="MREIVSCQAGQCGNQIGSKFWEVIADEHGVDPTGSYQGDSDLQL
                     ERINVYFDESAGGRYVPRAVLMDLEPGTMDSVRAGPYGQLFRPDNFIFGQSGAGNNWA
                     KGHYTEGAELIDSVLDVCRKEAESCDCLQGFQLSHSLGGGTGSGMGTLLISKLREEYP
                     DRIMMTFSVIPSPRVSDTVVEPYNTTLSVHQLVENSDESMCIDNEALYDICFRTLKLT
                     TPTFGDLNHLVAAVMSGVTCCLRFPGQLNSDLRKLAVNLVPFPRLHFFMMGFAPLTSR
                     GSQQYRGLSVAELTQQMFDAKNMMQAADPRHGRYLTASALFRGRMSTKEVDEQMLNVQ
                     NKNSSYFIEWIPNNIKSSICDIPPKGLKMSVTFIGNNTCIQEMFRRVGEQFTGMFRRK
                     AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATVEEEGEYDEEEEAY"
     gene            <386034..>387365
                     /locus_tag="LMJF_33_0818"
                     /db_xref="GeneID:5654490"
     mRNA            <386034..>387365
                     /locus_tag="LMJF_33_0818"
                     /product="beta tubulin"
                     /transcript_id="XM_001685784.1"
                     /db_xref="GeneID:5654490"
     CDS             386034..387365
                     /locus_tag="LMJF_33_0818"
                     /codon_start=1
                     /product="beta tubulin"
                     /protein_id="XP_001685836.1"
                     /db_xref="GeneID:5654490"
                     /db_xref="GOA:Q4Q4C4"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002453"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR013838"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4C4"
                     /translation="MREIVSCQAGQCGNQIGSKFWEVIADEHGVDPTGSYQGDSDLQL
                     ERINVYFDESAGGRYVPRAVLMDLEPGTMDSVRAGPYGQLFRPDNFIFGQSGAGNNWA
                     KGHYTEGAELIDSVLDVCRKEAESCDCLQGFQLSHSLGGGTGSGMGTLLISKLREEYP
                     DRIMMTFSVIPSPRVSDTVVEPYNTTLSVHQLVENSDESMCIDNEALYDICFRTLKLT
                     TPTFGDLNHLVAAVMSGVTCCLRFPGQLNSDLRKLAVNLVPFPRLHFFMMGFAPLTSR
                     GSQQYRGLSVAELTQQMFDAKNMMQAADPRHGRYLTASALFRGRMSTKEVDEQMLNVQ
                     NKNSSYFIEWIPNNIKSSICDIPPKGLKMSVTFIGNNTCIQEMFRRVGEQFTGMFRRK
                     AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATVEEEGEYDEEEEAY"
     gene            <389622..>390953
                     /locus_tag="LMJF_33_0819"
                     /db_xref="GeneID:5654491"
     mRNA            <389622..>390953
                     /locus_tag="LMJF_33_0819"
                     /product="beta tubulin"
                     /transcript_id="XM_001685785.1"
                     /db_xref="GeneID:5654491"
     CDS             389622..390953
                     /locus_tag="LMJF_33_0819"
                     /codon_start=1
                     /product="beta tubulin"
                     /protein_id="XP_001685837.1"
                     /db_xref="GeneID:5654491"
                     /db_xref="GOA:Q4Q4C4"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002453"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR013838"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4C4"
                     /translation="MREIVSCQAGQCGNQIGSKFWEVIADEHGVDPTGSYQGDSDLQL
                     ERINVYFDESAGGRYVPRAVLMDLEPGTMDSVRAGPYGQLFRPDNFIFGQSGAGNNWA
                     KGHYTEGAELIDSVLDVCRKEAESCDCLQGFQLSHSLGGGTGSGMGTLLISKLREEYP
                     DRIMMTFSVIPSPRVSDTVVEPYNTTLSVHQLVENSDESMCIDNEALYDICFRTLKLT
                     TPTFGDLNHLVAAVMSGVTCCLRFPGQLNSDLRKLAVNLVPFPRLHFFMMGFAPLTSR
                     GSQQYRGLSVAELTQQMFDAKNMMQAADPRHGRYLTASALFRGRMSTKEVDEQMLNVQ
                     NKNSSYFIEWIPNNIKSSICDIPPKGLKMSVTFIGNNTCIQEMFRRVGEQFTGMFRRK
                     AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATVEEEGEYDEEEEAY"
     gene            <393202..>394533
                     /locus_tag="LMJF_33_0820"
                     /db_xref="GeneID:5654492"
     mRNA            <393202..>394533
                     /locus_tag="LMJF_33_0820"
                     /product="beta tubulin"
                     /transcript_id="XM_001685786.1"
                     /db_xref="GeneID:5654492"
     CDS             393202..394533
                     /locus_tag="LMJF_33_0820"
                     /codon_start=1
                     /product="beta tubulin"
                     /protein_id="XP_001685838.1"
                     /db_xref="GeneID:5654492"
                     /db_xref="GOA:Q4Q4C4"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002453"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR013838"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4C4"
                     /translation="MREIVSCQAGQCGNQIGSKFWEVIADEHGVDPTGSYQGDSDLQL
                     ERINVYFDESAGGRYVPRAVLMDLEPGTMDSVRAGPYGQLFRPDNFIFGQSGAGNNWA
                     KGHYTEGAELIDSVLDVCRKEAESCDCLQGFQLSHSLGGGTGSGMGTLLISKLREEYP
                     DRIMMTFSVIPSPRVSDTVVEPYNTTLSVHQLVENSDESMCIDNEALYDICFRTLKLT
                     TPTFGDLNHLVAAVMSGVTCCLRFPGQLNSDLRKLAVNLVPFPRLHFFMMGFAPLTSR
                     GSQQYRGLSVAELTQQMFDAKNMMQAADPRHGRYLTASALFRGRMSTKEVDEQMLNVQ
                     NKNSSYFIEWIPNNIKSSICDIPPKGLKMSVTFIGNNTCIQEMFRRVGEQFTGMFRRK
                     AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATVEEEGEYDEEEEAY"
     gene            <396814..>399006
                     /locus_tag="LMJF_33_0830"
                     /db_xref="GeneID:5654493"
     mRNA            <396814..>399006
                     /locus_tag="LMJF_33_0830"
                     /product="putative 2,4-dienoyl-coa reductase fadh1"
                     /transcript_id="XM_001685787.1"
                     /db_xref="GeneID:5654493"
     CDS             396814..399006
                     /locus_tag="LMJF_33_0830"
                     /EC_number="1.3.1.34"
                     /codon_start=1
                     /product="putative 2,4-dienoyl-coa reductase fadh1"
                     /protein_id="XP_001685839.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654493"
                     /db_xref="GOA:Q4Q4A9"
                     /db_xref="InterPro:IPR000103"
                     /db_xref="InterPro:IPR001155"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4A9"
                     /translation="MKQYAKILEPLDLGFVKLRNRVVMASMHTGLESPIHATRSAAAA
                     EGNPYARLARFYRERAKGKAGLIVTGGFSPNSEGVLYPGESVLGPKDADQLRCVTDAV
                     HVEGGHILLQMLHSGRYSTCDQCVAPSPIPSQISHTQKVPVEMSVPLIQRTVEDFARL
                     AICAQKAGFDGVEIMGSEGYLLNQFIARHTNHRTDDYGGSFENRIRFPLEVLRAVRDA
                     TGPNFIIAFRVSLLDLVPDGSTQAEVFELAEKVSKSGANIIDSGIGWHESRVPTIATS
                     VPRAGYTWATAAVRSHLRRQGIDIPLIAVNRMNHPDILEQVLENGEADLVAMARPFLS
                     DPYFVKKTMSGAADRINICIACNQACLDNIFVGKTACCMLNPLAAHEAERAALPAPAA
                     KKVAVIGGGPAGASAAITLADRGHRVTLYEANSVLGGQFNLAKRIPGKEEFQSSIDYW
                     TNTLTKHANVTLKLNRRATVEEVATVGYDEVVVATGCVPHAKSGALIAGMEKYPNVFS
                     YTEALLHPEKVGHRVAVIGAGGIGFDMAEFLTSPHSTSAETVAAAQYTKFEKQDNAEF
                     RKKWGIKCAAIAQDEEKAGISTGASGSNSCSPLPGGLVKPVTPRPYREVTMFQRTRGK
                     LGAHLGATTGWIHRLEIRMNRVKAVDGVTYKSFDGTSLVYVDKEGKEQTLAVDSVVLC
                     TGQVSNNEFEKAATPVLSKLHTIGGCNFTKKLDAKLAILQAHSVAIRL"
     gene            <401257..>403386
                     /locus_tag="LMJF_33_0840"
                     /db_xref="GeneID:5654494"
     mRNA            <401257..>403386
                     /locus_tag="LMJF_33_0840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685788.1"
                     /db_xref="GeneID:5654494"
     CDS             401257..403386
                     /locus_tag="LMJF_33_0840"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685840.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654494"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4A8"
                     /translation="MWLRCSCRLFFHIPPPSLAAPARRVAPRTLRSHGRSQGSEPANA
                     KVATSNPRTPDSFDSGSKGDGARCYHHQRRPRCRLLKPGDPLPPPLTSDGGYASSDGY
                     TSQRQEYRQRRNAANNPGDSPVDESVAGSLFTPLPRSCGFYDGIDEHAREAPRPSREA
                     RQQLLRESLEAHAASAVEFTDGGEDDIDLNGLPADQYHGHEGWTTIPKDSALYNTMYG
                     VGDLESRQRANSWTVAMRHGRVGGSVSVGGLLGDSAAASAQRPGTHQENEQTDQEVLD
                     DCRRRRQRDEGLLSTSLEGELLAPMQESVGQPRSTYAMRKLFVDGLVGYQGVITRAEE
                     TTMSEELLHLLQDPRAAYVAEEARYCVNLYETELGIPGKDTLAFALSSCQTLQRVLYR
                     FFFLGLIPSVPNVCQVSEMVGTFSGYPVHRHPSSIGSYVGMLNLVSTSVLHLQHKDAP
                     WYPRLHLIPRSLFVVTEPCLSEYAMGYKQTHQPFHAFEYATRVSKDYRIEVLFATVET
                     AQTRTLSEAVQLTEYAERRAREGTAKLLNGTSQPLAEARTHTTVTPTESVTGVPLRGH
                     TDEWLQRLRDNMHASEEARGYGHAKPLDGHALRRQLLAERLVGDRPRLDSGCGSVGWR
                     GGAGRDEGANVKAAEAQAETRHHESDTSPCDKTTTSAAHRRLAALKARYNFAQELKAS
                     RQRVEVTNDGPRLLRGHAPRDRRLGIK"
     gene            <404143..>406773
                     /locus_tag="LMJF_33_0850"
                     /db_xref="GeneID:5654495"
     mRNA            <404143..>406773
                     /locus_tag="LMJF_33_0850"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685789.1"
                     /db_xref="GeneID:5654495"
     CDS             404143..406773
                     /locus_tag="LMJF_33_0850"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685841.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654495"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4A7"
                     /translation="MHAHRFLSASQVARPQATTACNSAAGLSVTLPPLCALGACADAG
                     GGSSRRYEDVWAPIESYLAQLSAATADNNGGGKSGVTPAAPSPPLCLVLRLFPDLTIA
                     QLPSLRRGSTEGSSPPRRARNSFIAPHEYPLDAILGAEELWGSGADPQRVFRGAIDCL
                     HELGQRLLPQLALVLQLPTRLLVSQQFLHDLAALLVRDSWRSISFELPSTHQLYSRSA
                     EGSRAGVCAPSATSVTDVGAVDAAWCRLPVLCTPWPTLCRHPALGRTLRQLRRHDVVP
                     FHVLYSWAVAEMQLFHSFELSIVVDTTAPMPGEEALHAYLQGPSSVGRSAEELHRASP
                     QLPRQLCDSTDAPYSSGQTDSDAHCARTHVYMSENPRTARGAAVGFSNGVMNALRWRD
                     RSATPLESHQVDLDDVENEWRLWKHTNATSPSGAATAVAHTLLASSGSPGDLSLSLDA
                     PPDHLRALIENSIIDCDAAAPPRLSQRQRLLQNVGQLMQRTMEEPSVAASADTDSPLS
                     TSAGEDGESTPLKQEAEELERLLREANDASEAGTTSFDAEMMMAKVPRYTRAHSHTSP
                     AHREIMNRMHAAPGADVRVTLNTWPAFSGYWSCLHALVEEVTHATLLWTAPTFNNEAV
                     QAWTAAYYASQCPRVGHGEAHMPTSNAPLPLVVPIYMPVQSAMHVEVERLLREGRWFE
                     EPPLLQSREEGTALHTWLPASLNVALADTLSRLPGDYQAHERSRLLRDHQRLRKEGAQ
                     GARRGGSVSELAAASPACSDLCEDDEELRPALVRIRQEARPLFLLTPAQVERRESKAF
                     KEAAVACVTAGKAAAQLNKTVCGANKTFAQAVEESYRAASPASDAAVAHKTPPMRLLH
                     VPTPGLSLEELDRSWRCLPS"
     gene            <407449..>408804
                     /locus_tag="LMJF_33_0860"
                     /db_xref="GeneID:5654496"
     mRNA            <407449..>408804
                     /locus_tag="LMJF_33_0860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685790.1"
                     /db_xref="GeneID:5654496"
     CDS             407449..408804
                     /locus_tag="LMJF_33_0860"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685842.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654496"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4A6"
                     /translation="MVAAAVVETKYRIRHTLLCAHALRLRRLAITLPLFVAFPFTMLH
                     FARVLRKAASAVPPRLLVLTMIPNGGALGPALRMLGYHPYTFEDSVRKGRLLTHPQEW
                     MAVMRGEKTFDFEVLQAPQHTASTEAVPSSSGDPCASRTPECATASTTPSASPRAPLF
                     FDSLVGPPATVAFESILKECPRSTRVILVEEPDKLAWEKDMEQWLQPLVRECKKSAIW
                     WNASKLHMMLLDMVDLRRALISPNNQRGGRARPSPSSFAAMTAQNVPISMQHTTLRLS
                     GALDLFEEHVKEVVPRDRLLVYRVRDGWQPLCDFLQVPVPMAPATAGGAPPEPVAFPP
                     NSTGSDILLFVHQGFKKSAAVVSLLFLVVVALALLLLSSFTEEYKQFYRDYRDYVHRD
                     LEPYMDAEKVREGDESALTIRQALVMAKKSSKRFGEEYEREGGAMGSMSGLMGRIVGS
                     K"
     gene            <409605..>411083
                     /locus_tag="LMJF_33_0870"
                     /db_xref="GeneID:5654497"
     mRNA            <409605..>411083
                     /locus_tag="LMJF_33_0870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685791.1"
                     /db_xref="GeneID:5654497"
     CDS             409605..411083
                     /locus_tag="LMJF_33_0870"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685843.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654497"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4A5"
                     /translation="MGNPFEDLRPALRSEEDEIRKGVFSQALRNLQQASLEERRRWCK
                     AIREATTRGGAKTKKKATPAAAVAELSDNIGPSTAISSPPQPTASNSAASASPPTPYA
                     LTAAHSTEEADVTVGQKRARNEGEASPTGAPATALGGPLDGAPLCCAPQASQTVPESA
                     TVGSQPSRTAALAPADGEPSSSAAVSDPAAEETEESVKECIAVYMRSLLDRVVGTGID
                     NLAVPALKVLCMMLGIHTEVSNKLGLYSILADFYFSKCVKLGKRVSRDTVFERHVEQE
                     VSMLRRVASAASSAGRAEKVTAAAPEKAAVTVAKSATTLADKVEKTEVKREQAVVRKK
                     MFSAPLFNSSRAAKVVPQANPVTEHYLKYEDYNDNTFEDDAAVAAPASDYAYGGDVIY
                     QQPVFARSSNKTASPSHMTKYEGSGAGGEEEDDSWSLPLLERKVASIVQMYDPVTVAI
                     VVKKLSQMGYRDGGAESRVEQILRRFHERQLIFYDNGIAYLM"
     gene            <412559..>413587
                     /locus_tag="LMJF_33_0880"
                     /db_xref="GeneID:5654498"
     mRNA            <412559..>413587
                     /locus_tag="LMJF_33_0880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685792.1"
                     /db_xref="GeneID:5654498"
     CDS             412559..413587
                     /locus_tag="LMJF_33_0880"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685844.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654498"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4A4"
                     /translation="MSSTPALAHGEYLNRMLVLAAAATTFVGYASSVYWERTVAPCLC
                     RRHESALEQEIAELEREAEEICTTSNLYEHSRLMRRALRLRQEFEAERQKRLAYAFSA
                     ARVVSPLLGGVSFASRFGRPTRDAAAVGVAPGRVDKAAAAGNKPGALPYLCSTTTTSA
                     PTRHHAAESSTAAPHRLQVLVESAMNVLRYNAVTTVKYLLRFGSALVLLHVFGNRRGL
                     MAVPPSFEATLRYCAVEVMAPLLLNVFMYVPALVFAPAKRASLVKTYGSRAEDGAVGV
                     IHSSFAEAIPPSSSASSFSAVTRSASDAGAAAPFQCADVRFGASSDLASWLLACYLAW
                     YLIVRVFD"
     gene            <414905..>415249
                     /locus_tag="LMJF_33_0890"
                     /db_xref="GeneID:5654499"
     mRNA            <414905..>415249
                     /locus_tag="LMJF_33_0890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685793.1"
                     /db_xref="GeneID:5654499"
     CDS             414905..415249
                     /locus_tag="LMJF_33_0890"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685845.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654499"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4A3"
                     /translation="MQPPPPQMTPYEENITRSYQYLNGARMQSAILFNSTTFCIDRCL
                     DTQELYTLMRTTNAPISYRLQKDMEEKKCVQNCSAKWDELFNITLTEANEGAVREVQA
                     NAIAKMMGAMQQ"
     gene            <417086..>418828
                     /locus_tag="LMJF_33_0900"
                     /db_xref="GeneID:5654500"
     mRNA            <417086..>418828
                     /locus_tag="LMJF_33_0900"
                     /product="dnaj chaperone-like protein"
                     /transcript_id="XM_001685794.1"
                     /db_xref="GeneID:5654500"
     CDS             417086..418828
                     /locus_tag="LMJF_33_0900"
                     /codon_start=1
                     /product="dnaj chaperone-like protein"
                     /protein_id="XP_001685846.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654500"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4A2"
                     /translation="MVDLYAALEVDKRATPEQIKRNYRRLALRYHPDKAGPEGAARFK
                     EVNTAYEVLSNQRKKEIYDRYGEAGLEALENPVAGAALATFGSTAPVIITIAISFICA
                     VMLLLFLAFLVSFVDGQLRTWSYVRVFSPLFVLDFLVGVPALILLGVFAIMSPLSLHA
                     QCTLLSLLCAVVLTIVIPIAKDRNEAVARAGRTDYVQWRLWLIPGYLFSVFAFIAIVM
                     TSLPTERRIFDLKSIGLVHFANYTRVGFVFAILQGCCIVVFFALVACRADGVITIDYF
                     VVIGLPIFLLLTLFLVNRVVLYVLSSYISDVPPEVAAAAAARELNEHGGEAPAPHPNE
                     GCAEGPHSSWRGSSNPMCGGGTEGCNRTHRQPRAEFEEQLHSNDARDHGNRDGEGGED
                     GGRAQQSASHGKNPYAGQHASFCGVLISMIVASILVGLLMASTAMIAVRLNYYSNHGT
                     YDGVLSLSKACIPLFIIIGNVVLMELIACLTFCCCGVFMVVEGGAPVPEHGNQQESSA
                     GNEAGMQNNVCTDPARPAGQAVADLTHQNEAPRRCPPGAVSATTHSVALSADEHGKTP
                     RERQPDSTRLSDVD"
     gene            <420310..>420663
                     /locus_tag="LMJF_33_0910"
                     /db_xref="GeneID:5654501"
     mRNA            <420310..>420663
                     /locus_tag="LMJF_33_0910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685795.1"
                     /db_xref="GeneID:5654501"
     CDS             420310..420663
                     /locus_tag="LMJF_33_0910"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685847.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654501"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4A1"
                     /translation="MYLAVFHEFAHPEVLENVKAEGICDVDVAPEPNKLAASEEEQQV
                     LRCNAKLITVKHNITGIRDVFDGMTEAELVEIDGQVEQKLQQLVALGFQVVERHPRTS
                     AGRPMLDRVILSYPA"
     gene            <421725..>422384
                     /locus_tag="LMJF_33_0920"
                     /db_xref="GeneID:5654502"
     mRNA            <421725..>422384
                     /locus_tag="LMJF_33_0920"
                     /product="putative 40S ribosomal protein S3"
                     /transcript_id="XM_001685796.1"
                     /db_xref="GeneID:5654502"
     CDS             421725..422384
                     /locus_tag="LMJF_33_0920"
                     /codon_start=1
                     /product="putative 40S ribosomal protein S3"
                     /protein_id="XP_001685848.1"
                     /db_xref="GeneID:5654502"
                     /db_xref="GOA:Q4Q4A0"
                     /db_xref="InterPro:IPR001351"
                     /db_xref="InterPro:IPR004044"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR005703"
                     /db_xref="InterPro:IPR009019"
                     /db_xref="UniProtKB/TrEMBL:Q4Q4A0"
                     /translation="MGPLSKKRMIIRDGVFYAELFEFLKRELAEEGFSGVSYHVTTLR
                     TEIVIKATKTREVLGVNGRRIRELTACIQQRFNYKEGKLQLYVERVEVRGLSAMAQVE
                     SLRFKLLSNLQVRRAAMGIIRYVMESGAKGCEVTVGGKIKGQRAKSMTFRDGYMIKSG
                     TAHKSFVDSACRHCYMRAGCIGVKVKIMLPGDSTGRNGPSEPLPDVITVIEPKQITAS
                     E"
     gene            <422731..>425949
                     /locus_tag="LMJF_33_0930"
                     /db_xref="GeneID:5654503"
     mRNA            <422731..>425949
                     /locus_tag="LMJF_33_0930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685797.1"
                     /db_xref="GeneID:5654503"
     CDS             422731..425949
                     /locus_tag="LMJF_33_0930"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685849.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654503"
                     /db_xref="UniProtKB/TrEMBL:Q4Q499"
                     /translation="MCTRRRTCVAVLPSALRPGASVSLPSFSRRQRREGDGGGDEQTR
                     RVGMLPPSRLTLSGARYESDLHICVCVPLRGFGGDTQTRIFFFRLIVCANNPSLRRNV
                     KNAVRHCALLLLDAFAFSLHSPLAPSLMPQMPPSYTEHTHTHTHTYPTRCSHGSVVCN
                     NNERGREGQTPSFRKACWPFIGRGATFRLMNAQDSAPLLKKAALCSDDSVRSPLEAGS
                     LTSRRRLSSRLGAQMPSSTTATALALTSKQRLFSEATLRSIALLLRHTAAEIEAAALE
                     DAMEDPVASEYIMTNGGRADEHSVSTTSVSVPVTSFFAGDADRSALSSSASSGSGADW
                     VSGMSAPSSTHDAATRSTDSPPSQPQRGSKITAQVPSTLTLSSSAPGDRPRHSRCSPP
                     PLELRRRPRASFSGTLVDQAIRAAGAAASSPSYSYSFPEKWFGPPADALARRAAQRSA
                     GDTLLNPSTRRASIATAKGFRPRWQPRTSSAKLTATKETSFAAASRSQSLNTAVFLPD
                     PSPARSPTTLTHRNSFSNHADWNKVLATATSQPPLFFDNLLFDPATNRYLFGGHAFRE
                     EVRVLQAPAADASALAASRADDAGSGNSVTKHTRGSPSPWLLLVREYIPVSAECSIVG
                     DEQRPLSASGGSVDAVVVQCFSLLPPQLVHLRPNPYQLLPETTITMCLLVALPGCVTL
                     VTPLDVFLHDARHSLLMVAGSSLERLLSSSHETTEVRRRPGSGAQSSLATVSPSASTA
                     RVNFVHPSTSLEAAFGNRVSDVSPSSAATPVSLDAAERDRDTTRIAIVQERLVQVVMP
                     DILDEAMHAIYGTLVVYCIQYEQRRRMLVAVGAVHVLQRFFRRCLAVMERAVRRMVRL
                     WRQLEVDARLKLQQYRPLPTAMERLDAVANSILQEHMLTSGSYKRSFIAAQWAARRRS
                     FAQWRQTEEWDSVFASHVRRREIDSNGAATDSAAEKRPRSARLSAGEELRLESEFNKR
                     RGWSSKVMMPCTEPSSPSRAAESYAEREQAAIRRFLSWYIDPQELLYLSHQRLLETLK
                     GSVFQMADVRLELRRAANRPTNEDCATPLAASVSCNSVHQCR"
     gene            <426844..>428490
                     /locus_tag="LMJF_33_0935"
                     /db_xref="GeneID:5654504"
     mRNA            <426844..>428490
                     /locus_tag="LMJF_33_0935"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685798.1"
                     /db_xref="GeneID:5654504"
     CDS             426844..428490
                     /locus_tag="LMJF_33_0935"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685850.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0935"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0935"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654504"
                     /db_xref="UniProtKB/TrEMBL:Q4Q498"
                     /translation="MPSSSPFSASFFESLLYSRRGTGKNRGTRSIARRSQELGAQLCG
                     RLSQVALEVSSAAFSRTATAAAEVGAGTHANGSPLVSSLSSAASAPLSFMADVHRDLS
                     AHYGSHTVRRGLAKPLGPCVHPVLRKGNLATQRAGVHSPRYMRVWLLRLVRRCWCPRC
                     GVWLSSGSAPKPSKLKASRTTLATIKECRVRRQLRPSRLSITRRRFMLCCLRCLDAAQ
                     RAAKRNATLPRITTGGQQENDIAVRSTVESASLSTQHAAREACAAWVEQTSAAVLTEA
                     RVPRRNRRCRRRSKRRRRGSTGEARTGVNETVRAGCGTSAAVHQQSTFASQVTQGIAL
                     SLKRSTTPLPGVAGARKATKASAVKVSTTASTAHKSLRGLVPSGPLKKSVLRACAKGT
                     PPPSSMNLPATAPVACSPSAAVTKHAVVASSTVQIRPSLPSQFIDDAHGRLAHQRLDA
                     EQAKHLQMIHKATNSGGTAPTTTASVSGLSPSPTDSLPSSAAPAPPVPSAPAKAIAST
                     SRTTDVAKKAAHPPAKAATVTKKPAAAKKKFMDTMSQLGF"
     gene            <430124..>433630
                     /locus_tag="LMJF_33_0940"
                     /db_xref="GeneID:5654505"
     mRNA            <430124..>433630
                     /locus_tag="LMJF_33_0940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685799.1"
                     /db_xref="GeneID:5654505"
     CDS             430124..433630
                     /locus_tag="LMJF_33_0940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685851.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654505"
                     /db_xref="GOA:Q4Q497"
                     /db_xref="InterPro:IPR008614"
                     /db_xref="UniProtKB/TrEMBL:Q4Q497"
                     /translation="MPVAVSMHACSAWPVSIDFVAFRFFLAGYSVEETVEQLMALRSE
                     TPATSPHRSTSSASPSSSRSSDVGKASHAGSASSSQSAAHPMAHRHDRKQQRTPQQRQ
                     DSLYAMHKAQQQAEDRRLEVEDENPQEIAVVTAAAALPRKTSISGSASGAHVPTTAAA
                     PSTTTVVDNSNTNASASLSTTVAVSASSAAFRPVPSGAHTRHHRHRHHHHQCLDKSPG
                     GSERKKSCHSAPHSSRSRTATTSSRTATHTSFALPSTLNNADSDASPLSVDLSNFRRF
                     TDDATVAATAAAAPSDAGGGSGARAGGASSSHHLHHVNFGDTKASSSLPQRREKHRKD
                     SAGRHCFFLSESYMKFQRQLQEFEAIGGVGVGSSSLQSRYLFEEVTEQYQVFRELSRE
                     EQLGSPYAFLSNYYIPIPVATRLQLLQLYYETDAGVFRWAFGDKLSRFDLPAALSAAR
                     EEKVSGTLSAGFGGVAGLGSGGGSSSGAADGGVTAASFWTSRWKGSPGKLAAMDAATV
                     TRLSEQHVDALRRQWENVKHVCVTVAALYRGKGSMCVPLDMPLLTTIQQCFGLRHQQA
                     LDYATAAFGFEHRLETRLFEHLHNFNEYGVICSVVASLWCDCSGYFLSGSFRDGCRRL
                     GRLLDEYRILSELHLIVFGETMRPRWQVQLDEVQRVITTSSHVDKNAMASATAAVTAT
                     SPVTPSVSGGGGGIATPTTMSAGMLPSFSSGAAGAGGNGHSGGATGGAAADAGNASAY
                     TSPVFPTTGGAFSTNNVHSPFSGNGQYSRPFLMEFPSLMKHLLRVCVALSSNGGVNDG
                     LDIFFTRIYSYLELLSSRTAPAIVSRMMNAAASGASTMTGAAAVVGTGGLASTLSGQL
                     GGSVGGGGAAPSIGASVAPSGRPPLPLYGERVQSDGDLSCTTADSGSAMAPAAASTPL
                     HQGSSSSLAPLTRGGTNLGRPLRSGLPRASSSGHLPRQASGRGGGNAVAMSLLTGASA
                     TNLRTGVGGSGGVDEGMAASAPFSYAVSTVVNTSLLQPASILLPLTAAIAAHNSPASG
                     GVASSPLQSALGSRGCASEDEPTDGDADAGSGHGEGAARPTAGGSSPNSSGALSPLTA
                     QPLPASTSSLPSQVSGMVLKVIDKRYLRELCMLLTALPCAWRQLTVLTRDDHMATDKS
                     VSDMMMALKAITQVLMASDDFD"
     gene            <434825..>439522
                     /locus_tag="LMJF_33_0950"
                     /db_xref="GeneID:5654506"
     mRNA            <434825..>439522
                     /locus_tag="LMJF_33_0950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685800.1"
                     /db_xref="GeneID:5654506"
     CDS             434825..439522
                     /locus_tag="LMJF_33_0950"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685852.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654506"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q4Q496"
                     /translation="MRAFQVPPLGADDQLLKAASSERPGSGTADGVVAPLKTHRSANE
                     LSAIVADLHRTSHSAHPPDQKRTGDPTGAHSPAEGKQQMHARAPAPPHSSSRLALRSL
                     SQEEFVHAIQTAVPSATLPEIQALLSKTISETQDTVSWNELTAFLVTRSRQKADLALE
                     NQRFVLGGPPCGMRFDDQHSSSITCVAVEPVRRLLVTGCSEGSVRAWSSGSDLAYRGL
                     LLQVDKWIVGLHWGCNKRVLYVVTMDRWVYILDGTTYEVLRVYHGRGITQSTVSMTYA
                     NETIDTVHVGGVALSKFAASSARRYGSARLIPQGIGSPDKSRTPPSSRPLTSRAGAME
                     SHEERTRRLLFSAMHVCRAVRPASKETDAAEHPHRNCSPQTGDATAAAGASASPPSQS
                     RTEASSPLPTSTLTTMYSLTTADAAEVLHQNNTPLTGAGRGPYVHQQLDECVLTALID
                     PVTATAFHESAFQEDVLLLGTSAGDVFLFELAQHHHLNANRVLVARHVFRQLHRGRIT
                     KLDLLLPLHALVSSGDDGHVRVMSLVTGEPLRTFYAADLPEQHASVTDFDLHPQLKML
                     LTVGPERRALVWEWTQPSPIALLDPANSPCCCGAFIGDRVLTISRDGVLHVYDCKGFH
                     LQQEVSLATAGSLDRFGSAVGATHSAISQVHVDEARQWLLCFGHFPFSLRVKWQVSSG
                     FPERYRGHHVPILTTLSSRAFRQVVTVGTDGVVMTWTPRTGANEFSFPLSNFSNMATA
                     SVPLRPTAVSMDLLQRRLLTGFADGIMVVWNILNGQVERVLTAAAATALPSRSSSPAA
                     SRGTTRKRVKPISGHGRSTARASVERAVATATAVALTSPSRDVTAVGSFLRHRSVSYI
                     FALGSRVYVDAAVESSGAAERCSGPQLGEYSTTPASSWTVPGAFGDVATLVQLGMQLV
                     GCATASGAVLVYNVLFDRQEGAPLWVHESLLSPTWATGSVLSPTSTVNAACDFASVGS
                     SSTLLWRNGTVSTAGQQMNGSGVLAGTHSQRTCPGAATLFLESLANRARAAGAAQAAG
                     ADPVAGAAATTGAVVSRVSCLMMLPAVHPRLLFVGQEDGTVSFWHTLRRVCLGAVSLT
                     TAAGVEDGRQGEGTEWGGGEAVVGMDMEETDGQMLVFGDGEGKVHVCRLKWKMLADLH
                     EQTAALAMPNLALYCRTPTPRKEQLPAVAASTASSAEDATASERALPALQELERVHVF
                     SSGLKLSGVRLVHADEETAVFRAAVPLPKTKTGAEDVGTAPEEGGGRDAPSSSPGTPR
                     DTDRPRLLIICTGMDHFVRVFTLAGVPIGELGMDEWDTARPSTFRFMGEPTVPLPCSL
                     AGNFTWQQDGHDKIKRSGCYHDYLADLYATHHARPAMLTGPTKGLACSGNVPPGSSAA
                     LRRTMGGTVYLGCPDIPPSRATVRASLVARPSPAPDAPHPVDRVRSAAGVDKRQSHGH
                     SKVVGFTKNVETGTRAAPEVFSEDGRSLLPPQLSPDQRRPASQGFHARLRQNMLHLCE
                     KDRPLHGVLKHSYVRQLQNLHRQGHPSSLSSFQQPLAALPELPSILPSTSATPSAAAS
                     EHSESAGQSQAAE"
     gene            <443335..>444579
                     /locus_tag="LMJF_33_0960"
                     /db_xref="GeneID:5654507"
     mRNA            <443335..>444579
                     /locus_tag="LMJF_33_0960"
                     /product="putative nicotinate phosphoribosyltransferase"
                     /transcript_id="XM_001685801.1"
                     /db_xref="GeneID:5654507"
     CDS             443335..444579
                     /locus_tag="LMJF_33_0960"
                     /EC_number="6.3.4.21"
                     /codon_start=1
                     /product="putative nicotinate phosphoribosyltransferase"
                     /protein_id="XP_001685853.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654507"
                     /db_xref="GOA:Q4Q495"
                     /db_xref="InterPro:IPR002638"
                     /db_xref="InterPro:IPR006406"
                     /db_xref="InterPro:IPR007229"
                     /db_xref="UniProtKB/TrEMBL:Q4Q495"
                     /translation="MAHSNEFAPIIKSFLDTDAYKLHMQQAVFHQNPTVTAAYKLSCR
                     DKDVHLGIYADRVYAHVQQMAHVRLTEEECAYLATLPYFKEDYLEYLRGYRYKSEQVQ
                     IRTVLPTMACEKNEFGEDGSDLEVTVEGPWVETILWEIPLLAIVSEVTQRSRHSRVGP
                     AEALANLHEKLDLFFANHTEEELATFKVAEFGTRRRCSQAVQEVVVRALKEDARFGPR
                     LVGTSNYDLARRLGLPPVGTQAHEWFQAFQQLSSELRRSQIMAMDHWLQEYPQCLGIA
                     LTDCITMDAFLKDFDARLANAYQGLRQDSGVPTEWGQKALNHYKLLGIDPRTKTLVFS
                     DGLDLEKAAELYNGFKEDINVLCGIGTQLTCSIKGVRSINIVMKMVRCQGRPVAKLSD
                     SPGKIMCDDLEYVEKLKEAFNV"
     gene            <448813..>450606
                     /locus_tag="LMJF_33_0970"
                     /db_xref="GeneID:5654508"
     mRNA            <448813..>450606
                     /locus_tag="LMJF_33_0970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685802.1"
                     /db_xref="GeneID:5654508"
     CDS             448813..450606
                     /locus_tag="LMJF_33_0970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685854.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654508"
                     /db_xref="UniProtKB/TrEMBL:Q4Q494"
                     /translation="MSNRYEDAVLRGTALLLLDLPPALRNAAQPLQKLFDTHYPDNGI
                     TRILLNTPPIRSTSGANVMECGAVFFSSSKALWTILDQVRVLLRTEDGVLELRRGYLT
                     LGVHEVLVEGVVTWGAEGRQRPTSVPKAATPTLAPAVAPCAEDAKSTAMPGSAPTAAP
                     KPVSVPATTSATASEAVRAPRNDEAHSSRGETVGGVDSCGEICQTVVVTFLFRELYNR
                     HRDNREDCAHGRRGGVAASFPLSPFMVYQMLVGECQPRKIVVIECQRAAAKREWRALV
                     ELENADVAAQVIRVFTRRAVEFMSESNAYKVPERSRKPPEKGPLPICAEVRYYVSCSY
                     SVRKGQSRFLPNGTRNYHRTVAVRPFCKTELDLTDPQNLARLQVRAPREWKHDPHAIR
                     PASIRDSESPNRADVYEEEGRPNESASPAVPSKRRRLPSPRDSQRRSRRSPSYARSRS
                     ASRSSSRSYSPASSSSSERYRRYHGRRVDRRHGDERWHEARAAAPREHQYTEAAGPVA
                     AFAPETAVRVEAQSTAAAMHAQTQLQQKTHVMCKPASATPALPAVAYDSHGPLPVGWR
                     PIFSQEYQQTYYAYRDPNTGVETTTWERPAT"
     gene            <454417..>454911
                     /locus_tag="LMJF_33_0980"
                     /db_xref="GeneID:5654509"
     mRNA            <454417..>454911
                     /locus_tag="LMJF_33_0980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685803.1"
                     /db_xref="GeneID:5654509"
     CDS             454417..454911
                     /locus_tag="LMJF_33_0980"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685855.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654509"
                     /db_xref="GOA:Q4Q493"
                     /db_xref="InterPro:IPR001232"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="InterPro:IPR016072"
                     /db_xref="UniProtKB/TrEMBL:Q4Q493"
                     /translation="MAQVQPLAQTMHSPSRPSPLPTLPPTEVEVPFPYFTGDILERVC
                     RHMSYRFRMSSFGSEDGCYRVYVMKTRTIPRPMTLPLVEYLDAKDRAFIADWDELITV
                     QILKAATLLNYEELLQLASAKLASYLIERDLEGVRTLLGVKGDFDLTEDAELKKEQMV
                     DYLR"
     gene            <456409..>456837
                     /locus_tag="LMJF_33_0990"
                     /db_xref="GeneID:5654510"
     mRNA            <456409..>456837
                     /locus_tag="LMJF_33_0990"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685804.1"
                     /db_xref="GeneID:5654510"
     CDS             456409..456837
                     /locus_tag="LMJF_33_0990"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685856.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.0990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.0990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654510"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:Q4Q492"
                     /translation="MASLKERDTVAPAEIVAGVTASGPAGISAEELHKVLNSSEHASV
                     VVVDVRNADEYASFHIPGSINKPFQELNFAQLADEVAAHTNHAAHMLVFVSAQSPDVD
                     DLAAREYINEYEKSHAATPTKDSVRVLLGGLYTWSQIYSA"
     gene            <459993..>463091
                     /locus_tag="LMJF_33_1000"
                     /db_xref="GeneID:5654511"
     mRNA            <459993..>463091
                     /locus_tag="LMJF_33_1000"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685805.1"
                     /db_xref="GeneID:5654511"
     CDS             459993..463091
                     /locus_tag="LMJF_33_1000"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685857.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654511"
                     /db_xref="GOA:Q4Q491"
                     /db_xref="InterPro:IPR007130"
                     /db_xref="UniProtKB/TrEMBL:Q4Q491"
                     /translation="MEKQRQQLLQTSSQPGAAADAQSTAPTSSGVTSAWDQKQLSADD
                     NIRLVFLFTLAVPTFAFWYCNLRTMEPRALLWIYRHCRGTDGTAAVDVNSQTLLPVPL
                     AELMLGFGCVALVGYARFVYLDHRDKDVSLKRHNKRWIDRAINWFKFCVYRRYVDCQC
                     RLWKRYFSLQLVPAYGPLPLFLFPDEAGAGERGQSAESGHTSTRAFGVVSTTRDNPFV
                     ISAATASTYDVPAPTDTPFTAVTSLERHEAPLSLESQTPVSTGGTALGSASATTPHKC
                     GDDDSGDDWDEEERKLLRRRHRGASATPTRPPSKQRCDARGQPGDLHARQPSVSLSSS
                     KVLQECSQLPPPPKPPAMRRAHYFFAAHPHGILPWCCCVNMISNVTHRDEKLFLDNRG
                     TILHPRDASNTSVLSELGQQSSSSLPRAANTFTTSSTRAIFPISGLTTLGPSASPTTV
                     AAEGLTGADSAGSGVAYAKGRYYVYDPFFKKFVLRRDKDEAVPATPADAEVYRRRLRT
                     AQARRDAAALKKEAGVGAAATRHSASRRQVKIRIRAVVATFPFYVPLMREVYMFHGYM
                     DASYETCKRVLLYNNSTRREREGLPPISPASSRQAEFATGARDCGIGDGDASDDGYDE
                     SAYSDDLNHLLLFPGGASEALLSSAHGPARLLLRRRKGFLRLAIHTQSGLVPVYTFGE
                     TDYFEQRSSATTQHVTPVDDDEGSMYMSRQGSEADALLRPDSAGGDGEAPQTAPDVSL
                     LSQEEQQMHRHPPENGPNAGQHGDGTSALGPTDRRGDNISSTGTRPRNTVRPPCQLPP
                     TGSTLTSPTLSPIASALLHPAAALGTAYQHESWKDRERRLLREEGEARGRSGRSPTPL
                     HVQALSLEKRHESGDSAASLRELEAAPMTSLETSLSAKSQGGLPSVSDQVAQKHAAKT
                     EGKVAAASSPPTVSRLSRFIEVVQRLFQDTFGLSLPIIKNIIPHRVTGATVVGRPIYF
                     ELPPELQRMYTDPANYFEKEKDQEVLRAAQEVYFHELQELFLKYAPQYLKDPGRRKLE
                     II"
     gene            <466389..>469973
                     /locus_tag="LMJF_33_1010"
                     /db_xref="GeneID:5654512"
     mRNA            <466389..>469973
                     /locus_tag="LMJF_33_1010"
                     /product="putative calcium-transporting ATPase"
                     /transcript_id="XM_001685806.1"
                     /db_xref="GeneID:5654512"
     CDS             466389..469973
                     /locus_tag="LMJF_33_1010"
                     /EC_number="3.6.3.8"
                     /codon_start=1
                     /product="putative calcium-transporting ATPase"
                     /protein_id="XP_001685858.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654512"
                     /db_xref="GOA:Q4Q490"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR006068"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023298"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:Q4Q490"
                     /translation="MVGHKRIDILTNDHKGPGGLLYELNVRCSPAGSPAVNMCSAEER
                     SAAVQRRELGIVAHSVPERQTRYGANVLSQPPKESVWHFVKSSIEDDRVVQILTGAAL
                     VSMILGITTPDFRTGEVDLAMGWVEGAAIFASVFIVTFVNAVNDYRKQEQFAEVMRAE
                     NAARRRVTVWRYAPLSSTDGCGGGSSVTGTDGLACVALEVPSSDIVVGDVVQVSAGMQ
                     LTFDAVLLGSLGPILADESSVTGENDDVLKQALTDPFLISGSSLLDGSAEGVALVCAV
                     GPNSFSGEIAMSIQSTEKANTPLQDQLEAMAEVIGKFGIGAALFTFAALLIKEVFMYL
                     VHSSPLYAMKFFENLTTAIAIVVVAVPEGLPLSVTISLAYSMRLMLKDGNLVRHLAAC
                     ETMGGATVLCTDKTGTLTAPTMQVKQIFLSAVTYAVEDAGTVVGGDLSTFGDEESPAA
                     LPTRSIRTHTFVPPPPPCGFGQSPLSRAPPSKAITVPLPPSSVQLFLDCIVANAIDPE
                     VGRATNKTSEALLWLCHLMHCSSSHATQHDVQSFRNTQACMLTAMQDPSRCRRYPFSS
                     HSKMSLCMLRQLAGPAGAGNGGGRTRLYAAGAAEVILARCTSYINDKGVPVPLTSEMR
                     AFHEQALTRYTESGLRTICCAFSDAHGAAEAKLWNQQLQHGAGAAYDGELCMIGMVGL
                     EEDVRPEVPGAVSQCFGAGLRVIMITGDATLTAINIACRCGLIRGGSSSGALRGPPLP
                     DGNRTLRNPEAPSWSTTATLANGNDNGFSPTESSDAAIFVNTSLLHYENSGAASDVEG
                     QFLDGAFGRTAWMMQEPTANASPQQLIDSGYALDGETFRQLSDTELLQQYLPQIRILA
                     RATPMDKKRLLSLLRRIDPSAVIAMTGDGTNDAPALKLSDVGFAMNGGSDVAKRASDI
                     ILLNDNFIGMVKATMWGRNVKDNIRKFLQFQLTVNFSACVVSFCGAIMSEQNMSPLKP
                     VQLLWLNLIMDTLAALALATELPCEPMLLSRPPESKDTAIIVPSMWFQIGFQSTFQVM
                     CQLLLLGYGNVLLSARGHTKPLPPSGESPRDPRYFSDAHICFLFNAFVWMQIFNFFNA
                     RLLHRGEGFFSNWADSVVLFVIVGIIVVLQIIIVEFGGKIMSTVPLTAHEWFYSVLIA
                     SGTLPVGAVSRLIYARYSKRVLPRDGCSRGLLLRLRRSVKSGRLKGKR"
     gene            <478349..>481081
                     /locus_tag="LMJF_33_1020"
                     /db_xref="GeneID:5654513"
     mRNA            <478349..>481081
                     /locus_tag="LMJF_33_1020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685807.1"
                     /db_xref="GeneID:5654513"
     CDS             478349..481081
                     /locus_tag="LMJF_33_1020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685859.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654513"
                     /db_xref="InterPro:IPR007557"
                     /db_xref="UniProtKB/TrEMBL:Q4Q489"
                     /translation="MAGAHCASYDGQGAATTPSGRDEDAHSSSNYAQRGDHVARASSS
                     SVSRAGQGSLSSRRSRHTFSRSSHNPYVLLSSSDVNRPEQEASAMENSSRAVRRRRSS
                     YSYSNNTSQNALMFEFNSASTSTSTPTPVDFGSSNLADSGTIRRYPSQQLQQQQPVDS
                     PSTRLWRDGNRMTLSTTDARPISTTVGTLTCSDKEQNFNVNVKQRVRPGTNSASCSLN
                     TSSTIMPVVQSVSPTPNSASAMAHNVSSIPQATLPVSLGATSNASRFATSGGSASEDH
                     SSCGPSSQQLDHRYVDVAASTPSTADGIELTGQRRSEPEVSPYIPCHYPPKTLYYQHP
                     QQQQQQQHAQQQQPYGYGVQARPYPLQQQHQQAYVYGGYPSHNYPAISPQPGYYTQIT
                     APPKQQQYYAPPAPNSNMAVLGSAADGAPSPTFAEVAYASMPQPAQAPYMASAGTIMG
                     PYSYLPTPPMAHYAGVALGSFADVQSTAPRQSSGNATAQVQYTQALAVVAAGPTPAAA
                     ASALGKPTKAKSQHADPPQQHHQGAKKVAAPASVSSLASTLDTAPRAGTQSASTVTRT
                     PPAPRPVSSSSKKLPKKQDDVRFHVNRDAPVRLFVVVKRKREGQRYACALPPEEVPVG
                     SHMLVEGDRGADIGEVIRHVSIEQMARDCAIVERLRQRAVERMLGGKEGIVANAHDDA
                     ANAELDETDLPHLTGEAALEYVMSLKTWPWLIGPTTAEDMASLGPQLEAEKQAYAIAK
                     PIVQQFIENRYQQRAARNEAALAAAAATAEASKTADTAAAAAEKAGECSADHASTDDG
                     DRHRNLTPLSVEELEMLELSREVTLLDCEYQFTREKITLYVSRPSRNIFVDFRSMQRK
                     LFRTFRCRIWIAYMDEVTHDKDAPESFVFVPYSSMPAAATAPTRGDAKGTKDVV"
     gene            <483946..>485418
                     /locus_tag="LMJF_33_1030"
                     /db_xref="GeneID:5654514"
     mRNA            <483946..>485418
                     /locus_tag="LMJF_33_1030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685808.2"
                     /db_xref="GeneID:5654514"
     CDS             483946..485418
                     /locus_tag="LMJF_33_1030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685860.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654514"
                     /db_xref="GOA:Q4Q488"
                     /db_xref="InterPro:IPR002088"
                     /db_xref="UniProtKB/TrEMBL:Q4Q488"
                     /translation="MHDQKKKEKQVLSPEAKEAAAQENERVGALYKSVLASSKAHEYN
                     STTLANTEALLLAVPEAYTVYNYRRLALEAVASMQPCVDSSGSVAETSSNAAEVAPAL
                     RRRQCLVQELKLNSKVLLLNYKNYNAFLHRHWIFHQLEALTKLEMQQATAHAAGAAVN
                     DTATGTYELLCSLLRKERAQCEQLLQMDERNFHAWNYRRWVLEQELRATQLAAVHCPA
                     HSPFASAEDATQPSTSTTPSSAFFSPEETAALAYTTHKIKRNFSNYSAWHQHSLAIKS
                     AVERWQRQQQLQGVVSTTGDAQQHQQAWRAALLAQLREDIEFLKQAVYCDPNDQSAWF
                     YAPFVFQLMRRQYCYEDEDGDAAALEESFMNAVIELVADVDRVSTEDECYMPHYFLLD
                     QLVTLQAASQGTALPTTTASAVPGTRSSASLRRHITTLCGKVPSLLVSANGEVAGDGD
                     VMNARRRCFRYLHKHLWQVDTLRRCLYDDLFQRALEGCHS"
     gene            <486101..>486634
                     /locus_tag="LMJF_33_1035"
                     /db_xref="GeneID:5654515"
     mRNA            <486101..>486634
                     /locus_tag="LMJF_33_1035"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685809.1"
                     /db_xref="GeneID:5654515"
     CDS             486101..486634
                     /locus_tag="LMJF_33_1035"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685861.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1035"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1035"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654515"
                     /db_xref="UniProtKB/TrEMBL:Q4Q487"
                     /translation="MGCSASKSKEVKPSGGPGASSATASNAIGACANGTYAQKPATEA
                     AAADTAQPSQNGTTLSANKSPSNHSVEAPTGRAADASRDNKNTNGDSTEAPDKGPRQN
                     GAGLSSGDLDENGNAVLLPKGVWVKTEGTPYYYCAEENLYFHPPSCQFYDPTNEMWYD
                     PEKDEWYRDDGSDAEAA"
     gene            <490410..>491762
                     /locus_tag="LMJF_33_1040"
                     /db_xref="GeneID:5654516"
     mRNA            <490410..>491762
                     /locus_tag="LMJF_33_1040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685810.1"
                     /db_xref="GeneID:5654516"
     CDS             490410..491762
                     /locus_tag="LMJF_33_1040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685862.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654516"
                     /db_xref="UniProtKB/TrEMBL:Q4Q486"
                     /translation="MDGGDPAFYEDAVLHYDEEEVKDSAPQATLKLLGDFPEPLTETQ
                     RRAVQRHVSQKVREYEAVRYQVAVVEQGYLALLRLVKRLRREAADLTASLAEGRNKAE
                     APDSTAAASVPRVRTTLPAAPTAAEKPTATVAAAEASAASATKEGATAPKRRPGGLLL
                     RSSVFSGLQRVLQAAKTEQLDEKAEQLARQRERIARESRLHLVSQDLETQEALLMPLQ
                     SKYARAVALGAAAAEEVTPLLTLLEEMWRLEALYPSRFSMAARGTLQPLLGNDTYAEG
                     EADKAEEEAVVSTDDGVGRRAAHSAAAVPFLVPFTPAQYTADMEDLVRAQVEVVIDEY
                     LAYRTRMDPVLYQLEQSQQLAKAKKVDQLMDAIGIAGAETGTEVLPIGGAATVLQDER
                     AGVSVKTLQHMMDISSDDEDDDQAEAGVAMGSDAADVDRHDREQIQTALTALDDFEDA
                     "
     gene            <492356..>493642
                     /locus_tag="LMJF_33_1050"
                     /db_xref="GeneID:5654517"
     mRNA            <492356..>493642
                     /locus_tag="LMJF_33_1050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685811.2"
                     /db_xref="GeneID:5654517"
     CDS             492356..493642
                     /locus_tag="LMJF_33_1050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685863.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654517"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q4Q485"
                     /translation="MIPRNVPYEHSPPPRDNIVTVVMPGVISCRSMLSRYTGGDPLTV
                     LCNWSDVNPTDPLYIADVGKNRFTGIPLARRLRYALLQWWRVVMSGKSNRPDSDDEDD
                     LAEARQQTSPDLALAGGSDRRQRTRGDEERNAAATVQAAELGLIDPPVLYRARCRIAP
                     RLLHGVLVSPEVAEVRHRGWYRTLNPLHWGLVVKELLACWWFSVRPFHWCYSEPGRTN
                     IAGMRDQAAFTREVRRGVRHIKVATAAETHGDQAGVEARENTSMRSNKKHLVLFGLSR
                     GATTCFYSAMKLSPEEAKHVSLVLVEAPFDTLDHVIDASCWIPRLMRWFVRSFADWRG
                     TREEKLAYDFDPKEVHLRCPIAFVMSVKDKRVPNECTQALIDRVRRELVPHVIPAVEV
                     LVLQHSGHGTMAVGNKEDQGAYVAFVERLYDTYCSS"
     gene            <495584..>498457
                     /locus_tag="LMJF_33_1060"
                     /db_xref="GeneID:5654518"
     mRNA            <495584..>498457
                     /locus_tag="LMJF_33_1060"
                     /product="putative chloride channel protein"
                     /transcript_id="XM_001685812.2"
                     /db_xref="GeneID:5654518"
     CDS             495584..498457
                     /locus_tag="LMJF_33_1060"
                     /codon_start=1
                     /product="putative chloride channel protein"
                     /protein_id="XP_001685864.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654518"
                     /db_xref="GOA:Q4Q484"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR001807"
                     /db_xref="InterPro:IPR014743"
                     /db_xref="UniProtKB/TrEMBL:Q4Q484"
                     /translation="MTRYESVDTYEADSMLYKDHLETRSHEPRWFMWVFVVVLGVVTS
                     ALSVGMMTLLHVLNSVRYELFGFGLRGFTFADAQRYPNVSEASPAHVTGSGGRGTART
                     TSSLDVWAMLRGYSVGLYGIASPRWYWSGYLLWVAFAVCTSAIASGMCYLVPQSVGSG
                     IPEVRAFLNGVSYPMMRSTRVLVAKTVAVVFTVASGVCTDHYSHLMLAGAMLGSQLLQ
                     RRHGIRCYHVHFVDYFRNPRDHRTVLVIGAAAGIAAAFCVSVGGLLVILELVSAVFPV
                     RFALYVFAACLLSTLSTQMYWSYCMNFDSPYRLHGGLLLREVVLFRSHLPFGQHAAMN
                     LMAYIPAFVIGLCSGACAVGFVRLSWVALYCRRLLEVRLRTKVIRYVLPILFTLVYVS
                     VHYWVAVAFSAESGPGDTMPSAVGADSNAQRSGSADPLASSSSSDGADVGPPAVCRPV
                     PYTVRSGRNVTTIGFYGMNGFLCPAGSYRVVDAVDIYNAAEHSNRVSSVTKTLPRRQQ
                     TVRVVDAYASLAFSYADSTLQTLLSQRTEYLLPWPALLTFSVIYFFASAVYSGLALCG
                     DIILPSLVIGAAIGRCIGAAVHSVAVAHSKDAATWADPGVFALFGAGSFVSATSGLSF
                     SIGAILIECTADFRHLLPLMFSIAVARRVLLRWGRDVHTVYLEARAVPLLNAEPYLER
                     YSLLSARHVMHSPVVTLPVVCTLDDVVRTLCSTPHHGFPVVSINGRTFKGIVTRAQLK
                     LLLWHIIMTDGRTNHCTYDVMQRVEDHVFHSGWEGVDPTQLLRRERLPTDQISLYPYV
                     DTSAFTVLDTAALPRTYEMFTTLGLRHLVVVDRSNCAVGMITRKDLVSDNLSAVLESQ
                     GAPAPANGVPPSVVLAAALACLRKPFHPTPAQVAEVAQQSSTRNLDVSSPLRRHHYGQ
                     DRESEPSSHAPPPLHSREASFAQVVRRVSLLRVPSPFPPSTGN"
     gene            <499298..>500029
                     /locus_tag="LMJF_33_1070"
                     /db_xref="GeneID:5654519"
     mRNA            <499298..>500029
                     /locus_tag="LMJF_33_1070"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685813.2"
                     /db_xref="GeneID:5654519"
     CDS             499298..500029
                     /locus_tag="LMJF_33_1070"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685865.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654519"
                     /db_xref="UniProtKB/TrEMBL:Q4Q483"
                     /translation="MSRVSNKISGGRACQTVVDHGYYLKPMTGNPYLCTQHDGVTTAY
                     LQGFAPKDAHWLYRFRYNLLPQGMSGGFFSRNPYGRYVHWLEVSTIEKMRLQMLTLES
                     VPCSVVSVILLVFTMWHSYRLAFLHPDITLYNLGLWPTKPWVQQQRFNKKKEFDQDVY
                     RWVYRAPEVMIDDPIRDIYKMGIAANDPVLAMAKEQGVASQLTMTQAEYTSAAPDIRR
                     VIANARKDIEHSSQSSSATSAMVGV"
     gene            <502432..>503769
                     /locus_tag="LMJF_33_1080"
                     /db_xref="GeneID:5654520"
     mRNA            <502432..>503769
                     /locus_tag="LMJF_33_1080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685814.2"
                     /db_xref="GeneID:5654520"
     CDS             502432..503769
                     /locus_tag="LMJF_33_1080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685866.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654520"
                     /db_xref="GOA:Q4Q482"
                     /db_xref="InterPro:IPR005033"
                     /db_xref="UniProtKB/TrEMBL:Q4Q482"
                     /translation="MSAESQRVVYGAKLDIPYAIGSVSVPLDALGASSPSRVGAQEVR
                     GAGPSPSPSRRRGVSSGSISSVRRCTHHRYCYVRDGSELLQDAFYRWLEQQRQEHREG
                     THASSTGGPPNEAPGGPLTPATDSASATNAPSSAPPDTPSSPSLFYASVKCVVFVLPN
                     SFPRPRRVLRRPPFIIEDDTWAEHVVEVQLHFWPHLKIPPATVVHQALLERRVLTAPP
                     PYHSGAVSPAAPTEDLREVWVPQLLASTYGKPKLLAVATNVAVPAPARRAIAPAPDTA
                     KAASRVVVVAEKVDTLHLYHPSLDVIRHIRAVLALSRMPILEAVRDAFDATYSTPPST
                     NADGSSPGARSPTPTDTAATSRVVEDSSLVTPFAHSWSLPFEDIIAEYAEQRASTSVA
                     VLQAVLEKLKRERQEMEKSCERSMEEIAELATVVLPTQLERVHTRCMKLHKKE"
     gene            <506559..>507170
                     /locus_tag="LMJF_33_1090"
                     /db_xref="GeneID:5654521"
     mRNA            <506559..>507170
                     /locus_tag="LMJF_33_1090"
                     /product="putative guanylate kinase"
                     /transcript_id="XM_001685815.1"
                     /db_xref="GeneID:5654521"
     CDS             506559..507170
                     /locus_tag="LMJF_33_1090"
                     /EC_number="2.7.4.8"
                     /codon_start=1
                     /product="putative guanylate kinase"
                     /protein_id="XP_001685867.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654521"
                     /db_xref="GOA:Q4Q481"
                     /db_xref="InterPro:IPR008144"
                     /db_xref="InterPro:IPR008145"
                     /db_xref="InterPro:IPR017665"
                     /db_xref="InterPro:IPR020590"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q481"
                     /translation="MSKPLNALVVCGPSGVGKGTLLGRLLREYPNRFAYSVSHTTRQP
                     RQGEVNGREYHFTDRESILKMRDNNEFLELCDVHGNFYGTSVAAVHAVQKEGKVCVIE
                     IDVKGAQKLFSRTDNALNAVYFFITAPREELRKRIMKRGADDETMLQRRLETAESEYK
                     FVDENPDFFSVLLVNDELEAAYAGLLAAIDDQLVKHNMEKLAA"
     gene            <510195..>513077
                     /locus_tag="LMJF_33_1100"
                     /db_xref="GeneID:5654522"
     mRNA            <510195..>513077
                     /locus_tag="LMJF_33_1100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685816.2"
                     /db_xref="GeneID:5654522"
     CDS             510195..513077
                     /locus_tag="LMJF_33_1100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685868.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654522"
                     /db_xref="GOA:Q4Q480"
                     /db_xref="InterPro:IPR011124"
                     /db_xref="UniProtKB/TrEMBL:Q4Q480"
                     /translation="MKSASPSADRSPAASPSNASTPAVAGSAAGTSRPSASQEIQTEP
                     RYIRLPDALYALRRRYPSVTESVFLECTRCHQWVAVRVLREIPNEITSAVVPCSALGL
                     DSISVRTGCSGPLRHAHQDALRRREELANDAAAPQWRSRRLQEKHSHLASGDANHNGE
                     AHGDVSRAGTATPQQAFFKSVLHHLRRSRRPSQEGAEDSVTAASESARERSRRHTPLY
                     IPNPDTFICAGWQCTWDADALADLRRDWLQSIYRALPMPPVCEDGMGLSSDASSSSPS
                     LPSSPAVSSVMALRQRKAALNETLALELDVGRSRRWGRGVGQRAGRDEHNLESQDSLP
                     ALSLPGRAAESDTELSRLQGSWVRAAALHLLRNSSSAAEGCSVTPVAEEDEEAETPHH
                     RHSSVEEDSQENVLSAYCWAVCDACGKLRRIAQPFPGGAPFVCAMAVTTSSSCRAARG
                     SNAPHREATSGLDQACTVSEVEGLLQCNMKLCEAELIYAALSSPFLPYPLRAQLSALG
                     RRQTCFKDSSEPAKRLSRADVSRVLLSEPLLRTIQSSVRESVTREALHPTACQRRRGS
                     GATATATPAPVKPHRKASASELDYADAELAETEFFLYRSLPILRELARSIKARSISAF
                     VRQLQLTPAQIQAKREAVMLASFLSNHQHTPTTGRDSGTEKRKPAVVIATTSEAERTR
                     AKVKVEEGDMSSTEPAERLPPRPTRTRTRAPPAVPETAPAPAVVKEHMKVQAASGSDI
                     ATPQPVGEPTPARTRRKPLQEAAPRASEHQEGLSYEAAPQQPALGAPRKRGRPPRQGP
                     GEPSRPVVPGSQATTEATGVGTGVDTASLRRRRQRCENAPVKEAKTAKSSAATAGKAE
                     TVGEVASSPASPSRGRPHERPPGSGSARRKRSQGAHDEDAEAKAGDGNKWEVVHWVQC
                     DLCSKWRIVPHRVPAKIKFWECKMRYDEQRGRTTTCNDPDDAELAS"
     gene            <514532..>516808
                     /locus_tag="LMJF_33_1110"
                     /db_xref="GeneID:5654523"
     mRNA            <514532..>516808
                     /locus_tag="LMJF_33_1110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685817.1"
                     /db_xref="GeneID:5654523"
     CDS             514532..516808
                     /locus_tag="LMJF_33_1110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685869.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654523"
                     /db_xref="UniProtKB/TrEMBL:Q4Q479"
                     /translation="MCFACSRCEYPICDSSTLLLRKVRQGPSEYAFHYNLDGLLDLEE
                     VQVPCYSAAEVVHTSAVVSESLMKFPMPPAALVVALESIVQSRKHWIQQRQSMNARLH
                     ERGVAALPATSAEASIAAVTSGTASSVEGTLSTPADVSRGADAAPVAATTTAASNAPI
                     VRRYGDTAESRIDLVCVKDSVLAGGVQECTKDRSAVATTVVSPEGQGAEDGAESAAHR
                     EDGVVRSALATAPAVIRDASFANIQADVMKAATAAAAETSWTSPGNFRLREAFIDVSR
                     TTLSSRAPWFQDYKCVSRVQCPDCHQPLGFVFCVSDSNKQQQQRSSSEAAGPLEATLQ
                     TQGVKRPATSEADETGSIDDTATPPDAVAVQHSSAGPATAPVTEVTQLPHAKKTRNEK
                     DAQAAASASTRHTWQEARLHRQRNGAEECQGKSGNEAEDREDGVQGGADEADDDDAEA
                     APDRFVGLELKRIVQRQWTLSVFHERYSKSRQLQTFRELFPEAEELQSLYSRLLGLRT
                     QTELYSSLLRRHKEQNDVQMALLMSNKDRMHTYDEKVKTMQQIIEAQRAQIAMQTRQI
                     RNQEELVQSHRRQFATQKRQMDVEQLLLVQQSKTIESQKEQLRLLKNHFQATRPEVLL
                     DARLRGSPCPPPLLSRGLPSGTGGIEPSQAVQAAQSLRQLSARGRYREEAEHDWTDAE
                     EGEEEGGGEGDGRIRKTVAPSASLSVAPLETPPAHLCGVPTSSASRHGVTPSENDQTL
                     AHTSLPLSSFGSERGKTT"
     gene            <517795..>518796
                     /locus_tag="LMJF_33_1120"
                     /db_xref="GeneID:5654524"
     mRNA            <517795..>518796
                     /locus_tag="LMJF_33_1120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685818.1"
                     /db_xref="GeneID:5654524"
     CDS             517795..518796
                     /locus_tag="LMJF_33_1120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685870.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654524"
                     /db_xref="UniProtKB/TrEMBL:Q4Q478"
                     /translation="MSTPGTNSSASAKASSPIVHRDGRAASAGNSKPLPTNDPPQQPA
                     ALGSVSPLPPKLSTAAAAATTTSAPASPSPEVDNLECQSKDFLIRRVQALERQLKIRN
                     SDCARLLEERQQLLPLKEKCESQREMILALRDQLNLAQAQRESAIDALEEMKRQQRDK
                     EHRERVTHAERVIHGASAAPKATAGGTSGPETSVSPAGKAVPSSKPASALRANNPPRR
                     APGGTVVNTSSGPQIIYDSSDISTVGFTKNAKLPYDFLGGPGAQLQYLAPSRGSAGKE
                     AGEQLEGGFDASDDAQVRRTMAAAAEAIELDAKHAEMEEKEHRALLERLKALREGHK"
     gene            <521850..>523892
                     /locus_tag="LMJF_33_1130"
                     /db_xref="GeneID:5654525"
     mRNA            <521850..>523892
                     /locus_tag="LMJF_33_1130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685819.1"
                     /db_xref="GeneID:5654525"
     CDS             521850..523892
                     /locus_tag="LMJF_33_1130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685871.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654525"
                     /db_xref="UniProtKB/TrEMBL:Q4Q477"
                     /translation="MRRYRSWSAAPLLSALLMVALYSFALHSAAARTRESQLYCLPAE
                     TEPHGLIRCVIQVRNGYQQPTTNFNPSDFIALTRTSNATAVVTKSALVRGSDNTTVVF
                     TMSVSTAADVLIRVYLREKDAVGGNSGMGEVRGSGITVSVLSWPTSRLGPITCTAQET
                     GLALRSSTICRAALYDESSAPSVVHSADVLFSEASGLGNFVFTSGIKELVFSFTAPPT
                     APALVSTFTLTVSLHSKDADVNGGGAQAAQIPILYPGDVALSETTGLQCAAESRPISC
                     FITASGAQGPVTFNATHFRLRVERSVGAVAAAADTLGSLTTNGLGAVIRHWVDVTDTF
                     SLSVARSPLRPYVGVVSWEPKSQDSLYEARLRVFASTDGQEVGAASGDSAAITGNAAD
                     VAGSPYFFTTGMLPTALSVTLRGCRESVIASGNTTVCFIDLANGVSGDTTLYAITTSD
                     RESSVSNVTYVAHDSVCACRSLWFIYHAPTALISPVDDYIEVSMYTDVERSVSGMVMA
                     NNVPLRLGVLPVVSRSGHDTSQAPTDAVLISVGILFYGSVLAVGGVLIVRRSRKAASI
                     RHKRALKERAMMQAMDRRQGVPTPGTEILRDSPSALAGTPAMTQTPDGAAAGHVFLVR
                     GCAGSNTSGYDTIDMLGVGAGGAGGGGSRSTSPPLVPAAVVSNVAVLQDTFHSDSD"
     gene            <528588..>529886
                     /locus_tag="LMJF_33_1140"
                     /db_xref="GeneID:5654526"
     mRNA            <528588..>529886
                     /locus_tag="LMJF_33_1140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685820.1"
                     /db_xref="GeneID:5654526"
     CDS             528588..529886
                     /locus_tag="LMJF_33_1140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685872.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654526"
                     /db_xref="UniProtKB/TrEMBL:Q4Q476"
                     /translation="MVVAANPAVGAAPAVTGATCAVNSDGWCSNSTLKFEGTDLASVK
                     AIRIGSTAAEEKQITCADKFAATADTVSCTVAMASSAKAGLYPVTLVLGDQTQVEAGS
                     VLLGALWELPSMQTWTSTTASAPHKVTGQSSDWPSTGDAWSISGTFDPANHYSVLFYN
                     IEAEAAAGNPSQITCALLTVTASKLTCTIVAANGVMGMYRFLVKDTTKGTLLLGSTSL
                     GAIAVNPPLPAVTGAQGECATNSAACVNGAALTISGTNFNYRDHAYQQFFVGVTEAQR
                     SAIRLTPTAVSMTDLTANLAVAHGTPAGSYPVFVKVQVCMMHMMSPPRYVGNLVLQSG
                     SIAGFNMEMPTGYSSETQGAAGGRCGVMSAGYIAVTILAVVFGVMFLILLVALTLVCL
                     RKAERHRHLPEGNRFWDVMASDVPAVASERKDFDSDCVVR"
     gene            <531867..>534419
                     /gene="PUF6"
                     /locus_tag="LMJF_33_1150"
                     /db_xref="GeneID:5654527"
     mRNA            <531867..>534419
                     /gene="PUF6"
                     /locus_tag="LMJF_33_1150"
                     /product="putative pumilio protein 6"
                     /transcript_id="XM_001685821.1"
                     /db_xref="GeneID:5654527"
     CDS             531867..534419
                     /gene="PUF6"
                     /locus_tag="LMJF_33_1150"
                     /codon_start=1
                     /product="putative pumilio protein 6"
                     /protein_id="XP_001685873.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654527"
                     /db_xref="GOA:Q4Q475"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q475"
                     /translation="MYSEQSWNDHHSVSGAQRFARGGGIGNINPSGRSGAGGYDVGSA
                     AAAGGYSNVAAARQQSPQPTSFYPPVTSRFTPMDFELFINSNRDPTDEMRRSQEYYYW
                     YHSKQPRDPRVPQPLPSLEVQETFTTMETPWEDVSAMPSSTAVRAGAASGLGRKMGGK
                     SLALDAKDLCETQEAQAINPYGHSLITESNMMSPSTQFFAAYAPTPLAMATPSTLRAY
                     AHGHLPMPSSGNRGSYEGEMAGGVTYGRGTGPTAKSIASQQYYTQEPMNTFGIYNTGV
                     DPGSNYYDATQGSSSNGLGAGHGNPYQLMEGMGEVDPAMLYSQPGTDCGFQSRGTGRG
                     GNRRYNNNNSAGGGVGGGRVGRNNYRGGRGAGGMGSMESGSGPNSHRFVGSEKLRMFR
                     HDVAEQKTLQWRLEDLKGYAVEFAKDQEGSRFIQSAVDTASPESLDVLFHEIFESPLE
                     LVTDIFGNYVLQKLLDKGNTPQLTFAAERMCGHVVELTMQTYGCRVIQKCIEVMPAAG
                     LDILLAELKDNVAKCIQDQNGNHVIQKCVEVIPQRCGFIISAFSGRVMELATHAYGCR
                     VIQCIMQHCPEQEDTIFNELLKAVDVLAKDQYGNYVIQHVLQNVKDESKIESVYAALK
                     PKFFYLSKQKFASNVMEKLYARSSPANRMEIVEMMCADFPSKADHVEIVAFKRSATKT
                     AAIVNAEEGTWPPTRSNADGTVKEVKEKNREAKDAAMGIIEEVVSVGLGQPSMLCLMM
                     SDQYANYVVQRVLDASEVDQFVKLVDNIEKYILPIRTYTYGRPIVQRLSRRKLVLAPG
                     DEVGEAGSTSMGSHNHNEGRVNHNEGRANHNEGRSNHEGRSNHEGRANHHRR"
     gene            <543108..>543551
                     /locus_tag="LMJF_33_1160"
                     /db_xref="GeneID:5654528"
     mRNA            <543108..>543551
                     /locus_tag="LMJF_33_1160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685822.1"
                     /db_xref="GeneID:5654528"
     CDS             543108..543551
                     /locus_tag="LMJF_33_1160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685874.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654528"
                     /db_xref="UniProtKB/TrEMBL:Q4Q474"
                     /translation="MFAGRSLLLSQNRLGCHRAALLGGAAANLRVSTRLSAASAATNR
                     GQSGALTVSKRQYLGSTVIPNFITHCTQIGACASLSTILYSPIGTAMTIVLAYNVIVI
                     CSKHVNYSLDITAKDYVQDQQLLTIMRYGILSCILLGMEVMFIEI"
     gene            <545615..>549931
                     /locus_tag="LMJF_33_1170"
                     /db_xref="GeneID:5654529"
     mRNA            <545615..>549931
                     /locus_tag="LMJF_33_1170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685823.1"
                     /db_xref="GeneID:5654529"
     CDS             545615..549931
                     /locus_tag="LMJF_33_1170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685875.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654529"
                     /db_xref="UniProtKB/TrEMBL:Q4Q473"
                     /translation="MLHLSHPFLSPVLLSLCTGRLLSAVHHVAQHHPRAYIARTDRLD
                     SVRAMSPEDYEESGVASDRERDASDDFEGDDEESASDSAEELKTRSLHPSDKEVVEED
                     EEEDYDALDDAPTPKPLPKTISLMLPRKASAGAVCEPTRVHVCLTRGMIGRPLERGAH
                     TKRSDSNGEDEKGAVSPLTPRAAAAGRGGADDADDADDEAEDEVSSAAATLQGCCADH
                     HHYETDYAAPLAALRRRLILRHLHSDQKSLQRFLLSERARDKRALQSPHGDAADGEGE
                     GSDGSGEAEEDNSTHPLETVVWPWTAVQKPPPYWLPALLSNDIHAFQRVLQIMYGWII
                     APDPHPSDQLQLDAAGQLCTATPDTKAARDDEDAEDSEKADFSLASDAFASAGSEEKS
                     TDSANRESPAPARCTSKSLLGAFNECEADEEQRHSDKESPNQQPDLASQDSSSCSRAM
                     QSITTAPPPVAALPYFPFAEYEFYIVFDEASEEWHLLDTHPLFVMEACRRRRAEQMSH
                     EGGQPEAETGDGTGLGSDEETASEAESEEEEGEEKVKDSCHVPRYALDTIVPVSPVIL
                     AALFSPAALRYCLLQPLQAEPRNEDDSDEAEDHDVDNNAAAAASLRSVSPHAVLRTFD
                     HAWLSVDMTVALPILATICRARQRVLQQDALRIPYALGNLWIDVNPLYALPAFADVVN
                     AAGVDEVRLWRAPPGQHPEDDDDGDSDSGKVSVSGSAMRAAELCSPHRWGTALDSIAD
                     PGHYGRLVLNALLDAGLLPTRPVELAIFHHLSLLRLALWWWMRLPPKLIQKWGVAAAA
                     DGHVADDSADNNAGSAEMSDEEAEDEGVTDEELNEMTVNDVTELLLQRVENMNDRDAR
                     SRRLRLRKWHPTVVFAPLLQRVLLELQRRLDRMSAVDARRVPLAPSQYTLQESVARTY
                     VAEQLESGHLHQDPLVTAAFVGLAGRTPAAAREASTAPVAVGSAHAAAVRHQRLYQSD
                     LVLLLLALTTTPAPLPSLTATILDFDDRFTSVVEENACAAGEENVKEAPSDDVDAHTA
                     LFSHLLEVKSMRFVRRPQDRTRAGTTKLLLLCAVDFCRGATRQRVFAHVPPFELFGST
                     GYCPLSDLVQAWSCNCRTDRNGNRAKKVATVQLFAYYTWNEIRWRLRKGQYSEAAVVK
                     MRAQLPELFELIDSHSSTYDAILARLDAEAAADSKADGGGGDGSTSALGTESRTPSAG
                     ASLRASGKTNYDAASSPAAAAQPQRHPLISTEVLHAIRAEERGEADLSPTSDSLPLTL
                     AYPNAYSADVLESKARVNALWQSFAVSSHTYMTAETLHTLLFGANAHHSGDAAGVAVG
                     AAGGARRFHTAALRVMFENGITSVQACPLDGPETPAIEEALQRADLPAVKILLGLGAA
                     SLRDTYRNGSATLQSCAEKLFNPAEMDVLRFVACKNKQVTRSDPRLHFGARRFGSAAT
                     NS"
     gene            <551555..>552298
                     /locus_tag="LMJF_33_1180"
                     /db_xref="GeneID:5654530"
     mRNA            <551555..>552298
                     /locus_tag="LMJF_33_1180"
                     /product="putative 33 kDa inner dynein arm light
                     chain,axonemal"
                     /transcript_id="XM_001685824.1"
                     /db_xref="GeneID:5654530"
     CDS             551555..552298
                     /locus_tag="LMJF_33_1180"
                     /codon_start=1
                     /product="putative 33 kDa inner dynein arm light
                     chain,axonemal"
                     /protein_id="XP_001685876.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654530"
                     /db_xref="InterPro:IPR019347"
                     /db_xref="UniProtKB/TrEMBL:Q4Q472"
                     /translation="MNMSHLMRHIQDTGALLDTLFPIQQQSAAAVPPSCTVSPSGVSG
                     DSEAAQEDAEQLVSVQTVSAAPAFREDVVALHATLQKRLEERRARPTGLCPIRRALYV
                     DLFSELVRQITVEEPARGLLLARVREEAEHALQVHAALLREGQRFAAGKLMQDKHDAL
                     VLKERIAALRQEKVALEVQKHELLETLKEMEQRFEEERQLRRKQQQDEVKYLRHANHQ
                     LSLRLKMETERESAAAEVEGSSEAAPATS"
     gene            <553665..>556319
                     /locus_tag="LMJF_33_1190"
                     /db_xref="GeneID:5654531"
     mRNA            <553665..>556319
                     /locus_tag="LMJF_33_1190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685825.1"
                     /db_xref="GeneID:5654531"
     CDS             553665..556319
                     /locus_tag="LMJF_33_1190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685877.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654531"
                     /db_xref="UniProtKB/TrEMBL:Q4Q471"
                     /translation="MPGSGSVARYPLVRVRGGAAMLFAALISSLPPPAQVALRRVLLV
                     IPVMAVAKVQRAAVLMFVRRVLLPLLTDAFPAVCGALEGVKLNSSSATLIAALSHAVT
                     AYSLTEKLMKADRAASLAFTTGTTACLFNEEEHLRLLLGAVVDAEAPSLPSALLSAPR
                     PALTAGAPRMCSAFFSTTTPVALKAYLRHVHARPRASHVTIFVPGLLTAPWTTHLIPL
                     LRDLFCRQGTAIVGYDICADAEHYDVDLRHLRDRIRQEPRSTAESSALPPVSSAASPF
                     GVLVLASIRGRRFRNGDKACVFAKMHGWQVVELCLPTLPLDAVHELNPQRRPQWLSAR
                     QVQRATSSVRPDVRLTAFDDAGMYGGAVVELCSDDNALLLHMKRQCQPGLVERPVDGA
                     AGQAKARNFPRPAAAVTPRKLPSSAVSATLGAASGASEFITKVWCPWARRLCAAVWRE
                     ASMLHPGAVTAQEAVAALRRFPLQTSPKVPPRAQAQLRRLLSPRRGGVSTTDNDSAPG
                     DASRHVSANTPVEQRTTYIKTPLAAVSLFAEPQPHAASPVDVGSDRGDKGSLTVAKTT
                     SPARAAAAALMAPEEALTNWAVERRIRLRWSSLLMSLTFAAGGAPRVASDAAAAVGTS
                     AAYLSLWSFVAQLPPWVVTVSAADDGETARGERRSSCCVEAFATALLVRVASPRAVAK
                     LLRDEALVDAAAVRPRAWDSLATTPNSTVEEALTFEDAVVFPGCDQATRLSEELLYLP
                     LSPELPVSARAAMLRVLWDKVPHAGDAASASVRSSWLERRKATGALSAHVQATVNSIY
                     QMHLPQAQRRLDGKALSPAASAGNTLPNGIARGHSGGTVVSAQDAEKVQQFLFDVVPA
                     SSVTPSLSAGAALKSLAQTLIPAVMSNL"
     gene            <557084..>559051
                     /locus_tag="LMJF_33_1200"
                     /db_xref="GeneID:5654532"
     mRNA            <557084..>559051
                     /locus_tag="LMJF_33_1200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685826.1"
                     /db_xref="GeneID:5654532"
     CDS             557084..559051
                     /locus_tag="LMJF_33_1200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685878.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654532"
                     /db_xref="GOA:Q4Q470"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q470"
                     /translation="MDSYTDLLNLNFMYSLRTGDLLTDMMIAALLPLVSSAIVYLTRT
                     WWPQLVNRALSYLSKVDSTSATFKMPENGSGLYYGYTLRVALSTYVTKVLKPRFDIAE
                     LRYLSIPGKELQDAANYTEALRDYCFVNASPAKELPMRLTEHLELRQTVTRNDDGGRN
                     KDAGRHGRSGGSQAPEESQFIITQYRHSFPALMKFLRLAHKSTTEDSEKSEVAAQLER
                     DANADGDAIQSLLERSLEHYRLEYKEITARTDRYLYQPLLTRRELRFGPDSAERGHTE
                     GAMECNRYLLHSGKTFQSLFFPAKPRLIQLIDDFEKKTGKYAIPGYPQKLVLLLYGPP
                     GTGKTSLAKAVAAYTKRDLFAISLSRIRSDEELMKCMFSGRFKVSDKRDGDKVNYDDC
                     SCDSELLDPAKLVYILEDVDATTAIVLKDEAEEVETGGEAQNQRERRGEGGSAAAPPS
                     SDSTSSDGESEEENDMTENESGDGAVDESHDAGRDATNEVSSEVLTQREVVKVKSKRQ
                     TIDRTLTIDGLANALNGVLDFPQRIVIMTTNHIERLHPSLLRPGVVTMKLHMHNFDVA
                     CALDMVRHYFSHTTLLPGQLEELRSLLEAASAKASKVDTTASISDEAADSSALAAKGF
                     SPAELEQHCAECDTIEELLEVLRQGSRVNIF"
     gene            <560238..>561278
                     /locus_tag="LMJF_33_1210"
                     /db_xref="GeneID:5654533"
     mRNA            <560238..>561278
                     /locus_tag="LMJF_33_1210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685827.1"
                     /db_xref="GeneID:5654533"
     CDS             560238..561278
                     /locus_tag="LMJF_33_1210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685879.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654533"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="UniProtKB/TrEMBL:Q4Q469"
                     /translation="MSNTTSWQKAMIFASKGRMVGYRLTLEHYNTVLYSQSMWGRALE
                     MIKVIRAMQQDGVQPNGATYYYIVNGMANAEHGYNYDFNINHRLEKLQHWRVALNALQ
                     ACEANGFDSTDTMHNSVIVTMTIPGMNHWREALQVLKKIIDEDRQLHPNMVRFLHDCL
                     IRNYRPREASDLLRCAAERGVKGYETAWETDVYKGKPTDAQLEASQAEAAVTDAAGTE
                     CVAGSSGALSSSTSDCKKAAHNSAQASAAATLMALQLRGDQTLPPPQMRSALQEEMER
                     SITAERQALRPFTAGLHYTEMRSVFRPRVHRQLWYQWHQIANRYRPTASLKRRQLAPR
                     DSPTGIPAWNRL"
     gene            <562526..>564880
                     /locus_tag="LMJF_33_1220"
                     /db_xref="GeneID:5654534"
     mRNA            <562526..>564880
                     /locus_tag="LMJF_33_1220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685828.1"
                     /db_xref="GeneID:5654534"
     CDS             562526..564880
                     /locus_tag="LMJF_33_1220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685880.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654534"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="UniProtKB/TrEMBL:Q4Q468"
                     /translation="MSTWASRLSSSKSVSPTSGTANRGAATLRDFSSVSDTASPTSMV
                     SGGGAGADVGAGSRNAAALLREEFRAVAEVYNEQNVCLLHLPPDCWDMTAKYLSYMDV
                     IALGQACRFLWKVLHKLDSLWRRQLSYFYNDMRDLRGGKLLCTAPLFPEPPCSRSTSH
                     QGSMGALTGSARGQEWPRKAWHQPYMSAYERFFQERRVYVLDSHREWHFQELADVEDK
                     STGMFTVALHDGRVEAVTAAASPLSADPFSFSGAWSASPIFANAVDSTREWLLAAPSS
                     PASFAASQPPASPAQTPTPLHARTTSTQTNGTSIGSSPALAPAAAPSTPPLLPRVGEP
                     IINERNPLLRLRVYTIEPVETEENRDDEAAEVAADASRIDEERHRSHVSLASSISASL
                     SGMTEEQVIEYVMRLSLAEAQQTTSRSSPSAPATEAPSNAKPAATDPVGSATQQQPKL
                     YRHRHYRGANPAASLPLSELLAILDAFTNNASDQLQYHHVRNCTEDEDPAFLQRLSET
                     LRSAKHRRLHLGNHHRAVRNNGQTTRNRAGRSAGAGSADAPSLSLSAAGTATPPQQPP
                     PMNRMLRGFHGDLLEITEREAQLVAGTLLGMPRAIDEFVAFRCYDPALLYHRLHPSST
                     AIDRVDTRGTPREARGEAPWLKDNSVLSDSVSHISRQTTQVGSSEPTYQSVETPAAIP
                     PLTTRTPPLRPLPFFTRFFLAPELCHDGYIALIVVDVVRALVIVEKEVVTTDNPDWAS
                     PLIARGGRVVVHGQGYNAQAYTRDEYNYVPLNPTRRRRNSDSGE"
     gene            <565959..>567824
                     /locus_tag="LMJF_33_1230"
                     /db_xref="GeneID:5654535"
     mRNA            <565959..>567824
                     /locus_tag="LMJF_33_1230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685829.1"
                     /db_xref="GeneID:5654535"
     CDS             565959..567824
                     /locus_tag="LMJF_33_1230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685881.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654535"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q4Q467"
                     /translation="MPAMARLRAVSPSVKTREATAVYSETKCFHTEGAVVAMATSRNS
                     TMWLAMQDGRVEVRDVHTGQVVHTFAVAGVRQRRNKVWCMLSVYDVVHQEAQLWMGLS
                     SGAIEVYTENYQLRRQLSKHLSGVYCLTQYRGDVAYAGSSDFTITQWRVADGRLLRVL
                     TGHSNYVRCLYAEGNALVSGSDDSTVRVWDTASGASLQQYSHLHRESGGVSVLCRVGT
                     AMWSGDQSGVIAVWRLKDGEVLLVCRQVQGRVMSLRKVGARVYAGSAEGCIYVFNAGD
                     CTLVNRLDDHVGSSISAIACAVEVNRYFVWSGSADNTIQCWHHDEHQPMTAEREGALD
                     MRWYYTTQLPYLQANEALLEQQRELAELLVLSSGTEDAVLRFLGSLGEGRETAAARYW
                     LLDGKVKQMQKRYDTTEEASRAIDAAVERKTHTLEMLRRQLARLTEALSSARQPPPVP
                     APGAAAPSAVPGGASVPAPPTATEPPAVLAGVAPHLVTVLPPPDASALSTSSPLGAAV
                     PPRPSTFVSALPCASPPPPLQTTVAAAPLPPPPPKVPAPERTSPALCSVTEAQVTLSR
                     SYEPVLSSLPPPPKAAVPPPPVAAVPPPPPTRGVGTLGELPAKTTAPPPTRRMSF"
     gene            <568819..>571389
                     /locus_tag="LMJF_33_1240"
                     /db_xref="GeneID:5654536"
     mRNA            <568819..>571389
                     /locus_tag="LMJF_33_1240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685830.1"
                     /db_xref="GeneID:5654536"
     CDS             568819..571389
                     /locus_tag="LMJF_33_1240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685882.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654536"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q4Q466"
                     /translation="MPSQQKRSVASELLVNDRILVVPAPPLSIATVGDVVWITFSDGE
                     VEVRNRRTGEVVRRFEPALSAVPASDPTDLAAVGFLSSVTNRMSAVGVGGATDASSPL
                     KRHSHKDTATTLTVHSTAVVRALLAVPTADGETHVWMGLSNGCIEVHDGETFPSRSGE
                     TAVGASNRPSTGSLIFLLRKHTAAVTSLAEFGGYVYSGSEDHQILQWRACQYMYARFF
                     RSHCPHDGPVRCLYAEGNALVSGSDDCTVKVWDIGEGDMRLTGYFHSHSDGVLALCRV
                     GELMWSGDASGQVVRWHLRTCEAVSIHAPHSGRVLSLCRVGHRVYSGSSDGTMGIFDA
                     ASGQLLQRITDQALGWVTAVECPAKLSRFVVWSCSADGAVRCWYQDEYASMSADEARF
                     DDGSWYDSGSTPYREFRASVGQRTQRLKQQLEAIEHRDNQAMALLRHCSTVFGGSVSE
                     REMQQRRLQDQLAQLGERCRVAEERLATKRSNIAQVDRDIAAALALLQNTRCELNLLI
                     PGEAERVLSSMPAVTTEDLVAYTPTPALAMLGTNATAPSITTTTTDGFPTVAPPPLSS
                     LSHPLPPPTVTVPGSAVAASALPLPPAAITSTLGVGGPLSGVPLPLPPPVAAVPRLES
                     DGIAVPAPGSAIALQQQPSVPTAGASVPALTSGIVPAVGTATTVAGASTGMGAAGTGV
                     GVGASMGAAGVGAAGAGLGAGVGAAGTGTGVGVGAGVGAAGTGAGVGAGSTGAGSAPA
                     GVGADAAAAEKSAGPSLYPDDGFRWTNPHVGNYIQRRYYGASPSLRTTDLMKRERRRG
                     RLPRVKVEALQRDRSRSRSSPTALEAKSRSASDKAKRATTTTKTATTVVKTSSTKAAA
                     "
     gene            <572261..>573481
                     /locus_tag="LMJF_33_1245"
                     /db_xref="GeneID:5654537"
     mRNA            <572261..>573481
                     /locus_tag="LMJF_33_1245"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685831.1"
                     /db_xref="GeneID:5654537"
     CDS             572261..573481
                     /locus_tag="LMJF_33_1245"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685883.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1245"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1245"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654537"
                     /db_xref="UniProtKB/TrEMBL:Q4Q465"
                     /translation="MSSTFAPPPPPAGVVVPPPPPAMIPVPPAAVPANPSTASGAEGN
                     VVKPGGVALDMSNHFGPPKNVPKKSLPPWERKKLSTPLSGSSPRADNSTPPPGPVAAT
                     SKPLSPVAVPLPHTVANAPAVVTRKSLSTASLTTSPQPCASPSCTSAMSSAATAATGV
                     SSPPVISIPPPPPPVHPVVQAVSSSAATTASPLPLVSSSAAPPPRPTPDAQEPLPAPA
                     SATAGVPTLPLPSPGVNQAATVAAAAIHQGTAQPTLPTSSPAAIAATDHIVQEAMREL
                     RPPLLSPMLTVLAPHVVFQGDEQQWVVPPLGPVPSSKRKKVLSAAVASAGSWHNSYDL
                     KPSPSFDAAQHDGSEPLVTPAATSSTRRQWTSNAVINSAKAKSNWRETYWKHVDVHRY
                     VARRYFGAPPPLEQ"
     gene            <574299..>575294
                     /locus_tag="LMJF_33_1250"
                     /db_xref="GeneID:5654538"
     mRNA            <574299..>575294
                     /locus_tag="LMJF_33_1250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685832.1"
                     /db_xref="GeneID:5654538"
     CDS             574299..575294
                     /locus_tag="LMJF_33_1250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685884.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654538"
                     /db_xref="UniProtKB/TrEMBL:Q4Q464"
                     /translation="MRATRSVRAVHAFVRMPHHRSVPPTGPSGILVNRDVLFRQFRDF
                     YRTIQHSTLVDKVHLMAERPGVESLRVADQMTSLGPVLLGMPLTGMEHRSSEFLETMR
                     YVRGAGGPTTVSAYLQDNDACRCHSGDIVCLPQGIAVGHGPRTNAAAHQVLRELFGSG
                     EAADGGIDGGDGPAVTSPGHASKFEVVTLEQEGDAPPLGDYFGFAGNNTLLVWKDEHG
                     LLAVDQLQQQLAQSELQLQVLYLEPGCHFFTFYGVDYTPDVLVQKGFERSMDTIAAAG
                     LNPIAVQWSEMDKLGISMRSAVLPLKFLQSPSSTGGLLQRSRNRGNRWAASQITS"
     gene            <576434..>579454
                     /locus_tag="LMJF_33_1260"
                     /db_xref="GeneID:5654539"
     mRNA            <576434..>579454
                     /locus_tag="LMJF_33_1260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685833.2"
                     /db_xref="GeneID:5654539"
     CDS             576434..579454
                     /locus_tag="LMJF_33_1260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685885.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654539"
                     /db_xref="UniProtKB/TrEMBL:Q4Q463"
                     /translation="MDITPSSSCALRKRLLGLFGVYSTAVSNGDGVCEVAEVRRLEAT
                     RYHACLNALARLSSFRKLFAGSEDDMAIRAAATQLQSRPIQDILWRAAVRRDANCARQ
                     QQQQRLNPLEVERTAAPWPSSDDYADADFLGEACYSPSAFGHGIHSTPSKDAGAAGDA
                     RGSISWNALHSVLVLYLYDHQCFHNSFLAQEVDALRRDSDGGVMMHTNPDRVCAKEKQ
                     IDVAAMTPPVRRKAAYANSATRVAAVQAAERRPCGATKSAAPSSWNANPPPSLQDTLL
                     RQPNMEIAMDVQIGEEDAGRSLEPVYTLPCPPRMGVRRAPPGAPSLCSPVPTRHTACA
                     ASNSRCTVDSGVDPTKRSPPPRRKHTQREAAEFLYQQRHIGAVTDVEVVSGGQSAFHR
                     AASVSVSSLSPSWSPPSGKSAVVPKRIAAVTRRQWSASPSPRRPASAAVVFGDEHIAA
                     SPTPHVACVLRLCPQSPSQQNAMAGQPREYHHRKHRASRAGAAVPTLVTVKKNARAQR
                     LYMTRQPQPANPADATPELTTREGGTGVDATKQKMCLLVPQPLASRPVLAEAWPGRRE
                     YSCDLKVPPTTRHEGCFCEAEESASLLDIKLQRARTGERSDSGRHAQGRRTTSFAVGA
                     PRGASAEASNRDGSMRPDWVRWTSPAKPPLSPGTPTALLRASVLPSRASSAAPVDVEG
                     AASNQENQPPPTKTSRRRHALYQLEQPFPFTTGEPFAPRPLHEERHTGAAAAPAMVIP
                     VHHATAPSPTPTPREDETDAWQHSAVHREASAVAPPPPLHHFTTQQVPKQRPRQPSQQ
                     LIGMPRLLFSPSDALSLATNRSSRVSSTEQQQKDRKLVPASTPTNPAAPALSPLFCET
                     THRPFASAHEMGSTVMEETCTPTRRWSPGQQSLTCRTPTSVVSPMNRQPPAPLSPASA
                     KAQQQQPDGRSPPPRLSSRAKAQSITRGSCTLQTPPRVPSTRVLLSPSGSLQVTTPPS
                     LSPPPHVAAAGATRRLLRQVGGGDSEGGVVGQRS"
     gene            <580210..>581202
                     /locus_tag="LMJF_33_1270"
                     /db_xref="GeneID:5654540"
     mRNA            <580210..>581202
                     /locus_tag="LMJF_33_1270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685834.1"
                     /db_xref="GeneID:5654540"
     CDS             580210..581202
                     /locus_tag="LMJF_33_1270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685886.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654540"
                     /db_xref="UniProtKB/TrEMBL:Q4Q462"
                     /translation="MQIAPRTSAPVVHRFGLLRQAPLIAIRQHTSLWRFAASTASVGT
                     LLLSHSSSGGGSAVACSCPSFQRAHIRTVVPPRPAVTTLVYLDHSGRAVRTGVETDLS
                     FIRTRDNKFYLQRVLPNGEVVRWLAPGLDYLKNVTNFETYALNEVDENGGVVIPADVM
                     PTAAHDAPSFRDAIFYITKLEATSKFTRKDRRRWHRRLFAHWKESPEKYLNHTLGAYG
                     ITFLVALWVCVRGFHSIKNQKPFWDINVYGRTDEERERTDPWLRLKRFSERHPEHEGM
                     DMTVTMLSPGQSRLSSARSELRESDFTDPHYHSEFWWKVRHCYYYGHWPKGMAE"
     gene            <581835..>582338
                     /locus_tag="LMJF_33_1280"
                     /db_xref="GeneID:5654541"
     mRNA            <581835..>582338
                     /locus_tag="LMJF_33_1280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685835.1"
                     /db_xref="GeneID:5654541"
     CDS             581835..582338
                     /locus_tag="LMJF_33_1280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685887.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654541"
                     /db_xref="GOA:Q4Q461"
                     /db_xref="InterPro:IPR005746"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="UniProtKB/TrEMBL:Q4Q461"
                     /translation="MSMTQNIVRRIFGDRKLPESLSNEEYDKYMQDNFPKWMKEFEDG
                     GFLEKTKLPPIKSEEEFIAKLQEHKDELMVIKYWKHGCIPCLTFAEMYKEAAERCTKE
                     KKKIVWYSVDTKALSTRQLIDYQLISGTPTIQTFTGQKQVGNEIRAVNTEELLTELDK
                     RVPKSPS"
     gene            <584466..>586241
                     /locus_tag="LMJF_33_1290"
                     /db_xref="GeneID:5654542"
     mRNA            <584466..>586241
                     /locus_tag="LMJF_33_1290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685836.1"
                     /db_xref="GeneID:5654542"
     CDS             584466..586241
                     /locus_tag="LMJF_33_1290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685888.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654542"
                     /db_xref="GOA:Q4Q460"
                     /db_xref="InterPro:IPR000576"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q4Q460"
                     /translation="MPLPQPLRGRREEDETSSDNLSVASGGSCTFIPFAMVEPTTTDK
                     SIRAPILNSANRSCVEVNFNSAMFSNINFAGDNSKTAASVGLGRLTEVADASGSASAT
                     PAAAAATTATVNMMPAIIGCFSFTFGTGICSFYSRIFQAKGFSAYEIGILVSANPLLS
                     MTLLPGLSYLADKFRCQTTMSLVSIFISTVSMFGYTISEGRVLTIVFFLVMTASRVVI
                     GPLLDQRILMMFPRQVRSSAWSHVRSYAAYGWGIGSFVASLIFSYTGNWVAVTIQYLL
                     GQAGLAYCMVVIKPYERIERVPVKFVEVLKLLGSNKRLMLFLFASTMMGTGYSFIDNF
                     LFLLLGELGGSEVLMGLTVILTVSTEIPLFQRSAQLHQMLTERQMMTIAMSLWAFRVM
                     CYTMLTKAWMVLLIEPLHGVTFALMWLPSVHVISRAFPPKLSSSATGLLFTFTSGVGP
                     MIGNLLAGTLYTLIGPRKMFFCAAVTMTTAMIFFQTLDRILELRGMPMVYEPEAEGDA
                     ASDLAFAANKDQVETQQARKEIASVSTNELKSSGSRRNAAARSTIAQRIKLKGTDEGR
                     QRTIDVAESELPSSLHSCVEGTKGV"
     gene            <590507..>592444
                     /locus_tag="LMJF_33_1300"
                     /db_xref="GeneID:5654543"
     mRNA            <590507..>592444
                     /locus_tag="LMJF_33_1300"
                     /product="putative ABC transporter"
                     /transcript_id="XM_001685837.1"
                     /db_xref="GeneID:5654543"
     CDS             590507..592444
                     /locus_tag="LMJF_33_1300"
                     /codon_start=1
                     /product="putative ABC transporter"
                     /protein_id="XP_001685889.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654543"
                     /db_xref="GOA:Q4Q459"
                     /db_xref="InterPro:IPR004147"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4Q459"
                     /translation="MALLSSKAARKWGRRCLYATGILGVGYVGADYVTDNSLTRSLRT
                     LLAFGIIVYTYKLTTPTTPEELSSMHSRVARIILDTCLKNEGLYIKIGQGLNSMSHVL
                     PREYTEVLKVLLDRAPPVPIAEIRKIIRAETGKEIEELFVRFDETPVASASIAQVHQA
                     WLPPPADGASAEPQRVAVKVRKPCISTQSVWDLCIYSTIMTLLKLLFDLPTDWSRKTV
                     CDALVREMDFTLEASNAKRFRRAFRDNPRLYIPRVHDAYTSKQLLVLEWIEGTKLNDV
                     ESIRAQYNEKRVLTTLFDAVGDMVFKHGFVHADPHAANVLVRPLPKANPAPETAGTDM
                     AAATTTTTTTAARDSSDYQVVLIDFGLVTPERVRFRYQYALLFVSLFTHDKESLRRVV
                     HDWGINDAEMFASIQAQKPFEAIQAGSYDEVTRDEVIAMQTKAHERVKEILRDTRRIP
                     KELIMVGRSLDILRSVNRLYGSPVNRMNMFVQSAVECLGPLRNYDAVDAYLKRMQKIM
                     EARGCLTTVAMDCYQEYESVYDASADTVREEQEAAAAQIAAEDAQRGLHHPLQGPASE
                     VYAWLDAVYRALLLHSLLFLLNAVHVITYTYNSLIATFLSAAAQKKLRIASLEDRRDP
                     LLGQQWSIEGKEMAEAVLAAG"
     gene            <594314..>594955
                     /locus_tag="LMJF_33_1305"
                     /db_xref="GeneID:5654544"
     mRNA            <594314..>594955
                     /locus_tag="LMJF_33_1305"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685838.1"
                     /db_xref="GeneID:5654544"
     CDS             594314..594955
                     /locus_tag="LMJF_33_1305"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685890.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1305"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1305"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654544"
                     /db_xref="UniProtKB/TrEMBL:Q4Q458"
                     /translation="MSGIIHKESLPGQSVIKRRRIDTQATTEPRKESEHGDGNEKHVG
                     DVLKGVAGENDAISSTVAQSGPCSSAAKSSVKAALARSSSSSGSSSDDEDDGDQIERE
                     NARLAKLREQRSRRQQEQRSAGVASSASSAQLSANTPGGVDTTSSPSASKAQEGAVHT
                     NSYDHDVLFRNRAWCHPSKSATAAEKQQKKWDSVLNRTQDSVAFGHFMKNFFK"
     gene            <596276..>598288
                     /locus_tag="LMJF_33_1310"
                     /db_xref="GeneID:5654545"
     mRNA            <596276..>598288
                     /locus_tag="LMJF_33_1310"
                     /product="putative expression-site associated gene
                     (ESAG3)"
                     /transcript_id="XM_001685839.1"
                     /db_xref="GeneID:5654545"
     CDS             596276..598288
                     /locus_tag="LMJF_33_1310"
                     /codon_start=1
                     /product="putative expression-site associated gene
                     (ESAG3)"
                     /protein_id="XP_001685891.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654545"
                     /db_xref="UniProtKB/TrEMBL:Q4Q457"
                     /translation="MVKPTSFHTLIRRHGPLTGSSHGKRHSGKHGAWFPHAQCPFRPL
                     LHGLTHNRGLVPLAIALTVVLLVASTELLWPRRYARLRDGRNLSIPYRSKAAAYRQSA
                     VFVAPLPRGSENVVPGTDGETVPVAVHSRSRRQTALEAEIEAYLESHGIHRERRTRVR
                     FHTFSNFVDWRLCTTLGSAALAGFSVPVTGFNDTYSHIRRFERYLDFVEREGLHDEDI
                     VVTLDSDVFWTGVDFLPFLEKFARFSPEKESDLDVAAVRAWEDYGEKKAPLYMQHLQA
                     EMRNGSAHGKRPLLQMPPVVYNADDLCWWGQHSEGFVQCPLAFATLDHMIEVARNHVS
                     SMDLSKVGSQVLVCGDKLRAQLKNLFTGKQRWMVDDLLRHPNAASPYITQAKRSCDDP
                     LFYNTTIVHKSNPTVLLNGGMHVSRVWALRWVAKAVATYMRTETPVPEAEDHRTSQWW
                     CDQALLGQMYVRARLYEIEHNLLAGPPLSMRTPPVAYDDRYGPPGLVGLDRRSQMVVL
                     APTIERNPNLFHHGGYLERQFPGSNRWWIWNKTELLLGENEPQGVSLGNLQTTRGGVL
                     VTPPLLWRSATAEDRSRGFQNEAEEDPDVVRVPFIHYAAPSKHKRFTAQRNYYAWMVA
                     ARHDRRARESVTSALGKELVELWFNEERVFVNFTRMCEDPTVLSPP"
     gene            <599494..>600291
                     /locus_tag="LMJF_33_1320"
                     /db_xref="GeneID:5654546"
     mRNA            <599494..>600291
                     /locus_tag="LMJF_33_1320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685840.1"
                     /db_xref="GeneID:5654546"
     CDS             599494..600291
                     /locus_tag="LMJF_33_1320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685892.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654546"
                     /db_xref="UniProtKB/TrEMBL:Q4Q456"
                     /translation="MSVEEPQPSSPVAVNDDAEDVVEAELVAYDAHHTHLVEGDFFPA
                     EAPEVEADGAVADATEEVDALVDAIAAEAAAVAAVSVVSTPPKPAEVPSRKRVCWADE
                     GHPDTARGLVKHVTNFYMPNTFSRGSRYDAADQSSPTRQTNATAVNPTPPLFREKVNS
                     DATTYKFCKAQRPALQYAEWRRQQHEYGVTPFELQPVEAGELTSSASVATRTLFGELF
                     QRSVVARVAEGQVRIRNGTHHNSQDNGFQQPFVRIDATFDEPLPIPL"
     gene            complement(600641..600713)
                     /locus_tag="LMJF_33_TRNApseudo_01"
                     /db_xref="GeneID:12980828"
     tRNA            complement(600641..600713)
                     /locus_tag="LMJF_33_TRNApseudo_01"
                     /note="tRNA-Pseudo"
                     /db_xref="GeneID:12980828"
     gene            <602500..>603744
                     /locus_tag="LMJF_33_1330"
                     /db_xref="GeneID:5654548"
     mRNA            <602500..>603744
                     /locus_tag="LMJF_33_1330"
                     /product="cysteine conjugate
                     beta-lyase,aminotransferase-like protein"
                     /transcript_id="XM_001685841.1"
                     /db_xref="GeneID:5654548"
     CDS             602500..603744
                     /locus_tag="LMJF_33_1330"
                     /codon_start=1
                     /product="cysteine conjugate
                     beta-lyase,aminotransferase-like protein"
                     /protein_id="XP_001685893.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654548"
                     /db_xref="GOA:Q4Q455"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q4Q455"
                     /translation="MSKICAAQRLRGLSTSSIWEEMTPLANKHKAVNLGQGFPSFAPP
                     RLLLEELEKVVQDSEEAPLAHQYCPPRGNAELVAQLCKSYTKLLSQDIQPSNVVVTNG
                     VTQALNAIFQAFINQGDEVVLVEPFYDAYYQDIFITGGVTKYVSLQPSTESAENWKLT
                     REALLEVVSAKTKFILINTPQNVPGKVWNVEELQIIAEVAKQFDAVVISDEVYMYLTY
                     GKPHVSIASLPDMWERTVTLCSAGKTFSCTGWKIGWAVGCAKLTAPIAQIVSYQSFCC
                     STPFQIAIARAAAKAAENGFYDILRDEYAARVAQVSNMLAASGLCPVKPQGGFFALAD
                     ITKVDPKHYYDASNKSQAKDWQFCIWLTKKIGVCAIPVTAFCQEESKPLYENYVRFAC
                     CRSQSELNAAAERLQKLQDYLL"
     gene            <604497..>605324
                     /locus_tag="LMJF_33_1340"
                     /db_xref="GeneID:5654549"
     mRNA            <604497..>605324
                     /locus_tag="LMJF_33_1340"
                     /product="putative QA-SNARE protein"
                     /transcript_id="XM_001685842.1"
                     /db_xref="GeneID:5654549"
     CDS             604497..605324
                     /locus_tag="LMJF_33_1340"
                     /codon_start=1
                     /product="putative QA-SNARE protein"
                     /protein_id="XP_001685894.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654549"
                     /db_xref="GOA:Q4Q454"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR006011"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="UniProtKB/TrEMBL:Q4Q454"
                     /translation="MELKVRDRSAEFAERRATVCTRCDRSESSVPEKPTEQLFTAPLW
                     SRLPSDFEENALALSHQIDQLRSRHLLFLKPKLRSKDEEDELRALIDKQAVDIRAFLK
                     MLEHTIVLGTQLKSTYSEEEARIVKSVQARLTARFKELALQFKSAQELFGAELHRREQ
                     KSSKYMKVGSDAAYEAVQQEERTVQFLEMGFTEQDAQSILIEDMQRDQTNKEIKDILD
                     SIQEIHCMFEDLHTLVVDQGTMLDRIDYNVDKALVSASKAQIELERARENQSSCILM"
     gene            <605705..>606250
                     /locus_tag="LMJF_33_1350"
                     /db_xref="GeneID:5654550"
     mRNA            <605705..>606250
                     /locus_tag="LMJF_33_1350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685843.1"
                     /db_xref="GeneID:5654550"
     CDS             605705..606250
                     /locus_tag="LMJF_33_1350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685895.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654550"
                     /db_xref="GOA:Q4Q453"
                     /db_xref="InterPro:IPR002478"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR016686"
                     /db_xref="UniProtKB/TrEMBL:Q4Q453"
                     /translation="MRPLTDDETKKLFDKLAQYIGANTTHLLERKGEEEHVFRLHKNR
                     IWYMPLRLAKLASCVSKTNLMGIGVLFAKVTHNGNVRIQVTALEYIAQYSLFKIWVKP
                     NQEQKFLYGGNVSRAGLGRITESTPKYQKVAVFSMGDIPLGFGVAAQSTLECRKCEMN
                     SQVLFHEADVGEYLRDEARMT"
     gene            <606735..>607223
                     /locus_tag="LMJF_33_1355"
                     /db_xref="GeneID:5654551"
     mRNA            <606735..>607223
                     /locus_tag="LMJF_33_1355"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685844.1"
                     /db_xref="GeneID:5654551"
     CDS             606735..607223
                     /locus_tag="LMJF_33_1355"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685896.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1355"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1355"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654551"
                     /db_xref="InterPro:IPR008011"
                     /db_xref="UniProtKB/TrEMBL:Q4Q452"
                     /translation="MVFLRITLHCLCFTALLPLRRSLAHISLTTAYPSALASSTLFVH
                     QNRKTNGGKSSMSAAAKTVQESVDRLRGQMIRTARRFRDYNFRQYFVQHVKDDFAALA
                     KLSEEEQRKFLATEGRDKLRQLQRMALVNQMYAKRPLYFDTAAQKPHRRQDDDTGKPV
                     IQ"
     gene            <614710..>616104
                     /locus_tag="LMJF_33_1360"
                     /db_xref="GeneID:5654552"
     mRNA            <614710..>616104
                     /locus_tag="LMJF_33_1360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685845.1"
                     /db_xref="GeneID:5654552"
     CDS             614710..616104
                     /locus_tag="LMJF_33_1360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685897.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654552"
                     /db_xref="UniProtKB/TrEMBL:Q4Q451"
                     /translation="MTMYRQWYHDELERVSKWAVETPRSTRTYDDEAQANKDDEGLCG
                     EGEVADTWADSAGASPVTAMEEWDLYVCLVSGAGAGSATHQLTAPPPSPSLLSPDVRS
                     WVEELVAPFDSSSTLDRQGEAFVTGPAHWHASTHRRQQQRDYAEQHIHFRVVHSPNEL
                     LAFLEHLGSNAALAPSAGAAFADAAPSIVPPVPLVASQQQPSSLQLSRSSSTTTARGQ
                     KRRRSPRTAVSSSSSVSPSCGKLPQRTWRLQRQRLLLLDGLDALWLHPSLGNHCATHT
                     GQWFAEELHRRLRAVLLPRLSYAASNSAVVTPSYATAAASPTSPYPHHTLYSTVVFTN
                     GCNGSSRGILNPQQLEARLAGPVGGAEGWTATLPRPSGNAVWCRAADTRCLVEPAHPG
                     LVSLPTPSSSYVHPARVSHGPGAMRQSCRGMTKAVGPSNANSRESLVTVVKGGSCVAA
                     TWVLRDVTGGEQET"
     gene            <616807..>618084
                     /locus_tag="LMJF_33_1370"
                     /db_xref="GeneID:5654553"
     mRNA            <616807..>618084
                     /locus_tag="LMJF_33_1370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685846.1"
                     /db_xref="GeneID:5654553"
     CDS             616807..618084
                     /locus_tag="LMJF_33_1370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685898.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654553"
                     /db_xref="UniProtKB/TrEMBL:Q4Q450"
                     /translation="MSIIYVDELAIRLPSDVRNTFNPLCAFGSSNNSSANTHNNNRCS
                     APVMGLREVQSGHVLLPIDAEGSIVVTPGQRYTVVLVRETRGGSVASAAAPPARAEFS
                     SAASNGHQNSADGNTDKMIKSVAPAKPHQPHQQQQHVKKPSLPREASAAEPIAQPAMP
                     PAQKANLSKKERKVASESAAEEQVYGGEAPSASTVAQAEQPSKKRKRQDDGAAQAPPQ
                     QHRQKSSPTLSARVESADTDDAPLMEAHRSSQSHTSSRTSPVMGPSISAESNRHSSKR
                     GALRSKAEAIVVPPPPTRRSLSSTDGYDDEEGAQPLAQLYSAQSAASQPSVPDPKHAG
                     EEETRITATSKKRRSPSEKTTKSTSASTAAPTTAPRVPSPPQPATFAAAETATKTLRQ
                     KSASPDRVPVTLPPSSRRSTVRRVPLDTSSDSD"
     gene            <619983..>621209
                     /gene="MPK11"
                     /locus_tag="LMJF_33_1380"
                     /db_xref="GeneID:5654554"
     mRNA            <619983..>621209
                     /gene="MPK11"
                     /locus_tag="LMJF_33_1380"
                     /product="putative mitogen activated protein kinase"
                     /transcript_id="XM_001685847.1"
                     /db_xref="GeneID:5654554"
     CDS             619983..621209
                     /gene="MPK11"
                     /locus_tag="LMJF_33_1380"
                     /codon_start=1
                     /product="putative mitogen activated protein kinase"
                     /protein_id="XP_001685899.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654554"
                     /db_xref="GOA:Q4Q449"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008266"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q449"
                     /translation="MPATKSLAELQAEVRRLDDRYLLERIIGAGSYGVVIRARDTKSD
                     NRLVAMKRVNKEIFEEVILAKRILREIKLLAHFNDDNIIGLRNILTPKDPENFDHFYI
                     VMDIMETDLKQVLRSGQELTEAHIQFFIYQALRALHIIHSAGVIHRDITPANILVNTN
                     CDLKICDFGLAKEENDQGEYMTDYVTMRWYRAPELVMEDKDYSVQIDVWGIGCILGEL
                     LGSRPLFQGKDRVNQLDKIVDVIGTPSEEDINSVGSSAAQKYLKKKSHRPQADWRQRY
                     PKASPEALDLLRHMLVFNPKRRITVLQAMRHPFLEQLHDDADDNLSYTLFRFDENEQK
                     TIMDVKRAIYKESVKFHNEHPSSMRATTMYSAFNTPSVAAPSVATEGEGRSAQQTIEK
                     NIPEDVAEGNFDREQV"
     gene            <625719..>626597
                     /locus_tag="LMJF_33_1390"
                     /db_xref="GeneID:5654555"
     mRNA            <625719..>626597
                     /locus_tag="LMJF_33_1390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685848.1"
                     /db_xref="GeneID:5654555"
     CDS             625719..626597
                     /locus_tag="LMJF_33_1390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685900.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654555"
                     /db_xref="UniProtKB/TrEMBL:Q4Q448"
                     /translation="MWTLSRPCLAAVRTAVLCQKKQTAAGYMASAGKVGNEEKWAQAA
                     MEYIHEKNHVNDARKRQQDVDQERSIANAYDRYSAVSEAKFDERLSRLIARMSEALEE
                     MRNLGLEEALEEAVLLNSEQPPGHYRRPSLTPPLAGYEPGFGLDVPQLRSQQAEYPPL
                     RRPTDWLEFGEGGADDFPYVDTHKIEDLTAKHEAQLEEQHGVLREAAPLTGVEGEGWE
                     AYVALHRKALARQHLIMDLHNDPELRDKYNADEAFRAAEWERRGMGALSIEAPLERDL
                     ELHYAQVPAYEAFRSH"
     gene            <628747..>634611
                     /locus_tag="LMJF_33_1400"
                     /db_xref="GeneID:5654556"
     mRNA            <628747..>634611
                     /locus_tag="LMJF_33_1400"
                     /product="putative protein kinase"
                     /transcript_id="XM_001685849.1"
                     /db_xref="GeneID:5654556"
     CDS             628747..634611
                     /locus_tag="LMJF_33_1400"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001685901.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654556"
                     /db_xref="GOA:Q4Q447"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q447"
                     /translation="MPSTAATQIVSRGGSPTPPLTTDVDIRGPFLLYGPSGRLLSRYE
                     PSDLWGLLISEHTTLKCTYAQTTVRVGRAGGCDTVLSDPRVSSTHFTISLELEPYGNS
                     DHRNHRRGGGDHETPWLLRRSPKGSPAHTRGIHADANDDVASGADVPGSAVPGGLASS
                     SSLSSPAAAGKGLNKDGRSDARALSGTTLPGWRVSRVSLTDCSANGTYVNGVLVGRGK
                     CCDLHYGDDISIVRVPEKKRPRRGSATPTDLSSEEDETQQESEKEVACFSQGERGAKL
                     PRGTAAAPLSSAQHVAPSSLDALAGGGAARMGTEANEEGNSPSGDDLRVTQMFTALLS
                     TLSTEHTYVERFCFHLYHAEEVGRGGVPIIEPDTVVASQRAAAGEVEAEAERQGEDDK
                     EQNKYDDVLRQPQPELKHNLSQHKSVRFPHDPVMVFDPPPENADGDAVDSPPASLSTL
                     QHRDRHASLSTSPISPCAPVPDDTAASAAFAPQSSALSRASSANSLRTLSAVVTPHSL
                     LRPRPSIQESFIAPINPPDTEESTAPSNGAVHGSAMASTPAIRFHESIGISPALQREA
                     AAQRALAARRGSSTASNQTSGSLGTVGAITKDMPPDIPIRYAVLPLRHLQWGGRIGFG
                     ASGDVFMGIDVSTATVVAIKVLKGSSLFQSSQPADTAVAKAHSKTTSGRPAVPSVQDD
                     GTILNLSNISLGNGAVADPRAASEGWTCASHALASPMTLSSHCATSLQVNHANEESIQ
                     ISEASTPLTPASAVTSSSASAHGNTSAALVNMSSTPHCHTQVQQQQPPRPQSQDEHSA
                     SPLLRKHLREIIFLTTLQHRRIVRFLGFQFSGEGRLCLLMEYVAGGTLQTLVKNFGVF
                     EENVIRLYTLQILEGLEYLKRKGVVHGDLKSANILVSEQSSVKLTDFGTSRFLRVCAA
                     EEKGAGEAAGADDERPGAEVRRARRRGESREIRHAPADRAHKRYHHASSPGADAAVEE
                     DSRGEDIGVGNAEGCGDCCRGGSDEDAYSDDIHSAEGTFEEDEEREDLNEDVGPERRL
                     LCGTPLYMSPELIRTQEPTFASDMWALGCVVYEMATGGVLPWRPVHNLSAPAVIWYIG
                     QRGEEGDGPSMDDVYTERDRLNRASTDPSLHESVDDSYDEGGGRRGHSSRGGSGGRWD
                     RTPSPMLLDLLQSTLNMNPALRPTPVELLQHPFIRNETSNAALERWHALVAANRRPAP
                     HALKQHGEKGEELMSHLKLKAEPVADTKSTLRSVRGSAGSASRDGSRHVRASLSPART
                     SPSPQAIHVEELNDNAPAKLGGENSPGTGSKPQHPSLHPPPPLGEPMTSPSMNLLGDP
                     WEDVKPSSVLPLPPPASQPKPQVPKAHAVQVPSVLGAGNPDSQPLIYEPPRRPDIRGR
                     RMDAPQSVIGRTAAAVECFPSAPYGAASLPWWTPQSFSAPTKLPVSRSRPSTAAVVGM
                     RQAEQQAPYTMPVAQQNASKSYLRQHQLFLKQNELERRRLSFLVPQGGRQMRGRHRTE
                     GPSILQQQQLLLPVPMAPTPAAAGRMPMCPPSYQYAMRQPVLEYTPGYSDYNPQVNTQ
                     TVEMCLPPGFTSQSPSAPHQQGRRQSGSSGSNRVVTGAQLQSVASSQQPLSQQLRGNK
                     PKHSSRRERAQNAPITAAASNVSPSLHPNTRSPVISMSPSHVRGPAAAASTHASSGPV
                     LPHASQQFAPPPPPQQQQQLSLQPLHPVVGGLMMELDNLTISSPLLSSFAASIAPLPV
                     QDHRYVLSYSSAPMPVDQPVSKSQQAQCQGPVLPLPSHPHHRHTAHAQSTTTSSFGPG
                     SGEGGGAVQQASPANTAEVEGAGNSAAQRNARRGRQGHRSAFSSSSLLLRQNRLRNPR
                     RASPLLRQQLHQMTLARTRTCVVEHSNRQEQQRIPPLNEEVPAAQQQEEPRSTKRPCA
                     ARPSGRSSSTHTAGKKRRIRTSLRVSTREAIRRRQQRRSQKQRDQSPEANAKQQ"
     gene            <635456..>637225
                     /locus_tag="LMJF_33_1410"
                     /db_xref="GeneID:5654557"
     mRNA            <635456..>637225
                     /locus_tag="LMJF_33_1410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685850.1"
                     /db_xref="GeneID:5654557"
     CDS             635456..637225
                     /locus_tag="LMJF_33_1410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685902.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654557"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q4Q446"
                     /translation="MHIGLAAAVPSPTTAPQWLQDIENQLLIRNAIELKPSQSIFDSY
                     TTLHVSVLHLQTVEDERQRLRMERSRLTERVRELEQAAANSSLQTSYERELEAKKDAL
                     QDQLRVYMQRESDYYKALSEVKAVQEERDMLRLRSNKLDAELEQRTAELQLLHKEYTA
                     LRDEYDRVRLTVSEADRYLREVKTAKEKTVQLQHRIVTLEDEVNMLRRQLQEALKGET
                     AAAVDKAKRANPNKDGEDAEVAPSPMHTTHSPHTDPCTTLSPNPLGAEPSHASMVISE
                     AHTSSTLHGLCVLDDGKRFLTSGADKHIRLWNRQSPQAEKYFSSSSIALALDTSSHYL
                     LAGCADHVVRFWDVNSLRVLEMTGHTEKVVAACLSSSAQHAFTASSDSTIKLWDVRRR
                     ESLRTLLCQSTCNDVTVAGDTVFSAHYNGKITVWDRRTATRSGEVVAHQRVATCVRVS
                     ANGQLCVSMGKDNVISVRDARVFTKTLFSVAPVQLVVMMNWARLSIAPSGQLCAVGSG
                     RTSDLLLIRLHGGGQGDAEATDSASSPALVKVLKACVSNATSYGDQGSGSSKGPIFST
                     AWGASEGGPLVSISNDRCVQVWE"
     gene            <641600..>643063
                     /gene="AAT26"
                     /locus_tag="LMJF_33_1420"
                     /db_xref="GeneID:5654558"
     mRNA            <641600..>643063
                     /gene="AAT26"
                     /locus_tag="LMJF_33_1420"
                     /product="amino acid permease-like protein"
                     /transcript_id="XM_001685851.1"
                     /db_xref="GeneID:5654558"
     CDS             641600..643063
                     /gene="AAT26"
                     /locus_tag="LMJF_33_1420"
                     /codon_start=1
                     /product="amino acid permease-like protein"
                     /protein_id="XP_001685903.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654558"
                     /db_xref="GOA:Q4Q445"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:Q4Q445"
                     /translation="MFGCAMMSLSSGSVLGAALSLAVTTMGAGILTLPSAYADAGIIP
                     ATLILVGVGILTVFSIDYIILGVDKLCRNSYEELTRELLGKKAEEVVRWMLIIYNTGS
                     AIGYLVVLEDLVAPMQPLVTRYLPALTTPKHSLLSFWAVFILPLSCVPTLGALHISSF
                     LAISSTSFICIMIMFRYFVPGPTELSAMTTDAIANGTASANWWWGKYPLLALPIIMFS
                     FDCQSLVFQIYAGLDDMRRSVMIKVAIISLIVTGVIHAAVGLFGYLSNPVDVRENIIS
                     NYDPNVDRLFQIGYLLYTAPMILAFVLMMFPIRDSIFILWYGYSSASMATHVPRSKDF
                     TRLVRQEEALELIVNAESGHQHNHCNGFGSKHSYGSVKEELQQVIEVKKHHNNIERIP
                     LRDHLIISVTLSTLCVAVALLVPGIVSVVSLLGGLCSSTLCFIVPGLYRWQLHNKNIA
                     RCQTFWEIALMVLMVVFGGVAAILGTAVWVEGVLLSM"
     gene            <649052..>650809
                     /locus_tag="LMJF_33_1430"
                     /db_xref="GeneID:5654559"
     mRNA            <649052..>650809
                     /locus_tag="LMJF_33_1430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685852.1"
                     /db_xref="GeneID:5654559"
     CDS             649052..650809
                     /locus_tag="LMJF_33_1430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685904.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654559"
                     /db_xref="UniProtKB/TrEMBL:Q4Q444"
                     /translation="MWRPRRVQGLGSGEDICHLVSAVRRQGIRSLPSGLVVAAEIAYR
                     CCSYSIESFQTDSTEAKKPSRVVGTAPTERQKRPSALAPSSSIPATEKAGIIVEWVPD
                     ALGYHLPLGLRERWEPSSKASPTEAGGLKASNDAETHGTEQQELEEVSSVGNPCASSR
                     VGDGGGGSGHRSGHSDGPPFYGPLPNFATSPVFEWERCLWQWRPVKITPAAGTPHHTS
                     LTVTAPISSSGEKRPLRDEMHCSDGGENDLAEGGLGESSQVYHLVPFLLCPTLEVCAT
                     QPLMHGSLRKELAAAQNACHHLRRSWPEDAKQDLLGTRRCPTYSEHETRLWSITIPTP
                     VGELALSSPQDTDGDDANKQNTMLDLPTFAMIEGEPPMRVGGRIRACCGHGITSPAPP
                     EAETWEAATAAARNERSTSAGNAAVPYVHVFCSEMSAACSDSLLSQTGIKASELPTPS
                     SCDVSSPTLPLTRRNVVGGGLAELILAVDRYAALIARGDLALSAACWATLCDTKSWWV
                     VQRLRVCPLEMERELVAATEAHKLWQQYAVSRNSTLVGKSSHGICFYDYPFLAKWPLG
                     RQAATKATAPIRAHTRWRV"
     gene            <655817..>657865
                     /locus_tag="LMJF_33_1440"
                     /db_xref="GeneID:5654560"
     mRNA            <655817..>657865
                     /locus_tag="LMJF_33_1440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685853.1"
                     /db_xref="GeneID:5654560"
     CDS             655817..657865
                     /locus_tag="LMJF_33_1440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685905.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654560"
                     /db_xref="GOA:Q4Q443"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4Q443"
                     /translation="MYNFFASVNAPSTPPQKQPQVEPSLPPSACHHHVAASSLLDGMT
                     AHNASLWLLNASQQRSLSYAHSGGGGDNLAGAEQEKRTAASQFYSTFPTAAAPPPSSG
                     VQSLHGVGQQPAQQPHKHLCTSILQSYEHVGNSATPAPGLSSSLPLQEHQSSTWVTLR
                     GGSLRMQLDGVPYSPFASTNASAASQPPDAAHGNEQYYDSTSHHRGYSASSASSIRHT
                     LQVPASPQQQHQQQRLPISSSVWTAATPATAMPASLFASSSIRPLTNTTYPGYSCDWS
                     GNALPTLPAAVPAPYVSGAALPVSSRSQTTYSVMPQPPQSGQPCSPTAHPATHSIMIL
                     HPTLDRGTAAILQASADAVNTPLHCLTDVKASEISGTTHYLEVVQGGGSVGDNSKHSY
                     PSSIPIASRQPQPPLQQYYLQPTPQQHQQGQQLAAEQPPVHSCFLTNDGNMSHFVNHT
                     TAAGAIIQPPSSMLSDIASLASLSSRTAGAGRSGAWQQPSTADMGSYKDQSSKLQLQQ
                     QQQQQQQQRRPVSAARQVTYTRGIPRRNRDRAVLFVGQLNYEATEADVSQVFSCYGKP
                     LSVVVLKDKGKATKKGGAGGITGGSAATHRKVGGSAFVTYGTTLEADTAIMALHGRYN
                     AKGDDVENVDNSKYLQVSYGQQTGLISAFGMMHAEKLHASKPENPIPLLVKDRTNGKL
                     "
     gene            <665104..>665733
                     /locus_tag="LMJF_33_1450"
                     /db_xref="GeneID:5654561"
     mRNA            <665104..>665733
                     /locus_tag="LMJF_33_1450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685854.1"
                     /db_xref="GeneID:5654561"
     CDS             665104..665733
                     /locus_tag="LMJF_33_1450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685906.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654561"
                     /db_xref="GOA:Q4Q442"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4Q442"
                     /translation="MYMHPIGQPMGHPLVPPTIVSGAYQVNTIPVVQQQFVYTAQPMV
                     APQPMIQGVPAATPMYSVAPPRRQKNKGNAVLFVGQLNYDVTEKDVRDLFSYYGHVVN
                     VVLLKDTKRNNGKGASAQSKNNKHVVGSSAFVTYPTTAEADLAIMSLHNRYCMDNRDK
                     PVQVSYCQKTDIISDFGYRHALQLHSENPANPIPSITPTPSVAYAIKFA"
     gene            676069..676151
                     /locus_tag="LMJF_33_snoRNA0037"
                     /db_xref="GeneID:12980829"
     ncRNA           676069..676151
                     /ncRNA_class="snoRNA"
                     /locus_tag="LMJF_33_snoRNA0037"
                     /transcript_id="XR_002461054.1"
                     /db_xref="GeneID:12980829"
     gene            676208..676277
                     /gene="LM33Cs3H1.1"
                     /locus_tag="LMJF_33_snoRNA0090"
                     /db_xref="GeneID:12981248"
     ncRNA           676208..676277
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs3H1.1"
                     /locus_tag="LMJF_33_snoRNA0090"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461061.1"
                     /db_xref="GeneID:12981248"
     gene            676304..676365
                     /gene="LM33Cs3H2.1"
                     /locus_tag="LMJF_33_snoRNA0130"
                     /db_xref="GeneID:12981294"
     ncRNA           676304..676365
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs3H2.1"
                     /locus_tag="LMJF_33_snoRNA0130"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461072.1"
                     /db_xref="GeneID:12981294"
     gene            676417..676524
                     /gene="LM33Cs3C1.1"
                     /locus_tag="LMJF_33_snoRNA0039"
                     /old_locus_tag="LMJF_33_snoRNA0127"
                     /db_xref="GeneID:12981297"
     ncRNA           676417..676524
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs3C1.1"
                     /locus_tag="LMJF_33_snoRNA0039"
                     /old_locus_tag="LMJF_33_snoRNA0127"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461055.1"
                     /db_xref="GeneID:12981297"
     ncRNA           676419..676524
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs3C1.1"
                     /locus_tag="LMJF_33_snoRNA0039"
                     /old_locus_tag="LMJF_33_snoRNA0127"
                     /transcript_id="XR_002461056.1"
                     /db_xref="GeneID:12981297"
     gene            676581..676650
                     /gene="LM33Cs3H1.2"
                     /locus_tag="LMJF_33_snoRNA0091"
                     /db_xref="GeneID:12981249"
     ncRNA           676581..676650
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs3H1.2"
                     /locus_tag="LMJF_33_snoRNA0091"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461062.1"
                     /db_xref="GeneID:12981249"
     gene            676677..676738
                     /gene="LM33Cs3H2.2"
                     /locus_tag="LMJF_33_snoRNA0131"
                     /db_xref="GeneID:12981295"
     ncRNA           676677..676738
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs3H2.2"
                     /locus_tag="LMJF_33_snoRNA0131"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461073.1"
                     /db_xref="GeneID:12981295"
     gene            676790..676897
                     /gene="LM33Cs3C1.2"
                     /locus_tag="LMJF_33_snoRNA0041"
                     /old_locus_tag="LMJF_33_snoRNA0128"
                     /db_xref="GeneID:12981298"
     ncRNA           676790..676897
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs3C1.2"
                     /locus_tag="LMJF_33_snoRNA0041"
                     /old_locus_tag="LMJF_33_snoRNA0128"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461057.1"
                     /db_xref="GeneID:12981298"
     ncRNA           676792..676897
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs3C1.2"
                     /locus_tag="LMJF_33_snoRNA0041"
                     /old_locus_tag="LMJF_33_snoRNA0128"
                     /transcript_id="XR_002461058.1"
                     /db_xref="GeneID:12981298"
     gene            676954..677023
                     /gene="LM33Cs3H1.3"
                     /locus_tag="LMJF_33_snoRNA0092"
                     /db_xref="GeneID:12981250"
     ncRNA           676954..677023
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs3H1.3"
                     /locus_tag="LMJF_33_snoRNA0092"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461063.1"
                     /db_xref="GeneID:12981250"
     gene            677050..677111
                     /gene="LM33Cs3H2.3"
                     /locus_tag="LMJF_33_snoRNA0132"
                     /db_xref="GeneID:12981296"
     ncRNA           677050..677111
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs3H2.3"
                     /locus_tag="LMJF_33_snoRNA0132"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461074.1"
                     /db_xref="GeneID:12981296"
     gene            677163..677270
                     /gene="LM33Cs3C1.3"
                     /locus_tag="LMJF_33_snoRNA0043"
                     /old_locus_tag="LMJF_33_snoRNA0129"
                     /db_xref="GeneID:12981299"
     ncRNA           677163..677270
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs3C1.3"
                     /locus_tag="LMJF_33_snoRNA0043"
                     /old_locus_tag="LMJF_33_snoRNA0129"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461059.1"
                     /db_xref="GeneID:12981299"
     ncRNA           677165..677270
                     /ncRNA_class="snoRNA"
                     /gene="LM33Cs3C1.3"
                     /locus_tag="LMJF_33_snoRNA0043"
                     /old_locus_tag="LMJF_33_snoRNA0129"
                     /transcript_id="XR_002461060.1"
                     /db_xref="GeneID:12981299"
     gene            <681933..>682916
                     /locus_tag="LMJF_33_1460"
                     /db_xref="GeneID:5654569"
     mRNA            <681933..>682916
                     /locus_tag="LMJF_33_1460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685855.1"
                     /db_xref="GeneID:5654569"
     CDS             681933..682916
                     /locus_tag="LMJF_33_1460"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685907.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654569"
                     /db_xref="GOA:Q4Q441"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4Q441"
                     /translation="MAQLFVGQLPFSKFFPDDLLDLFRPYGSVIAHQLHIHQGNAFVT
                     YATTDEADRAIQALHSKCSLGTRSQPIQVMYSKGTRLISAFGLHHRSVCLSRNKDRQR
                     SKEASATAGGATEDDTLLNEVSNLNSSSSKNVILTPLMCTAGGAGGSEEPNTSFTTLF
                     SSYGDLSGKSEISGEEDGRQPSGVHGAVASSNAFLQQQKPPSYPVGADPLVYSSAMGW
                     QIARQSLVASTATTPPTSVISNGATTPMSDLINPSAPAPAPTPVTYVMMPNSGNSMPC
                     VMPLYYALPASTSAAIAQQQQRQQQALASALASYNARAAPVQIAYLPITPQ"
     gene            <704657..>705049
                     /locus_tag="LMJF_33_1470"
                     /db_xref="GeneID:5654570"
     mRNA            <704657..>705049
                     /locus_tag="LMJF_33_1470"
                     /product="putative RNA-binding protein"
                     /transcript_id="XM_001685856.1"
                     /db_xref="GeneID:5654570"
     CDS             704657..705049
                     /locus_tag="LMJF_33_1470"
                     /codon_start=1
                     /product="putative RNA-binding protein"
                     /protein_id="XP_001685908.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654570"
                     /db_xref="GOA:Q4Q440"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4Q440"
                     /translation="MTVNNSNNNNNGERLGSGTARLFVGQLNFDATEHDLRQIFSFYG
                     HVIHTNVLRDADGKSTGSGFVTFRVTDEADFAIMSMHDRYNMGREKPLQVSYCRRSER
                     ISPFGYEHAMKLREKNTTNPPPPQPTSS"
     gene            <712865..>723199
                     /locus_tag="LMJF_33_1490"
                     /db_xref="GeneID:5654571"
     mRNA            <712865..>723199
                     /locus_tag="LMJF_33_1490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685857.1"
                     /db_xref="GeneID:5654571"
     CDS             712865..723199
                     /locus_tag="LMJF_33_1490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685909.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654571"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q4Q439"
                     /translation="MLSFKSIAGFLKKVGGTREDHSKEGHQRGGADGSHAGAGSSGSA
                     SAFAAGSAATGGAGDSAHHRSYIGSSRTAFTGGAGAVAASHHGDVAHDPHLSDFPTSG
                     MPSTFGDNVMFASSHILRGLPPNTSMQDVLLHIRCVVQERSEQLQQEEREEQERPSTL
                     WQRGLSDGSIAAGENTTAAGAQRRRSASFTSVAATNGAEARAAPCESASPPASLKGKA
                     EKGAAGVTREHVQRLQKMRAEMIDALDVCLQEVPEDPRTWGGSSSAGFSEDERARNGK
                     TGADAQKQQERSNGTPDTAADSSGDVLLEGMRTESELDASRQESSIAATLLGAAEPSP
                     GIAQEPLAPADFGHYEWRRLLMDIINVLVRIDRALLHDARLRALERLIPSTTDSDGNA
                     GPEFRWENLSQVLLTPGVLGSPFSAADAAASGSRRSQFPLTPTRGPQRHPPHGDAAPL
                     NSPLPNRNADTAALAGIATPRERAVTPVTTTTTTTAARAGSTSSPFGKAKRALVDSGV
                     VSPESPTDLFITKEDKKMLEELLTIACSLASWAIVKAILRHHLHVLEQRQSRGSFTSL
                     AKAAITTTVSVRISGDIPVLATNIETSGAGNTNTTGRPPLAPPAPPPPAAMNGAACFS
                     DAAEGGAGAAETAATDDDQSKNTNHISAMDGVGAIPYIDWAAVVQELAEWIGEQHFVA
                     IAECILCASFLRDDGREMVLCMLQTPKPRRLLTNIHRHADKLRRADVDSLLSCSSPPR
                     VVTAATAPVSSPTVAATAFSGSAPAATSSTLTSSGTPSTSSSTGSAAAAPPAGTSANT
                     APTAAAMGAASFLPATKIGAAAAPAAGPSSTANTIRTMLEDPTLVMDDLVARLEMVYR
                     KAVANTWASYLEDAIEADVQQLSIAAGNAVDAAGTPAAGDPDTSPAPTPTTHLVAAGD
                     EVLKQSTGSVASPQALPRLQQLHITDTKALCRLATAFFFGSDAWSENKRERRFALLFR
                     SMRGRMERYSESAATRRHLRRGTICAASMTHTVASAPAASSLDSHPLVELAMAGAAAA
                     TTAPSSRGASQSQSLTIPPQISTAAAPVSSASAGLTPSKFSVEDTSARPSPSGGCPSA
                     ALLAAGVGTSALANRGVAPSSQWVAHQLLSSNASTAAISTHSTPLTTSLLVSRDGTND
                     MEGMVSGAGGPINGCSLFTVGHTDRTTTWTPFAFAMTSSEPMTPPPELHHPSASTTNQ
                     RGAEDGHQEAGEDNVGRRAMESSALSMPTVTLQGPSTLAQPAASKGGDSALESLVLER
                     IVNMSWSAALHKRGEQCLTAKPPRLEEAEQDALEERLVASAFGEFRARQRAIVSLINA
                     RLASGKSVEALTNAQKHFKFEKKDWTSHNQTIFSAMRYLQSMVFLVRAQAACRVYGAV
                     IETVQFVLPQAALCEQMLQVLAPRPRGDYILRFGDCRSKLLRSYVYLLKEGWLAHAAF
                     NDLAKAEKYFIKCAQVMQMLRRRVRETELFAAYMERGAQLMKLKEYKQSVVLFRCAVN
                     IAKKSLQAADAAAAAAAASANGDSCAFSPNASVGSAGPSLGSAVTNIENAVSVAAAGL
                     AAKAPPAASQQQFHRNLHLRAAGSGSLTTAEEHIPGVTDAIEDDLELVWRVAESERML
                     ALSYVTQAEHEVNVRERREELSNAVSSAYSSQRSLQRWQRKGGTPKRLLTAVPCSLIV
                     ICKGLLLLNQPRKAALLLEPLIENKPNSALVRPPMWGEILHPTEDPYTTEDVVLRTYV
                     SSVKIAVFMLYARCLAEFDGDRALRAVTLVDQLLQESDAWICTIRTELRRVLENVSAQ
                     DKKVADSLNSPRTAPSIEALRRTSAASPRGAASHGPNSEDGEDRQSCGRHGDGAGAET
                     TASASTAATTVGKHTARTIEVPTLQMPTSHSSTGSPSPLDDDRHSPGWNSPEDAPLRP
                     RRSTTVGTAGAASTTAVESASAHDEPSPGGSGAGGAAMDDDDRSRRSTSIQLSAAGGN
                     RSGTDLFSLVNSVNAGISSTTAMPTAHSSHGPSSTAPHLAQLPEIRVHTQSSSECMTA
                     LFALREAKSHIRKALRGIFIVSGDAYSLIKNWEEALKVYSHALVITMSEVEAASAAAQ
                     SRRRVSHSTSQARFSSQQSSTSPVAVDDGASLSAPHDVYETFGNSVGGDVSTSLQAWG
                     PVVPLDEEFFLWDEEDVLMSDNLINRELTASTAARDLRAVVADEERMDSRACESVVLS
                     KLANVYRALEKPATAIHYHTLVMEYANECHDKLLAYNSMLSLARLYTAANMSDKARDA
                     WAKVSELAKEYEDKEVSRETMRNIVAAQEAAGMYMDVVKTAEELEKLATGEEGEDAAR
                     DSRFALEALANANLQLGQFDACIAALDSREKVQEKSAEWSGALLSMRAKARMGLNKSA
                     EAIKVMQSWATKARNLANWVELGKANSALSGAYASENHNMQARYYHEATLNAFALAET
                     LDKECRHIALESARWLVHYAYLNDTTVQVDPTLTYTGSGLTSDSEASGCDFHYAESGL
                     CNISGDLGVMLAREEELHRTSSMLGESCKFGFNDDDDDFGGGGFLSNQSMFGVRPPGS
                     SLADAPSPKGHGMSEKEEQRDHYAAAHREEDGGKGAAAAAEDSTPSMASSFISSFLAP
                     KDSSMATQPPSLASSVNISMRGSLPHLDGALVGGNDHSEGSSSAGQSDGGDNEAGEDV
                     EDEAPRSMDVEDVAEHHQDPKLPVSFEGEEGDLVNLKKPTPKPSPAAPTPTVITAAAK
                     PTVNTATVAGSGATVGKSASSIYVPPPTSLANVSICSRPAAAAAGTDVLELPVDASRS
                     ASEHATLSGPSTTSSPLMGSSPRGAAFQGGPAATASGGDDDGVPERKPSTVRTTYFRG
                     AIEMIETAAQLLLVPRSVRHIVIPYSPAEAVDFALLAYPQSLFVFYFAEYTTEYGAQC
                     DVVVRPPRAAGFMKLRAQISLQEYHNKDAMSALLASTSAEFSITGEHGNAAETAGAAS
                     SSTHPFGTVMARAATGSAAASPPLSNSTPDMLRAALEEETSTCLRNLYVDAWQPIADR
                     MRREHINYQDAEELIIMPDVSLMHLPFAGFLPSPNYGDEEAPLGEQFTLIVTPCLTHF
                     VHHGMTHQPQRLRNRSGALDPAAKKYIFLPYDGSVGAGSAAPSAPLAMPTFALCAPSS
                     SSTRPQQQPKTGAGTAANSDTSALIATMGSAASKASAHSAVAPPVSSAHSLADSLPTG
                     HPLATSATIGNISMRSIPAPADPTSATPSGTPQQSERADTFDDLLRTWCVHRGCTRKE
                     LIQAFTDVRTRALMFLAPVDQGFIRVADGVVTIQDLTQNLQQVRVQQPAAHVANPAST
                     VTASSTGATAATSNTTSSATSVSPGTTATAVPPITSGAPPALPLPPLCSHIDLLVLTA
                     NRSQYPTVSDAGTSAKLCMALGVNRVLRLNVLHGLLPNDEHYAFISLYLANLKKVMRW
                     MLKNPYAVALRTTMAEARRLGMSSNTWGAFTLVGVP"
     gene            <725493..>728051
                     /locus_tag="LMJF_33_1500"
                     /db_xref="GeneID:5654572"
     mRNA            <725493..>728051
                     /locus_tag="LMJF_33_1500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685858.1"
                     /db_xref="GeneID:5654572"
     CDS             725493..728051
                     /locus_tag="LMJF_33_1500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685910.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654572"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4Q438"
                     /translation="MASYNPAPLPVRFDSNVSLTLHQAFLSTAGVLLSDPVARVHVVT
                     VKRLHASPPSSVPNANPHSRGVAAADEGIRTVLNSKEVAKSKPHFFTAHPRFNETFNF
                     TVTETSTLTSLSIPGKAVPDRANTSAQCRRKREGGSGCSESVVDYVVVTIESADGRVF
                     YGEAYAPFSPHCSSSAPAENPVRVMLAPRNAQDTADPLFLQDNALLEAKHLDDFGFVT
                     MSWEVAVVPHGGALMGTEPPLTSSAPSGSASPFPVGLTLRATWLARAAVYVRGAHYTT
                     SVEFGGQDRFIFSDPLQPLCLTLQGGSAETELRRAVFHCSVQSVVDPTKSHDVAVPLP
                     LPPLTSASVRNRDVWWAAPVRTINGVDLGLLLVTMRVSSKPLSADAPRCPDAACTRIN
                     DPVHQEEYQHVAQLWGKSQPPQAPLGAYQPIAWESQQHVAEAARRQLKRNCILEAQPT
                     AEHVRHIFDVLMGRASLDGGVAQLAATFSSKSVAEVTAGDLRELMVGCAFHAAQMSVQ
                     DAARFCFVALRRDVADAVAAEEVQYIVDYCLLEKTIEMPTGERKRLVADLFADVGTIS
                     YHDFAKYLLHNYAVWAALGVPLTVDESVSNVQRQHAALLHAPGSGAAVLDVAALPQPP
                     RATTGAPVTAAAATATQGSAVALAAALSDPASSTMWRTFVVRVAQAPQKAFSVTAHAA
                     DRISDIMAMVEESTGIKAERQEWRVFSGGAEGSGVSSAAAQKSLDPATLVGSTTLGLP
                     SALRSRSAPFTSSTFGSNAAQEVWIYEAEEAVQVRFHVKDRLHSTKDWQERLSVKEKV
                     LKVRAAVQRRTLIPLSRCTLTVKRSNGMVTKLQDRHTLGHYHLMSGDVIEVSHE"
     gene            <729633..>731528
                     /locus_tag="LMJF_33_1510"
                     /db_xref="GeneID:5654573"
     mRNA            <729633..>731528
                     /locus_tag="LMJF_33_1510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685859.1"
                     /db_xref="GeneID:5654573"
     CDS             729633..731528
                     /locus_tag="LMJF_33_1510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685911.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654573"
                     /db_xref="UniProtKB/TrEMBL:Q4Q437"
                     /translation="MRDVVTLFIEASVAKGEWQAALSALKLPLASQSSSSSSTTTSAG
                     SSFAEEVASNLFRLSSTLSNKGEWMAALAVLRNAPLPFAAQGCKSYSSAYLAARARAY
                     QHVLTACCSGSSAAVVDKAAAVTRPTASARGVKGGTEDMSFECALALAGEAFCVFDSA
                     PGLCGRDKTPCEEPAGQVLPKPPVALVTTSSAEPDAGTTCVEDLLRWCRAELPRRRSC
                     TGVATLEQTEAAVQQLRALSDAALRGISDAHVVAPDGPSTEPENKTASDPHADSSYAR
                     VASDVHRAEEDLTRLLAGNSQATDAWATSLTFLRRLPAECVSGHLFTALLRHLLQHNR
                     RGEVAQLVRTLVLLQRSGDSAQGASPALTRTPPSRATASVLRLDSVVIKVVAEACHRL
                     RRSDLAAELLFDTEARAAMTPSAAVPLVMTLRDAGAYSSVMLWWELLRKEEPVLRYPL
                     LQHAKLSSYVASCVLRNTTARGGGAIAEAQQAASSSAVNGMRARSAARWTGDWRSALD
                     VFRDAAAPAHDPALVLLFQLRLLRQAGQWEAAVQLFTAFCQTHPGMLTSKQSPSDIAG
                     QVHDGRHGNLHGWRTHREAPYPAPGKERASAMKSACAVLTQEHAEQWIPSPVLVRLQQ
                     QVQDLKP"
     gene            <732877..>733500
                     /locus_tag="LMJF_33_1520"
                     /db_xref="GeneID:5654574"
     mRNA            <732877..>733500
                     /locus_tag="LMJF_33_1520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685860.1"
                     /db_xref="GeneID:5654574"
     CDS             732877..733500
                     /locus_tag="LMJF_33_1520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685912.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654574"
                     /db_xref="InterPro:IPR004895"
                     /db_xref="UniProtKB/TrEMBL:Q4Q436"
                     /translation="MIENDRLPWMTDFADIHKMELPRKAKEIAWRLNLNIPYYSSNYI
                     EIFYVVTMPLLFMCNTPFFVVTLLAILIIHSIQKHKKKMHEYGDSVVLLGRRIRYRQL
                     GHLLVFALVMLLIFFKGLRTLLWVLLLNVCIIVPHALIRKPTYFDDEDLEKCRPKMVQ
                     YAICLVILVLAYLEGDLSADEVAESRRAVERERKRVAQAVARREAKD"
     gene            <736124..>736669
                     /locus_tag="LMJF_33_1530"
                     /db_xref="GeneID:5654575"
     mRNA            <736124..>736669
                     /locus_tag="LMJF_33_1530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685861.1"
                     /db_xref="GeneID:5654575"
     CDS             736124..736669
                     /locus_tag="LMJF_33_1530"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685913.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654575"
                     /db_xref="InterPro:IPR004895"
                     /db_xref="UniProtKB/TrEMBL:Q4Q435"
                     /translation="MSDISIAAKVQQLYHVSRQHVMRNFMALRPWSEFFDTTFFHTPS
                     GVTDTVNRLNRNLPYFYANYLVLSLLCSSYILLINLPFAVYAVLMVTWYLFIRSRSAM
                     VAALAAQGASEEEQMVYIANRAFTISQLYLMLIVFGVVGFYLTSGSSVIFWLLLTSLG
                     VSVGHASMRRPPIQDSAFNFV"
     gene            <737801..>738370
                     /locus_tag="LMJF_33_1535"
                     /db_xref="GeneID:12980830"
     mRNA            <737801..>738370
                     /locus_tag="LMJF_33_1535"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722343.1"
                     /db_xref="GeneID:12980830"
     CDS             737801..738370
                     /locus_tag="LMJF_33_1535"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722391.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1535"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1535"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980830"
                     /db_xref="UniProtKB/TrEMBL:E9AEH1"
                     /translation="MQLNGAVPPLTLSMPFGGFLLSVASMRERERRAPSCYMISRFVL
                     LCSECNSIRVVASLGVYACFAVGVIQALAHPRNFPSFLAHLRRFSARSMSRVTLSECL
                     IIDVLILPPLLHHNHLLHCEHRSVSRALHSTRDDALFFFFFTLTLTACGEGGITEPQT
                     HTHTRSSTQTRASAPGAELVRVRADKKKE"
     gene            <739147..>739809
                     /locus_tag="LMJF_33_1540"
                     /db_xref="GeneID:5654576"
     mRNA            <739147..>739809
                     /locus_tag="LMJF_33_1540"
                     /product="putative elongation factor 1-gamma"
                     /transcript_id="XM_001685862.1"
                     /db_xref="GeneID:5654576"
     CDS             739147..739809
                     /locus_tag="LMJF_33_1540"
                     /codon_start=1
                     /product="putative elongation factor 1-gamma"
                     /protein_id="XP_001685914.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654576"
                     /db_xref="GOA:Q4Q434"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q4Q434"
                     /translation="MHLLYQKNPNNAPAQKILAAAAYAGVEITAEPCDENKTSTDADF
                     LNFCDPCGEYPVLELGDGSGVCVFGANAILRYVARMKDEGSVHPYGRTPFEASQVDMW
                     IDFSSTEIDAANMPYIRMAYEKAISDVPADTLDKVKAVLSALEEVLSVRTFLVGERLT
                     IADVAVAFSIHWVYRCNRKHGQTLYKEYRAVYRHYNTVMRHPKIHAMMRKEGAAIGPL
                     RS"
     gene            <741191..>742174
                     /locus_tag="LMJF_33_1550"
                     /db_xref="GeneID:5654577"
     mRNA            <741191..>742174
                     /locus_tag="LMJF_33_1550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685863.1"
                     /db_xref="GeneID:5654577"
     CDS             741191..742174
                     /locus_tag="LMJF_33_1550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685915.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654577"
                     /db_xref="UniProtKB/TrEMBL:Q4Q433"
                     /translation="MRTDKCVSEAVQTFREAQNLLPTLYTHLSALENIMTQKGALVGA
                     ARRREQCFAKALPASHFLCMDTGTEERTLPQATTAGPSCVHTTSPVMTSPLGVLAAFS
                     ASTVHHLVAQHQRDVEELLGVVSRITQRSWSQKVEQLKSKIAQLERASEVGETPEHPP
                     SAGGIVAVSSTPASSSYFATASELSVALYGFAACLLKMGNVLQETMLALRKDARLSLM
                     AHAAPGSAALLTSTSADTASHLAAMLAREDRTSEGMSLLPMHSSHCGSLHEATSASSP
                     FSGAAGVQAAPLQPMRLVDAVGKLKSFLEARWKSCCDSYLAPESHLLLALV"
     gene            <743654..>745666
                     /locus_tag="LMJF_33_1560"
                     /db_xref="GeneID:5654578"
     mRNA            <743654..>745666
                     /locus_tag="LMJF_33_1560"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685864.1"
                     /db_xref="GeneID:5654578"
     CDS             743654..745666
                     /locus_tag="LMJF_33_1560"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685916.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654578"
                     /db_xref="GOA:Q4Q432"
                     /db_xref="InterPro:IPR002781"
                     /db_xref="UniProtKB/TrEMBL:Q4Q432"
                     /translation="MTNEQTTTFLVYVTLAVFNFASSIIQGVAGIGDAILIQVLWLLA
                     CNLSDDFNRTPLGDSPVRAVALIMYIRLLFMSPLVVYLGIDDSVFSKQMTIMMAVPST
                     ILTVVGVILYTRLDTGTLKKILGFTCFLFALVYIGIMIYRVWRKKRQVEELKSRNVKL
                     VVEADALEEEAQLSLKTSMVNLHASFVHNVPNNSIFAMRPPPPGGHGGLGVRTLYTTP
                     PPDSSMLHGSAVAMRGSTIIAQGVTAGEIDARTGLPADTTEAFLSTIGGDVFVGSETQ
                     APRVNEENVPKLTPSKISPSRTMTFTRVRINRNIDANGKIKMSTKISAAVAASLAGIM
                     ASLTGVNAPPQIIFILLFDAPNYIVRVNFSAQSIPSNVVRFIMAVCNGSFTWAMIPLM
                     INVVIFGFAGVFVGNRIGRLLGPQSFNVFVLCLLLLCALAMVGKWQDFLIICTILTGI
                     ITVACGYLENKRNKPIMEKQRLSELEVEKRLYNCLEELQRSNNSFTQPRRSVSTFTTL
                     VPFQRTNRPKPMWGGANFDNDDEDAGDERERDATALSAAGATHGELGSVKEEKSSSSG
                     HPLRRHSSPAPPPTAAVANGAEGVSPAATAATHPGSAAGMRPIPAVSPRPGYHTPSSN
                     NSDKDDHNLPSSSSTMLHNDQSAPSEVNHCLPELQSPSLRSMNSNA"
     gene            <747005..>747793
                     /locus_tag="LMJF_33_1570"
                     /db_xref="GeneID:5654579"
     mRNA            <747005..>747793
                     /locus_tag="LMJF_33_1570"
                     /product="putative ribulose-5-phosphate 3-epimerase"
                     /transcript_id="XM_001685865.1"
                     /db_xref="GeneID:5654579"
     CDS             747005..747793
                     /locus_tag="LMJF_33_1570"
                     /EC_number="5.1.3.1"
                     /codon_start=1
                     /product="putative ribulose-5-phosphate 3-epimerase"
                     /protein_id="XP_001685917.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654579"
                     /db_xref="GOA:Q4Q431"
                     /db_xref="InterPro:IPR000056"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR026019"
                     /db_xref="UniProtKB/TrEMBL:Q4Q431"
                     /translation="MTEFNRYNHEDKSTWLNAVEKPQAPLEAIIDPSILAADFCKLGD
                     EVASVVSPAGGAVEWIHVDVMDGHMVPNISIGPGVVSSLRARFPNVFLDVHCMVSDPK
                     QWVPSIAKAGGSGYTFHIEATNDSKGVAEHIRAHGMQVGVAVKPATNLTQELRDLIEG
                     HYVDQVLVMTVEPGFGGQSFIQERLSFISELRRNYPHLNIGVDGGIGPSTAVQAADAG
                     ANILIAGTSVFRAGDRKAAIEELRASAKSGICKNSIQRALPGMR"
     gene            <749551..>751086
                     /locus_tag="LMJF_33_1575"
                     /db_xref="GeneID:5654580"
     mRNA            <749551..>751086
                     /locus_tag="LMJF_33_1575"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685866.1"
                     /db_xref="GeneID:5654580"
     CDS             749551..751086
                     /locus_tag="LMJF_33_1575"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685918.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1575"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1575"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654580"
                     /db_xref="UniProtKB/TrEMBL:Q4Q430"
                     /translation="MQCRALCRRLLGFPKRGGLWRSVRSGKVADGMRTSNPQCSARHA
                     TTSSLTFNSAAASFTTTSQAPFLHDAFVSRFSAQLLSSPHRDITHVPYGDWFALYVQA
                     RKHWHSLEPAPACATSATREESTMGESSEQAEIREARSQHAKQSIDALLLSSLFARHW
                     TEVQTATTSSSPLPTYRWWWHRDSLFSAAAPANAPECEAASPPLELCTPEFLTEPLLG
                     GNHLRLWMEEIRASSGTTDVTRAAHDATAVPTAILPFSSLWVVKQSAYWRPSAAAGAG
                     AGDHSGAGSSGNETVAFTLQERQARQALLQSVDQLLQLQRDAVERCNGTLCLPANQLQ
                     HVCVLSPTQEWDLLCDLPRYRQARYRPAREASSASTNVSDHSTASCVLPPRWLSLGCL
                     CEDTTARLAYCTHMLNWRRQLKSGTNASASKTAPVAVRVLSPTTEHARLRSLSVSSLH
                     EQSCMKASLQRRHAARCQSPSAVSGASSAATVHEQARKGCSDAVRRMSHREENIRQSF
                     SVR"
     gene            <752692..>753675
                     /locus_tag="LMJF_33_1580"
                     /db_xref="GeneID:5654581"
     mRNA            <752692..>753675
                     /locus_tag="LMJF_33_1580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685867.1"
                     /db_xref="GeneID:5654581"
     CDS             752692..753675
                     /locus_tag="LMJF_33_1580"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685919.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654581"
                     /db_xref="UniProtKB/TrEMBL:Q4Q429"
                     /translation="MIAIAATPTLSNGAGMAVQRLRILLPGERRGEVRLLTFKKSVLT
                     AASFEEATHDGYTHRLGSPYRQGYGDTHRMVDKVLHQAPLRAVAITEDGKSGVTMSEQ
                     GMRIRVLDFVGDDKMTNRLTLDRGHLPAVVDTVSLAIVAVPQAHPLMRNAAAPTAYTH
                     ERCGSNDNNAPAHVSEALSRQYQHLTEAVHDIVVCLTSSGTTHIFGCGLQQVLFYHSD
                     KTLLPRVGYPYAFSVCLPPLLAKEGVVSVFVARSDVTTSAVHYLPRHEHYVTKGGKRD
                     SSNDATDHLPGEFFAFELRYHSSTAAAAAAAGGAGSTSKYTMLFCFVLSAP"
     gene            <754848..>755828
                     /locus_tag="LMJF_33_1590"
                     /db_xref="GeneID:5654582"
     mRNA            <754848..>755828
                     /locus_tag="LMJF_33_1590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685868.1"
                     /db_xref="GeneID:5654582"
     CDS             754848..755828
                     /locus_tag="LMJF_33_1590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685920.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654582"
                     /db_xref="GOA:Q4Q428"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q4Q428"
                     /translation="MIYIYTWIWAVVWYICGWVGPLSVLTYLVAIVAQQIALRFPQDL
                     GKKYKTHWGLVTGSSSGIGKAIAEKLASQGINVVLVALDDKMLADTFAELQKKYPHVQ
                     FRKVGVSLSAKDYAYMKDITSQTDDIEVGLVFNNAGYICTGLFADTDLERLRCNLECN
                     AGCAVPITHHFLRKMIKRKSKGLITFTSSAACYLPGPTATMYSPSKAFLTNFATTIAA
                     ENHDLGIDVVVIHPSPVNTNFYKNEGPALDSLKTAQKSAISPMNIAEQIFASAGRLTV
                     LDQGSTCMIIRIITKVLDFQIFAEIITRFAHMNGDHLRLRKESKLRTSRE"
     gene            <756796..>759495
                     /locus_tag="LMJF_33_1600"
                     /db_xref="GeneID:5654583"
     mRNA            <756796..>759495
                     /locus_tag="LMJF_33_1600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685869.1"
                     /db_xref="GeneID:5654583"
     CDS             756796..759495
                     /locus_tag="LMJF_33_1600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685921.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654583"
                     /db_xref="GOA:Q4Q427"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:Q4Q427"
                     /translation="MKCTARWCNTGGVVAAMERAHRHVPRQTFMSRAATDGEAEHSHT
                     PRYLIPDLQRYTERQQENQHAHKQSLSELPRLYEHTMNTPTAVSPTLAQFIHAAKTAF
                     ESSLASFQHQALASQSAAQLAVNDTARCLPQPPVQRTGGASRSELEAAVRSYNPTLDR
                     ALVQRIAARLAIADTLCIARQLARYLQESAAAARDKGDAGNNDEHQVTAAQAVALLRR
                     AVDVCRERYVQNSADTRTTSRPTSPRLWALTSAARESAGIAARLHSAAAATKHAHRRR
                     RQLHRCFLRYTSDVQVNEVLSNGAVVTFTHATRPEEVGSRASPAEGKGAEGNPDTSAA
                     AAKAKRTPPCFSTPASFRESLESCLTSSPSTVHLHFVLYRRGVSLAAAIADIVEASEG
                     LISAHDVSVNIRMPENDEHVVVQACSVRVALPASTQPCGVEDAVQHCLHAARAIVQIN
                     LVRGTPRVALQLLACRTDACGEQHTASQVLDESPRRLQYALLLRGFEQRGGPVNRLDH
                     TSLACAMCVPNYFSPHHFGAAAVPFFRTYHVTEALAKRRYADAAVMMACLEVETVAEA
                     STEVPPWLARALQLLCRGEDREGVWQAWWIHEVPAATQRRMVCAKSDLVWNVVASHRL
                     QELVAATGGCRDVLLAAAPKPGDFVFQLEEAEDSGATSAALAPVALSAPVTAVYSQAQ
                     AARYSVHDIALPLVLDASSEFEGCESLAVIEAQLGFTHDRRRHLSLHPSQRPCQSHTS
                     LPAVAQTNETVFRPLLVEATGYPRATRPWCRSFPEPSVGPAFDRPKAALESNATVFAL
                     ATDWDLASQTAVARDYAAKSRGPRACVWPLSKRGRALTDRLPAGLMTVASADGSSLLG
                     GASTTNYHGSRCLAIHCTLPARVSLANFVSELAAVEDLRDSQA"
     gene            <759974..>761392
                     /locus_tag="LMJF_33_1610"
                     /db_xref="GeneID:5654584"
     mRNA            <759974..>761392
                     /locus_tag="LMJF_33_1610"
                     /product="putative peptidase M20/M25/M40"
                     /transcript_id="XM_001685870.1"
                     /db_xref="GeneID:5654584"
     CDS             759974..761392
                     /locus_tag="LMJF_33_1610"
                     /codon_start=1
                     /product="putative peptidase M20/M25/M40"
                     /protein_id="XP_001685922.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654584"
                     /db_xref="GOA:Q4Q426"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="UniProtKB/TrEMBL:Q4Q426"
                     /translation="MSDCHWAVIRKAVEAEWDASIIPALAAYIEVPNQSPDFDPQWAT
                     NGLLTKAFTILINWMKGQNLLGLSYELMEVEGRTPFLLVEIAGTEPTKNTLLMYGHMD
                     KQPPLHPWGEGLDPHKAVVRDGKLYGRGGADDGYALFSAITSVSVLQRHGIPHGRVIV
                     VIEACEESGSFDLDYYMERCKERIGNVDLMICLDSACLNYSQVWLTTSLRGVTGGVLN
                     VQTLTESMHSGVAGGVVPDTFRIARELLDRVEDSKTGKVLFPEAYCEIPDYVVKSMES
                     MKAVPFKEQFAMADGVSAEPGDNVELALRNFWKPSLTVTGSNLPEPQIAGNVIRTHTS
                     LKLSLRVPPLVDAEKATQAMAKVLVANPPYGAKVWFEPEVPGDGCATPELKPWLVTAL
                     NEGSKMAYGNPLAFQGMGASIPFISMLLKAYPQAQFVVTGVLGPKSNAHGPNEFLHIE
                     YAKGLTFAISRVVAEHFSHTPK"
     gene            <767750..>770467
                     /locus_tag="LMJF_33_1620"
                     /db_xref="GeneID:5654585"
     mRNA            <767750..>770467
                     /locus_tag="LMJF_33_1620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685871.1"
                     /db_xref="GeneID:5654585"
     CDS             767750..770467
                     /locus_tag="LMJF_33_1620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685923.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654585"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q425"
                     /translation="MDLLPKYLNELQDSNKMKRCAAYKKIHEFVKAQRGNLSKDDEFS
                     IIRSCLKGFEDTSERSREEAARITIELLPGQDASVLDWVLPSVVTRIGIVPVAEESEE
                     IRLLLLRLGTACMTCFPHDIGPRNYIDFFLVLLENCFRDPFPELKKEACKAACQLCSI
                     EPKQVKVISTPLAKALKDSCLLHKHSAVRCEAAQTLAVLFRCGASEVLRDGKDEPENR
                     TMASELFVLCNDHSEPVRLAALSVLSCALLDVKERLEMHAKYLPHLMLLVTDSFDAVR
                     NMARKILERVGQLYMIDNEDNRIDMANRRITMKDIEWYGDAEYPSMTFTAPSAECCDL
                     FHSRPSLGTRYVVAEAVRAFLDKILRDITAVDWMIPFSTNNRKVVALKLLWTTIYYCE
                     KSCVQFTERILSAVYKAFADENVEVRQEATFCVEILGKFLVPEQYLPFLIAKPAANAD
                     PYEDVSVIERSRNKMVVLTSLDDACGPMPTLFSTAAVTVKCSILQALAYLIEGSKEKL
                     TPTHSSRIIQALTTSDLIECENEHLLGALLETLQKVIPVFVAKGFIASPEHPLPNEVL
                     HDPKQRTLDSIILYSLLRIKSTEIPALQLKAGETITMLSTLVTGSITGIYSLHAGRLL
                     FRYRAALPVSAFSDLVLNADGIDTLGGVLTDIFESRLTDINFAVKVTEELRYFTVLEQ
                     LLWRRTGAFAPSETSELLRAVVLPLSAFQPGNTAHLFRKVAVNCLCALLDPVYCDALQ
                     AELVKNSNALSTTVINSWCAASDADDGEMRLVCMSVLFEVCRLPMVKGAAHEIIQSVL
                     LRFDDSNDAIRLRTSNELTRLLADNWGASPLIVDEVSAQVVPLAKKMLVYLDDTEETI
                     GIRPSLAEALKRLGDISPHIVVDLTRSALERHAERGYCQDVLSYLEAKD"
     gene            <771363..>772025
                     /gene="CYP4"
                     /locus_tag="LMJF_33_1630"
                     /db_xref="GeneID:5654586"
     mRNA            <771363..>772025
                     /gene="CYP4"
                     /locus_tag="LMJF_33_1630"
                     /product="putative cyclophilin 4"
                     /transcript_id="XM_001685872.1"
                     /db_xref="GeneID:5654586"
     CDS             771363..772025
                     /gene="CYP4"
                     /locus_tag="LMJF_33_1630"
                     /EC_number="5.2.1.8"
                     /codon_start=1
                     /product="putative cyclophilin 4"
                     /protein_id="XP_001685924.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654586"
                     /db_xref="GOA:Q4Q424"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR020892"
                     /db_xref="InterPro:IPR024936"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:Q4Q424"
                     /translation="MHSEALVISYFLRSCSLKVSLPPKMLRRTFLSAERRIPFYPINS
                     NNPIVFFDISIGSQPAGRVEMELFKDVVPKTAENFRALCTGEKGVGRSGKPLWFKGSR
                     FHRVIPQFMCQGGDFTAGNGTGGESIYGHKFPDESFAGRAGRHFGPGTLSMANAGPNT
                     NGSQFFICTAPTDWLDGKHVVFGQVTKGYDVIMKVETQGSQSGATRQPITVTDCGEIK
                     QE"
     gene            <772472..>772843
                     /locus_tag="LMJF_33_1640"
                     /db_xref="GeneID:5654587"
     mRNA            <772472..>772843
                     /locus_tag="LMJF_33_1640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685873.1"
                     /db_xref="GeneID:5654587"
     CDS             772472..772843
                     /locus_tag="LMJF_33_1640"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685925.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654587"
                     /db_xref="UniProtKB/TrEMBL:Q4Q423"
                     /translation="MEKDLNAERVDIEIAVEEVTEAKQYLVDLDRRKNQYREAQRKIL
                     TARPEEDLWILSGGSTFVLCELSHTDTLKYFEWRLQQCDNEIERAREDLKLKVAALAV
                     LEGADSALARLYEGFDLKGMS"
     gene            <773183..>773980
                     /locus_tag="LMJF_33_1650"
                     /db_xref="GeneID:5654588"
     mRNA            <773183..>773980
                     /locus_tag="LMJF_33_1650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685874.1"
                     /db_xref="GeneID:5654588"
     CDS             773183..773980
                     /locus_tag="LMJF_33_1650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685926.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654588"
                     /db_xref="UniProtKB/TrEMBL:Q4Q422"
                     /translation="MAFQFPCGAEFLFVTQYLLQFDDTVKFKLRREGRRTVLQVSTVN
                     IPPFSYTTVDFADESERPQKIAAVEPYATSWAVNAIFFTSVLSCFSGLSPITLEVADD
                     LSCVLLYQKKEDDTGVQVAQVGALHDLGPKLLVDHDVGVLYTIADVRNFGEIVRSVCA
                     GDDERCDVFLRRVSSTVCELGMKTSTVTSSLQLLLDECDGVSKRLEGSARCTDLQEYA
                     RLCTRMTKLAAKTSLMLGFGSDGIALFRFEWLTERGSRTADLFFCTS"
     gene            <774334..>774948
                     /locus_tag="LMJF_33_1660"
                     /db_xref="GeneID:5654589"
     mRNA            <774334..>774948
                     /locus_tag="LMJF_33_1660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685875.1"
                     /db_xref="GeneID:5654589"
     CDS             774334..774948
                     /locus_tag="LMJF_33_1660"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685927.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654589"
                     /db_xref="UniProtKB/TrEMBL:Q4Q421"
                     /translation="MQGRPLAVQLGDTHGVVVYHATALAPEKLCATFEKFGKTSVVHS
                     FELTDGNHATVVFFSEPMNCAVCYASLSRLAKEPENSGIIDVGWIHENGIDAFARRSY
                     VRHKYTSAVSTVGARFAASNGYLVVYWKGVAEPDRREISQMARSSAVEVFEDDKEGGR
                     SFLRFCSEDAADAFHSDLLSRFAAMRRSLSYADATDFSLAKGAA"
     gene            <775345..>776709
                     /locus_tag="LMJF_33_1670"
                     /db_xref="GeneID:5654590"
     mRNA            <775345..>776709
                     /locus_tag="LMJF_33_1670"
                     /product="UDP-GlcNAc:PI a1-6 GlcNAc-transferase"
                     /transcript_id="XM_001685876.1"
                     /db_xref="GeneID:5654590"
     CDS             775345..776709
                     /locus_tag="LMJF_33_1670"
                     /EC_number="2.4.1.198"
                     /codon_start=1
                     /product="UDP-GlcNAc:PI a1-6 GlcNAc-transferase"
                     /protein_id="XP_001685928.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654590"
                     /db_xref="GOA:Q4Q420"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="InterPro:IPR013234"
                     /db_xref="UniProtKB/TrEMBL:Q4Q420"
                     /translation="MGQHRVALVSDFFFPGFGGVEVHIYNLALCLMRRGHKIIIITRA
                     YGDRVGIRYYTNGLKVYYLPMLAAKLPPGSVTLPTWLGAFPMLRTIFIRERITVIHGH
                     QTTSNMCHEAIFHAGTMGIKTCFTDHSLFGFADAASININKVLVWSLRTVDQVICVSN
                     TSRENTVLRARIAPQRASVIPNATDTSAFTPPDDLKYKSWASKIDKEGLTIVVITRLV
                     YRKGADLFVDVIPEICRRHPDIKWVIGGDGPRRSQLEQMIERHNLMNRVKMLGALKHS
                     DVKSVLNQGQIFLNCSLTEAFCIALIEAASCGLLCVSTKVGGVPEVLPPPMLLLADAD
                     PSSIVAALEEAINDVPHHSPWTLHDNCKQFYSWDWVAERTERVYDRIMEMPTLSLYER
                     LMNYASVGPLFGLVCWMLCSLDWILYRLMEYWIPTETIDIAPDFPMSFYLRNKEKIMK
                     KNGE"
     gene            <777262..>779649
                     /locus_tag="LMJF_33_1680"
                     /db_xref="GeneID:5654591"
     mRNA            <777262..>779649
                     /locus_tag="LMJF_33_1680"
                     /product="thiamine biosynthesis-like protein"
                     /transcript_id="XM_001685877.1"
                     /db_xref="GeneID:5654591"
     CDS             777262..779649
                     /locus_tag="LMJF_33_1680"
                     /codon_start=1
                     /product="thiamine biosynthesis-like protein"
                     /protein_id="XP_001685929.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654591"
                     /db_xref="GOA:Q4Q419"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR020536"
                     /db_xref="UniProtKB/TrEMBL:Q4Q419"
                     /translation="MPSNRQEEKLPTNPRAFPDDRTPNFILKAKNGHFHFMMVQPDVS
                     KNYLWYMSEPKLVRVPELEAEMRVPGRRWYATDKAGFELQKRNNAVATEGEPYVCLHN
                     IKNPELYWFGKRHAEPPVEQVTLVISVGELYLKSAIHRKRLVRVLMDNIRRVLQNPQV
                     FRNGDTMIEVRKEMPTKEQLKLLALLPGIAKIYEASQERGERKGDPRGAFICSGAQGI
                     PITPDQRVLALISGGIDSPVAAYRMMTRGCLVSGVHFLNSTNDTASVVEKNRRICERL
                     SSLQGRFNMHYVDISTLQSQIVANVPNHNRTLIYKWFMLSLAASFDDSCFIVTGDSAG
                     QVASQTVHNISTLYPTFCKAVIAPLIGVTKNFIIDEARKINTFDFSIQEGADCCQYMM
                     CKSGANLMMGRRTLEACVRRIKLTELKVMKEVYRDGKLCESSEFTYYPQPGVRASNKT
                     PPPAGLVQDASSEDDVHDVVYFDAAAGTKIAEQVRMAMMRAPEGNPNSMHMSGREARM
                     AVEKVRVQLAKVMHVPANDIIFTSGGTESNNIALNNYRVVREPWSHPSTRENSNIPDG
                     ATVVKVVDLVNHETGSIDRNLTRPEGGRLHIDASQGLLKVDFGSLDLSQVDSITVTAH
                     KINGPVGIGAVYLRDLTCNKLFSGGSQEKGIRPGTENVPAIVGFGAALALDRSNSLHK
                     EIDALMTEELEKMGCEINRRGETSGYIVHATLPPGYSNTDVVSRLSTKYHVEIGTGSA
                     CKTNEVNTTVYDTLGKTPAPTRSIRISWDSFATLHDAERVLSALKNVLGEIKLMR"
     gene            <783092..>786190
                     /locus_tag="LMJF_33_1690"
                     /db_xref="GeneID:5654592"
     mRNA            <783092..>786190
                     /locus_tag="LMJF_33_1690"
                     /product="putative DNA polymerase delta catalytic subunit"
                     /transcript_id="XM_001685878.1"
                     /db_xref="GeneID:5654592"
     CDS             783092..786190
                     /locus_tag="LMJF_33_1690"
                     /EC_number="2.7.7.7"
                     /codon_start=1
                     /product="putative DNA polymerase delta catalytic subunit"
                     /protein_id="XP_001685930.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654592"
                     /db_xref="GOA:Q4Q418"
                     /db_xref="InterPro:IPR006133"
                     /db_xref="InterPro:IPR006134"
                     /db_xref="InterPro:IPR006172"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR017964"
                     /db_xref="InterPro:IPR023211"
                     /db_xref="InterPro:IPR025687"
                     /db_xref="UniProtKB/TrEMBL:Q4Q418"
                     /translation="MSSSALSQWKSIARLPLPSSYLQKDVCFQLLDCCQTKGNPHETV
                     SRVRHSEVPVVRLYGVTAEGFSVLVHCYNYEPYLWIEAPPNWLPVYSQAFMRELNDQL
                     SNQTRLQDTVVRVEVHQRRSLMYFKGGQLVPHLKIVVQLPQHIPKLRSLLSDRGVSCP
                     GAWDGIRVFQTFESNVIFPLRFLVDNDIGGSNWLTLTYGKFFASPVKTSTCQIEVVCS
                     HEDVQNHEPLGDYLSIAPFRILSIDIECQGRKGLFPEPEHDPVIQIANHCVEYGHESE
                     PLTKTIFTLKSCAPIAGAQVLSYETEAEMLLAWATFMKALDPDILTGYNICNFDFPYL
                     LSRATALKASDAFHYWGRQVHERTVARDKKFQSKQMGNREYTELTLEGRIIMDAMVVI
                     QRDYKLRSYSLNSVSQNFLGEQKEDVHHSIISDLQHGDEETRRRLAVYCLKDAFLPVK
                     LLDRLMCIVNNVEMARVTGVPVGWLLERGQQIKVFSMLLRKAQKKKLVVPTVEYTGGS
                     DRGYEGATVIDPIKGFYNCPVATLDFASLYPSIIIAHNLCYSTLVRPADARLYPEDAL
                     DRSPTSDVFVKKEVFPGILPEVLQDLLAARKHARAMMKDVPMNSLEYKVLNGRQLALK
                     VSANSVYGFTGAQVGKLPCLEISASVTAYGRQMIDRTKNLVEDLYPGARVLYGDTDSV
                     MVKCVTDEKASDKERLQEAMDFGIEAAEKVSSNFLKPIKLEFEKVYFPYLLMNKKRYA
                     GLLWTNTDRFDKLDAKGIETVRRDNCPLVARMVSGVLNRILIHRSVESAVEFVKGTIS
                     DLLLNRLDISNLVITKAFSKAEDEYAGAQAHIALVERMRQRDPASAPTIGDRVAYVII
                     KAAKGAKAYERSEDPIYVLDNNIPIDTQYYLEHQLAPPILRVFEGVLDDPSVLIKGDH
                     TRHIAISAPSKNAGGLMRFVKVQLQCISCRAVIKAGALCDNCQDKAPEVYGKIVAKRN
                     HYEAIYSQVWTQCQQCQGSLNQEVICSSRDCPVFYMRKKVQKDLHEQQVLLDRFGVVD
                     DW"
     gene            <787894..>791205
                     /locus_tag="LMJF_33_1700"
                     /db_xref="GeneID:5654593"
     mRNA            <787894..>791205
                     /locus_tag="LMJF_33_1700"
                     /product="putative DNA-dependent ATPase"
                     /transcript_id="XM_001685879.1"
                     /db_xref="GeneID:5654593"
     CDS             787894..791205
                     /locus_tag="LMJF_33_1700"
                     /codon_start=1
                     /product="putative DNA-dependent ATPase"
                     /protein_id="XP_001685931.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654593"
                     /db_xref="GOA:Q4Q417"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR015194"
                     /db_xref="InterPro:IPR015195"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q417"
                     /translation="MAAAIARRVRIRQDLHNTPAFERDMNDVAAQDLYEQILLSSIRS
                     GSDPNAKAVVEVYEGYMEPSYDPVKGASVAASHRQVIQEIYREREVIIRTLRSSEEHR
                     ELSAFDRLLRETEFYTGVREWKGASARGPRSRLYRHASRDNEEDSTGFDMMHLTETPS
                     YIRGKLRPYQIEGVNWLLGLFARGVNGILADEMGLGKTFQTIATIAYLKFTVGMPGPH
                     LVVCPKSVMGNWYREFKHWCPGLLVYKFHASSDIRPSIVKAHLHPTDRIKYDVIVTTF
                     EMVLDELNLFKRIAWQYLIVDEAHKLKNEEGRAHTALDSLQTSHRLIITGTPLQNNLK
                     ELWALLHFLAPRLFNDSESFDTWFDTTSGQQDANVMSNLHKILAPLMIRRLKADVSTG
                     IPPKKEIYVSCQLSKKQREWYMNVLAKDAEVLNKAGGSVASLTNVMMSLRKVINHPYL
                     MDGGEEGPPFVTDEKLVRTSGKMVILDKLLHRLRADVQGRHKVLIFSQFTSMLNILED
                     YCNMRGFMYCRIDGNTSGYDRDSQMASFNSPSSDYFIFLLSTRAGGLGINLQAANHVI
                     LYDSDWNPQMDLQAQDRAHRIGQKRSVRVYRFVTDGTLEEKMYRRALKKLYLDAVVVQ
                     QGRLQSKATNQATKEELLSMITFGAEEIFKTRHEDVTEADIDRLLDEGETISNQLTND
                     AKQQVQMSLASFQLGAEEANIYDFEGVSYKTGAESRILHLRLSLPVSQAELQAQCSQY
                     GEVIKAVLHPNLKEALVYFRSTSGAMEAKAKLPYESAFASRDSQTVVSSDMIAECIGV
                     GEKLGRGHRMREPVQLFTEADVESMQKKATKAPPLKLPKLPKFHPYQLYNAKRLTELH
                     NTEVALMVRNWKRKYEEKSDAQKSKESNEEGACDEADGKAEDEDELLTEVEQEERERL
                     LSEGFPTWTFYEYRSVVSALTSGKMDLTDYAAIAAAVGGTKTVGEVRDYVVALLERGE
                     QCIKKFALVEERIKKAKLRREAKENVFKAAKWKVETCEHPEKELTFKARGNVALDREI
                     FLMAYETGFKANNTSELVRTRPQHIFNVWYQSRPDGFFSKRLHTLMKSVQREWEKPAD
                     DDGAMPSKGHRRLEI"
     gene            <794581..>796503
                     /locus_tag="LMJF_33_1710"
                     /db_xref="GeneID:5654594"
     mRNA            <794581..>796503
                     /locus_tag="LMJF_33_1710"
                     /product="putative protein kinase"
                     /transcript_id="XM_001685880.1"
                     /db_xref="GeneID:5654594"
     CDS             794581..796503
                     /locus_tag="LMJF_33_1710"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001685932.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654594"
                     /db_xref="GOA:Q4Q416"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q416"
                     /translation="MSKEAAKTPREDGGVAKKGDSKTPKKLIGGHIELGHVLGVGGFG
                     KVYNAYDVTKKVHVAVKMIDKALVRSSGIQSYVEREIAMMRKMKNQHVVRLLEAIETS
                     KAYNLVMELAPNGELFDKIVDLKRFDEETARNYFQQLICAVHYCHRMNIVHRDLKAEN
                     LLLGENNVLKVCDFGLSRYTKEGRFNDHEVLFTSLAGSIDYQAPEVLKERGYEGDSCD
                     MWSCGCVLFFMLCGYLPFTDRSDGLTRKRIMSCQYNKTSRYLPEQAADLIAHLLVPFP
                     SARYTTSDVIQHPWFRVNLDPSMFPDDNVVSTPMSPLGNGEFIQRVITPQMSSGSFGA
                     APSPTTSKADEMHQAFQSCNITGDGFLNKEEVRDALIKLNGGNQVTEQEVKDFMSNFQ
                     VDQEGRITEEEFVMGWTKHQNDLGSKYDLSKMAHLFHYDLEKEFLQVVREAFDLIDSE
                     HSGIITKEKLKSLNLGLTDKDAESAFSSMDTEHKGLSSLTFEGFVGLCLQYDFFKNHP
                     LAIRLRRLNAFFEATEHAAFRASLNTGYTVAGQREVIKALLLSKQESLSTAFEEGDGN
                     GFLYGTYTQDSKKVLEIGVRLLPAAAGYTKVIVYRIGGKTIEFHKWFLDLRRLMKDEL
                     LRCEEDTAVKGEPELM"
     gene            <799217..>800443
                     /locus_tag="LMJF_33_1720"
                     /db_xref="GeneID:5654595"
     mRNA            <799217..>800443
                     /locus_tag="LMJF_33_1720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685881.1"
                     /db_xref="GeneID:5654595"
     CDS             799217..800443
                     /locus_tag="LMJF_33_1720"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685933.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654595"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR026000"
                     /db_xref="UniProtKB/TrEMBL:Q4Q415"
                     /translation="MSSGRILLSTKKQKYAVVTSNNKTLLSHDDLRCIDRFVDKRVVT
                     ATYVNGTQPPPSHGIPALPFEKVSENCDSVLLLSVSAIHERESALDAPLRFMAPEEYH
                     APTLEEPPTRLPLARRIVALLQGAMSSMVSWRYTPPVAKDYTVTEIQVTKDAEARAHS
                     SLRAGNKSKAAHLFCVSGCFHYNYGNMEWAVSCFKKALSIAEELEDARCLAFCHNILG
                     VCFYRLGEYKMSLVHHKKQEALGGSYARAVAQTNMGVSYAALSELEFAQQAFEDALLN
                     ARETGDSMLLTIALGNVGLVSLRIGDMRAAQLHLEQCLEQCSIAGDKSGASLCLLLLG
                     EVYSLIHDHQHALFYYKHAYRVGGEANNPDVVSMARVSIGIAQGNLEIGDSVLREAAL
                     MGKTNSVQSIVSQLPQ"
     gene            <801619..>804300
                     /locus_tag="LMJF_33_1730"
                     /db_xref="GeneID:5654596"
     mRNA            <801619..>804300
                     /locus_tag="LMJF_33_1730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685882.1"
                     /db_xref="GeneID:5654596"
     CDS             801619..804300
                     /locus_tag="LMJF_33_1730"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685934.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654596"
                     /db_xref="UniProtKB/TrEMBL:Q4Q414"
                     /translation="MGTPRLTALISRCRKPIFTAAEDVALTSAALLDLTLYLDARETR
                     ECLVPLKKFARHSPETLQAALDSTDVSPEAADDGRRFAAVSRVIPASKSAVATALWSR
                     VVSTTTRALEAGVWTPSDLWAIITHIRRFSTYDAAFVECAARYAGAAIPCASADDLPA
                     LVSIVTSLPELVAHPTRLLDAAGDRAAVLAESLTPGAVGHICGQLNRSLCTNTNTVIA
                     FQEEAGRCAEKGDTFTAVQLMCFVARHKPALISGEAVVWLMERITGEELDVRSLENLC
                     SAVVHLPVAVRTALRQELMEFVAFLSLQARELLQQVPAAQGGLSGCSDADAIQYFVSH
                     VLELTVMLRTYPDLQWPPEFLAAVDACAASVEPLQEALLSAESSPVGLMVRLLEAPTG
                     ECKRVGLAMLREAANQCQSFATLQTFRFLLLMGDHGLQDVGTSRYLRDQFAKTAADVP
                     PVQLSVALRCLGVATAGAATQGASGAGELRATVEGTAGNADLDDELERERLDAFLQFC
                     VEVSRKHLSQGAPLRCVLATTESLHRLGCRDTAFFADVAAYIAAKHAAAPAERESADT
                     ATAVCAALGEDLLGEYPAVREFLLDVAQRGVRGESAMSPTQWMNLHDPSNALTPLTEQ
                     QQESWDIVEEMVRTRSDDVDALVRLAEKYMELLPFARPDDHKYFFGVCEEKVLKQDKL
                     LKKCLDTIVDCGAVSRLSAQTIASILHSLAAIRFEYFASVKRFTSSISDEQWLLMEAA
                     PLVQILTGMDKLSLRTPAVLRRIGGRLTEICRFLTPLDTAQAIHALQALGHNDAKLLG
                     KLAAHAAALARRFDEASMAVLFSTPSIHRLMSTPEVARPLLLQASAKIQSQHRREKIS
                     AWVRRSGLPRELIDESTRRLQVTSGDARSSEVHLRLT"
     gene            <804898..>805239
                     /gene="MIF1"
                     /locus_tag="LMJF_33_1740"
                     /db_xref="GeneID:5654597"
     mRNA            <804898..>805239
                     /gene="MIF1"
                     /locus_tag="LMJF_33_1740"
                     /product="macrophage migration inhibitory factor-like
                     protein"
                     /transcript_id="XM_001685883.1"
                     /db_xref="GeneID:5654597"
     CDS             804898..805239
                     /gene="MIF1"
                     /locus_tag="LMJF_33_1740"
                     /codon_start=1
                     /product="macrophage migration inhibitory factor-like
                     protein"
                     /protein_id="XP_001685935.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654597"
                     /db_xref="InterPro:IPR001398"
                     /db_xref="InterPro:IPR014347"
                     /db_xref="PDB:1VW5"
                     /db_xref="PDB:1VW6"
                     /db_xref="PDB:3B64"
                     /db_xref="PDB:3FWU"
                     /db_xref="UniProtKB/TrEMBL:Q4Q413"
                     /translation="MPVIQTFVSTPLDHHKRENLAQVYRAVTRDVLGKPEDLVMMTFH
                     DSTPMHFFGSTDPVACVRVEALGGYGPSEPEKVTSIVTAAITKECGIVADRIFVLYFS
                     PLHCGWNGTNF"
     gene            <805663..>806004
                     /gene="MIF2"
                     /locus_tag="LMJF_33_1750"
                     /db_xref="GeneID:5654598"
     mRNA            <805663..>806004
                     /gene="MIF2"
                     /locus_tag="LMJF_33_1750"
                     /product="macrophage migration inhibitory factor-like
                     protein"
                     /transcript_id="XM_001685884.1"
                     /db_xref="GeneID:5654598"
     CDS             805663..806004
                     /gene="MIF2"
                     /locus_tag="LMJF_33_1750"
                     /codon_start=1
                     /product="macrophage migration inhibitory factor-like
                     protein"
                     /protein_id="XP_001685936.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654598"
                     /db_xref="InterPro:IPR001398"
                     /db_xref="InterPro:IPR014347"
                     /db_xref="PDB:3FWT"
                     /db_xref="UniProtKB/TrEMBL:Q4Q412"
                     /translation="MPFLQTIVSVSLDDQKRANLSAAYGMICREELGKPEDFVMTAFS
                     DKTPISFQGSTAPAAYVRVESWGEYAPSKPKMMTPRIAAAITKECGIPAERIYVFYYS
                     TKHCGWNGTNF"
     gene            complement(<806445..>807260)
                     /locus_tag="LMJF_33_1760"
                     /db_xref="GeneID:5654599"
     mRNA            complement(<806445..>807260)
                     /locus_tag="LMJF_33_1760"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685885.1"
                     /db_xref="GeneID:5654599"
     CDS             complement(806445..807260)
                     /locus_tag="LMJF_33_1760"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685937.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654599"
                     /db_xref="InterPro:IPR027796"
                     /db_xref="UniProtKB/TrEMBL:Q4Q411"
                     /translation="MPFDRYDLAGTANINELVLRHGTMKTSDLKTTRHPALYQRVGRP
                     HDRPSSPFMLDRYLSNLVRALVHPLHNYLQCHHSLHNADEVQVMLMPKDGPIALADRA
                     AVPSRSSSSHGESGALRRCYVATNNETLTQESLQAAVADWGVAGVFQIGEFVLVTGEK
                     GCHAEKKLLEHLETQVLSHAAPPVLPTADQKALIVGERLPCVACRLFAIAFESVAVLL
                     PSHGHLYLSTIAASVETRAAATSGKTKDINAMLASPAEAAALLLAPKHRRLLR"
     gene            complement(808774..809409)
                     /locus_tag="LMJF_33_1770"
                     /pseudo
                     /db_xref="GeneID:12980831"
     misc_feature    complement(808774..809409)
                     /locus_tag="LMJF_33_1770"
                     /pseudo
                     /db_xref="GeneID:12980831"
     gene            complement(<810688..>815583)
                     /locus_tag="LMJF_33_1780"
                     /db_xref="GeneID:5654601"
     mRNA            complement(<810688..>815583)
                     /locus_tag="LMJF_33_1780"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685886.1"
                     /db_xref="GeneID:5654601"
     CDS             complement(810688..815583)
                     /locus_tag="LMJF_33_1780"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685938.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654601"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4Q410"
                     /translation="MSLTSDMEEISIELVSDHDSLYDNSLFEEADDDDDDFVFSSKSV
                     PLVKELMKRLLKVYGSLKEKSTAVENEMAGAASSTNEEEAAPTPALTSSAIAERENAL
                     RSLLELQELYGFLWARLLCVLDEENERCSDAYMATLNMQDRVPFESLAHAIHHNTVFC
                     DHMGEVLGLNYEQQLHREETRNAVGRDLLLEFHTRMERTQCTASHCALLVVEGSRESF
                     LDPISMYDLCKALATEKNPRKRLVPLSLMFSMLDQDEQTVSEALAQNMPKVLLQRFRH
                     WVHQLYGYFPLHRETTLTSRSQRRSPQRYRSAAVASDMDSHPTSRRSSPGRSPILTQQ
                     QMQEVAMDEASEASPVAKTAPDSPLPRSAEPTFTAEASPPEPTGNGARKRQRLDRSVT
                     PQDTKNAHHEGPAEVELYLDGWIPKAGDRVGRGPGWKSGQQGKGCDYGVVEGCTEDEV
                     LVRWIPSLDQPAAGEQDRLFLYQFGSPHYEVVLWETYLRVKTLNVTRADIRVLELLQI
                     GIVAGILCQQSDAILPVLQFQTIESALKVLDSIDIRARFLESEQAREAAERSVRQTLA
                     EHNANEATQEEMVRSLLQWDVNLISMKRCYRLEREMLARIGWVLSAILSHKKLALLFL
                     DADGVSRILRLVQGKLEVYTMYGCAIVLSHLAKTAVFEELLRRQRSYFEPIMQFIIDQ
                     WKHTTNSDVQSSVGAFLFHSLSFPIVIDYFEAENGPTESIEALERCLKISEEQLDVMH
                     SDLLLALLRCLNIYLVTHLMLSTKVIFRKHRVLSALVTQSSRITSLPRDPPTVDAILG
                     FLAAPSPGLPGVSAENVQSLLTAERLGAIQQLVDKGMHTLLLRCANFFFVQSRWDLLI
                     ASLQALCALTVIPYVRPLIAEVRSHESGIAQLLAIVNDLAVSSQNRNSSREGHLLPCV
                     VAALQILIHITNPPADVADESAVANFNNACGAFRASDGVRALLEVLKIRKDASMSAKL
                     NYFPVVARAVQLMAVLRRYSDTAALFEALNIRTLAQDLSAQYSDVQREFISVVGARKL
                     PTELGPAGHFMDNLKSFMPSAFGGVSQADVVKVHAVDPLEMEQRQAIIGRAVVDYSKD
                     SLLQLIAEHLDSEGLSAAAAALRNESGIKSSPATGAPYNDGATATSMSISDAAAKGPT
                     PSLDGVIRSYLRQQQERCPNPIETLPQFDLTKKHVYLPLPIPLDDTRNEFNRLLRRRC
                     GGKFTLRTQTSANWLTYRYPAFMFDITGSGEELQGESVAFCDGGDSIMIGTSEGSIAL
                     FDTFPEETPDEKLLEQHLVFENEAISALVVSDDGSLIAAVNDSHKAHVMRRNLLPVAQ
                     QELTECRTLRFSRDNRLAVVTSEEEHACRVHDLVTGVELRTLSDPIWTGENMANVALF
                     DCTSQLVLNDAILWDLRTHEKPIFRFDRITESFASVFHPKLPLVIIDEKVWDMRTWRM
                     MQTVPSFQKTTSFHCSKAGRVLYSFREASRISGTHLPIVSAVDSYTLDSVFSEEVRPS
                     FKSFAVDPSDRYCAAILDQDIDSVIRLFSLSAGPYPDHGAFASPAVQEEQDSAMGADE
                     EEMEQWSIEDDDYDTDDSTDSNDDEFEEDEDDDDDSYDEEDAEEEFEEWEEEDEEESS
                     PGTGSGSDEQEGTQASSRHAN"
     gene            complement(<816166..>816927)
                     /locus_tag="LMJF_33_1790"
                     /db_xref="GeneID:5654602"
     mRNA            complement(<816166..>816927)
                     /locus_tag="LMJF_33_1790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685887.1"
                     /db_xref="GeneID:5654602"
     CDS             complement(816166..816927)
                     /locus_tag="LMJF_33_1790"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685939.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654602"
                     /db_xref="GOA:Q4Q409"
                     /db_xref="InterPro:IPR013110"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4Q409"
                     /translation="MNYLRHHSITANYRPLGLTSPPPNFAVMQPLLYKHLSEEYESRG
                     ELELGEESITVQPNVFAQIGIIDVNGVRQMWTKAIIPALLDGRKRELLESKGESQADL
                     EARIVFCDIGSGVGNVCLQVLSETKCPKSVGVEIIPSRIRAAEEALKRAKLLYSDIFS
                     KKEAVWVQGDLAKCAARLKEEGVTVLFTHSWMFDDDLMTKLTNVIAQVPSIQCVVTSR
                     KLDEKVLASTTLRQRTLMHFNADWNDEAPFYVYGK"
     gene            <818090..>818737
                     /locus_tag="LMJF_33_1800"
                     /db_xref="GeneID:5654603"
     mRNA            <818090..>818737
                     /locus_tag="LMJF_33_1800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685888.1"
                     /db_xref="GeneID:5654603"
     CDS             818090..818737
                     /locus_tag="LMJF_33_1800"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685940.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654603"
                     /db_xref="InterPro:IPR007599"
                     /db_xref="UniProtKB/TrEMBL:Q4Q408"
                     /translation="MNNVIENALRETPITLVLCGLMGMLGVMSSLEVIHPLYLLLSPS
                     LVFKEHQYWRLVTNFLYFGPISAHCIMEIQWIYLVSSYLEAQYYHRRPLDYIFLLLII
                     GCSLLGLRFSSIVNVPYLSYMLGTCLTYIMSRIFNDMEVAIFFVVPVPMRLLPFVLLI
                     MNTMVSGMTNEVLGNVLGHILWYFLEVFPRITGQSPLRIQRVFERAFAVPVRQAT"
     gene            <819041..>820207
                     /locus_tag="LMJF_33_1810"
                     /db_xref="GeneID:5654604"
     mRNA            <819041..>820207
                     /locus_tag="LMJF_33_1810"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685889.1"
                     /db_xref="GeneID:5654604"
     CDS             819041..820207
                     /locus_tag="LMJF_33_1810"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685941.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654604"
                     /db_xref="UniProtKB/TrEMBL:Q4Q407"
                     /translation="MSRQLLQRCSKKHLVIHMDINKTIIQVDQAGGRTMDDVLNSNVA
                     ANTFGLVDPTDNKWRPLYCTADAPAVPPDTHSGPIMSYEAYIDSLHCAPPGMQELPKA
                     ERDAVWKSVSNLRRQATRKFTFPGEVGESYAPLVDLQRQHLQHSDGYYIIPAFFHMVN
                     TLSELNLRFTLIFRTFGSDLNTVLQEWRSFILGTHACKPSGPVLQELKENYIEPLSGS
                     FFRQADDVYICYGPRVSLSSYLNSGFEETDPAKVLEYLHQVPGCTSAYRTSFADLKDH
                     LVEYFARSKNIGGLVDYYPSWAQAAEHRTGGKVFPISQNDPSYYFVFFDDNIFLGDEH
                     SIVDVREADGAKSVVDAEVERKYCVPVNAFRAIVDKEYFVNELCACLKLQDSEL"
     gene            <820536..>821828
                     /locus_tag="LMJF_33_1820"
                     /db_xref="GeneID:5654605"
     mRNA            <820536..>821828
                     /locus_tag="LMJF_33_1820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685890.1"
                     /db_xref="GeneID:5654605"
     CDS             820536..821828
                     /locus_tag="LMJF_33_1820"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685942.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654605"
                     /db_xref="UniProtKB/TrEMBL:Q4Q406"
                     /translation="MTEYKKLTTLADTLAQDVSTLKACCTDGGDFDCNGSAVSGVDSR
                     LLACDAEHLHLLSTRIREAVADGIPRLRKIVLKARETDPDRQIYNEAMCAKIEALFLV
                     FCEALRLLAPGYFDTLTERDVSLPEDAKERNVLDALLDADFDPNVFLEESASLQAADA
                     VHNHYILHRAKAEAWQSRVAQGLADAVAFESQNRAFILAEEKVSRVAVLEAKRTDKVR
                     VTKIMEVQAELQWQTELQRRDAERSLLIAAAAAISDIDTIPFFLASSISDEALRVTIA
                     GHTLQLIKALLSTPEDMNIRRLRNNNEHLLRDYGHPCLSACDPETGERCVCQRVVSAA
                     EVLWCRIGYIIRYTKVPNSSLDVLRSEAKAHSLLLPCGRSLSAHNYEPMGFEDYSERL
                     FELEEPDAMERADEWMKWYAMMQRMESMLSNMMPRSYR"
     gene            <822497..>825370
                     /locus_tag="LMJF_33_1830"
                     /db_xref="GeneID:5654606"
     mRNA            <822497..>825370
                     /locus_tag="LMJF_33_1830"
                     /product="putative protein kinase"
                     /transcript_id="XM_001685891.1"
                     /db_xref="GeneID:5654606"
     CDS             822497..825370
                     /locus_tag="LMJF_33_1830"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001685943.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654606"
                     /db_xref="GOA:Q4Q405"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q405"
                     /translation="MHPEDGVGTSGAAPISVSEALHSFGGCLTAYERKEIVQYETIHY
                     VGQRCVDKMGSPTNGRNDGYDTEEGEYIFRVKDHIAYRYEILKELGSGAFGQVFKAID
                     HLDSSIVAVKMIRNQRKILQQAEQEIRMLQHVNDRDPKGLYGIVRMTDNFKFRGHTCI
                     SYELLGSNLYEHLKANNFFPMTLSLIRSIAARMLVTLTFLARENIVHCDLKPENILLR
                     DNDPSVVKVIDLGSASFDVKNMYTYIQSRFYRAPEVIMEQKYDKAIDWWSFGCILCEL
                     ANGDPVFPGEDEKDQLGCIMEYLGPPPQSFVEISSARRRREFFDERYKPRPRTTCKGK
                     QREPGSRSLAKFVSVSEDDDFLSFVRLFLQWEPSKRVPPREAMKHRWICGEFVFPTQS
                     EEKPELSSLRKSNGSAIGSLKACMSQEPATPLKTEASTSATVGQPFTARGAPADLLSP
                     SAAHQRVQRPEPLPQLPTACTGRANCDALSGDGAILVDTVPCCRDASASAATHGAARL
                     TDAKVQRPPAQRRQSGRLQRGRQRRSTDMADVEMPGEAITSPNHSAYLHAPLDAEESS
                     AERCTREFIIAANGASSPSSSACGTATRASNTRLHEARLANRVLSSEVLSPAILRSST
                     NPIIVTSRGRNAHSAENKASTNASHSKITNGGAVGNARGGDSAGGVHTRVLELHQKYA
                     DSKTKAGTTDPFDRSGSNIAFDSRSRWFNTAGKPQLSGRRQGSASASDRLDSRGCTSP
                     GVSTESPRGQSRGERREYSINLDAATFPTTEVYQPAAVKDSLHAGEYMLPSELQPFSE
                     GARSSSPHDVEVAPKCRLLAAMVSEPRDKSEKSQLSLQPRGSSPPSSPGPSAAATPSL
                     RPQYQLRQRSTQCSMLAMRDGGAAYAAARSQRAVAGAAAPMSWERPAVRPSDIPLVPP
                     RQTLAQRSLLPQRNGAGTRGGDVAKLSTTPTPQLPSLKRYSAH"
     gene            <834214..>834867
                     /locus_tag="LMJF_33_1840"
                     /db_xref="GeneID:5654607"
     mRNA            <834214..>834867
                     /locus_tag="LMJF_33_1840"
                     /product="putative small GTP-binding protein Rab18"
                     /transcript_id="XM_001685892.1"
                     /db_xref="GeneID:5654607"
     CDS             834214..834867
                     /locus_tag="LMJF_33_1840"
                     /codon_start=1
                     /product="putative small GTP-binding protein Rab18"
                     /protein_id="XP_001685944.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654607"
                     /db_xref="GOA:Q4Q404"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q404"
                     /translation="MGSTTGADKTIKVLLIGDSGVGKSSLLLSFTTGAFDENISSTIG
                     IDFKVKKVDVVDAHTGGKTTVNLQLWDTAGQERFRTLTSSYYRGAHAVVLVYDVNNPQ
                     SFHGLKKWLDEANSYCRRDEAESSSMAFLLIGNKTDLCPDENSMPLPCSIAQGFAQQN
                     NMLFALTSAKTRIGVAQAFDEVARSVHDKLQDLEQYERRRIANLNDGSNNGSGQGCC"
     gene            <836094..>836864
                     /locus_tag="LMJF_33_1850"
                     /db_xref="GeneID:5654608"
     mRNA            <836094..>836864
                     /locus_tag="LMJF_33_1850"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685893.1"
                     /db_xref="GeneID:5654608"
     CDS             836094..836864
                     /locus_tag="LMJF_33_1850"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685945.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654608"
                     /db_xref="UniProtKB/TrEMBL:Q4Q403"
                     /translation="MSGMDDRAKQFKAAAEAQPTGPALKKEISTLRRFLFRNQGYRFT
                     KAAQQALYMAIIAHYGNSAAHHASGYPAACDTPATTASPARADFSVPTSASCADPSRG
                     TGVPHPAGDEDSDDGDRGNTADAADAPILRLLDDALKMPFTVFTSPQKDKLLSLYWTV
                     LGTDGSAGANAGNGTTPITAATLTLSLVDIVDAGKNKAQLSLFTDGGEEYPQEVLVSD
                     ASTLKHLRTALHKGNAISVTVQENETGASLVSFSVDDE"
     gene            <838595..>840517
                     /gene="ABCD3"
                     /locus_tag="LMJF_33_1860"
                     /db_xref="GeneID:5654609"
     mRNA            <838595..>840517
                     /gene="ABCD3"
                     /locus_tag="LMJF_33_1860"
                     /product="putative ATP-binding cassette protein subfamily
                     D,member 3"
                     /transcript_id="XM_001685894.1"
                     /db_xref="GeneID:5654609"
     CDS             838595..840517
                     /gene="ABCD3"
                     /locus_tag="LMJF_33_1860"
                     /codon_start=1
                     /product="putative ATP-binding cassette protein subfamily
                     D,member 3"
                     /protein_id="XP_001685946.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654609"
                     /db_xref="GOA:Q4Q402"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010509"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q402"
                     /translation="MAVVSKLTSSRFLGFYAVQLLCLAAAVRMLRAVVHRRRALSGST
                     KHRSRRFSPSRVGGSSEDDTIKMDRIFWRRFLSLLRLCIPHFVSLESGGVLLLLALFY
                     LRTHLTLLFARVVGRNGRYLVERNTKAFISSVADIGLLAIPGTILQIGVQYVKIMTQQ
                     RLRDNLQATLHKEYLKGNTIYMIAKQSAFIDNTDHRLTQETDQFCKGIAGVFGALFKP
                     ILDVVTLLMELSRHGGLAPPAFLISYYLLVATCMSVLLPNFGQLVATSQQKEGNLRTK
                     HHQLISHAEEIAFYNGEEIERAHVGRLLGSLIRHEYKIKRTKWLTGCSDSLFIKYGAS
                     LVGYLVCSLVVLDQFHLMTKGDLTQLYLQNVQLYVPFSAAIGRMLLMHKQIGALCGSV
                     HRIGELRETLERINASSVRGEAANVFYSDDLVQWRDVDIVSPAGMSLLHDFNLTVTPG
                     KHTLIMGSNGSGKTALMRVLSGLWPVAKGSVTLPTAPESLMCLPQRTYLPPGSLRALL
                     TYPHVTEDARDGKPEQAFVSDEVIMSAAMSFGLNPMMDREGGLDASENWEEVLSGGER
                     QRVALVRVLLHRPQFAFLDECTSAISQDEEPFFYRLLQKAGVTLITVSHHETLRKLHR
                     VVVSLDGEGGCQVSEQ"
     gene            <842839..>844797
                     /locus_tag="LMJF_33_1870"
                     /db_xref="GeneID:5654610"
     mRNA            <842839..>844797
                     /locus_tag="LMJF_33_1870"
                     /product="putative nucleolar GTP-binding protein"
                     /transcript_id="XM_001685895.1"
                     /db_xref="GeneID:5654610"
     CDS             842839..844797
                     /locus_tag="LMJF_33_1870"
                     /codon_start=1
                     /product="putative nucleolar GTP-binding protein"
                     /protein_id="XP_001685947.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654610"
                     /db_xref="GOA:Q4Q401"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR010674"
                     /db_xref="InterPro:IPR012973"
                     /db_xref="InterPro:IPR024926"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q401"
                     /translation="MTSVYNFKTITVVPTYKDFMDIVLSKTQRKTPTVVHKGYHISRI
                     RQFYMRKVKFTQKTINEKLTYILQEFPRMDDIHPFYGDLMHVLYDRDHYKVALGQVGA
                     VRHMVDNIGRDYVRLLKYGDSLYRCKQLKRAALGRMATACKKLNSALAYLEKVRQHMS
                     RLPSIDPNARTLLVTGFPNVGKSSFMNKVTRADVEVQPYAFTTKSLFVGHTDYKYTTW
                     QVIDTPGILDHSLEERNVIEMQAITALAHLRACILFFMDLSGQCGYSIEQQVSLFKSV
                     GPLFTGKPVVVVFNKCDVCTIDDVSSAEQELIMDAIQEADAKWITTSTLTDVGVGDLK
                     TVACDMLLAHRSEQKEGSGRYQAIQNRLYCATPQQRDELERPAFVPASVLQARATGEP
                     PRQRRKTERDYEWENGGPGQYQKNERKTWDLENPEWVDDIIPDIMDGHNIYDNIDPDI
                     HQRLLELEAEEEARLEDLELEASRKHEQYTLDNDTIEAVKFIKDKIKVLKMERAMKNP
                     AIRRTHSQAMAIDKFNKRTGSQDARAKSIADGSGEVPTRKRGRSMSVAQEALIRDRSG
                     SAHVSTKTTRSISGASASRERSMSVNRGDGYRDVNEKLRAVKLSKVKARPLARQARKG
                     EGDHHIPNLRPMHLFTGKVKSNGARDRR"
     gene            <846697..>847632
                     /locus_tag="LMJF_33_1880"
                     /db_xref="GeneID:5654611"
     mRNA            <846697..>847632
                     /locus_tag="LMJF_33_1880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685896.1"
                     /db_xref="GeneID:5654611"
     CDS             846697..847632
                     /locus_tag="LMJF_33_1880"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685948.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654611"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="UniProtKB/TrEMBL:Q4Q400"
                     /translation="MREAFVWEVTLPFSADVYGVLHCHRLRLTIPSPHGHHRIMSENL
                     DRYDAYRLFCISAAAVNGDEDELQDRLGIVEEYLTEYEGLCRAFHKAQRTTHAQEIRR
                     LLADEAEERRFLKEDADSLPWKLFINMSFACAQELVVEHERKMRQGIVAAYTASFTEL
                     LFPYETLQRMRLTWEALDSLALKACIVGRYGVREGQLARTSIPGYTAGSTFPPSARAA
                     AAADAVRSLLAEEHQERQEMIEARGQHVAAALLILASSEKFRSFASASVCGMGFLPQL
                     RNNLASTARQALDNSATRIQSAYRGYRVRAVRARS"
     gene            <848737..>850407
                     /locus_tag="LMJF_33_1890"
                     /db_xref="GeneID:5654612"
     mRNA            <848737..>850407
                     /locus_tag="LMJF_33_1890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685897.1"
                     /db_xref="GeneID:5654612"
     CDS             848737..850407
                     /locus_tag="LMJF_33_1890"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685949.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654612"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3Z9"
                     /translation="MVCPAGSAAAASAAAGHLRGDGPSTVLRLFSFTRGEVGELIDEL
                     VTAEACGVVWVGNRHLALDVRRSSECVHSEAATSSLSSSLLSAPATSTILIEVTKTPE
                     KLKYVRQNQGAASPVSVLGSVLCEIRVVKQSLCFWDLQREKVMHECVLPNRRLRQGKT
                     RVAAAACCDGPFVFVVNNDWTVHGFHVSRRSVRELKPMLSQFESQSVNVANNRGGNAK
                     ASEENSEGQEVARAGEGEEPPMSPQPAKSSALAHKLARPRLFARAISDTQVLLALQGS
                     STILQCACEPKGSRDEEWTVVAKMRLPRRLQAMCEVVGLSPRGCLVRQYELAEGSAPS
                     STAAAPSDKRTGASANSQKTVAYFVVPLEMKATGKTSVEVAVGPPAVTAVHGRSGATE
                     SSAAAPRASTAAAKNAGTAAASEVASEASRTEGKRKRKKSAAPAAAAVNGDASASATS
                     PAATSASAGGTANEQGGGSDQGSASSPLQRAVRRLLVHAGIAGKDEFYGTFAKDSAKN
                     VADAAAAAAASPPERGREWYSADVLMSAGGVLVGVVLGVVLMRRFSLL"
     gene            <851065..>851448
                     /locus_tag="LMJF_33_1895"
                     /db_xref="GeneID:5654613"
     mRNA            <851065..>851448
                     /locus_tag="LMJF_33_1895"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685898.1"
                     /db_xref="GeneID:5654613"
     CDS             851065..851448
                     /locus_tag="LMJF_33_1895"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685950.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1895"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1895"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654613"
                     /db_xref="GOA:Q4Q3Z8"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="InterPro:IPR018993"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3Z8"
                     /translation="MPNQESLKAAMRDSLEANGTISRIKAELRAAIFERLSDVTTKGD
                     DRAVDNPPVPPENMVINELIKEYLTFNGLEHTLAVFQLEARSPDSQVPRRVLASELNM
                     ASAPSSVPLLYAMLHEARLSKDLGH"
     gene            <852270..>852884
                     /locus_tag="LMJF_33_1900"
                     /db_xref="GeneID:5654614"
     mRNA            <852270..>852884
                     /locus_tag="LMJF_33_1900"
                     /product="putative vesicular protein trafficking mediator"
                     /transcript_id="XM_001685899.1"
                     /db_xref="GeneID:5654614"
     CDS             852270..852884
                     /locus_tag="LMJF_33_1900"
                     /codon_start=1
                     /product="putative vesicular protein trafficking mediator"
                     /protein_id="XP_001685951.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654614"
                     /db_xref="GOA:Q4Q3Z7"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3Z7"
                     /translation="MGKEDKMYDILFNMKFASKQMSKSAAASEKAAEREKLNVKRALE
                     KGNPEAARIYAENAIRKRNEGLNYLRLASRLDVASSRIQTAMQMKMVTKTMSTTVKGM
                     DKILTSMDPMRIAKVMDAFEQQVSAMDVNLGTMDTAFESSSAGTVPVAQVDSLMEQLA
                     AENNIDLSAKLGNGPLGSSIAIPARKQDVDEDEIAERLKALQAL"
     gene            <855424..>857178
                     /locus_tag="LMJF_33_1910"
                     /db_xref="GeneID:5654615"
     mRNA            <855424..>857178
                     /locus_tag="LMJF_33_1910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685900.1"
                     /db_xref="GeneID:5654615"
     CDS             855424..857178
                     /locus_tag="LMJF_33_1910"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685952.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654615"
                     /db_xref="GOA:Q4Q3Z6"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR022052"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3Z6"
                     /translation="MKRGAKRSSRDGEDVPGTRARTKDAEEVRKEEERRQRELEEAKR
                     QAELEDDDSWEDDDGDAEDIDDGDGDEEEIIEASDEDDDEYAEFQKESLAHITNSIKS
                     ISFKEAGEAGADNADEAGGAAAVSVWRGDIEGTAVGEAEGGEPITLEFSNKAYDAFFQ
                     LRTEYPCLSFDVVRDNKDNHTKYPLSTVLVCGTQADQQARNELLVLYVTNMCRTKYDV
                     ASDNDSEEDYIGEEDDSEEDEDDEAGEDVNDGEPVVHHRVIKHYGTANRVRCCPQNNP
                     ASGSQLVAVWSEAGHVQVFDIESEVRALIDFSNWSKEQAQVWKQQSAGGQSKKAQPLK
                     FCTPSTSHKTEGYGLDWSPVQASVFASGDCAGSLFVWQPTGDGRWKCAASSTVPGAMS
                     IEEIQWSPTQADVLITARAGGLVEVWDTRDMRACKISFQADPSDINVADWNRARQASH
                     LLVTGAESGAVAVWDLRRIATPEPIQRIALHKKAITSVEFAPHNESVLSVVSDDGRCT
                     LWDLSLERDFNEEQEAVGELFSGKLKEYPDQLMFHHQGLVHPKEAHWHTQIPGMVVTT
                     DYEGLNLFRPMNWKSLMR"
     gene            <858340..>858909
                     /locus_tag="LMJF_33_1920"
                     /db_xref="GeneID:5654616"
     mRNA            <858340..>858909
                     /locus_tag="LMJF_33_1920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685901.1"
                     /db_xref="GeneID:5654616"
     CDS             858340..858909
                     /locus_tag="LMJF_33_1920"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685953.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654616"
                     /db_xref="InterPro:IPR019263"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3Z5"
                     /translation="MNILLPLTILIVSWSLDSTDPDVQRRIFFIFVIVHTAIMCMALY
                     LLFEIWRCDDHTLIQVKDPYSDKESIQKHWEYDIGKLRDLMLTNIGFSAGISTFFALR
                     YGIYFPLLLQSLNNPKALYYSELFRIYAKREKAEGELQRPWKETNTIPEWAKALWNQS
                     EKNSEKLLASSGLASQSSTGGSKASRKRR"
     gene            <861049..>862119
                     /locus_tag="LMJF_33_1930"
                     /db_xref="GeneID:5654617"
     mRNA            <861049..>862119
                     /locus_tag="LMJF_33_1930"
                     /product="putative phosphoribosyl transferase"
                     /transcript_id="XM_001685902.1"
                     /db_xref="GeneID:5654617"
     CDS             861049..862119
                     /locus_tag="LMJF_33_1930"
                     /EC_number="2.7.6.1"
                     /codon_start=1
                     /product="putative phosphoribosyl transferase"
                     /protein_id="XP_001685954.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654617"
                     /db_xref="GOA:Q4Q3Z4"
                     /db_xref="InterPro:IPR005946"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="InterPro:IPR029099"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3Z4"
                     /translation="MSANTPQHHKGHQVAAGETFFYRQHVRPGVETTFRIRLISGTAN
                     PDLTDNVAKCLNVDKCRTEIKRFANGELNIKVVDNVRGDDCFIIQPTAGGFDTDVNTA
                     MMELLLLVHTLKLSSAKRITAIVPYYAYSRQDRKSEPRVPISASAVAQLLQCMGVDRV
                     VTMDLHCGQIQGFFRNIPVDNLLMFPEFATYLTRQPWFDKNQTVVVSPDAGGVERANV
                     LADRIGASHIVTILKRRKEAGKVDSMQTVGNVQGYTCVIVDDMVDTAGTLCKACDLLK
                     EMGATRVIACASHGILTDPACDRINACEALEEVVVSDSIDQRLTTAKCDKLTVLTTAP
                     LLAQAVHSLHTEASLSSLFVKL"
     gene            <866166..>868118
                     /locus_tag="LMJF_33_1940"
                     /db_xref="GeneID:5654618"
     mRNA            <866166..>868118
                     /locus_tag="LMJF_33_1940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685903.1"
                     /db_xref="GeneID:5654618"
     CDS             866166..868118
                     /locus_tag="LMJF_33_1940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685955.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654618"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3Z3"
                     /translation="MSSGFGATYDLNSCTPRAPPSFSLTTVASRRAVFQPYNTSSMRP
                     GDAGPSGSEGSFAVPLDLVVVDPSTDPLWNNQTTAQPIMSIANQDTMNDSFMGADSVS
                     GSDVDGYDGEPNMYVVDLLSALRGYQSSPTEPFGHLVAAALASRSKEMPVRGFEIAAA
                     EHNAYLVRLILDSGTLDETDVEAQRNVQETMDELFSTKDGTVNPAIYEYLTSFFRMPF
                     ARLSHTQYVMLKRSGFEYIKLMYDHQHVLPDESFHSILINQSNVMWILNLIFMVMQLC
                     TIIFSNVAIALVLAKWVELNGGRLQSYALYTLIVFGGGWALNLICIICTVRSRQDETQ
                     YEPRREDEKYLVVPSPYVAVVPAIPLFDIFCLIAYARALRQKRMILGHNIVACSRLSG
                     IIHAIIFAFPQLITQAYFNNIELSIQLEWRRLWPYVLLLVAATTQWCVALFGYAWLLF
                     THDSIDGLGFACFNLGRVSHMLERHTAVAHVLHYVMASVLETNIFLVVATSIRLSETT
                     CRYYNITIIVLSGITVVYILSVCIIIVLKEASTVRISFTCVPLVIIQLVLLICSERVG
                     VEECASFRHLYFRETFIFGYLSWGAYFSLFLVWLILMFQWCVLYKTEVNLFPRLLWPL
                     ARKDTRFSASKKVDSGDETFPTDSVS"
     gene            <869543..>871627
                     /locus_tag="LMJF_33_1950"
                     /db_xref="GeneID:5654619"
     mRNA            <869543..>871627
                     /locus_tag="LMJF_33_1950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685904.1"
                     /db_xref="GeneID:5654619"
     CDS             869543..871627
                     /locus_tag="LMJF_33_1950"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685956.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654619"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3Z2"
                     /translation="MRRVNTLVGERDAAAAVQAVKAALQGSSEPLTDGAEIADSGPSG
                     TGPSGVMPTSRSVFSTKAFAAALFACEANGDAASGLSLVAEVRRCSTSGISTEWLQTE
                     HVLSVILRLQCVAGDRDGATRMLAYLEQHGLLRLRSVSTFLQYCCSRLKDRRLAFAVY
                     EAALKHKIELTEPDYLALGRLCVQVREPVGTLFFMLQEMREHVAEVSEAMVRDVLEPW
                     VMMANEDAAVGLKPRGVPMSLQLHRVDEMHHVPQLSVASPPPSASASARGAASPGDSA
                     AAAPRSGAQLCGVCPACQAELSGYPFTAACRSHLLRELKELIIPQACRSRRALLGFEH
                     WKRYIHARLDAGDRVDIFIDGANLGYYGLSSWYDLAKKQLMLHRGVPESRITDNDLDF
                     GAQCKTSGRSVDVGVNFELIDAAVKLAVDTYGMRSPLVMLHERHVEPKFMTSQNTAIV
                     QRWKDRGWLYCSPTGLNDDLCWLYGALLLTDPTDATPTSVATASASPHRTFVCTNDKM
                     RDHHFRLLSPRAFTRWRDRHRIAFRCSRVGDRTELHWELPAPYERCIQQRDAHSAPSL
                     RELDKQPTPLHHVTSHAAIHADSPHASGTGAVTSWHIPFASGPRSAAASAELNASFDD
                     KNVPHSSGGEQAAVMPNVEGKSAAQYHSAFMQGAGRAQGETTGGEVDAMATAPAQAGP
                     WVCITVHEEAVG"
     gene            <872482..>872733
                     /locus_tag="LMJF_33_1955"
                     /db_xref="GeneID:12980836"
     mRNA            <872482..>872733
                     /locus_tag="LMJF_33_1955"
                     /product="60S ribosomal protein L37"
                     /transcript_id="XM_003722344.1"
                     /db_xref="GeneID:12980836"
     CDS             872482..872733
                     /locus_tag="LMJF_33_1955"
                     /codon_start=1
                     /product="60S ribosomal protein L37"
                     /protein_id="XP_003722392.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1955"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1955"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980836"
                     /db_xref="GOA:E9AEH2"
                     /db_xref="InterPro:IPR001569"
                     /db_xref="InterPro:IPR011331"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="InterPro:IPR018267"
                     /db_xref="UniProtKB/TrEMBL:E9AEH2"
                     /translation="MTKGTTSMGQRHGRTHILCRRCGRNSYHVQWERCAACAYPRASR
                     RRYNWSVKAIKRRRTGTGRCRYLKVVNRRIANHFKTPKA"
     gene            <874604..>876235
                     /locus_tag="LMJF_33_1960"
                     /db_xref="GeneID:5654620"
     mRNA            <874604..>876235
                     /locus_tag="LMJF_33_1960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685905.1"
                     /db_xref="GeneID:5654620"
     CDS             874604..876235
                     /locus_tag="LMJF_33_1960"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685957.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654620"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3Z1"
                     /translation="MYAPFAAQEGNGGMFDFFFSAAASETLCASSAGSNSNNTGIGHG
                     GGEAANGFNAASAGPLVENNNSNDDRVGRLNFDFASFFFQGGQSGAYDDSGLDAAGRG
                     DDGSGADARRSEHYIQRGSADAADSTGKGVLPALGFFFPEDQVAPAAAGGSLILPPTS
                     WCVESAAGADNRYSPPQVQPQNPAAVRETAASLKGDEAAHTVAPPGAALTVLKSDPTH
                     IAPVDQTLVQRLPCEHASSSAMDHECSLAAALAAAPSSLGLLSDEESQRTTVPLSRTS
                     DAEEAKCDETPTRLVAGNSCPEPEARDSSVAEGVAEEDAMPAPTHSRQPPPRVPVVSL
                     PRSSHPPGAAPAGAVVTPTPPSPRQPPAPLTVSTSTPYRPEVPLLIGPAGHDATSVAL
                     SKAIGEAEEVWAHRLDMVPITCPERRDAEMGMSCSGFTPSSSSDAVFLAEVAQLQQQT
                     ARLTEESARSVTSLQVLTSDLLRILGPHAALSSFAGEQYAGTPLVHLPWALIAVLEGL
                     LNDDADAEEKAEGQLVAPRPSSEGVESGSSGVHDA"
     gene            <877640..>879127
                     /locus_tag="LMJF_33_1970"
                     /db_xref="GeneID:5654621"
     mRNA            <877640..>879127
                     /locus_tag="LMJF_33_1970"
                     /product="RNA editing complex protein MP46"
                     /transcript_id="XM_001685906.1"
                     /db_xref="GeneID:5654621"
     CDS             877640..879127
                     /locus_tag="LMJF_33_1970"
                     /codon_start=1
                     /product="RNA editing complex protein MP46"
                     /protein_id="XP_001685958.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654621"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3Z0"
                     /translation="MTTVPESTCAASCESQLCLLCDTPYTSWTEHSREHAHVARSVVC
                     RFFVMPERSESIMQHLERHIALDLKEVDALTDRKVGRRRERLLAGLVHLVEKGVLRDS
                     IPTLPFSTPARGGTDKGRGAGISGVTLGVDADLFLNRVLVGEAFLRREVLDRCARLMP
                     SLTAMELNSVVTYLTSTRQMARIFDELSLIELLVTRSGLESAPANVNTATAAATAAGR
                     AAESASVEPLSETAAAPLPDSDASTESPPAHQPCSSTLAASLPSPPRWSLSREDKVYI
                     MCACLGELHRFHEQERPRSVISKAAADAIVLNVLAGHGRENLVSELVHETLQRIVDEG
                     TVVWRQHQEDVKRRGRSSEANVAGAARISARRAPRTDSTVSEDLCYVRTAPLPSAPSP
                     RPASQVTLDSAAAEQLVSSYLPFNDVDQLSGAETDAVKATAEAPSRSSPDRTCTTSPE
                     CISVLHTSEKDWGPLTAELRKRAEDWNRLPFVPSTPELKASKMPR"
     gene            <880977..>882323
                     /locus_tag="LMJF_33_1980"
                     /db_xref="GeneID:5654622"
     mRNA            <880977..>882323
                     /locus_tag="LMJF_33_1980"
                     /product="putative serine/threonine-protein kinase a"
                     /transcript_id="XM_001685907.1"
                     /db_xref="GeneID:5654622"
     CDS             880977..882323
                     /locus_tag="LMJF_33_1980"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative serine/threonine-protein kinase a"
                     /protein_id="XP_001685959.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654622"
                     /db_xref="GOA:Q4Q3Y9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3Y9"
                     /translation="MAEAIPISSQEVSDKGEAELQFKDILGPIGCKTCKYERVRELGS
                     GSFGKALLVRRVSDGQLLVAKRMDLAAMSEKDKKYATGEIQCLASCDHFAIIKYYEDY
                     VAEPHILIIMEFADAGDLNMQIKQRAKAGFIYFEEHEVGYTFVQLAMAVDHIHRRRML
                     HRDIKGANVMLMTNGVIKLGDFGFSHQYENTVSNQVAQTFCGTPYYLAPELWNHQRYS
                     KKADVWAMGILLFEMMALRRPFVGQGMRALSEAVMSNRRDCELPQQYSRSLKDLCNIM
                     LQADPNQRPSCAQLFKLPHMMKLLLDFGTSVDNSQLVSDALKKKIHANICEIRDTNVN
                     DPEAFTFVGHVGTVRSSVFYEGYVRKESGKTWKERFLVLRNGGLVISRHKGDKETKPL
                     PVAFINSAVYVPEQSACSTGVFAINLADTKTMWFQALPPETAEMWVHKIQQSIGVS"
     gene            <888340..>890040
                     /locus_tag="LMJF_33_1990"
                     /db_xref="GeneID:5654623"
     mRNA            <888340..>890040
                     /locus_tag="LMJF_33_1990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685908.1"
                     /db_xref="GeneID:5654623"
     CDS             888340..890040
                     /locus_tag="LMJF_33_1990"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685960.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.1990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.1990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654623"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3Y8"
                     /translation="MCAHSLYLRSARDVGASEGSVPVGSAQAVRDYIAYLQYSDLRKQ
                     LAAELAKPTAAMGATVTGAPRPPVASSIGVPPPEHGLRGDGAREVCDTAQSWLFPWDE
                     DEIGRDGAQGYVVQPLDCDRAYALHANRLRHWFTAAELASFRGETVLEDAALAGTGGG
                     RRGRSPVAATASASMLPFSTAALPLEPPPPAVAPADAPESAHHPSHSPQSFAATPSSS
                     SSASSASLTSFVSTASLEAYESAARATSGVDGGPHDRRQRTYLGEELGYGEFVALGDP
                     EGLFFIEHVLLAHEPTQGATPASTAGARWTSGNSDKVTEDREQGLTSQSSQGVRSAPE
                     ASGKTAASMAAASAAPLPSHVEPIVTLTARQQCRLLELISVADFMGTQSLVELCATYL
                     AAWLVNRTDEEIVQSFLTTAGPSSAAAGAGASSAPTSFKVTSAASFNEPWIAPLLRDD
                     VAPEKPGEATSMSLPSAGVPAMFGVVKPRMETATAAAVKKRNAAVPKQAGKLKGNHAG
                     STDATAAGPLKYAGGDRGTTTASAAVDPVHAPLLLTDDRRLVLLRQMKRDNSIIVSPY
                     "
     gene            <891472..>891819
                     /locus_tag="LMJF_33_2000"
                     /db_xref="GeneID:5654624"
     mRNA            <891472..>891819
                     /locus_tag="LMJF_33_2000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685909.2"
                     /db_xref="GeneID:5654624"
     CDS             891472..891819
                     /locus_tag="LMJF_33_2000"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685961.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654624"
                     /db_xref="InterPro:IPR019379"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3Y7"
                     /translation="MLIRGSFTLEKAESACQWYYRIGFFGLPWLWAVLWLFFRHYEDE
                     SESIRWYVERAKRYSISGGAVFVIVSVVFLFIIPPTSRIWVIAPFQDTFQWGYFAVNA
                     SEAAGAENASSSG"
     gene            <894402..>898541
                     /locus_tag="LMJF_33_2010"
                     /db_xref="GeneID:5654625"
     mRNA            <894402..>898541
                     /locus_tag="LMJF_33_2010"
                     /product="calpain protease-like protein"
                     /transcript_id="XM_001685910.1"
                     /db_xref="GeneID:5654625"
     CDS             894402..898541
                     /locus_tag="LMJF_33_2010"
                     /EC_number="3.4.22.33"
                     /EC_number="3.4.22.-"
                     /codon_start=1
                     /product="calpain protease-like protein"
                     /protein_id="XP_001685962.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654625"
                     /db_xref="GOA:Q4Q3Y6"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="InterPro:IPR007330"
                     /db_xref="InterPro:IPR022682"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3Y6"
                     /translation="MPSSVPAEASMWMQNAVHLDTDHKYVEAEECYTKAIFLFRQALS
                     DPNMVDTERQKLMNYMSDVAKRIQRLRALNRTSQSAHSPEPSVSPAGPLGRRASPRQA
                     SEHTSPRGSDATATAFGARNPRGKDGEKTPADVENDLKVLDAIQVNQTDPFQASNSSP
                     SPSAASSMSGKRTLPVASPTPSPPSAPPCKPTCGSDGVPDGGKPGGSSAEPPALPTPP
                     PPGSSQRLFGVASHFAPRTSEMVYKAIGIAIQLSQQGELKRAVDVLQHAYSRGSRERN
                     NPGNFKEIGATLKLMRQKYYAKHPPRFLQDNPILPSEMELLRKSGITSTILLPLWDDV
                     QEGYGAENIFMPCEGVWEDAFTPKLCQRQISSGAVLMHFSGYRQAGLDYTIVREADPL
                     HIRQSVVGDCSLVCSLMICASYQKRFPNAKIISNVIYPQDRDGNPILNPKGKYCVKML
                     INGITRIVTVDDRLPVNPQSRRFLCTSSTDPSELWVSIMEKAFVKVCGGSYNFPGSVS
                     YADLYKLSGWLPDSTAFDKPEFDREFQWRRLYQNFKAGALLFTVSTPVKMPAADEALG
                     LAAGHAYAVLDMQEVGKERVMLLRNPWGKQEWSGRYGRRDTSEASVAVRAAFDLKRED
                     EDMGVFCIAYDDVVRCFDTCSLSWNPYMLYRTPEGRPCRPVRIACHGAFDYTISTALS
                     PQLHIGVVDAPKRTRMHLILSRHITDVSEFGRQYEKDDDTTPYLALKVYDVTDYPSVA
                     QHLGGHCSLEMCYCRRLASNSDFKNSIEPLNDVIYRASSARTFSFDCPAGSSNLVVVV
                     SRTASKARQPFNFTVTLHTELEQMRLPRLQGNYGSGAEDKNSLLASANANAGNPHGGV
                     YMHMIPTSSLKFTTRLSGEWVKGKTCGGRTDAATYVFNPQYCLHLDQPSHVSMRLAVT
                     GCEVPCSIQMIKPMSSNKYEESGGSGGTKRKMTDFDGRVGNGAKAGELVLESARYAFG
                     GAVLDSALPFCVCYDRYRALGKLQWREAKKVLVTVTSSNRTPESFIVYDLGDTDTVAV
                     LLLNAIKKGYAASPRDAHFTVSGKPITLETTIASLFQLASSLAGESLASGGDGATTAK
                     SVTVALALDGKAASIESASSPPVRKLKEVMNDIVSDVLKCSSQFSSYVPRLTHLARQA
                     NSALDGASDADVRAYILELTAYLADYVKRCASAVRSAQTPQALLPLLPAGDYTVIPSL
                     WEKGRPGSFELTVETSQPHKAWEIPKEGHNMQETLVRGALHPVAVCLSTSLMKPRAVL
                     SMRDPFFENSKVQVLCPARSVFMSRLFVLVDMVDAEARGQPAKAPATNLSLFRVHNAS
                     SMELVCASDEYSHGGVSTPPVELEAKTRYLLVVSAKESVADKFLLRIYTSGSCTAQLA
                     N"
     gene            <903230..>905863
                     /locus_tag="LMJF_33_2020"
                     /db_xref="GeneID:5654626"
     mRNA            <903230..>905863
                     /locus_tag="LMJF_33_2020"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685911.1"
                     /db_xref="GeneID:5654626"
     CDS             903230..905863
                     /locus_tag="LMJF_33_2020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685963.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654626"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3Y5"
                     /translation="MPERLTARQYTQVRCLLIAAHITTFALSLGMLVVAMLKRSRYLG
                     YFRIVTEPDRDVNISSGLMVASGAIALVQPLLFFGIHVAYPLVRQRQWAVQYDRMRRS
                     AGAGQREQTAQQRTYTLHAESSGHQSTPMDFMRTPVLTVHDSNLHRPLSRTHIEGEGT
                     PQGKVGAVTEASTATATASAAAAAATDTSSSTPRVGPPQPGSPLSLEVSSGPPVPQGS
                     CFFYTPLQNAQGAPRGSSVTVAHKAASCLFSFQSVAETEADVNNAMPLLSLSPSFKKE
                     APELERKPPAAAALPSARRLTGGHPPFYVCKTPSSVKAGETVASRDRYDDATAVVATT
                     AAKAGDAGVGKATPSVSDPASPLPSHVTRAMVKSPGSVVIYESGGTASRRPRRQSTDT
                     EAQRTLDTLHDVDSSTLAAVTEAAPNDAAFRLNASQAQSATNPFHAPSTAFASSSVPS
                     LTPPLLSVRPSDARDTTSTQQACTDASSVTPLRRSAVATPTVTPTAAVPRAASVRERE
                     VGALSSEEVQPPKASREEELQHSQRHLSCSGDFPQRSAASAFLQALAWCIPTRVTAEA
                     SPSQSPPTRRSSTSLRNASVQPLPPALLHICFKSETMFRSLLSAYYIFAGIGILLMYF
                     FGMLWLVRRELQGLNSLVSMAEGWSNVFIYQNVTPAVDAALCSVELDRRCSGGMSLCN
                     ATTYASAEAAHNVSCPFCEASQQMWISTFTQLCSVAYDPSVRYTRAFLILLMLSAIAS
                     LVSLCVAVFSCGTGVLASVGYAALSKREEALEAQAMLETGFFFSTEHAQRAHASYTPT
                     RVSSPLFRATAADEVLSPTTPMAVAPSCERLMHTFEGLHAPSAALLPPSSVVMAELSS
                     SGGLVVPPCGHERKGVVASHE"
     gene            <912440..>914893
                     /locus_tag="LMJF_33_2030"
                     /db_xref="GeneID:5654627"
     mRNA            <912440..>914893
                     /locus_tag="LMJF_33_2030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685912.1"
                     /db_xref="GeneID:5654627"
     CDS             912440..914893
                     /locus_tag="LMJF_33_2030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685964.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654627"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3Y4"
                     /translation="MPSAGMLEPPGCLTADEDATNEQAGQSPAASCNHGIDAQEFSQL
                     YHVAQQAGDSRIEQAVDLLLQLKQWLVTSLHSTGKTPVLDGEAVACLQTTLLHFCRYW
                     PTGATLRQAVDYCSSRNADIEEFDSAEGSRAATAASTALAPLLYAQRALLAATIMLQS
                     FPVTALVAEPVSLETMVRTLHTIAEAGLAEWVACETDALGALVEALRLLAGAELSAQP
                     QAMQWVDWVLDTVALCCEDAADTAATTASHGAPLGAGDLSVPRPRQRLHSSGLSSPTS
                     HPLSGCGETDVIRGSGLVDGEAQNQLRRKQSCHMKSSSRHLHPHPVNNASFADSISSG
                     SPLSFIQSRDGGAAAAAFALLPPRTAPEEHENLCDYLVSLGFLSTLQRISDHALAQCV
                     PSNGDRAGSSAADALASLLPIIGTLYRCFAQSYPEELRGLGVLGTLTSMLNMCAADAA
                     TVEAAARTLVKLTYVEECLAEMQAGTAVIAAAAHALRSQLFRTHADAPQESSIELLVS
                     RLCGVMARVAEDSTEQQEYLVSPPMVHLLEALATRYVTVSGPADVELEHFSDSLPLPP
                     SPVLQAVVWVLGIASMSPQCPLQLVRSVTPPLVRLLAVLRKTPNMQLTAVYVLMCLSN
                     LSYFFGAFEAVEPARSENDGGYASDWLSTLYSSLGLVLAHYLFEDNVEATVEATRILG
                     NISYTNAGRDWMEANHCDEVTVLFLGHEDLRVVYNCCGVLLNLTAASPCRVVQDPELL
                     QTMLSYTSRYTDQDRVEAVTALEEARLRQEQQELQQQRRGGDMKELVSEASSHVAQIS
                     DIVEKLLLNVHGVLHASAI"
     gene            <917668..>920031
                     /locus_tag="LMJF_33_2040"
                     /db_xref="GeneID:5654628"
     mRNA            <917668..>920031
                     /locus_tag="LMJF_33_2040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685913.1"
                     /db_xref="GeneID:5654628"
     CDS             917668..920031
                     /locus_tag="LMJF_33_2040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685965.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654628"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3Y3"
                     /translation="MQEVYTDAEQSDQYHPDAIGIESVQPHRRWFVSHYAHLQAFLQR
                     QPVLRRANIICRWLESTYRDNSRHEPRLRGEEEVVLRQLILTYLRGGELNRAINAAVT
                     YESCVHSCILSAAQLQTVQEPWFSQTALAPLFGEYAHGELNQAWCGNEYRLDNLSQLY
                     EESLKYRSAAAAVGVEGSAAPSTPSAVSDFDAVIGAALCGNLTVLENAFKVNGSWKDM
                     AWCYLRCALVVAFTKQLMVAAGAGGEESGRPAAGVIDRSYAVFIEEMTGSGDNWAASF
                     SQKLVQGLAERLQSGYLPRAPLEEQLQMRFILQTLTCTDGKRSLLSTAPSAGPTSTAL
                     VGAAEWFDIVPEEGDSDAVRLITHVVLAQDVAYGETLSPHAVQVRAGATLATSLARYA
                     VFLALLPRYPFDEGLRAVTAMTLRLRDPQHRASVYAAFIMAAREYELQRQNLSRSELE
                     EQEARLVRQFVTADSDATVHAEVQQLLYQQVAPTELLTHNKLAEKLMWEAMHADSLSD
                     YLAVLHRGLSACCSFWLTEPEPEVEAIADVSSILTRRVLVEIQRRCETHEGGRAGELT
                     GGAASPSTLSQSVSPVTEHERSEATFWYLLSEARGIATEHATIAAQLNAAKHTAAFAG
                     AAAASNRTLIYQLTQDEAALLCKLVEHTQRAVRHGGAVVYRDRQCLTAIIKLVQQLTE
                     AVTLSMLPGVVESDVEEESPPSCDELSRMQQVYGLMEELHSAGYLHPALLPQQSASAL
                     YAQIRAMRVSYGQRVHKRQVVTALRQRAGGAAAEVGRVGAVVAVDGT"
     gene            <921277..>922470
                     /locus_tag="LMJF_33_2050"
                     /db_xref="GeneID:5654629"
     mRNA            <921277..>922470
                     /locus_tag="LMJF_33_2050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685914.1"
                     /db_xref="GeneID:5654629"
     CDS             921277..922470
                     /locus_tag="LMJF_33_2050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685966.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654629"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3Y2"
                     /translation="MTSVPSSATGVAEQQAMPSADTIQQLQEAFCFVRHEREDVRKMA
                     IRGIAEHSKENRDLWFLLASPQYGHSCIDSLLQYLHAGGKHVLGDILTILVNCSADGS
                     CAEMLVQRKVVRKAMRLLDGMERSDQPEPYVRSVQELTLMLLNNLTSSHVTAIDDFLQ
                     KDDEDMRGFYLGKLQVYYELFVRSTEAEAAQAGENLAKPKPSSSHRDLSRWILHILLN
                     LTRTLDGQELLLEDEGWRGTLSSSLSSPNPRHRYLAAQCYRNCGCSPKPLYGLILNSD
                     ALVTAVDRLNCKEPIEDIQRSLAEFIASVLESEDGMARLESVNAKKVLARALDVSQAA
                     HAAKAAATAASCVEVVEEDGVPVAATPTVTLAPSVIEFLQQSVMPYLEDIMDAYIAPG
                     SEELD"
     gene            <923169..>923519
                     /locus_tag="LMJF_33_2060"
                     /db_xref="GeneID:5654630"
     mRNA            <923169..>923519
                     /locus_tag="LMJF_33_2060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685915.1"
                     /db_xref="GeneID:5654630"
     CDS             923169..923519
                     /locus_tag="LMJF_33_2060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685967.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654630"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3Y1"
                     /translation="MFRRLALQSVAGRRAVCSGARTYFYANCGETGISGATMQVLIKL
                     TLACCVVQICAIRYFVFQRLTTKNQFVEDSTDLWENDGTEMEGEEAVANLRIQHERIM
                     PFMNDIKDKLDAQA"
     gene            <927969..>930998
                     /locus_tag="LMJF_33_2070"
                     /db_xref="GeneID:5654631"
     mRNA            <927969..>930998
                     /locus_tag="LMJF_33_2070"
                     /product="putative protein kinase"
                     /transcript_id="XM_001685916.1"
                     /db_xref="GeneID:5654631"
     CDS             927969..930998
                     /locus_tag="LMJF_33_2070"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001685968.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654631"
                     /db_xref="GOA:Q4Q3Y0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3Y0"
                     /translation="MHLLAGRYILVKQIGKGGFGAVEEYTDAITEDNVAIKTIPSRYV
                     NQESRRLVREIDIMCFLHEAHPHVIGYFSIFATKGTAIPHHNDSNTFDDPLMSVAQTA
                     ENTAYELNVLGEHYAGLSEDERLRLHHEELMAFVAKLTKTDEFNVHIVMPLMKGDLFY
                     FIRLLSSQSSVQRLGVTHQFLAQVAVVFAFQICFGLDYLHQCFIIHRDMKPDNVLVRL
                     DITNPYMSTALIADMGLARDAQHSDTIYICTRYYRPPEVITSVSGGSPRIDIWSLGCI
                     FYEMCTGQTLFTMRTALNERGEWDGAKASLQLEVVLNTIGTPAAEDIERYMPSGNAKL
                     YLQRSAARPSQLRQLIEQNWILHTSADEKEKWIDLITRCVAFFPEQRPTAQQLCQHQL
                     FRNYNVFYGSNVKQYAPTPFTLSYSGSSDSTRAENKAAILALVQRALRKTMPQRSEES
                     SDEESSSLNSSSGDSKSDDERATATQPTSIDDYVSAAHRCLTSLPRDSLQQHGGIVQN
                     EESGPVAAPFSALDSTSTSGAPAAPPPARQRQSYALHPFDNSTSKGYCNSFLDDDDEG
                     DVERSRERARDTEDEECLPDFQQQRPSAFMAHLSPGSAFRHRPASLPDGTLAAAATAT
                     ATATATAAAAAAPAAPAEPEKRFAHSFSSEESGPVVEDTPPLGPSATFRNRITRRRSS
                     AAQEEEDPKLESLMPSAFNLDSYRAGKPLDVTVNEGPCIPESGSPQAMESMPADEVAR
                     LLAAYNMPLDGSTYRAMLSRVQSVPPSVMPSDPYHFISQCSIGGGVGTAMLPQQQSFH
                     TAASPNEANGVPRGGNEGQRGADSEVRSWAVTPPSSTVPPLNGAAVEAGTDDQYDYLA
                     GTDYYIGPTPSNVAQVAAARQPAEKHGSSSYSLKVADGMPPEQAQLRTLSHASPPPIY
                     LPSPQSSETYLFHQPPSPPPNALHEQSVAGFPPIADAELRQRYMSYRHTPRSIQAATS
                     SVLEELGGCTHDAERSSELRQLLNYYTSLEVKTLYAI"
     gene            <932647..>936423
                     /locus_tag="LMJF_33_2080"
                     /db_xref="GeneID:5654632"
     mRNA            <932647..>936423
                     /locus_tag="LMJF_33_2080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685917.1"
                     /db_xref="GeneID:5654632"
     CDS             932647..936423
                     /locus_tag="LMJF_33_2080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685969.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654632"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3X9"
                     /translation="MSFVCRGLPRSERLLPLESTEVLGSTDSFLLHVLHRRHDGDGDA
                     GDAPWHSKRLREHVSLYWDQQHTYHSYHRTLLHAVRSTRGPVRFAGFPQVRTAPKRTG
                     VASRAAPAPEFDWAECTGARASANGSAFPPSQLGAEAATAASSSPPQSAEGVLPPPRS
                     LAAWNWISLVAPYERLLCPSLLYSALLSPSVGGCTSLYYATQQPLPAPEATATPAPTG
                     CVRARWSTHTCQSLWTLHSFAAEASIPAQEVYVMCAGTIMYLDVIVTAGRVWSELEGL
                     WGNDLIVELEREHATMQTGCPENSETETRLQLSSLKSFLSQPPQTYADMLQHVRVLLE
                     ALARTTTAAASSNEPAAPEAASTALPRPLAPWLEAAMGREVWTSAPDTWTAGSDSSGG
                     NASSVAVQTLRHVVAEWLSRRGVTVTATTPTGSRAVPLPARDLCLSRGSNRGVSASPK
                     SVMLSDCYSARAGSPAPRAGTRRQPMTTARSTGAATAAVSITFEPFEPHDTPRDQHPF
                     FLPPLPQDPAFIAFAVVWRRTLRRCVLEPDMLRQRLRQVILGYTGQRCEELLREARQQ
                     QLQRQQSVDSFTVAGPCEGPLSTRASTDQADVIGKNSAAADSALGDAMLTSLPSLPAA
                     AAPPSLLLLTCDPIATSFHVLGPRCGEWLTSSRGGGGWSGFRGELFRCVGPPPPPLTV
                     APLLSGTRAAQACRRLLPSSGTASSAVASAPSAEQLTEIFVDGALELDSAGGVSSASS
                     AAPGSRVPPLLYSAEELADRLCRLGSALPRYATEVCGDRLRPADADFVREVLQRHCLP
                     LLLACQRRGIQQWGLRGWMKGIDLTLLDNSGAESRVITPAKLVELGLQQARSAGGQKA
                     FATATTLRMVMDGGLSEALAFLEHVQKRPQRTVRRLPVRRLVGASGSIGSGAAPPPAP
                     VLDYTVAVVEALLLRRAEESALFRIFQSHPSAPLLAGCGVQRLALPPHATAPERRRGG
                     GGGYLLPPGSSMLLLVRTCGVAVDWDLQDCYERPRLSRLREPRRLVSHPPRDGASSGG
                     TQRLPLPPELANAVERVTLQHMRGMLQYYLRSLDATAAPCAAGRTAGDTPLASGVKRS
                     RTDSESERVERLYEPLPNTGVGPAERIAGTESSAVVSQADTGGASVADMPRTTLFPID
                     RAAVLYVLRHHPQYYRQVKGCGIKEVYVAAATLPPAESAVVVARANMAPDRTDALVAA
                     AATSASRFSSATLGPRRAAVIVERVCGQSVEVDVEACYDKVREGRPLRPFVMLA"
     gene            <937897..>941388
                     /locus_tag="LMJF_33_2090"
                     /db_xref="GeneID:5654633"
     mRNA            <937897..>941388
                     /locus_tag="LMJF_33_2090"
                     /product="putative copper-transporting ATPase-like
                     protein"
                     /transcript_id="XM_001685918.1"
                     /db_xref="GeneID:5654633"
     CDS             937897..941388
                     /locus_tag="LMJF_33_2090"
                     /EC_number="3.6.3.4"
                     /codon_start=1
                     /product="putative copper-transporting ATPase-like
                     protein"
                     /protein_id="XP_001685970.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654633"
                     /db_xref="GOA:Q4Q3X8"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006121"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR017969"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="InterPro:IPR027256"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3X8"
                     /translation="MGATTAQVAGERQATRRVTLNVFGTTCRGCAQHVQENLMTLEGV
                     HSVSVDLDAQLAEVDVDATDAATEFRIEKKMVSMGYTVQPAVLPSCGAPGREERELSP
                     APPPLRPSAASLSHLSSFASVSTCCTSQLQRSSETSKSTETSSLREGGGFLPFSRRFR
                     RVPCGCGGRGCLCAYAPEPVMVTEETRLLPEDDSEECLSERAEVPSSVDITVATVQAC
                     ASPRRRAPVGVRATSTTATAAAAAATTNLLIEGMSCTSCAARIEAKLKQLKGVLGASV
                     NFSAMSGQVLHNPALAPLPKVVSCVADMSYIVTAQDTTAPLGTADGEQPQEGECKCPT
                     NLQAVPVHVGSVMSGYEHRLVVLGMSCASCAARIEHRLRQMPTVLNCTVSFVTGTAVI
                     TTCTPSGFTDACRMVRSMGYTVTETALMQPDSSISRTREALERAREIAEHERNLIGSA
                     LLSVPLAVVMVLTVFMDIMARPLLARMIDGMQFCAVTPIVFHFGRGFFLSAWRSWQHG
                     AYTMDTLVAIGTGCTYAYSTVVYLLTLFVYPHARMMTYFDTAGMLTTFMLLGRFLEAR
                     AKRSASRAVIELMSLMPTTAVCVQPDGSEVRVSASQLQKGALVRVLAGDRVPVDGTIV
                     EGSSELDEQMVTGESLSKQKKPGEEVVGGTLNITASLLIRADKVGEETMIAQVLRIVQ
                     EAQNTKPSIQRAADRIAMSFVPFVLVFSLLTLSLWLMLGVTDAYPVSWRGAETSWQAF
                     AFNFFISTVVAACPCALGLATPTAIMVGTGVGAKNGVLVKSGTTLEEVRRVNCVVLDK
                     TGTITNGRLEVIRTHMIMTGLASPPTTTAQPHGSSDAALVRCLVGLVEAQSNHPIAKA
                     VSAKLLAENDRGTDEVQRRARYGVSSVVTHGGKGVEASVAVTPASGGKDEVSSEPPPP
                     RAHHVLVGNVALLREHGVSLTPEVAHLVEEENGHGLTTVVAAVDGAACLVVSLADSPK
                     REAHGVIRYLHKAGIRVLMVTGDNAGVAGRIAAEVGIHSKDVYAEALPIAKAGIVKGL
                     QEQGLRVMFVGDGINDSPALAQANVGVALGAGTEVAIEAADAVLVRDSLVDLLNLQSL
                     SKVTVQRIYGNFIWAFGYNLLMLPAASGLLYPFFHIRLPPVVAGAAMMLSSLSVLTSS
                     LTIRCLRAHCERDFYFM"
     gene            <942703..>944181
                     /locus_tag="LMJF_33_2100"
                     /db_xref="GeneID:5654634"
     mRNA            <942703..>944181
                     /locus_tag="LMJF_33_2100"
                     /product="putative glycerolphosphate mutase"
                     /transcript_id="XM_001685919.1"
                     /db_xref="GeneID:5654634"
     CDS             942703..944181
                     /locus_tag="LMJF_33_2100"
                     /codon_start=1
                     /product="putative glycerolphosphate mutase"
                     /protein_id="XP_001685971.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654634"
                     /db_xref="GOA:Q4Q3X7"
                     /db_xref="InterPro:IPR001345"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3X7"
                     /translation="MWWTAARRRLYYPNQIFLSKDNRRINNSWLPRRLLLVRHGESEA
                     NVNREVYSNTPDWKIPLTALGREQAYDCGKRLRNIIQGEKLYIYYSPYARTRQTVSEI
                     RRSFDESQIQGEREDERLREQEMGNYQPLQDMDATWAARNAFGRLYYRFPFGESGADV
                     GDRVSGFFDSLLRESIGLTVPNMNECVVQGAREGLGALDLGPWSTGVDNVPGSSCACS
                     VSTSQGGPVASSTGSESAPPSWTPSFHQATTSSAGLRRTIRRTSPHRPLPLSDFGEAE
                     TRGVPPLNDHCASAGEEQNVLIIAHGLLIRLFIGRWFRVPMEVFETMCNPPNCAIIVL
                     ERDDRLGRLVMTDMSKSLFGSDPLLQMMRFDGREDTHWYREKFLGIVDPTKAAEEAVV
                     EDDDENHYSMSNAHNSGVGAPAPPPRQRKPSTSTATRASPSTSASASGTSASSAESAD
                     VSASTAEHAALAARDRATQPKCPPPCMDCTPNRDYMTFSRRR"
     gene            <946143..>947675
                     /gene="iPGAM"
                     /locus_tag="LMJF_33_2110"
                     /db_xref="GeneID:5654635"
     mRNA            <946143..>947675
                     /gene="iPGAM"
                     /locus_tag="LMJF_33_2110"
                     /product="putative phosphoglycerate mutase"
                     /transcript_id="XM_001685920.1"
                     /db_xref="GeneID:5654635"
     CDS             946143..947675
                     /gene="iPGAM"
                     /locus_tag="LMJF_33_2110"
                     /codon_start=1
                     /product="putative phosphoglycerate mutase"
                     /protein_id="XP_001685972.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654635"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3X6"
                     /translation="MSISIRSTAQRQLARRQPPTTSSSSVSLPRAAFAPASRSASAVE
                     ATSESASSSQVPEQQEATPTRILDNARSSSCAAAPPPFSASSDQRSDQINKCIHDTST
                     LTSKPPPSASSASSRGAAAPSLPPSAPSSTTGAPRSGHDAEPEGLHDAASSTAAPSGA
                     GSSAVANSQRTAASHSLLYSVSRFTEPVKRIILIRNGRSEANEDVRAYVQTPDWRIPL
                     VEEGKREAIAAGRALSELIGDGPVYFYYSPYIRSRQSLRYVLQGFDEARLSGLSHSRE
                     WWEDEETAAVASAAAAAESSTLKCATASADEAGSPPLLAPAPSAISTNATSSDAQCCF
                     HRDPSLVLNRGTSNNIIGVREDVRLRDGDIGRYTSADELMHHLVERERYGRFFYRFPF
                     GESGADVCDRVTSFLDAFQRERVEFPMDTSVVIITHGLTMRMLIKRWFYLTVETFHKM
                     KSPPPGSLCTLTRLHHRSCFRLDECCVESMNLPLSLNEFNGYKYRNKQLLGSMSSGAP
                     YM"
     gene            <949278..>949937
                     /locus_tag="LMJF_33_2120"
                     /db_xref="GeneID:5654636"
     mRNA            <949278..>949937
                     /locus_tag="LMJF_33_2120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685921.1"
                     /db_xref="GeneID:5654636"
     CDS             949278..949937
                     /locus_tag="LMJF_33_2120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685973.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654636"
                     /db_xref="InterPro:IPR007529"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3X5"
                     /translation="MKCVVCDADKAGYRCRACRSAYCSSQCYRKHRMSREEAAAQVAN
                     INAATSSFAHLCETVVAAQRPQKELDEKRQRTEAEADVFSDVSREKVAAAGAVHGSEN
                     DAPPPSTAPAVETAWKTATGASEASGPACAEPQPSARTEYAGDSDAVYILQEKHLGAL
                     AHDPRVRSALRSPSLQKLIKTIDSSRSRLDALEAAQYNNADFKGFCDAVLRVIAEVEG
                     R"
     gene            <955462..>958224
                     /locus_tag="LMJF_33_2130"
                     /db_xref="GeneID:5654637"
     mRNA            <955462..>958224
                     /locus_tag="LMJF_33_2130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685922.1"
                     /db_xref="GeneID:5654637"
     CDS             955462..958224
                     /locus_tag="LMJF_33_2130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685974.1"
                     /db_xref="GeneID:5654637"
                     /db_xref="UniProtKB/TrEMBL:Q9GRN4"
                     /translation="MLFRDQHDSGNGADAVGTGVANQHNEDDETCSTGERSYTSAESA
                     TAQSFEHRMEQLQNTMNMMSDISGGSDAFSKAGSGIDGGAQTYLTPGYQLFPKADGAY
                     ADTDSDDVDDVQKSLPVMGHVNDGGDGGSKRARHNTTSSGRQPASFIDEDEEDADYLA
                     SLLRNIEKHAERLDTQFHRYPPSDVIKQQMATTAPPSEEKAKDHAAATGNGAASAGSC
                     GATASAGEGSVAEDQSGSGSAFSPRSSPQALRAGSPAPSPTAAAAPASSNSPGTKLFL
                     GGLRYEVIQSGRHMVSWIFQVACGVHLSPSSILIHRKTKNGRSNVAPTGCASVFITND
                     ADVQALLDMNQRIYCAEEGVYVSPSPKIMKELIASKDIVDVTGGRVRGPTHPVVIERA
                     YSLSHHHGHRESSGSGTRGHGGAGGGAAASGGGGHRHTRTTSSASTESNLSSQLRGPM
                     PPPYGSVPPPQYGAVHASPSGIPGSLQPPSYTPSTVSSSTGMGCMPVAGSVPTRSSST
                     TLYPSSAVLSGQSSPSTQPLLGDALPFSPPSAAKGLDPQRVTFHAYLRSDAAVHRSPT
                     APSPSGLSSTTCSSAAHHTVLFIAALPTEATSDYVSWLFSLMSITLPPSHIHIIGGGG
                     SNPVVSGPPGGASSAGVGKNMSDSCATVNLGEGDIPIALNYHRRVLCTSRGVWIGHSA
                     QDIAALRASDASLRDCPALHVDRRMSAQTAAGGGSGSTASPETPVYTHGGAGGEFGSS
                     DVPPYPPMQVPYSPPVFGGMPVMPAATVGGAVNGMPFPMQWGFGIPSSSANCMRAGVP
                     PPPQAAMMGGAVAPAMSAGAPPPPPNATMPPPFPFPQTVTIGDRVYQLPHGATLQFLP
                     VITPAGGAGAGGEAEAGGTGGAAGGRRRSESSGHRHSSSLEAPATPRTGLPQPDIPLH
                     FSTRLS"
     gene            <960340..>963210
                     /locus_tag="LMJF_33_2140"
                     /db_xref="GeneID:5654638"
     mRNA            <960340..>963210
                     /locus_tag="LMJF_33_2140"
                     /product="putative kinesin"
                     /transcript_id="XM_001685923.1"
                     /db_xref="GeneID:5654638"
     CDS             960340..963210
                     /locus_tag="LMJF_33_2140"
                     /EC_number="3.6.4.4"
                     /codon_start=1
                     /product="putative kinesin"
                     /protein_id="XP_001685975.1"
                     /db_xref="GeneID:5654638"
                     /db_xref="GOA:Q9GRN3"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q9GRN3"
                     /translation="MSIEVHVRVRPSVANVVWSSAETVLYSTANPNTRYVYNKVYPSN
                     STNESIFHGMEAVVHAAFDGKNVTIMAYGQTGSGKTHSMIGVDHDSGMVPRAAKLLLE
                     LKRTTPGTKIQAFYTEIYNESVKDLLEPQRGELVLHDAPDGGVFFDKKMIDVETFDDF
                     IQLQAAAERNRKYGVTNLNEHSSRSHVILTFEIHRRNRVGKSVINLVDLAGSESASRA
                     NTDGISLREGGYINRSLLTLGNVVDAIVERRPYVPYRDAKLTRLLRTCLGGSGITLIL
                     CCVNPSRENFDQTVATLRFTQRAMKIKNDPVVVLNMPPLFTHQYSDGARQLIEGLQES
                     AEAEYQRGLRDSFHYCGTTVALVVSNYQAQVSDCLHSLANAQRLLVAHDHAMAIDHIG
                     RLYNQQNDLVRQRIGNQELAENERKRQRDVASEIESRKDKIAKLEEELRTKVSSLDTN
                     LAGWEYQLYEARQKQRSEMDVLLQLELARRARIQYEWVVCWERIASRNIPIIQAGLSA
                     LQAKLVENASGAAEHQQYRHHLHTILSLQDGDAGSRTLHMKELRTALMKARDELEDLK
                     TAHEMVKDDIEEARRQQQQDSERGSASVSPQPLPNVSDLSEEDLVDYYRGVADSEVEE
                     RIHRLEREEKALMAQARRGVRRESLRRVRESLRVSRGSRGGSSRSPQSGGGGVTITRL
                     AETAGAGPGSNASQHGGRSVADEEVRAGFRQAEATAQVEARGRRSSASYADGVKNALS
                     ILDSLKAQLQRRGGSSHASPTVASTSRNQQTQSQRQQGSARVRNHRSVSSSSETRRRQ
                     GRKGVEETAVYHDPEEGDVGEEHQCAAPRSAAEAAAHRRHHATVPDSADDTDNISLAE
                     LYQASMGKENWSRPKPSAAAAVSSRAAHKYTAVAEDDAAFDADEETQEEKEDGRPVSH
                     QLTSSPPIGIAARRKVKRQNSRPAVERALYALNSNSHSTSPS"
     gene            <966924..>969545
                     /locus_tag="LMJF_33_2150"
                     /db_xref="GeneID:5654639"
     mRNA            <966924..>969545
                     /locus_tag="LMJF_33_2150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685924.1"
                     /db_xref="GeneID:5654639"
     CDS             966924..969545
                     /locus_tag="LMJF_33_2150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685976.1"
                     /db_xref="GeneID:5654639"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q9GRN2"
                     /translation="MPLKGHTYDVATTVEALNASFSFDPSCRIERVLPDASRELVKQV
                     LWATSRVSAVNGSPVADSPELKAALLSLVMRHRNPPSVTGEEKTVPNSVALFPKTLIT
                     VTFERTDEHASKVSIEGSVLSDGAVSKVKSPSSAAVQELISEIAPPSIEEPPPALPAI
                     DADLRGSFRRSMIGHPGTAAALLKESVSAASPNATVAASRRSTCTPATRGTPQPATRR
                     ASSPPAPPVLRPSHSKSSSSSSDLDDSEAASEASSSDFDTVRICQLKGTSPSDGCITA
                     AAAAAAAAQAGSEFSTPGLLEFEKMKLSMRGDEVLRHVGSGAGTYGHTPTDVAEMTVK
                     GRIKRALDCVEMGYCVICVTQDVNPIAEIELLALTAKKRVVAFDLSVKLRLRPKPEVL
                     AAQFAEAMRSGAWFIMVNAHKSISTCLIFEELLEDAHMHNLEGFDPSARIIIALESHP
                     HFPKALMHHAVVIKVVSNFQGSSFLSDSMAASISRARLVTADALTQSQIGGPSPRSLQ
                     ASVTPRATVQKPAKKHVRISAAVEIVDIAPREVVKVPKRDCPIDVSGSVALFKTFSGV
                     SGDKFLCVQSAGEEGRFAVGSSCGNVYFLDSLGNSLLQAHAHNASIWDVSFKDKFHFA
                     TGCEDGTSAAWRLGASLGGALTDDAVLVPTAATSLGSDVYCVCYLKNINPSPLLIGGL
                     HNSLVIREAESDAVHLVSIPSNAQVVGCLPNSATALVGGGDGSVCVVDVMTARPLGTL
                     VDHTRKLPALAVLDDNQFFTGSFDSSILSWDLRVPGGLTSSVQGGAAATELAAHTMHT
                     LKLKNYVTGLDVDDVHLAASVGENLYLWDVRKLHTVLGGYPQGWKGLSRGVKVQSMSH
                     RVVTASPDGFVRFWSFV"
     gene            <974145..>974750
                     /locus_tag="LMJF_33_2160"
                     /db_xref="GeneID:5654640"
     mRNA            <974145..>974750
                     /locus_tag="LMJF_33_2160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685925.1"
                     /db_xref="GeneID:5654640"
     CDS             974145..974750
                     /locus_tag="LMJF_33_2160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685977.1"
                     /db_xref="GeneID:5654640"
                     /db_xref="GOA:Q9GRN1"
                     /db_xref="InterPro:IPR010033"
                     /db_xref="InterPro:IPR010036"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR024734"
                     /db_xref="UniProtKB/TrEMBL:Q9GRN1"
                     /translation="MSRVTSEADGDAATLLPRVIVFDLDGTLWTPEMYQLWGGSPFKP
                     HKQNPSIMIDKSGTEVRLIGESRDVLQTLATNPKWANTYLAISSTCDVPSWARELLGT
                     FEFTDYAGKTVPMHSLFSDRIEIYKANKAKQHEMILQKVNKVDPSVSEYAQMLFFDNQ
                     TDNVRHVSGIGVTSCYCPSGMTKGTFEKGLEMWRRAQLSKM"
     gene            <976079..>980509
                     /locus_tag="LMJF_33_2170"
                     /db_xref="GeneID:5654641"
     mRNA            <976079..>980509
                     /locus_tag="LMJF_33_2170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685926.1"
                     /db_xref="GeneID:5654641"
     CDS             976079..980509
                     /locus_tag="LMJF_33_2170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685978.1"
                     /db_xref="GeneID:5654641"
                     /db_xref="UniProtKB/TrEMBL:Q9GRN0"
                     /translation="MGAFALCVESAARDIRSLLTLHRVHPQVHSDIQRILGSLLRKNY
                     ENMTAPVPMDLIDPPEQVCRELVNDIVENAFKTALPASDMRALEHRCVELQQDNAELK
                     AAVEEADESVMELRAVLSDLKKAHEYMLHSYFREVLMLRSRIDDLQRQLRTRRLHTTN
                     LAPLVSGSVSQFIPTTESPLQHFLVNTSVATGQGEPTSRSSTSPLGTPLPPSMSSDEE
                     SEADDGPVRRLLSNHISYHGEGRCADVQAQARPHALGAATVGAAPAAPPDAKGWSATP
                     HPKYKGYSVRINVPISTAARARTPGSARSATAQKTTTFEVWSTEPDSVDAIFDYEEYL
                     RILNGADATWMQRFTDAMDGWERGSPRHRRHSLSLRACTKSKVSFLSGSLASNPDDPL
                     SSATLSNERVNANGFRWLLHLALEPIKHKFHMELDQLREAVQAMQQEHADQVQRIECA
                     LLTVQSRNDALLDFINTFAQQARQTLLVVARDVQARNMVELLSSGALPVAAAETVASF
                     FTPAASAATPHVRPSLSSATASPLPHPESAQVPSASHLLRNKEWRLKPGVVLEAQEQA
                     SMMTAMNHRLGKASSVEVTRSMPHAPTNAAEEVNYYRADLGLPYWCSHPVTVHARKMF
                     GEVQEIAASIRATRAMHFLASKESAAGGGRRVRWKVRGTADSSRHDDGDHRGCNSPPP
                     LLKGRDSSSFYYFRDCDADDDSTLRHLVAHRRQREEWLTASVSGADGQTAADLLRELA
                     ALRMRRACDRKRLKVVQASLPQHFMKDAAASAMAEEAAVAKEMKKGAGARARATDPEP
                     ESPHLQFVSAEALLRACALQRLGRRTEQRLMQASQRIAELQRLLDLHLGHCQLKDSED
                     SLSWETARRLTAEGSQGLLGANGTLNLAGHLWRSPYLNDTVLDANDQQQQQRGTWAGY
                     SRGQLMYLPIGLAMARDADGNSIGGAGAYFMLDGSVISAAPFAPFSTAASKGGQGSNE
                     ESERPAMPGRITPFVAVMEYCRGVQMGRPLGRRAGPVYLFQDHESGDYYVGDQAGRNV
                     LKADDDTAGDAVGMRAEAGTQRPLLPMTRILFPAPMQFTAVDASSVASSVAASAAAST
                     ALHPIYLVPMAIPLSDEEAVMREGWQACHRHGHTRRDPIYYTTMTPLPLSKSYHHVVP
                     QPGNADAVALAEAAADVAAVSYNDDSNAPVNRYLRNPPCVFQPADEAAAMMRVRSLQL
                     QQRRGANKSFPDTAAVDSSAACAHSGLLSPDGTASSAVTPTSTLPSSVGPLSGYALSS
                     PEAHLLGAVPLLAADWQGSGGPVAAAPLPGSSSSPPAVPLALPPSPEPGTTLAKTGHN
                     GVQPLTKPVPHTSAAAAAAAAPASSATSFSPPLAAALVLAKERRYARLAEEAERAAQA
                     KKLRQDSLRNRTLTRTAPNKESDVPRVPPHRLAPLSGKHPGDEVSSMLPLPADSARLQ
                     SQMRPAKLALTPPPPSLRWREVNGGGLNAWNLSSDDGDAA"
     gene            <984151..>988383
                     /locus_tag="LMJF_33_2180"
                     /db_xref="GeneID:5654642"
     mRNA            <984151..>988383
                     /locus_tag="LMJF_33_2180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685927.1"
                     /db_xref="GeneID:5654642"
     CDS             984151..988383
                     /locus_tag="LMJF_33_2180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685979.1"
                     /db_xref="GeneID:5654642"
                     /db_xref="UniProtKB/TrEMBL:Q9GRM9"
                     /translation="MFRVTNVAEDRDLTPCSAAAPVVDEGEEHGGAAISIEDIFESHD
                     GADTRYVGVANKRAFSALHVAFPVTRSPSQHGGQMLSPSLCPRDTLATPASRSIAAAS
                     STTTTATLSQQLTPVHRPSLGRSPQQHTPHHHSTSYDHDRYQRFLTNALLSESEAGRP
                     SSVLSFPMRTPTRVNRASRRETPDACVMAAAAQCRTGSLDHAAVPHNTVHEEPQSTAS
                     ILHSSVVSGGWATELMSEGARSAVVQSEEKGHRRDGIPVDAYLWQPTKKAPRNVSRVD
                     DAAEPESTLYSAAHLPSAGAPFAYFQRAPPVWSRPAQTSLRLPSTRDEDNSTREADEA
                     CGTAILGFAAAQEGDELGSLRAVQRAQCTGAGVDVAVASVCPNTPFSPHGDPAVTVGA
                     AAASFFTPRHSPGVLSAAGELDRPDGVTTPLRLPSSTAQHVISDTPLPFVSARRSLTL
                     PILRYISEDDTDDEEGEKTAAPLLSTPVDCVIEASCATPVASSAAGSPTLAWPLSSGL
                     GRTRVANGAASVRSHAVHRRSPARSVLSSLATSRQLTTPQRLFTPVHHTDNSIRGASA
                     TGPSAAASSDALMTSSSIRGRAVSPAETMLSTTLSTARHRDGTGVQNSRTHSQPQQPQ
                     RHSRNTFHFIRALTAGEVSTDMRHRPLYWGCFGILVAQPTEVWCVGQTHPFRLFPPEH
                     APSVWMPRNGELEVTTVATTERLSLAQWEAASIAAGTPEASPPVVVYAAIGSSAGDVF
                     VYGYSKCPPTAPDATPVTLDTAQVHAHSTHTVRLTQQGVLQRADRLGGSDGVSEAKTR
                     AATAHGSPSMHDSTVSVVRVIDHWLYVGDQSGYVSRYDLRHTNFLCAVSTDTASSSAL
                     TATAAEPQGTREAKPCRESSARSDPTMAPLPARLNPCMPVHHFGRPLLLAGASPTARS
                     STPSQSAPAASTPAPKFHYAVNVGEPVYHLEVTSSQSYLAVGTQTRLLVYRTAQLPRI
                     SDTSSSASPSPPLPFHAPFIGTSAGTPSREGSSGNVNIVHERGDGATPLVVVSDAAQP
                     VRCFAWMFCDYESLMQSLHARSPVEKQVFFSDTDDDDSEAFSPVPLTSDDEIGIGNAS
                     SKFVALGSACRRHTPTPSLVFATVWQESTEVAEGQSPRLPVPRVKTDIRVFRVVTQTT
                     VTSCTLGYPVHVLAVLPGTTQIIVGTGGAVELERPASPGASSPAGHPLPASPQVPADL
                     LTGLQLSSPFTSPVLRFTSVTTATATSVSPLGGFRPPAIVGRRPSLAVAAAEALWNRP
                     YTVRHTARSVHPTGAGAVHQQQQQHRAHTSETNGYLFLLEVCPADSLAVGSGAGYDCR
                     VCLRVRGEVGVGEGESAVCGAMNPLQDHVSVLIHPTESDPRVVASPPRDGSRAKVKVW
                     RISTDVQSACIISTPGGLLFPSESQQQMECLR"
     gene            <995074..>997362
                     /locus_tag="LMJF_33_2190"
                     /db_xref="GeneID:5654643"
     mRNA            <995074..>997362
                     /locus_tag="LMJF_33_2190"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685928.1"
                     /db_xref="GeneID:5654643"
     CDS             995074..997362
                     /locus_tag="LMJF_33_2190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685980.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654643"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3W8"
                     /translation="MRTRRCSRSQSSQHVDSENNFYTATREDAAPASTALKRGDPAFA
                     VPSTKTHVNAALLVEPFHCISAAARQGTSLLRHASVTSSRVRQRKSPCDVPPSTRNAS
                     VLTPGLPRGGLPQEESAHRLIEALPLTPDDVLGCVSTGSSPHAAHAPVHGGVAGAVAE
                     RVHGAEIAHGEGQPTASVVSSPSQYLSQTSPLALAGAVPSPSSRQTSPSAVRARLTDA
                     STQGDGRFDRLLSCFCAEEAQQQRLFLVAQRCHLIQQEEAAAREWRALDASVQQHRIV
                     REERAAYRLVKSQQDHRRLPDASAYSVVGADAFGNDLTRARSAERSPSPFPEEALHLA
                     ATPPSGQRRRRMLSASLRSLLCPGASVPASAPDGDDGENRLGGFSLSTSLPRLVDHRN
                     EDSVPHDQDAPASFEEVHQHTAEKSNSEEKDEALGDAAEEAQGEPRSSMRSSEVNQWT
                     TSPPRALPPLPSSEGLGGELLARIRDLHNEEEDQRFLLTGDCPPPDVFQRWTARYCED
                     KRVCFSSAASGAGQPSALRAALSPEAAERCCSRSDSPAIAPPTHDGAAFIALAPSDSA
                     LARVPAAALHDRSRSPLLSATAEQADEEFLRREGASASWHRLCSEHRRAWAMENFFGT
                     DVAYANYHDGWSAGSARSPLPSSREESEFNASGRCAPDPRIFGAGPSAAPPSAFSPPS
                     HAAPSSSVPQTTRIESAAPRAKIDFSQQPPKSVTADSSLLRKMACPTEKTYLAPMGSE
                     REAWQALMDAFIDGLLQIMALE"
     gene            <999037..>1000224
                     /locus_tag="LMJF_33_2200"
                     /db_xref="GeneID:5654644"
     mRNA            <999037..>1000224
                     /locus_tag="LMJF_33_2200"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685929.1"
                     /db_xref="GeneID:5654644"
     CDS             999037..1000224
                     /locus_tag="LMJF_33_2200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685981.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654644"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3W7"
                     /translation="MHASCASLDGVAGRGRPMAVADALISQWSRRSGASLTWPSRLPS
                     GSGGEPASSFTTEAVAGVSPSATDAGRRAADGRTTSLQPVSNASAAPPSLEELFAEAD
                     EDDTDTTAAAAAGFLDEKEPEGLKDSRRHGAALLPRRDSSTFVASASPEVNRFDDTDK
                     SARSPRTSASATVEASLLEALLEEQLSQDLNVSVDDTTEEDSDGLDEVVPGAADAHAI
                     INVSCALPQGQYRSPYLRQAAHTETAGGDADDEADVKVDSIEDAVDDEESMESVLEEE
                     AERMYRAALTNMAYGQDNAAQGEARHGVFGDYTFFAKEAVASAAETLSMRESASAAGA
                     TSAFAFSDGIADGASTSAVEFDDDAARRAEIDSVGDVMATSGTAAVAAAKARKRSPGG
                     DVR"
     gene            <1003025..>1003951
                     /locus_tag="LMJF_33_2205"
                     /db_xref="GeneID:12980837"
     mRNA            <1003025..>1003951
                     /locus_tag="LMJF_33_2205"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722345.1"
                     /db_xref="GeneID:12980837"
     CDS             1003025..1003951
                     /locus_tag="LMJF_33_2205"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722393.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2205"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2205"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980837"
                     /db_xref="UniProtKB/TrEMBL:E9AEH3"
                     /translation="MLLSAQGRSLRLLGAFSGFPFTSTALPVAARRCPAQAHHLSKRS
                     PSSSWNALRGTRVTRCVVLPAGRRWATDCESAALEPNRGPTLVSRRTVHSAAASAAKP
                     ANEADGAAVVETVSASPATTLQSSESATAQTVMAAAIGAAAAAESQDTGATGDQQSSR
                     STTAAATAMETMPADQVSMWRRVWRAFKSEGTDFSIFYLPFYGGTFVFFYFAFATGLM
                     RKEAILDGVLSWMGDRVDHAKLHARIAAWNSWANLGFAIAINELVEVVRLPVVFVLYY
                     AMRPHSNRFARWLAGLARRLRRGKWTDGAAKA"
     gene            <1004980..>1005561
                     /locus_tag="LMJF_33_2210"
                     /db_xref="GeneID:5654645"
     mRNA            <1004980..>1005561
                     /locus_tag="LMJF_33_2210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685930.1"
                     /db_xref="GeneID:5654645"
     CDS             1004980..1005561
                     /locus_tag="LMJF_33_2210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685982.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654645"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3W6"
                     /translation="MHNRWVAKSTKEYMSEADSKVSKGNSLLFGARERRREGMERRKE
                     RFREVAEETDRTFELELERMRDDKDRRWKKGFNFFKRQGKAFTLLYIVAYVAPLAILY
                     VGFASGLLPKDAVFEFLFFFLQTFMDRDMFFERVEAWDTYSNFGFAFVVNETLEFMRF
                     PLVMFFFYQARPFLTGVNQRVKASIFRFNAAES"
     gene            <1006856..>1009120
                     /locus_tag="LMJF_33_2220"
                     /db_xref="GeneID:5654646"
     mRNA            <1006856..>1009120
                     /locus_tag="LMJF_33_2220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685931.1"
                     /db_xref="GeneID:5654646"
     CDS             1006856..1009120
                     /locus_tag="LMJF_33_2220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685983.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654646"
                     /db_xref="InterPro:IPR026720"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3W5"
                     /translation="MYRQQRAQQLRGGRGYPTEVAGRDRVKFFRRPVEPENTVLENAN
                     NNASTATCADAMQAQFAASCPSFSIPSNAAAFASSVPHGEAGGRTSHRPSSALGWRSR
                     HANSSSRMGGNGLVRRGGAGLRGAKPHHLPSLERGDAAGVVGSGGEAQQDGRSVASVQ
                     TMYRDNEAQTDPYSPDYVIPEGAPTPEILGLQSLTYQNGGLPSGKEGVELIQRLRRRR
                     DVEASLPTGTDAASIEAKYTALHELEEKEWAEREDHVAQLQQRRLDRLRESLLAREAA
                     REDANRRRLEQIKSQYLESLGGKLTSLEMRRMAASKRGIDKMAQLQALGTGGAAGQIA
                     EAGATLGIPSAAASMKSSTATSKSGRAKPSIATYSRYGTDGAPPQIEQSDITGGSSID
                     ARLRAARQAFNYDIRPQLLADPAGTEVVDAERGARVDRVSPKTFVVPENEAVQRLPTL
                     YQRREQERVLHSLEYAYNKLHPSEDAEDGKACEMTAQRVLELYRATPKLQRPETPVLR
                     LDSDEQEEEQDACILLQRLLRGRAVQNDFFDGRERCRGLIEELQAASTAQTAEQLAAA
                     KRKEELLAAEREAEAQHIVGSALGAIVHDTLGFLSHELGRQQDMAALRRLQEEAEVVR
                     ATREAAERARRAEVRQQRDRNEVAYAAYMRATDTTLQCFLDDVTRSAVEETAMVVAVE
                     AERACQAAHASPRYPATEEAEDVVCDMLDGFVIPAIVDAIGLQGRELEKKAVAGAALD
                     AAHTLSKACGRPPT"
     gene            <1011827..>1012627
                     /locus_tag="LMJF_33_2230"
                     /db_xref="GeneID:5654647"
     mRNA            <1011827..>1012627
                     /locus_tag="LMJF_33_2230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685932.1"
                     /db_xref="GeneID:5654647"
     CDS             1011827..1012627
                     /locus_tag="LMJF_33_2230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685984.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654647"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3W4"
                     /translation="MRDGAENDSLSFAEAIVSAMDAQPVVPPALLRNLQEPPFIWNRH
                     PSHGIVLCLLQHRGIYLPRYRELVDYHMAELFLHYLDLCREGAFFIHYSAGKWPKERF
                     FRIRMLPVNRLEAETEPAPHLVITLHESGVDILDAIPLNKLVGVTATPHTACFLPFLE
                     SPKTIIGCREGRGHRARLPADGAFSLWFYDVAQHKPRSVDILTCDAKVFDIWTKTFRG
                     LVSVNSSSIVQVALTPQGESVELAELTRAAQQQGEVEHGEQLGRLSSS"
     gene            <1013309..>1014244
                     /locus_tag="LMJF_33_2240"
                     /db_xref="GeneID:5654648"
     mRNA            <1013309..>1014244
                     /locus_tag="LMJF_33_2240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685933.1"
                     /db_xref="GeneID:5654648"
     CDS             1013309..1014244
                     /locus_tag="LMJF_33_2240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685985.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654648"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3W3"
                     /translation="MNTRRKMIQAKPDVPSTHWHLMSEDFYPLFEADKRQHVEYWYNM
                     AATGVQRDIFRRICNAIYRQDPATPDPTFNVAFTETVELEQVSLLLKNYGVVLSENVG
                     KPKTRVWLLHCGKSARDRNEFRSVFTGCQTTYERHSVMHTDYVAPDPASYPDDRTHFV
                     RSVDWTSLKTREAMLKLEAQRRANGGVMRSQLDKLSTTIAGEQCRMNGDGKSMQRTTK
                     PKNQFDGVNVLSSLGFDGVPAEEAVAQLKAKQNAHREAEWYYVDKDGSTVYKARSNKG
                     PAAAAIASRPERGEGGILASVTSEPMTRWVNKTCF"
     gene            <1015141..>1016499
                     /locus_tag="LMJF_33_2250"
                     /db_xref="GeneID:5654649"
     mRNA            <1015141..>1016499
                     /locus_tag="LMJF_33_2250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685934.1"
                     /db_xref="GeneID:5654649"
     CDS             1015141..1016499
                     /locus_tag="LMJF_33_2250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685986.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654649"
                     /db_xref="GOA:Q4Q3W2"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3W2"
                     /translation="MEGIIQYRLLGNHPAASGRYLTVGFPGETTTTDKILDQVIQEHR
                     INTSRYKLEVCRLVPSRDAPASAPVPALPPPESSGSAFSWSGAAAGAPNALVPVVIHG
                     PDALCTYDRLTITVSKRDLADDEASRKEKERLERQRQLKEMEEQLLSGTSGIGHFIDG
                     GAGAHSAVSPPPRPSRSAAGALPPSSPAAPAVDNLRLQRAAALASQLFPIMKGQCSTL
                     KGLHDADNTHQCVLCRLSAFEEMLTACCRFCVCRSCYASASEMVMNEDQCPVCGIIAS
                     SASRAGTAAATDLHSGTLANAGGDVTAYRKRERAAKSEDRRLWKREEGEPNVPLPRAT
                     SVQGAAARNSGSLHGDGRAATDDLAGPRDAAASAPWSTKASGSSCATVPDVAGPRSGS
                     GGDAGDAVAVTPFSKDVLQTEERLRSDLDQALSMLDAPDPLSAAAKAKRIIGAELAAL
                     CE"
     gene            <1017586..>1021884
                     /locus_tag="LMJF_33_2260"
                     /db_xref="GeneID:5654650"
     mRNA            <1017586..>1021884
                     /locus_tag="LMJF_33_2260"
                     /product="glycosyl hydrolase-like protein"
                     /transcript_id="XM_001685935.1"
                     /db_xref="GeneID:5654650"
     CDS             1017586..1021884
                     /locus_tag="LMJF_33_2260"
                     /codon_start=1
                     /product="glycosyl hydrolase-like protein"
                     /protein_id="XP_001685987.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654650"
                     /db_xref="GOA:Q4Q3W1"
                     /db_xref="InterPro:IPR005201"
                     /db_xref="InterPro:IPR008580"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR018997"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3W1"
                     /translation="MSSSSSHRYTVSLYRYDLTQGMARSLGPMLIGRELEGIWHTSIV
                     VYGKEYYFDGGVGVVSDPNPGHTRFGQPYRTEVLGQTTKREEEFCAWTRQQHRAGFGP
                     NDYHIFDNNCNSFSDAASMYLLGRHIAQDVLEMIPTLLSTPVGQMLRPMLEQATFGGA
                     GVAATGMVAPFSSSLASPPPPVIGGGGDACAGLLSTRQTVTEADEEDLMVAQAMLESN
                     ETIADGHLSPAEAFENTISGVTLLRMVILNICEHPSDAKYRALSTESTAYQTKLKPLE
                     TYGVTELLRIAGFRRRPHSSGTGGEQWFLSDSDGSGAVLRRVAEVLEAAIVNIQAASD
                     EAAERRGRHKSAGVANKETGSGSPAHSPCPPSPPALASGAAPAAAHAEAPLKEPSPRT
                     VKDGCDAHKRKIAKFCLPPFPEDWIPLPVGRESGAPLFSIRCRVASTSECPYCFGKCR
                     LTENLEHLKAYYCSSDGREVEIYDRYKVLCVWRGEDQALTWVPALLAFAAQAQHSTRF
                     IFSAYGHFGVARAEYGGGVHPGVMEPSGRCVVPYGGRAVVVTNDAEVLCETARLPPSV
                     LRELKALERGTHLAELLRAASGQPIDSFDELLHTWQPPTFYMKPRSLCPHTVLGPTSV
                     AWGGTGDAAKRSAVDMAGQEPSSAINESAAYSALPLAPRLLVCHDMCGGYTRADRRVF
                     LCEGAPASATASAEGVGKDGRTTPYVRLETVEGAYTVSYWNLADYFVYFSHRRISVPP
                     REWIENGHSHGVPVLGTLITEGDGGVADLKLLLTDARRMAAIIARLVDVCNTYGFDGY
                     LLNIENALPPSLAKRLVVFCTLLRKQLNRPYSAARGASAAAAAATTDRLVIWYDAVTI
                     EGKLEYQNALNSYNKPFFDVSDGIFTNYFWEPMQLAQSTTVAGNRGTDVYVGVDVFGR
                     SMYGGGGYHTHVAVAEAVHARLSVALFAPGWTMECESHGRRDGFQRAEGRMWFPMQKK
                     FSYHARVIWSTGATAGAPQQSTAADARDARHKQALCLWTSFQSGVGYDFYVNGHRVTG
                     GDAAASVVGTSGWCEVSGAHDLPPFFFEAPPSAPPSGALPPAAQGTASGHRGPFAAVP
                     IRLPAAPVKGNLQDPVVRAEWRYDKAWFGDCHLACFVPPMEAAEVVRWYVRDALPATS
                     LTELHIEIVFDRTAETEERAGMQRGLQLGLFSFTRGAFEICMWETTAVAAAVEVEGVS
                     GLVARASLTREGGSEGEGKSTRVTSGWERVHYQLRNTSTEPLHLTSISVANGDPRRTL
                     DCGVGGIAISHWRAGTPTMAASAAAQAASPRRHSILCAHGPHPWRPHHTFRTRKASEQ
                     VLALEGADDVFARLRDKHGLNASIVVFAGVSGATAGLGVSGSTSAEAEDEHAVAAVSP
                     DRRRREVCHTMYVGKYSIHPYAAATYEGSLLISVSLPSGVTVEEVEYYTVQNEC"
     gene            <1023915..>1025654
                     /locus_tag="LMJF_33_2270"
                     /db_xref="GeneID:5654651"
     mRNA            <1023915..>1025654
                     /locus_tag="LMJF_33_2270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685936.1"
                     /db_xref="GeneID:5654651"
     CDS             1023915..1025654
                     /locus_tag="LMJF_33_2270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685988.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654651"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3W0"
                     /translation="MSGLRGFREESPAVEVPIEDDISYNDSASQSSYTMSRSCSSTGS
                     VFSTSTSATDNEAYKNLKLELAVAQENIVELHQKYQDLERTSKYAKGQLENEIDLLRL
                     QLQRLKDKPATSDQHAEHVAGLEAAKAVADARVQELEAAAASSAEVASRLAAEHAEHV
                     AGLEAAKAVADARVQELEAAAASSAEVASRLAAEHAEHVAGLEAAKAAADARVQELEA
                     AAASSAEVASRLAAEHAEHVAGLEAAKAAADARVQELEAAAASSAEVASRLAAEHAEH
                     VAGLEAAKAVADARVQELEAAAASSAEVASRLAAEHAEHVAGLEAAKAAADARVQELE
                     AAAASSAEVASRLAAEHAEHVAGLEAAKAAADARVQELEAAAASSAEVASRLAAEHAE
                     HVAGLEAAKAAADARVQELEAAAASSAEVASRLAAEHAEHVAGLEAAKAAADARVQEL
                     EAAIAGLAEMLVKEPSSGIANCMVENKVVGKGVDLVVIARELQVGLRQQLKESEAAIS
                     RLVDEVRALKTKSAAAEAEKVVMARKGEVVEREVCRPAEATELSGLLSGQENGLGNRT
                     KHSRSWCPACAVM"
     gene            <1027200..>1030307
                     /locus_tag="LMJF_33_2280"
                     /db_xref="GeneID:5654652"
     mRNA            <1027200..>1030307
                     /locus_tag="LMJF_33_2280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685937.1"
                     /db_xref="GeneID:5654652"
     CDS             1027200..1030307
                     /locus_tag="LMJF_33_2280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685989.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654652"
                     /db_xref="GOA:Q4Q3V9"
                     /db_xref="InterPro:IPR002893"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3V9"
                     /translation="MSLVKTFLRGGTPCTSPSMLTEVLSSANPPYAHWRCVAYYPRRW
                     HHDAVDNRITAPVFFLLFGRQEWRENGGTDSATAPRGEAVTAPEETWHLLYYTVLTEG
                     AVPVETLAGDRKAALEADRGSGGPDASSAAALSRSGGGGVGALLVLLLTVPATLMPSG
                     SLEWYSVAHGIAYERMGLLTASVFLAKLAPAVSEVLSKHWKPMARDGKETGLSNTPGA
                     LPAPRPSAGYYILDGKAVEVVDFITIGDGLSSAFAARRRNKDDAAPVSDGVSFSPPFP
                     SPNPNLQFVAATVHEAVQHMCAESKMANLVADASAPSITEAGWRTLYPLMASLRPCMY
                     TSLFEEAANVGGSQDTLSDADVESLTGLARLRAQRDAGIAQWKKQIGSYTSFTVPEKD
                     YNAIAADVAAAAPVAEGTHATADLALPAVPPLAASTAASAESQYRHVLLLQRPIVTKK
                     PIGVDNRDAGPLSPQPIGAELHLVRDRGDISYALEQLENRANLHFAFEDTVHDDGEVL
                     VQLTPVEGVPFCDLEGYFRTVPATSTALNSGAVAQHSGSCCPAVVPRVVYRRPTGRIQ
                     KANPIAHALTELEVTSPTPAMVKAAAAALLYVSSQLVEVSEPMTDLSANTGAATSAPA
                     PGYTLHVPSVCFSAISHKKCGWCGRRREVLLRCGGCKAVSYCCKRHQALDWKEGSHRL
                     ECKLWRRARELQERVVAPWMKESSPMWRAVTADGQPGFFTKSRGWSCAATLIQFLSDI
                     DVSARNAQLKSPLPDNKVQYIHAVGLDTGCVGEFVRALAGDIELREALTSLSFSATSG
                     VRQYRVLICSDTFTDAQRNAVWAIRRAATDSLWLTPATGVLGDAWHCEGCNAAAMQPT
                     SAMALIRLSGIKYHTIERHHNASREGCPRAVLSFGPASGEGCTYLTGALEVFADHDVG
                     FVPLRLVDSSYVGAARTRDAVAARVASSNACPTATKSRVAALVAKAKQAELAEASSDA
                     DGSPNPTRGAFFIHFNKKGAAALAAAEDSRTTAGSTTADPASASVVTPYLNCFLWDVF
                     PSDCG"
     gene            <1032683..>1038637
                     /locus_tag="LMJF_33_2290"
                     /db_xref="GeneID:5654653"
     mRNA            <1032683..>1038637
                     /locus_tag="LMJF_33_2290"
                     /product="putative protein kinase"
                     /transcript_id="XM_001685938.1"
                     /db_xref="GeneID:5654653"
     CDS             1032683..1038637
                     /locus_tag="LMJF_33_2290"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001685990.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654653"
                     /db_xref="GOA:Q4Q3V8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3V8"
                     /translation="MDEDKRLATPPDARGDSPSSSNARLHLWSSFDSDEVPLTVEPTP
                     LGARTGNGGQNVRPTTKAASSTRGTTPIMAHPVTVNATGVPADQQQSLPSVFIATPPL
                     FDSVLPPRDAEAKTAAYPEVSDQPDAEEEMQILKPVTDTTPTQVSIISNSGDAAAAIP
                     PLPSVSVGEHSFEAGRSRRKLGKSEVSFAQATLKAPGAGAALPVVTPGSNHSVSSGGG
                     HLRTPSSRFGKVNGAGSMAFFSGAGGSLLPAEGTRGGLTSQASACSSYHASSSANKEN
                     RFDGTETVASALGGEQTPFSTARSAEHANSSSSPKFSSGAARLLTCLSSKMRSGTRSL
                     DQHHYTTDPSLASTWASSYRLGATATRSERRACRVSVSMAVVMNTVITVILVAALTIV
                     PLNAVSTQSTDYVMSTLSLWLASSYTRSVEARMLFLPNAINAYAFAYMNSSDTQAWNW
                     NAADMPQALRQMCHTVAGTNRNPTSFLLYMSLSSPYTGYSAYCSQQDSDDYLIGNYIT
                     DNSSQPRYVVNGTTYNYAEPPIIYPAVQAMTPWEYTVDFGGPKNPWNSVVMPWYAQYQ
                     QGRLSRAAAGAVSAHEAAPDRDRRSSTGPEHSVAKPLNYLNGYWRIFSTNVSVITYTF
                     PFVDYAGNPASIMGALRADGFNALHSDTLIAAASSARAMVVDTSSGLVFITSWGQDTT
                     VRLDNWNTSCNCAPGGNNQRAVYLEDITDPLMIAAVQNVGGREGIADTPLEVDRWIGQ
                     FAFNDTENLMVISRIPISSDYSDMNLVVIYAMCKNDFTAFINHVQIIALIAVVLVLVI
                     IVLIEISLLYLLVQPVRGVAAGLRAAAELRDGKECVDYATSVIKEVAEMQRDFHIMNT
                     KLMQMRTFLPQGMLGAHTMYSDIQGASDADLTVFPSSALHGRGGGGVWENAYGDDGYG
                     GPGDMLGGDGSGDVCAAQRGGKDSGADLGSILDVSETGQQQRRGCRQPVVEMAHLRLN
                     DRVLLEEVNRFRRRYCSTIVFCMHLMESEISVKLLNKNCVYFTEGVLPCVLRYGGVIE
                     LQRPDYIVVSFGAHNKVALHQNRAAMCALEVMKVLNTTTPIGPRVGCMIDASEYYVGT
                     CGAADRNALVTFSSSLVPKVDLIRVLKSVQTQIVLTQRLASTLESSMLVMPVDCMILN
                     PIGLKEIILYELRGHIRMLPSQVSVVMVRQVIRAVRMGFTHMLRGDYGRALEILEPYE
                     TMELQAARLGFMCRVFISRNINRPFVRSVTRLTFSEAHFTGYNEGCSTEWGESHESGT
                     SFGAHGHKSVSEGSVETANPLAAGGGIGGSASSFAFSPFSTELDPATLCLVVGASLNP
                     PLSRKEGPKQISEASVTASASSVATRANDGSLTMRRSTGAAGEEAEQDELERAAARRA
                     VADEGETALFEMFVENQPDDDDDVDDGEAEARGRGSRAGSSPYYSARNQAANSAGFGG
                     GGGGGGGERPVEHCTAAAMSTREAVRHPRKSELPFVFNDYEGNTWRRSYDILGTGAFS
                     TVYRGLSMSGNLVALKCFQLGARNIEVHAIVDEVRLFANLHHENVVQYLSLYVSGSHV
                     IEIMEFVPGGSLDTLLKSFGSLRPESVRRYMRDIARGLSYLHTANIVHCDIKPHNVLL
                     AMDGQCKLSDFGSAIARATSSICSIDSVLEMRGTPGYMAPEVARGEVPTMKSDVYSLG
                     ITILELLTGRLPWDYADAFAPKLSGKLTQPKSASEQRASQLQTCPAAGARGTRVADGS
                     VAQVGADLSKKTWNAGIAATRGPSGGPMTDSRLDAATMLSNSSYAGPATSMGETVCGF
                     GSGLLSSKNQSGEAEHSFRRLEFSGSGAEIAEGNAGLCQHALASTLEERASATVASLR
                     ATTASLVKVAAGKNAAAEACDEDGTGMPLGGSLKPSLEINQSRQQHHSIAYIPSSTSR
                     RPSSAIFSSFYQNPRFAVSLHRRPIEQVLRSSTELVVYIGRGLVVPRIPDTLDEDVIN
                     FLELCLKPDPAERASMSELMLHPWLM"
     gene            <1041852..>1043027
                     /locus_tag="LMJF_33_2300"
                     /db_xref="GeneID:5654654"
     mRNA            <1041852..>1043027
                     /locus_tag="LMJF_33_2300"
                     /product="putative udp-glc 4'-epimerase"
                     /transcript_id="XM_001685939.1"
                     /db_xref="GeneID:5654654"
     CDS             1041852..1043027
                     /locus_tag="LMJF_33_2300"
                     /EC_number="5.1.3.2"
                     /codon_start=1
                     /product="putative udp-glc 4'-epimerase"
                     /protein_id="XP_001685991.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654654"
                     /db_xref="GOA:Q4Q3V7"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR005886"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR025308"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3V7"
                     /translation="MRVLVCGGVGYIGTHFVRELLRYSPHDVIIADSLEATHGSDVHV
                     DTEKNYAARNPGANLEEVKRSGYRFAKLEVGDVRDVDFLEHVFTTHAPIDAVVHMCAH
                     IVVPESVRDPLRYYDNNVVGMLRILQIMLKYKCDKLILSSTAALFGNPYARMRAGSTD
                     EPDPMKPIRSNAKCMPESPYGTTKLVGEYMLKDCAAAYGIKSVCLRYFNACGADAEGD
                     IGETHEPESHLIPLILRVPLADKINAYNAVHHPERQKVNGYVSIFGTDYPTPDGTCIR
                     DYVHVKDLSSAHVRALDYLAKLTPDDKDRFFSTFNLGTSKGYSVREVIEAARRVTGHP
                     IPEREEKRRDGDPPVLVASGEEAAAALGWTLEYESIDKIIESAWKFHSKHPVGYELH"
     gene            <1045611..>1047188
                     /locus_tag="LMJF_33_2310"
                     /db_xref="GeneID:5654655"
     mRNA            <1045611..>1047188
                     /locus_tag="LMJF_33_2310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685940.1"
                     /db_xref="GeneID:5654655"
     CDS             1045611..1047188
                     /locus_tag="LMJF_33_2310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685992.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654655"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3V6"
                     /translation="MRKTVSMRVAPGGAAEATRAWAQATLNAVAIPPVPRGTHYSLFL
                     QRHHRALGLHSCGEGAGSRFQALRCSRAFIKSRSLSPDDPFGERSTWEDPSDGIYAAW
                     KDVDQEAFVNATESQEVRQAHFGPEWARFSTVGRMSVKKMREEQTLQHAPPSGAADSE
                     SQDAGVAAAASGSLTQRYPTAEELHEADLRQRRRLLERNYSSYETFLEHEVGRGEEFA
                     EAEEGLAFASEAGGHRGDAQVELYSAASMESAFSSVEGLDGLDRMAQRNVEREARETL
                     EAAEVAERVPLPPFMFEPDTRDVAAAPALSSSNLTPTTSSASTATEIRRSKTATNMSA
                     VKPCSTSGSPSKSASPSTSAVAGGIPASVVRQVLGALGNPHGDSRLPLTDPLHWGTED
                     IIRFLTLMEQPPISVDAGDWPASSAWSAMDDTMCDTFRMACVTGETLLNVVRPPRLFR
                     LMRQWHIRRHDVLSKAWKLRVQAEGALATEADSRLPADGVQMTVEQNRERLAEAVQQL
                     DRNLIHETILLCFPYGH"
     gene            <1048433..>1050790
                     /locus_tag="LMJF_33_2320"
                     /db_xref="GeneID:5654656"
     mRNA            <1048433..>1050790
                     /locus_tag="LMJF_33_2320"
                     /product="putative cell division cycle 45 (CDC45)"
                     /transcript_id="XM_001685941.1"
                     /db_xref="GeneID:5654656"
     CDS             1048433..1050790
                     /locus_tag="LMJF_33_2320"
                     /codon_start=1
                     /product="putative cell division cycle 45 (CDC45)"
                     /protein_id="XP_001685993.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654656"
                     /db_xref="GOA:Q4Q3V5"
                     /db_xref="InterPro:IPR003874"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3V5"
                     /translation="MATASGALEPWERISTYYASTRKSINVLVAPTADAAAASLSLTY
                     LMKVFLFPFQLHPTSSYDELKWFIEQANFAQDSEREDDISLRIDDLFILVGLGAPVLL
                     EDYFDFTRHIVIVLDAYRPFHLGNLCREDGDRCIIWGSDRIQVEVDDFFRKQRAEEAQ
                     RRRRHRRRLDMKRHEGHARRQRTEGGGAQDDDVYSDESSISTSSEEEESADSDGDEAA
                     DLFDGEDDDATPSQSQDRVDWRSAPGEVPAYLEALYYACSCAGRSSAVEVYDLSVILH
                     RFNDTILWHAAVGVCDLYLRRLVDYATYLVEMGPLEEAVSLQQSVRRGILRDRTDEAV
                     NSYHRASTNSMQLSNREEEQLYLLRHSTLWDAIWYDSQVASALDLHHVEDGRPRLSQL
                     LASRCGVSIAMAQRPWCEVPTDVGSEALRRVQVELQNWVNAQGNFIAYRNRIRCISRK
                     VGYSTEVSTFDVCKLFTAEMAAVPPASVYVIERSPANASLSPEEVAALAQRKLVEFQR
                     GQFWRASAVLDIDPNEKLFHEALAGALSLQQAVADATGSMMQPGNVQSSTGIHYALPS
                     DPSKTSPTLESFCTMRRLSVLAERLFFTLSMSRRRDRRALTALRPLILSCVLPQARLA
                     APPTASSGSGSGLPCGPGTDALVPAVHWSRASGGVPSASAATAAGGVFMGGGAQVEDT
                     AEYVVVLTHAGNTGAGMMPLLPVYRFAQCMQDEHFHTPPRRLFVERNAVQVRGRENTT
                     YLAERMLLLSVKTTVPRHEFRKRRAPAVDEYDDDDGGTEVVEVVD"
     gene            <1053270..>1056473
                     /locus_tag="LMJF_33_2330"
                     /db_xref="GeneID:5654657"
     mRNA            <1053270..>1056473
                     /locus_tag="LMJF_33_2330"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685942.1"
                     /db_xref="GeneID:5654657"
     CDS             1053270..1056473
                     /locus_tag="LMJF_33_2330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001685994.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654657"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3V4"
                     /translation="MTREREKAVSSQLSQSFPACAVPPSREAGPQPSDLLPRSVAKAP
                     PYTAKAASSPSSGSASPATKSTSNVDQAIRSTATLNVPVELAQLQPQQAEEATASHLA
                     LREEVWVENEELRRQLGVLLRIQEELERRYQQREAAVARVEQRHASEKKVLALEKEQA
                     LAQLSRAYEEQLQMLRNAEVLAQSNADTLAAEVVTLRRELSEVQDERRKSLEQQLGCR
                     RQSDEAMAAQARMQAECATLRAAAADVKPERAAEVTAQVAELQRKLWITEERAAAAEL
                     ALQALCSQLTAAAETTLAVAGADVQVGHTLDRDVTADAKLVHCSPTSELFSNDTQATA
                     APVLFDEAAVLTAVLSAMQDNGVSAAFSSSQRASSPTGGEGVAELSRSGSNGTSMKIE
                     TFVSQQQLTAPVLPPSADACGAPIRAGLSNAGLLRCQQHRQLLQVVLARVSDGYQRVA
                     REATAAARAAKAEHALSNEVKELRARLEQSQQLLLSHERGRQDEDSHTHGRAVAGCQT
                     TQSILQRRSSVGVVTDAVDAFSVKAPKAAAAAALQHRGAVEKAAYDEALAEAQRQLRH
                     ERSYICRLQKEVQSLRSSSYTTTVLEGLTNTVQNMRVAVCRLVRDAVADVQRIIEQEP
                     QRLQAPATNIRGCASEMVWRDDAGQALRGRWRAMHEDCRHHLNNSLPARETDNVHCAA
                     TALPFSSPLLDFAFVRAVHKSILRAEAHVQQVSATLLRDYQRVFSNTHALLGTHKQDE
                     DTAYKTSASPRSQQMSCSARDAVHNSLSRAHGACREAPSQRHAERGGTSFGGDSPSPS
                     SSIAFSGATRKRTAQQQRVYAEMCDLLQRSAPSHDGMTVSTVSPSHHSPDGSHWLSGA
                     RPPQARPSGMNASPTSQLSPYVAAYVTEPAELRRAASSCMPLDSAAKSVTLSSDARLG
                     FAHLADATQELRNVERVLDNIRDAEETREARRQQCLQGWQDAIVEAVDGVKERIEDAL
                     TLLRCPGAGAEVLPCDAMRRAKETHVASTLKAASADICADPAGDEPERARQGQNAQLS
                     VSHGMNPVVPHRGPSRLSEVLSGTMRLKADGDTLLSA"
     gene            <1057740..>1059209
                     /locus_tag="LMJF_33_2340"
                     /db_xref="GeneID:5654658"
     mRNA            <1057740..>1059209
                     /locus_tag="LMJF_33_2340"
                     /product="putative succinyl-coA:3-ketoacid-coenzyme A
                     transferase, mitochondrial precursor"
                     /transcript_id="XM_001685943.1"
                     /db_xref="GeneID:5654658"
     CDS             1057740..1059209
                     /locus_tag="LMJF_33_2340"
                     /EC_number="2.8.3.5"
                     /codon_start=1
                     /product="putative succinyl-coA:3-ketoacid-coenzyme A
                     transferase, mitochondrial precursor"
                     /protein_id="XP_001685995.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654658"
                     /db_xref="GOA:Q4Q3V3"
                     /db_xref="InterPro:IPR004163"
                     /db_xref="InterPro:IPR004164"
                     /db_xref="InterPro:IPR004165"
                     /db_xref="InterPro:IPR012791"
                     /db_xref="InterPro:IPR012792"
                     /db_xref="InterPro:IPR014388"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3V3"
                     /translation="MLRRNFWRLVGLDKVQSLEEAVADMTDGISVAVGGFGCSGVPDA
                     VISAMCKKGPKDMILYTDSAGIDGFGLARLIETKQVRRICCSFVGMNKIFKRRYLEGD
                     VELEFVPQGTLAERMRAGGAGIPAFYTATAYGTQRQTGGQIIRYDKNGVPCVISAPKE
                     TRQFGNRWYVLEETIRPDYAIVKALKADKSGNLVFRGTARNFNIPAAQCGRRVIAEVE
                     QVVENGEIHPDDVHLPGVYVHRVVQASYEVPIEKRTVSGSGAEPSSVNPNDDRQKIAR
                     RAALEFTDGVYANLGIGIPTEAANYMPAGVTVTLHSENGLLGMGPFPTADKVSADWIN
                     AGKQTISFLPGAACFDSATSFAMIRGGHMNLTMLGALEVSSNGDLANWGIPGKLVNGP
                     GGAMDLVASGSRVVVTMSHCNKRGDSKLVERCSLPVTGLHCVTRIITEKAVFDVIDKH
                     LVLKEVAEGLTVDDIKKCTAAHFEVDKVKPIAYAAPISG"
     gene            <1061012..>1063564
                     /locus_tag="LMJF_33_2350"
                     /db_xref="GeneID:5654659"
     mRNA            <1061012..>1063564
                     /locus_tag="LMJF_33_2350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685944.1"
                     /db_xref="GeneID:5654659"
     CDS             1061012..1063564
                     /locus_tag="LMJF_33_2350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685996.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654659"
                     /db_xref="GOA:Q4Q3V2"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3V2"
                     /translation="MESNNHTTDLPSHAPGVEAAPIAAATPPLTGLAEGAVVTEGASH
                     PKMAAAEPSEATATESPPSPHSTGEAKTQNALAALMSVLDNDEAARRGGTSLRSLQKM
                     CMRVPQLSTELTRPQRFQLYCLLLLEDGDDPAVPGGAAGQEDWTTYTKQALETHVHMA
                     KQAAALFPTTLHITTDELAGLFYRLGADATFYFNPAMMEVILCVTYVVAGSRSTDKNM
                     LLRTLYRMLCVLQKDFIVAAASHLYEPATTSLLRLMLQFYDPQLVTHMDQQQVNIGTY
                     LFDWSRRLLVLQSDYDTALKVLDWVFILGDPAMVPYVAHAYLITHRRSLMLLSTKQAL
                     TQHLDKMKFTLPACKADAINPELVDGRATAPTPVWGGKSLLQNADLLYRVTPLSTQRM
                     LAFCLYPDAGALNKTSKELQEYYAKTPSLPLERSDIASAFAKRGAAAQGGGDALPSHE
                     YVIADCRSRESFEYARLPTAVHVGDVLSYHHEDLAEALRRLESCRGHPLALFGTGRPI
                     VEEVNLLKVLALYLVNRQAFPFVCIVPGGFKTTIPLIRNHIIDAIMSPAAAAALENAT
                     GKRGVSSIDWGQQASKTAHKISAALNEVSGYLAQVEGAEVRQKAQELGTKAKEGVAAA
                     GSWGWGMMKRVRESLSETSEQALTALSSVSGKLAAAQMTTTAISGSAPSSATAPSAAS
                     KSSTGGQAAIPTAIAHPTAVRPSRQPQQVFSLGEDCAEEDLDLITSIPARPLRGTVVL
                     ESPPVAAEVAPSAPAAPSSAAVVSASERRHLTAPASSPAVAAAAVSLEPVSPPTSSAA
                     PAAATAARGASAPQIAADLDAEFDELFGDLTVTPAAASRVAGLSAAEADGFP"
     gene            <1067576..>1070362
                     /locus_tag="LMJF_33_2360"
                     /db_xref="GeneID:5654660"
     mRNA            <1067576..>1070362
                     /locus_tag="LMJF_33_2360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685945.1"
                     /db_xref="GeneID:5654660"
     CDS             1067576..1070362
                     /locus_tag="LMJF_33_2360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685997.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654660"
                     /db_xref="InterPro:IPR013946"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3V1"
                     /translation="MAATAASETAGDGINVPAASSPTTTQLAGNHHTRQNGTGVSGEQ
                     LSEDRLLSRSRHGGSGGASGMAAGASTDLRSAGPSLSFSHTWHTGDAQAPLTSPATTC
                     IPRRRTSAASCWDRRAYATELVGWLHLLVWVRWQVIHFLRDLSGVQGFVAWSAWYWSW
                     AQEHSRQAAFHQALSASFWRGVWLHGLHAQLNQVQYEVSRHMFTLQSVFQLIVSYIGA
                     VYTALEQLNTLLMQVQRSFEVMMSPVAAAAAVAVARAPVATAGSSCTASPLPANYANT
                     HRGGGVWGCDFNANQNSMFWSPIAAGVGRGRASSRTQGSRDRAGSPQRGDQSAFASDA
                     APATPHARRGLHDEAERESDISFFEEEVEAASLHAMDELRRGVWSTLQELKTMFCPDG
                     RPLDALEVNEQQARFPWGGGGGGLSAAGPATASIARPDSEAGLHPSDENALLGMPALD
                     EAAPAAQSSGHQVHFAEAGTPSAHDGSGLDGGHPASVREGARVLLQCVQCSQALLRRL
                     TVLVQRAHSPPTARHWRRILVAAVTIVPPFMWVYTKSPTELAAIARKTVTVGRQVLWS
                     YVVDPVMQLRESLFYVRPGVEDRRGAVERDAVSLANIIRDFHEDMYPDMSQKRLEELR
                     DRTFKRLRAGVADPEGLGLIDEQYRHSVRHPIRSVLFGHLPRIMLIQLSYQALEVSRV
                     ANGIDEVLEGNDINFKIMAMMPVFLAGGLLATWGLFRYRFKYKPVRLRMKLLWRSLFR
                     VISFAGNGQGLVLPFLRISAQQQGIRPHAEATALVVDFPRVQTNLARVAGRRRSTKAR
                     RHVHSHRAAVGATLGSSLPSRNTERGGSGDMDAIDTAAFSESGRDSESSSDESRSASG
                     SAVTARELNNYEQGMVLLLSHVMRSIAAEYLRSYAFFHELMEDFNDLESVQSTRRQRL
                     ATLTRMRATHTYFF"
     gene            <1071221..>1072912
                     /locus_tag="LMJF_33_2370"
                     /db_xref="GeneID:5654661"
     mRNA            <1071221..>1072912
                     /locus_tag="LMJF_33_2370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685946.1"
                     /db_xref="GeneID:5654661"
     CDS             1071221..1072912
                     /locus_tag="LMJF_33_2370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001685998.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654661"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3V0"
                     /translation="MASKKSSVAVKKASTATSTAKRGQDAQQKRALKEKAEQEALAQW
                     IDSNDPLLDKTAENPIRMEELFSTKLVHRTFFHPGTGEQPYDWSEFRKVLESRTASSP
                     RWFMQLREEDLLAGDDGMEGVTVDCYIIAEAMQPTVAPGEYIVKVHWPYSDAEDNAPE
                     RILPLEGQDMCWRRVVAADGSDMNVFLLQKRGKTASADGSGTAAAAALASPVFAFGAS
                     SSSTAAVAAGAPTTTSIPGFGFGNTLSAAGSAQLTAATTTTPATPGFGFGFGAAPQSV
                     GETPASVASGSSNGISFSFSFGKQAAQPPSPGSVDFGFSPATQTPAGAATKPPLPGFS
                     TVAPVAEESGEVKVQPLKTSEVLFALWTRRRLTDLTKEIRSGSRIVREDFPLDGTRKI
                     KLVMQNDRKDDVATTARRLLLNRLFAKQNADVKAIDTWINDCPVFDEALTSALQGFRE
                     RQLNELASKSDLFQSLHDQYYAKIAAELQRIVAVRDTAANKELERINAIMSQIKERKL
                     AEKSGFRLLKFYAKNDVQKFRPFGKISGISEMGESVDVCVPPAHVNINPFTGKPI"
     gene            <1077783..>1079408
                     /locus_tag="LMJF_33_2380"
                     /db_xref="GeneID:5654662"
     mRNA            <1077783..>1079408
                     /locus_tag="LMJF_33_2380"
                     /product="putative Golgi reassembly stacking protein"
                     /transcript_id="XM_001685947.1"
                     /db_xref="GeneID:5654662"
     CDS             1077783..1079408
                     /locus_tag="LMJF_33_2380"
                     /codon_start=1
                     /product="putative Golgi reassembly stacking protein"
                     /protein_id="XP_001685999.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654662"
                     /db_xref="InterPro:IPR007583"
                     /db_xref="InterPro:IPR024958"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3U9"
                     /translation="MGQDQSRAKACQLGQAETGGTDRSVSAGSASAAPWEAPVSLAGV
                     EGFQVVRLLPDSPAHKAGLIPFFDIVTALDKVLLESEGKAALSFFKSYVANHRDQPVC
                     FTTFNLYSRTYRDVYCVPSDEWGGGGLLGCSIEWTRADACPERCVHVVDVLEGSPAAC
                     STELQANRDYIIGMQTVQETLITLIKSQKDFYCRLEAWHEEQRWALERKQFFPNERVE
                     VPHVLLFLVYNSESNTIEEVEVEMGTNPEAAVGISVATGLLHIIPSVATADLAVGASL
                     PVMSKFASVGHSVVTPTRAQQQEHQLLQDVSLTPAVGAAPQPREQSQESTGSAQPLPS
                     LPLPQEAHARCAVVDSPEVHTMTNPHEPPMNSCPQPCPPRPQLQQQLTEAALYSMPSL
                     ASFNVAPPPRHDAAGGTAAAAVEMGQKPFNPFAEEASPDYDVLEGAPLAHEGVMAAEH
                     HLGQHAPTMEQPYSSSYPPLSSQSPPLSGSLPAQMNGSHNPATALPSYSAPPPPPQQL
                     HVTTMPTFSSQRMPPPLQFPVFPGAAAAKRAPA"
     gene            <1081986..>1083890
                     /locus_tag="LMJF_33_2390"
                     /db_xref="GeneID:5654663"
     mRNA            <1081986..>1083890
                     /locus_tag="LMJF_33_2390"
                     /product="putative heat shock protein"
                     /transcript_id="XM_001685948.1"
                     /db_xref="GeneID:5654663"
     CDS             1081986..1083890
                     /locus_tag="LMJF_33_2390"
                     /codon_start=1
                     /product="putative heat shock protein"
                     /protein_id="XP_001686000.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654663"
                     /db_xref="GOA:Q4Q3U8"
                     /db_xref="InterPro:IPR001404"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020575"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3U8"
                     /translation="MGFKTETRQLLDIVACSLYSDKEVFIRELVSNASDALEKRHLLE
                     LSNPEYAREPADEAPLIALSCNQSKSRFIIRDTGIGMTREELTANLGTIAGSGSKAFV
                     HELQSSGKSAAEKIIGQFGVGFYACFMVAKNVKVYSRSAKKGSKGYLWESEGTGTFKV
                     TECEGVEKGTKIVLDVKDTELSFCTPQVVERVLKKYSNFVSYEITLNGGKVNTVEALW
                     MKDKNDVTNEEHIDFYKFISGSYDSPMFRLHYSIDAPMSVRALLYVPQSHTEKYGGGR
                     MDAGVNLYSRRVLIQSKAKGLLPDWLRFIKGAVDSESIPLNVSREHTQDGSMMRRLST
                     ILTKRIIRWLEEESKRDRSKYERFIQEYGPFLKEGVCTDQVHKMELAKLLRFQTTKSD
                     IDYPYVSLDNYRDRMQPNQSHIYYLNLPSKEMALQSPYYEQYKEHDLEVLICTEPIDD
                     FVMQHLDTYAKHKLQNIEMFDANLDGYVQHKKKLEGDKNDDVAVKKQLNDVQVKALSD
                     FISKRLVGRVGVVKSTDRLRDSPAVLADHEAAQMRKIYRMTGQAAGPPPKYNLHFNPQ
                     HPLIRKLYTLSQSEASEEVETAGLLTEQIFDNAIIAAGLLEDPRSIVTRLNTIMSRMV
                     EKVPEPSADQ"
     gene            <1085369..>1087072
                     /locus_tag="LMJF_33_2400"
                     /db_xref="GeneID:5654664"
     mRNA            <1085369..>1087072
                     /locus_tag="LMJF_33_2400"
                     /product="putative ras-like small GTPases"
                     /transcript_id="XM_001685949.1"
                     /db_xref="GeneID:5654664"
     CDS             1085369..1087072
                     /locus_tag="LMJF_33_2400"
                     /EC_number="3.6.5.1"
                     /codon_start=1
                     /product="putative ras-like small GTPases"
                     /protein_id="XP_001686001.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654664"
                     /db_xref="GOA:Q4Q3U7"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR023179"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3U7"
                     /translation="MGSHSKKSGRGGGGAHARQARQRQQGQLKVLKKDLGVPDLKDVA
                     QRLTQTAQRRTHSVLSIPHMHGAEEAGGSRPSSSGVSGRGLRLANLTRGGGAFGKSGA
                     CSQIRGKALQQVAQSTEGAGRTESTLADRRREMLTLALRASEKVHDYEAPMQLFRQDG
                     AGEGYAEEDSVWVEDMTRRGQDRSLQRFFKEFHRVVENCDVLLQVLDARDPLGCRLTQ
                     LEKNIRSTYGEERKKMVVVLNKVDLLPSKEVLDAWIHYFEQQEQLMCIPFAANAKGSL
                     GQTYVTNMFRRLRSLARSDETGERKAIVVGVIGYPNVGKSSIINALKRKHVVGVGNMP
                     GFTTGNTEVELRSDIRVMDCPGVVSPGEDSGDVVLRNAIRVSELVNPFLPVQRLLQRC
                     TAVQQADDHDNTDVAAHQALRNSGLHPLALFYGISQFRENDVMDFIEQVGMRRGRLTR
                     GGQVDEESTARMILADWNDGRIPYYTYPPAVDELFLRSDDAYRAVNSSGCLGGGAEES
                     STQAELVSAKVRGVMLDGLPTFHLHMDLIEQHQQRTKKRWKQSDVPYDDPDGDDGDEM
                     L"
     gene            <1088548..>1090548
                     /locus_tag="LMJF_33_2410"
                     /db_xref="GeneID:5654665"
     mRNA            <1088548..>1090548
                     /locus_tag="LMJF_33_2410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685950.1"
                     /db_xref="GeneID:5654665"
     CDS             1088548..1090548
                     /locus_tag="LMJF_33_2410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686002.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654665"
                     /db_xref="GOA:Q4Q3U6"
                     /db_xref="InterPro:IPR002728"
                     /db_xref="InterPro:IPR010014"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3U6"
                     /translation="MRVALQFPDERLGDAVAVVHCLSNLVATDQRYVEAMELKRVEGV
                     VREESQCCPAGGVAPPQERGLPVAGAAAAHSRPATMDNPNCPKSAMRLFVLADNTFGS
                     CCPDEITAQHYTADCIVHFGEACMSRSTRLPVFYVQPAFHFSALTTGAVAGSDAVGAL
                     LDAEATLVLEVARRVASAIRHRLTNWWAKKAEATGASAGAPCPVHPRIAIVGTYPTKA
                     IVQAAEGRWSTTEDASVPISWPIFEERCLSVAGEPVKLHGAEASGVADAGSTSSGEDC
                     WVVNGVRFPRVLSSSSSPAPSHEVQYVLFIGAVGSSALVHVLTAEQYNQFHYSDLCRE
                     YLAWDGGAEVSNVPVVCVLNSSFGDTAEAKEQLHNVSKCLAGSGASLSASLELRGAVH
                     HWVSAACADGVAAALVTEDGMRAQQVLQRRMRQRAFNIESVRASSAIGILVASLAIEG
                     YYEVTQQLHQLLRAHGKRSYMIYVGHLNEFKLANFVDTVDCFVAVACPYSRQSHFTEK
                     RDGFMKPIVSPAEVLVALMSADDTQADEQYGMAAVYTTSFQAVLPLLKRAVQARQSEL
                     KSRAGGTDADPQQRQNDEEERWTSSGALVRASTGSGGGALIGQGSSQGALARLYDREY
                     VGLDPRVGQTPVQANILEGKHGIARGYAKEREGQGVPPSGTP"
     gene            <1091872..>1093683
                     /locus_tag="LMJF_33_2420"
                     /db_xref="GeneID:5654666"
     mRNA            <1091872..>1093683
                     /locus_tag="LMJF_33_2420"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685951.1"
                     /db_xref="GeneID:5654666"
     CDS             1091872..1093683
                     /locus_tag="LMJF_33_2420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686003.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654666"
                     /db_xref="GOA:Q4Q3U5"
                     /db_xref="InterPro:IPR002893"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3U5"
                     /translation="MTPTHPTIAHERGGQSSSAVRSITPAVPTTPLGRGAATFVRSGE
                     QAPPQLLVHPAALTALEADTDSAGAAAALDGERSGRRQGPLRTGPSEPVSARVFSVTP
                     SRSTGVASALLNSAANGFLGAAASGGTAGATLSNYSGKSFGGVSTRNQNRCSHCKVAE
                     EVLYRCPCGLARYCCTTCQQAHWPFHEAVCCHAVRALRPPTRHCDWCRTPSQTLRQCG
                     CGFAYYCDMHCQRADWPYHCIVCSTETSTALATALVGGRALRARHEAATQTAHWQISV
                     PVIRPTGRGDGTTAAENATGMSVHLHATLRERHSRSDSDGEDNAFSGSCTRASLAAAS
                     DAEATPPKSPRRCSHVRATSEHGSQVGVNSGSGAFAAFHQSRETPVHASSYADPGGRT
                     PTSTQPAIAGGDMGAGQYGVWFAGVNSRSTLSHHHATGTLYKSRHINTSAAQQHRHNP
                     LREGSRAGGSQSPRLSQAGEPDHGAAGASLQNQHHQSSLLTDHHSHAGPASQSELFHG
                     SLSAVAGPAIRDQPGVVTFLVASRHIVEREEVSARAALFRKFRLGCAGLQMRVLGKRE
                     EEERMAILKDEVLWCVLTGHPAWKKLMHELQRFHEVR"
     gene            <1094908..>1096860
                     /locus_tag="LMJF_33_2430"
                     /db_xref="GeneID:5654667"
     mRNA            <1094908..>1096860
                     /locus_tag="LMJF_33_2430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685952.1"
                     /db_xref="GeneID:5654667"
     CDS             1094908..1096860
                     /locus_tag="LMJF_33_2430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686004.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654667"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3U4"
                     /translation="MLTDYWLLTDLDGTLIATPHKANGRYLPITRSPCFGPIRQWLSS
                     DGNVCIVTTADLRAIDQVYYPLRSFLKTYQEYVDEAAAAGTPLATVDGMTAQPPRRGC
                     LLLSLYTGAALYWCTSDSIIMLPGYASAVHCATREAVELAAAYQLRMSHATLFVDGSG
                     KQLRPQPEMCVHGTCIDSATARCLRTRVEALYLDYVRDVLSGKDPAVREAMKWLSQRY
                     QSMWGGLLQYLELIYATAVHNHPASPLLLGTMAKQTLLTLAQQPPADPEAVEWKVDYL
                     RSRRGFLTAVGILRVEYVESHLCYTEDDKSTPRRVLSQNVEAQTKAAERAQLVSYAAQ
                     VLLADLPATAAPKLAAATATMASFLVDLLAPSVKHFQQQMREATLPVTKLVPSSPSSA
                     LPASSEGVANIAQVILLGLPLRLFSKYFRSHVAEMVHGGVNPMPQPNSVVFSKIGVSK
                     STALRYLLGKDRVASVEDEWQLHFTEATPSPKAGPASQAINFAGCVQRYHGIAMGDNP
                     QSTDYELTVFRDVTFLSVEKESQRVERQRRILRRLQRTQSIESRGGRPLMPDGSRAPS
                     YAELVSSLRRSGPMMDDRLFRNINYVGGEEEGTALFLTALLHYAKAARTSEKDQMTTA
                     EFRRLVSKAQETSRDQVMHRTPPAKL"
     gene            <1098169..>1099689
                     /locus_tag="LMJF_33_2440"
                     /db_xref="GeneID:5654668"
     mRNA            <1098169..>1099689
                     /locus_tag="LMJF_33_2440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685953.1"
                     /db_xref="GeneID:5654668"
     CDS             1098169..1099689
                     /locus_tag="LMJF_33_2440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686005.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654668"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3U3"
                     /translation="MRNLSDQFPVEDSPMNARRQMANGDDHSQRDSPMNHDVAHTYEG
                     NTLDGHLTKAESASMTKTPTAAANGACANSAPSEYVVAKERLEAARAAHKQRLREIKD
                     DKSLKIKSMPSLEELRDERVRLSEQVLHHKDEQDSLALDIEGLEGAAEVYQLAARVQR
                     LEHFANRAYEYAEETLPRDIERTLEEDRQLSNRELCAYIQELQSKRANTLKKVVASQE
                     GMVKRNLRKGATATTAALGEDADPMEAKAVAHTQENKDECVVLHQKIRRFCAMRTKLQ
                     SDILKEKSASKKMEERMCAAIRTAELANARDARMCGELNNRNAAATTNSQLLIDQLNV
                     GHYGLGNAPSTKQLLEDRKAREALLETTETDQQQYGRFVSSGSLGSRQSYANSQSSHQ
                     RAIKPPLVASKPTAAQRARDDASRSSREEFAQMLRRNSDGNSYQASRSQSLSKPPLVA
                     SKPTASQQSRETALRGEREEVSVSRTVARSNSLFSDVRPPSLAAKSTASQRSRDRQ"
     gene            <1101417..>1106345
                     /locus_tag="LMJF_33_2450"
                     /db_xref="GeneID:5654669"
     mRNA            <1101417..>1106345
                     /locus_tag="LMJF_33_2450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685954.1"
                     /db_xref="GeneID:5654669"
     CDS             1101417..1106345
                     /locus_tag="LMJF_33_2450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686006.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654669"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3U2"
                     /translation="MTALDAAAHDAAPSLENVAAAGTTPWPTEIFLRFSSFRDAYSAW
                     HEHGDFFRWLQSSDYAVVLLAASNLRPLHFTVKKPATTSTAPSPNAAETPAVHLALCA
                     PCCNTTVVLTEEERLALATLARILPFHVGPSGVATPNERLTAIPVHATQLERQHRVMA
                     GLLARAHREGCAWRDRLATGEQGSATDEATAPCARQLLLGSPSLCIMDSATVRAFCAA
                     VILRPPDAEAATSAAARTRCLLPRGTPPSVVRQCTEDTLAVLDPASSGVDCEAGTAVP
                     RLRYTGSTVNDRILQLFFAPKKRPRPEASSSAACSESGVKGEVVLQYMALLMTLYGYT
                     VAAAGDVQSVEAENADGDAVDLEQAEYAARAGTFRPSRWGAPPWKSPPTILSSADEEE
                     GNRRVHKETSTQSEMVSVADAMMRLGWHVRCQFCAHSPAVVAVRETVTTTTTTTITTT
                     RTAEALRTAACASGRSTAEASRDETQSFVDEKVDVRQPQHRVGASVESGSGDGVGGGN
                     EDVLGALAEVEAALLSADRSRHSGEVKDEAAAVAAALVNASAAQSDGAKEDGDKREAC
                     AHSYEYGEEEAAVSATPFSSVGRGSRDGHSEEEVDMSRGLGSDIASNEETPTREDSED
                     ASCGGEEALGEQSTHMRSGVARSPMEATTLLGTAGAGAAAAAFVFPSTTVTTKTVAQS
                     ETRSVTTITMTFSQRLALQKDTPKQPQQCSGISNSGHHGNCPWHRLFLTDAIDATALA
                     APERFMDFTWVVGEDGDSLHEERVADLSNDAPTSAATSGDRTQCGANEIAGGVGADGE
                     ELLAPPQDPLPSEGESDVCEASEKNSNRTLLVLRFLLPEVERLITTWRLSEEWERTRP
                     GEYLRHPLWRTWLTSQTLHPVRTESADGMMEQYLRALERQLMSSQCTAEETDASEKKP
                     AAAAGDKGNGSNVKNKAAAKAMEAAKWEALGTLEELGVTVGAPLYNVNATSFNRTVES
                     ALHLAARSLHRCFASDQAAAAAGGRANSGDARTLLREGLRSVLRGSGTSTAQSAAGGS
                     GAPLKAAFSAADNEESRGKEAAEAARAFLKTMEARYADSVVREGSCNASRLRLALQRE
                     AIPHGLHEFTASIYPALQPRAGDCSTCAADPVYVVNTAFGSTNAAPSHTPSDVDCSRV
                     TQYLQGMQHTAQEEQLQLQHEKERREEAQRLAAAKVAAVSSAAAANTTPSAPGARAPA
                     TQMSASKGPAKQQQRQQHSHDSRDPHSSVPQSPWPNQKQLRSTRQAPGPSQGTSVVPA
                     PNLTPTSSSSAVFQGVVCHSGGPPMQQVGYDNPLWGSPQPFSHGTSGVSPPLQPTPVH
                     HPTDGRTDNSAVPPICAPFKDQRGDSGLFNPSADSSFFPAPSAVPAGNQEPIFRDCGI
                     GGAPLTGSGLVSDGGPLFSALHPFEWLPFPSGSSGGDDPGVLETSVYAHPSAGAPPRG
                     RAGGPPSRSGDSVLGSLNTSNLSSGSGGPAEDLRLSNWSSSSISQGPATGDSGGGAVL
                     GPIASPVRRQDSTGGGSRNAGGSSAPSVLGTSALSSFTGPKTSTSGTQPLPASRGCAA
                     NRGRGSGGGRQNMQLSASHNQPAPRVKAGSAVLGGGGPNAHAPPARGGGGSGAGGRSG
                     QGRNRGGGGGGQRRGGGGRVGGGGGGGFRRGG"
     gene            <1107057..>1110212
                     /locus_tag="LMJF_33_2460"
                     /db_xref="GeneID:5654670"
     mRNA            <1107057..>1110212
                     /locus_tag="LMJF_33_2460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685955.1"
                     /db_xref="GeneID:5654670"
     CDS             1107057..1110212
                     /locus_tag="LMJF_33_2460"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686007.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654670"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3U1"
                     /translation="MSLVPHTQELQREVEALQQLRHSLHDAYIVEDKADHRSVRSARK
                     PLASIDMRRTVDAPTLNVLKSPNYPFTLCEEAPPSYVPPPVPYDVEGEIDSLKQRVLQ
                     VQEDFQCYQKRHSRGGAPLSASQVLDFFSQSKAYAEIAWEVSSLQWFYRWILSHSISH
                     LWNCKEQLEYVLTDHDESLPQTVEEMDACLQAYPFATAVSILDSDRRAVVAQERRRLR
                     SVSRIFRENVPSIAVTAATSCYLTPEEKYMYQEFFNQSEHMILLLNHTLLLNEANSAS
                     AAALQSRTESGSRGLLFNSQSRAHGYLQDSDALSVPSEPAIGVMDTASLTKETLNAVA
                     AEQEMITALMKAICERQQRGECFEVSAAEGERTRAAQVAVYGCVLSDMSLMAHQMSLT
                     VEFMEHYESWLKLYGYDSHDQLMTALSKRSGGTAWPTLSIYAEYRGADRHNHFVPPTE
                     SLMRYYRPREKAPREAVDTKGKPPASETCKPVGRSVAPSGGDSGGSAPSFPSVPSAAA
                     PSKASAAANAVNEHMVVSPASMPLSACQETDSEVANAFYSLLIHANEAVRKSRATGAE
                     KDDAVERTWLTACVRYAVIKMLRRDWSAADVAKGMLTAEEALLAVVGRKGAFSCMKST
                     AAALCVVVKEVARLCAARSSPPSLIAEVPVAVHIPDDVDNYAKVVAYVTNPVEQQRWG
                     SLVDAIWFQADPSSASCGGLLFHPTSADGVLTGPIPCNKQSAVHFLYMEAICMPPTAV
                     ASGVVSVALRYRIPRMSPAADTSRRVAPTLAAVSDAQPSSRGGLSRYYLARRVLMALF
                     EIEAKGLLPCFACRLSEVSVAPLAQMVYVAFDDGNTSSVVDKNHVPHLCMLPPAAMEL
                     KRMDTKVGAAPVPKRPTDAPYAAYAEPINFSSIGLLVGGALEDMASRAPTLHDLYMTA
                     ATVLEQANFDIKSGATPKAFANASTHPIPIACAPAKTRAMSIQHEPVINRNSASMGRF
                     ISPLLRHVDDRISSWELGDGISSVGGVSNNASTNTQSSVWTQRDAAAPEPASLTGRQT
                     ELVGRIDTASPSPSAVRPNRR"
     gene            <1112585..>1113784
                     /locus_tag="LMJF_33_2470"
                     /db_xref="GeneID:5654671"
     mRNA            <1112585..>1113784
                     /locus_tag="LMJF_33_2470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685956.1"
                     /db_xref="GeneID:5654671"
     CDS             1112585..1113784
                     /locus_tag="LMJF_33_2470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686008.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654671"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3U0"
                     /translation="MSVKSAEAVPTSGGGTALSSAAARNVRALRYGSLAILGGYVVVT
                     FYKIGLIARILPVALNHPLESAVEAIKSRTQPVGDAKRFALARSHLTATYSLAASGML
                     ALVSGVATFRCVPRVPIAIPVTTAVVPAVLLLGIPKRLMLRGCRLLCFFTSLVSVGYA
                     LGPIGWVAQDTLIVLVLLTGCTMTGLCLPLYLTRGMISYVVSAQVLSSALSVALVTAP
                     KQSKDNSPFKALKEQAGVRIILNGDINVLFTMQLMSNVGVCALHTLPSIYHCVTWQGC
                     EADLQDSIDPVREAFGICAGTTYVIYRCVRWACRLLIRRVMADSSSNPHGRHGQNTWL
                     ALSNHSLDVNRASAVVSSVVMGLWYVRAVSLLQKGDMETLLNQLRSACARVSPMSLLL
                     GSSAVRC"
     gene            <1116289..>1118046
                     /locus_tag="LMJF_33_2480"
                     /db_xref="GeneID:5654672"
     mRNA            <1116289..>1118046
                     /locus_tag="LMJF_33_2480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685957.1"
                     /db_xref="GeneID:5654672"
     CDS             1116289..1118046
                     /locus_tag="LMJF_33_2480"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686009.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654672"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3T9"
                     /translation="MPTKDESAASRTKRFANQRPGGDVPCWLRRTYTRTIPKDIRTTQ
                     ELQRSFEDIREQWRDLCEAYTHAKAKSSWQVESAIEETVPHGTRSAVERLVSQLKSVK
                     QELLAHLSRLSGALAGPAAPLPTEASASALPAWVSDVMGCSHNSRARTVRVEPCSEAM
                     QSYLQAIWLARRVWVWSLCFASVAMDLELLSGSVSVAAELFFGNAFDTAVAPELGEAH
                     LTQRDSRAFHSAYNMGGSISEALLYATVEATAAKEPTESRAGNAIARLDDSDSPPHFA
                     AKVDEEACEVAAFFGCSVSAARYTADTVAGVPSTHADSHAAAVKGEGRTRSLETSSAP
                     WVRDLFWVHAVALCYSVMARDDTSAARLLSVFETAKRSFSVEEAEGSTEGTEPSSLTT
                     AKAAEQPNPLQQSPVLQAATVFVLLAAKLIADEDYNAVQQLLHRAGFGSCDGRRSESG
                     AQGCSTLSLAALCPQGVLLRFLIRLLAEHVVRRQWTERGLGQAFRPMEPFDVGADAAA
                     AGSGIPNASNRHRLACALATRASTDDTAERTQPGSCVTTWSLFHATQHLCDALQMAAL
                     RSMGGDWPLPPALLRHAFA"
     gene            <1118853..>1120916
                     /locus_tag="LMJF_33_2490"
                     /db_xref="GeneID:5654673"
     mRNA            <1118853..>1120916
                     /locus_tag="LMJF_33_2490"
                     /product="putative recombinase rad51"
                     /transcript_id="XM_001685958.1"
                     /db_xref="GeneID:5654673"
     CDS             1118853..1120916
                     /locus_tag="LMJF_33_2490"
                     /codon_start=1
                     /product="putative recombinase rad51"
                     /protein_id="XP_001686010.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654673"
                     /db_xref="GOA:Q4Q3T8"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013632"
                     /db_xref="InterPro:IPR020588"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3T8"
                     /translation="MALIECAESLSSSTKAKLQDAGILYVSEVVSLLSSTGYRAGDEG
                     DSKPASALRHLSTALKHHMSPSDPRAPRRLRRDAGGDDRGALGGQAEPASVSRSIETT
                     APSTLRKDTEASRFLNLTEDEMREIVEMAARATAGADGEHKGGNDTASSAQGSDSIHD
                     VMSSLPPRAPVCLSRSADSAPETCERAHRGDRRSGAIPGCRTVREMHAEFQARQAQGF
                     STHVTTFSGELDGVLGGGVPVGGVTEISGPPGVGKTQLLMQLAVSCAMPVEFGGMGGA
                     CLFVDTEGSFVAERLEQMATAAVSLVRAILLTQPQPPQHETTVAPSSDARLSQESPKK
                     RGRSPPLDSRKASRSHGHCTDLGAAPGIQAEFTVESVLQRVHYIRVTDLAGLLALLHS
                     LPSWFEEERTAEAKSVGTSGTADTPTRSSGQGDSSVNSARAAVQMVLIDSIALPFRSS
                     EDFHREGLMSSTGSSGDSAMHLLVDTGRSAAHNSLFLQSPNRLLSKHGLWRRSRLLFQ
                     CSTLLEGLAATFQLAIVVTNHMTTKVLHGTAANGTANGSSAEESGCSAPNSEENAGQR
                     RQSVLVPALGDAWGQGLSTRLLLSFHHYDVPACSFADRPTSPSAATECTEDVVYSLSS
                     QQQQLPTSLRRVVQHRVVRVLKCSGQPRRETCFAVTSKGIRDARRDMVSQRVATAIRG
                     REPHK"
     gene            <1123717..>1124676
                     /locus_tag="LMJF_33_2500"
                     /db_xref="GeneID:5654674"
     mRNA            <1123717..>1124676
                     /locus_tag="LMJF_33_2500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685959.1"
                     /db_xref="GeneID:5654674"
     CDS             1123717..1124676
                     /locus_tag="LMJF_33_2500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686011.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654674"
                     /db_xref="InterPro:IPR006802"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3T7"
                     /translation="MTSLHPFEYAFMAGASFSPEERVQLTSSLPLLSVQTKRKNLVLW
                     GKIFGCKADYIIVEAFDDDAVVEPELYHTLDEGRTFSLLGTFSSVFSTCPGYSSCSGL
                     QQAEWKQFMLLGMRGPFFGDPAYEYRVSNHSSSDSAPEIQSVKESVRLALFVEEFDHE
                     CRVVPRGAYMKAERQATATIASTTGAEVDAGERAEVRRNTAFGGLPRTAEGALSLRNY
                     YHLRAVNPYRRLLAHKQNSLFTKSVLEQLSEHPLLDAAFESLAEDVPSGTWHLRYDAF
                     HNVVMGRNIRFSGSLFYHVPETCIYGTVYMGDGNMNINAAFEM"
     gene            <1125962..>1127995
                     /locus_tag="LMJF_33_2510"
                     /db_xref="GeneID:5654675"
     mRNA            <1125962..>1127995
                     /locus_tag="LMJF_33_2510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685960.1"
                     /db_xref="GeneID:5654675"
     CDS             1125962..1127995
                     /locus_tag="LMJF_33_2510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686012.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654675"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3T6"
                     /translation="MITNPGPLRVAYSPDYLDWLYRAYRSKLKYTDERKKAEEVFNGL
                     LLTNQTDEQGPAAGAALPGAPPPGQTLRPRHSVRRQAGEARRAAAQAKLDTLAKQQGM
                     LDLFERQPQFPAIHIDKAARFHVVELFKEMVLDRAWKPEEVWDKALLYRAILTERQAS
                     YPASYRYILDTAQRVNLAPRESGSSDTGSSSSSADARSSNESAGGIVSESTLVIPRED
                     NYMYFVYLVRRYYIDNAVEGHVVLRCHRQPNASELLFSHPPPKDEHEVLRSLYRPGTA
                     TATQGKDASAKAQDGAATAPQQRPSGAATIARPRPPSSYPPIEALWRCEENEALLRVL
                     VFGELNLLVSENPFVRFPKAQAYLTRPSASTPVPGAAGGSVEGADGYGGPQQQRRGGG
                     HRGIGSDGGISLSSVIAEKRGHLLAPLSRNVAMMIDSRANDVRRLQQRYEREDTASFQ
                     KMLRGSAQVEENPGLYSAYSDWSYFNPRAVRAEERDALSRQTVAALKTYDEASRDIYR
                     VGFEEAEARSAVRPVEGVNNAPSYVPTLPHFVALVKKDPHVSFLSHVALPEVYNTASH
                     AAAGVSAKHQLEKLVVQLARALYRTALEFHKEQLRRVNRQKVQVAASLLDRFVTERWR
                     VHCVAHPSSEGVRDMARRFRAYVPFEGRILDESGFPTDARVEDYERWMAAPSV"
     gene            <1129615..>1131330
                     /locus_tag="LMJF_33_2520"
                     /db_xref="GeneID:5654676"
     mRNA            <1129615..>1131330
                     /locus_tag="LMJF_33_2520"
                     /product="putative UDP-N-acetylglucosamine
                     pyrophosphorylase"
                     /transcript_id="XM_001685961.1"
                     /db_xref="GeneID:5654676"
     CDS             1129615..1131330
                     /locus_tag="LMJF_33_2520"
                     /EC_number="2.7.7.23"
                     /codon_start=1
                     /product="putative UDP-N-acetylglucosamine
                     pyrophosphorylase"
                     /protein_id="XP_001686013.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654676"
                     /db_xref="GOA:Q4Q3T5"
                     /db_xref="InterPro:IPR002618"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3T5"
                     /translation="MSSKAALLAVLAGSGQEHLVDDYDALSPSEQTTLATQILSYTNA
                     QWKHMNVILRDSLRLLNLSNAAAGTGGGDAATAAPNITPPPADTIINVPALLAKRPSE
                     LAAIRAAGMRVVASGEGAVLLMAGGSGTRLGMTIPKGMVECDKLVSGRSLFAYHCQRI
                     RKMERMAAAAAASLSQPSAVAAAGAAPVPPGAGRGTMPLLVTTSDQNDTATRQFFHDH
                     DFFGLLPNQVFFSRQSSLPCYDEATGRVLMQARGSICLAPGGNAGVYESLAKASATTS
                     GSQSVLAQIEARGVRYVQIVSVDNILARVGDPYFFGVAASYQAEVVLKTVPKVSAAEK
                     VGVVAQVDGEWAVVEYTEIGDRRSAETDPATGELAFNCGSIASHCCSLDFLALAATYM
                     ETSTFYHAARKTIPTINGPAPAIKLEAFIFDVFRYAKDVPSRAERAKKAPLPDALQIL
                     QVDRSMEFAPIKNADGAAADTPTTAAQLLLDLHTRWVTEAIEAAPGTYAVASTSTSAM
                     YTALERATALQRLRDGQCCWEISPLVSYEGEGLAAYVGQLIHRSATGSGVLGLEEATA
                     GTANM"
     gene            <1133690..>1137568
                     /locus_tag="LMJF_33_2530"
                     /db_xref="GeneID:5654677"
     mRNA            <1133690..>1137568
                     /locus_tag="LMJF_33_2530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685962.1"
                     /db_xref="GeneID:5654677"
     CDS             1133690..1137568
                     /locus_tag="LMJF_33_2530"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686014.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654677"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR012978"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3T4"
                     /translation="MVERLKLSTGALSGRVSGGLRRTKKGANLSRKQVFEAQQKIWKQ
                     KQRTAEEEAKAAKRERRAQIQKATNKKIHHVFDKTTLHAVQDGLTSAIEMLGQKVSPL
                     ALFISAFTALSKAPDQRHVPYMLSIMAACVPQLTQGVLLHQLQACFGLCDQLMAEYGT
                     NNTLVVAKALKLAVTMLLSIESPTVEQLQLLEKLEPSKLQTAAMKLYLSSFRKVLETN
                     ALCTRDAGSPAPRKDPASALYSLNTRQRFFCAGLPVFVRVCLRNLSETPAAVVAAVMA
                     ELTLLFDHALSPYIIESQEGQRCLDGLLSEELLSLLKPLHQQCWGMSMELLAIVFNRM
                     SYLKRVQPPPQEVAKAQAEYAASVGKTTRATQHGLDRTQTYIAFTDRFPSVPFLVQVL
                     NKLRVMDDSSLNAKVERALVGVGCCMYMREFTELLDFDPRAAYKAETVLDEDAAEQAS
                     TLWSTSYLLNVWRRTSAHDSLPFLIQHFFPLIQFCSRMAVDSEKEQRVEEFTRWSALQ
                     VQYWRVAAGFCHYPVEVTLESFRDLAKQLVGLLSSPVFVNTSASAIHVLCSGYSALRR
                     AEQDDDDDLDGAEVVPDDLRGEVPTSTAAQRQQRRLRKDALDEDLYVLSVTDPGWNPH
                     RYHNITQAYAELVCDTIFAKFSANIMPKLCNTFEAHDSTAVLLAIQSFSTVCNTCVMT
                     TILEGILHVSSNIAAQTARNASGSKAGNAPLTSKRRVILDIACAVVPQLSPENVMTLF
                     QDIIEPVLMDPAPESRLLQKKAYKLLYAMFEHRIKDIFPVLQRVLGLLSVSRQHVTVS
                     GLKMRIRCLSWALDACKMYCPAELLPTIRSLVGEVVLFSRERSSETRAMTMDVLDKMQ
                     RYMTAAGAPVNALLLMVIAGLSGKTTMMVSSAVVCMAKIVYLTHNELPESDLQAAMAI
                     GFRLMESKDVEVRTAAAIFARMALKLAKRSPAVKAAVSKALPKLLYAIALVTSQPSVS
                     SNTRMQLRVLLEKCLKRFPIEQIDPIFPLGSKNFLRYTQKMMKREERKSEKELKRRRE
                     KQQNEFDKLFLGAAMNAGREEAVEEDLLEAGALSSFVAKHAAPVFQGFGGATIAAGRD
                     IDVEDDEYDNMVLDFQSDGKLRIISKEEKQAEEAHKARQAMAERLLRRRSGLVVASAL
                     NEESSGRPGKRSRVEDEDFENEELTLRYGSRVTEEAAQKATEVYKGGRGSVGPSALQV
                     SRLRDQKAVKREMKRQRVEEDIRKGDEFRGAGDGDVKRGNLDPFAYVPLNRRYMNRRN
                     ARDAVHRFEAVTSKHLKGNKAKAAKGARNK"
     gene            <1138885..>1140384
                     /locus_tag="LMJF_33_2540"
                     /db_xref="GeneID:5654678"
     mRNA            <1138885..>1140384
                     /locus_tag="LMJF_33_2540"
                     /product="metallo-peptidase, Clan MA(E), Family M32"
                     /transcript_id="XM_001685963.1"
                     /db_xref="GeneID:5654678"
     CDS             1138885..1140384
                     /locus_tag="LMJF_33_2540"
                     /EC_number="3.4.17.19"
                     /codon_start=1
                     /product="metallo-peptidase, Clan MA(E), Family M32"
                     /protein_id="XP_001686015.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654678"
                     /db_xref="GOA:Q4Q3T3"
                     /db_xref="InterPro:IPR001333"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3T3"
                     /translation="MEPYKKLETIFTKVYRLDHFLGLGNWDMNTNMPPKGEESRGEAM
                     AMLSELRFGFITAPEVKSLIESATKGSDELNAVQRANLREMRRAWKSATALPAEFVGR
                     KMRLTTHAHSVWRDSRKANDFAKFLPVLRDLVALAREEGTYLAAGTSLSPYEALMNEY
                     EPGITTQKLDEVYANVKSWLPQLLKDIVQKQSGDAVIAFSQKFPQDKQEALCKEFMKI
                     WHFDTDAGRLDVSPHPFTGMTKEDCRLTTNYIEDTFVQSLYGVIHESGHGKYEQNCGP
                     REHITQPVCNARSLGLHESQSLFAEFQIGHATPFIDYLTTRLPEFFEAQPAFSQDNMR
                     KLLQQVKPGYIRVDADEVCYPLHVILRYEIERDLMEGKMEVEDVPRAWNAKMQEYLGL
                     STEGGDDIGCLQDVHWSMGALGYFPTYSLGAMYAAQIMASIRKELGDDKVDECLRNGD
                     LHPLLKKQQEKIWDHGCLYETDDLMTRATGETLNPEYLRRHLEARYLKA"
     gene            <1142138..>1143415
                     /locus_tag="LMJF_33_2550"
                     /db_xref="GeneID:5654679"
     mRNA            <1142138..>1143415
                     /locus_tag="LMJF_33_2550"
                     /product="putative isocitrate dehydrogenase"
                     /transcript_id="XM_001685964.1"
                     /db_xref="GeneID:5654679"
     CDS             1142138..1143415
                     /locus_tag="LMJF_33_2550"
                     /EC_number="1.1.1.42"
                     /codon_start=1
                     /product="putative isocitrate dehydrogenase"
                     /protein_id="XP_001686016.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654679"
                     /db_xref="GOA:Q4Q3T2"
                     /db_xref="InterPro:IPR001804"
                     /db_xref="InterPro:IPR004439"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3T2"
                     /translation="MAESISFAKGALVVPSCPIIPYIEGDGIGKEITEVAHRVFDAAV
                     AKEYGTTRKISWLEVLAGEKAFEQKGSWLPEETIEAFDKHRIGMKGPLTTPVGEGIRS
                     LNVVLRHRLDLFVCQRPVRWFTGVGSPIRHPEWVDMVVFRENTEDIYSGIEWGQGTPE
                     AAKFADFLTKEMGVTTVRFPETSAYGVKPVSLEGSERLVRAAVQYAIDHHLPSVTLVH
                     KGNIMKFTEGCFKKWGYALAEREFPDAAFTMTQYDAIKEKGGKEAAETALREAMDSGK
                     VVIKDCICDAFLQNTILRPLDYSVIATMNLNGDYVSDQLAALVGGIGIAPGANINYVT
                     GHAIFEATHGTAPDIAGQGKANPSSLILSGAMMFDYMGWSEVSARIINALEMVFQANM
                     ATVDLARQMTGARALSTAEFGEAIIKKINGDEA"
     gene            1146319..1148101
                     /locus_tag="LMJF_33_ncRNA3:ncRNA"
                     /db_xref="GeneID:12980838"
     ncRNA           1146319..1148101
                     /ncRNA_class="snoRNA"
                     /locus_tag="LMJF_33_ncRNA3:ncRNA"
                     /transcript_id="XR_002460997.1"
                     /db_xref="GeneID:12980838"
     gene            <1150080..>1156316
                     /locus_tag="LMJF_33_2560"
                     /db_xref="GeneID:5654680"
     mRNA            <1150080..>1156316
                     /locus_tag="LMJF_33_2560"
                     /product="putative Unc104-like kinesin"
                     /transcript_id="XM_001685965.1"
                     /db_xref="GeneID:5654680"
     CDS             1150080..1156316
                     /locus_tag="LMJF_33_2560"
                     /codon_start=1
                     /product="putative Unc104-like kinesin"
                     /protein_id="XP_001686017.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654680"
                     /db_xref="GOA:Q4Q3T1"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3T1"
                     /translation="MSESSRGASQEADLSRAQSPTHSRDQSAEPNTGYEEGRITVSVR
                     VRPLNARETKLNSGSCIAPLAAYNTLYILPPGELEQNVNALLAVDPHLRGTRHHRFTF
                     DHVYPVDSTQEQVYEQIGRPVLQSSFRGYHTCIFAYGQTGSGKSYCMMGADGGCSIDD
                     APGIIPRLCREVFLEMDKVKQAAAANEENVDFSVYVSYLEIYRERVRSLLSEVHDARI
                     VAGGNEESGPASPRAISGSLRRHGLLHAADSADAALRVREHPTLGVYVEGLAEISVTN
                     EEQVLRLMVRGNQRRHMASTRMNETSSRSHAIFTLQLLQKRTHAVQPGEGGSGGAITG
                     APATAVATMTTQLGAKINLVDLAGSERAKATGADGDTLKEGAQINKSLTTLGIVINAL
                     AAQSIATVSSSTGQSPMKSAATSKRHIPYRDSTLTFLLKESLGGNSKTFMIATVSPSA
                     DSYEESLSTLRYADRAKSVMMKAFVNETAGDKRIRELEEEVMRLRQQIRSLLSAEARR
                     SSTPMATPAARPVMLADSDSSLQPSLVGGGDGNPVEGKWIDQDKSDSRETSMAHSSAA
                     GMEVAIVPDGEADVQAPHAGFNELAGRDAGVPEPVSPVADTPVASRAEFVATLQSELR
                     RAEEMIRQMSASEAERNAHVAQLVKRHEEEQAAMRAAAAAMAAAVATKDADNCAPRAV
                     TATMRLCRDEPYLLNMDGAGDWVVAHLGPGKALVGVFPPNVGAVNNTAAAASAAKGNE
                     GGEVGSSSTSFDSSLVLPSYYTGSDAGANGAAPDEGADVRHVRLSREFSEGVGGPHCI
                     LEHFKAAGTAATASFTTTLRACAGYETRVIRPMCPSPFVVKDGDTLLLQSGDVLDMGA
                     DHIHLKYMDPAEPPVTARGRRTVHMETTAYVGGDGQGSDGAESDRVMSSAAASPASAG
                     YKEEEALMSLKRFIGFSEAHPDEEGAGEEACETRGTSGDGDGCKGDGVERASSFDRES
                     SHSVFDDEYSTSPAAEYNEEDIGGRRNSCEAGISTTMATPQPPSRPLIPTLALAKALP
                     ANRLSTPPPQQMPQRHHSASGVPFNTMSGNAKDSASSAILSDWEDHSTVNLSVNEGIE
                     APSLPIPLQRRSTPAAATVVKTRVPSKRVPQTAHLNPNSALSLSELQSMCAKSPSKSY
                     RSEPPPRFVGLYNLVLVGPSGSGKSSLVRNLQTEDTPWLQSAFSTLMATGRAYTGADA
                     DGSTPASAEAHPTIGIQTTTLTTAGATPMRLRVYELGGTPCFSPLLDQLPSRRVTYLL
                     CFPLDGGPPLVALRGIVEDILCRTDSHMVSLVLVATHARHSSAADGKGGGGGGSLFSR
                     RLPAVRQEMLRAQMEEVELQVVSLIQMLQPYAQLRPTVVGRFAVDNVHRQVYSTGYRA
                     VEGFPEWLQWLGDLARDRCRGDVDFASGLVPARCMELSRQVGLLRERGKWCLSLRDFK
                     ALATAVSTQYNTAEAASASFVRDTLRQHVQLLTDWGVLAHRFRSTPLRQHVVLDVVWL
                     CRVLTTLACCALVGQVESGGLSTAGAARMVAAAGKRDTVLLNRKDLALRILFTPKAAR
                     IVDVVKVVTMDTARLLRYGVLSMPVLVTMLEPHFKPWDSEGAAAGSSGGLEAGMSAVR
                     RTDNLAVDGCDTAASSVRYSVSLAGVLEFLVLCDVIILGHKLLLSPSAEEAVRTSTAP
                     QQDLVGCSRSLPVSAASEQEGGRSHNDNDRILDDINPAEEGFVVYPLSCRTPASAGVT
                     WLFTCFLSGPFYMFKLDMVPRNFFPKLICRLATVSDKIYLGPVQSQSWGAPTQWRETD
                     ATRERGVVGGRTPAAHGPFDSYFSECAGRSFVLPRFPTDLTPTAAEVSPRRREGLWFD
                     AAWLVYKDSAHDDDGESDNCRVLVRLVHHSVFLSFHCHQAGSSSGMSGGSASPGVQDF
                     YEAVLEAVRHVVEEFPGGKCSESMQCCVDPVILLEMEVKHPAVQSDQETAALKRHVRF
                     ASINDNLNSLERVLAKSVSALWTARTARRSHTSRSEDGEDESAYVPLLHNFSATCPLD
                     VAECIQRWKTEQHFHISTELEARLVGALQELGACYHGSAPVAVNSCFALDRLLDVLAH
                     IDTE"
     gene            <1157508..>1159094
                     /locus_tag="LMJF_33_2570"
                     /db_xref="GeneID:5654681"
     mRNA            <1157508..>1159094
                     /locus_tag="LMJF_33_2570"
                     /product="putative aminopeptidase"
                     /transcript_id="XM_001685966.1"
                     /db_xref="GeneID:5654681"
     CDS             1157508..1159094
                     /locus_tag="LMJF_33_2570"
                     /EC_number="3.4.11.-"
                     /codon_start=1
                     /product="putative aminopeptidase"
                     /protein_id="XP_001686018.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654681"
                     /db_xref="GOA:Q4Q3T0"
                     /db_xref="InterPro:IPR000819"
                     /db_xref="InterPro:IPR011356"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3T0"
                     /translation="MGTYKRIRSQSAYEEANVSAFVDSCVEYASSVTFHAVEKSRALT
                     SKTGQVQTVLVLGTDAQLKEMAAAAAVCPHYDAAACAAAATAPESRAHVVKVTATIRL
                     LIGKVPSVASRHNCASRPDQVSEIVKQAMAECPAADAEAGLDIYYLGSDHEVSVAVAI
                     ARSCRRSFTAKRGHAEQSYLSVGRPVRVVMPSGKTAQLAVIAQCVQLCQRLVDAPTNL
                     LDTVTFTEIAVRWAAKLKAAGIDVSANVIAGEELRERGYGGLYGTGKAAEYPPHLVTL
                     SYKPKAGMLPKDRIALVGKGIVYDTGGLAIKPRDGMCTMKHDMGGAAAVFCGLLCLAM
                     MRAPIEVSSILCLADNAVGPRSQRNDDILRMKSGVTVEVNNTDAEGRLVLSDGVYHAC
                     KELSYTPSIIVDMATLTGAQGVATGQHHAAIYANSEASENRFVAAGKACGDLCFPVVY
                     CPEFHNAEFASAVADCRNSVKSRANAQVSCAGQFIGNNLSKDYEGEWVHVDLAAPATR
                     DEATGFGVALIAQTFAAELL"
     gene            <1160167..>1160466
                     /locus_tag="LMJF_33_2580"
                     /db_xref="GeneID:5654682"
     mRNA            <1160167..>1160466
                     /locus_tag="LMJF_33_2580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685967.1"
                     /db_xref="GeneID:5654682"
     CDS             1160167..1160466
                     /locus_tag="LMJF_33_2580"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686019.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654682"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3S9"
                     /translation="MRLPGWMRRCEIYAICMVWPIATVVGLVGTYRLFMWSYGGRECF
                     RYVAIQEPFKGEWYQANPKSALGMDTPLSHVPKYLETPGYTVDGATDDHPHHRNF"
     gene            <1161225..>1162991
                     /locus_tag="LMJF_33_2585"
                     /db_xref="GeneID:5654683"
     mRNA            <1161225..>1162991
                     /locus_tag="LMJF_33_2585"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685968.1"
                     /db_xref="GeneID:5654683"
     CDS             1161225..1162991
                     /locus_tag="LMJF_33_2585"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686020.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2585"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2585"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654683"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3S8"
                     /translation="MRCSASFLFSDTPPASAGSASDQRQHSLRPPPLATGHLDREGQT
                     GLDVRRMCPSVDRPSSRRISWRSRAPRPVTVRQLCRAILGMDHAGVCTAAVGKPCSRH
                     ATQEPQTRVLSSASTSSASALCEEDDKVRGDRHGLREVVTAARLGESTIQLDAAACHR
                     VVVCGRIVRCIDAFSNGSVAAAAGAVASSMSPTVVPYDLLWLSDATGVVCVLRLRPVL
                     VHGRTSPPSPCRLFGGWSSGSARDGRSDALGAAGVGLSGVFAAVDTGGTAPSPMSAAA
                     RASLSDCNPCSPVPEEWRCPSDLGIGEVTRKAISWGTDATAAMVDLGLEYEDDYALGV
                     NDYVVCVGSLAFADVDVQTRHALQPYASDLRQATWAAATSSRSPFSAFPGDAASFIGT
                     GDASGDAGCLACGADGRDAATEEEGAAASVRRRSVPVPPPRQAFVLLPGSEVPLTLDA
                     ARAQLGLVGSLPASAHYLTAAEAVQWGCTPFDHAASSSTPLPFSASELRDQGGGRKLA
                     TSAGCVTSTAPACAGADMNAVPLMGIKGYPRLVLDTNECLFWWLAAAETHVRLRARAS
                     APSASVCADRSPTSPFVHGYRS"
     gene            <1163929..>1167102
                     /locus_tag="LMJF_33_2590"
                     /db_xref="GeneID:5654684"
     mRNA            <1163929..>1167102
                     /locus_tag="LMJF_33_2590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685969.1"
                     /db_xref="GeneID:5654684"
     CDS             1163929..1167102
                     /locus_tag="LMJF_33_2590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686021.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654684"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3S7"
                     /translation="MRDREVVECLLGMEQWLRELNRPLASAGVGGSVDVGASSSLLSG
                     FPPCMEGDALRSAYRSALSELRLLVLGVLNTMPWWRVVETVAGNPPAAQTGGARTASA
                     GGGDNSSSEAGAARVAARHAGGWDRSAAALHVITRWHARLQIAFERVCLVLIDQSQQT
                     VRGVLEVLLKPCQLRPPVRDGARRSIPSDSFIRVLNAVATKYSPVYVVELLEGCIADF
                     MPRRRWAERRHHVACTAVLLYLALEGHTPAYHPQLGNSQSLQRAVGLLKSLRSRRADG
                     RGALSGSPWLLPPATGSYSLTLPGGTSEESGTDLGGLFSPMSAKQEFHHASLSSMLPT
                     TGVLPSGYVSATLLERARAGEVSLRQPTLPHPSLLGGSSSLMDTTTTASDTELSDGGA
                     RVGGRARSAVSDSLTGGPSGRCVRAAFSGGGGGSDSSAATAVAARGKGRSGGGLAGQL
                     SSEGGGSAGIVPGTAVSAGAPSDLDVTVQHNNKLLSYRNDILRVLLNRLLDVELTLEP
                     RDAEEQQGGWSLLGGMYGLGGGGPSSALSLTSRHASVRCSPFGSPATPGLGSPSALLS
                     APASLLPGGSGGGTASAFPSTPIAAADTDTSRPTATASSDRSSPASFSPTAFLLPRSD
                     SLGIIGGTGFADWSSAAASPGASLTSAQPLERFFNTLSHPYLRILRDCATLVYGRLAD
                     DLRRQQIAGSCGNADWWMDIVPFYLTVVTRVDRPVCLLYLAPSLSMLGTEDEPVGLLH
                     KLITLVTKGSMPVEQPRSSSSVSGAFARSSAMWPSSATASVFSASSLPLSAAPAQPVR
                     LRMALPTGVSRRVVTMEERLRAVRHIFPLFRFLHSRIDEASGEGVRRRLLKWTAQELR
                     RLGGPSASAVGSSGGPGGNVYTRSRPLPSRETRLALVTFAQCAAISELMGVDVVPQLS
                     SAGKAARDSSRFTSSTAYGDTSDGIAAALEPFLNRYTLQSEPPAEDGDNENSNCSAAS
                     SSASLSESSSSPFVLATSATRDAEQARLKASGKVVATAAAGAPPVTPCDTEQRRRRRR
                     IDLRQMEFEGLLQPQLMAYCPWQAWLR"
     gene            <1168093..>1170897
                     /locus_tag="LMJF_33_2600"
                     /db_xref="GeneID:5654685"
     mRNA            <1168093..>1170897
                     /locus_tag="LMJF_33_2600"
                     /product="putative enoyl-CoA hydratase/Enoyl-CoA
                     isomerase/3-hydroxyacyl-CoA dehydrogenase"
                     /transcript_id="XM_001685970.1"
                     /db_xref="GeneID:5654685"
     CDS             1168093..1170897
                     /locus_tag="LMJF_33_2600"
                     /EC_number="1.1.1.35"
                     /EC_number="4.2.1.17"
                     /codon_start=1
                     /product="putative enoyl-CoA hydratase/Enoyl-CoA
                     isomerase/3-hydroxyacyl-CoA dehydrogenase"
                     /protein_id="XP_001686022.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654685"
                     /db_xref="GOA:Q4Q3S6"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="InterPro:IPR006108"
                     /db_xref="InterPro:IPR006176"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3S6"
                     /translation="MKRIETVSKHLQDNEFVRVERRGVVGLICMLSSAPPRSHIGGCI
                     LCGPMRAQVLRALKTLEADADCRFIVLTSTSHRFFSSGIDIANFTECFISDPTAQPPV
                     PSLSELTAAVAMCPKVCVAVIQGLCSSWGLELALAADYRICEMNAHFRFPEVRFGITP
                     GGGGAQRLVCLVGVPHALNMLCYGRRVYAKEAHQIGLIDTPAYSAPHFWTALREFLEK
                     YVTVATPGTQDGHGEKATGLSAVEDARAAKAAALHRRRTCPAYAQHSLFNRGWYAWME
                     HKLRDSVPREVRAPYRAIEAVRLAVTHSCRLNGGRSVPSSNGAEQSDAAAAYTVAERA
                     LFESCLLLPETQAMQHLMRASQRTSMSWERKWISQQRPVPGLAVINDRSSAVHVAANS
                     PVSAASVSDLVTDDATAQLGLKKVAVIGAGTMGTSIALMLLRQSEIEVVLVEADTQRQ
                     EVARRSIEDYLRSRVEAHRLSQRRCNDMLHRLRVMGSRIAPFPPVLADADLVFECAPE
                     VAAIKQNILAFLDSVCKRSTILATGSSAQDVNELAAVTQRPGQVLGIHFFPPANESPL
                     VEVIRGAATERWVVELVMRLLCQLDKYPILSVSRHGYVGTRLLLTALYQAYAMLEDGC
                     FPLQIDNVLRKNFHFTRGLFELEDIMGLDVMAMARASMMAVAARASGSSVPPPKRVGI
                     EPSVPSAFELSNAWCLPSRPVFDIPNALVAAGALGRKTREGWYKYLTPQEASLEYRLR
                     HPIASWLWTGSAPNRLGTGSGDKGGSAAGTTTTAGCAAMLSDAATTPSVAASSAASRQ
                     RYPLVSLASLIRQHNYSTEYRTIDCSKRRRVTRRPFCEEEIFERIVFVMINEAAKIMA
                     DGIVTSSADIDCTSVYGFGFPAWKGGLCYYADHVAGIDKVVRKMQVYQRALGSEEFPA
                     PCLALREMQAKATTFASMFK"
     gene            <1172034..>1173485
                     /locus_tag="LMJF_33_2610"
                     /db_xref="GeneID:5654686"
     mRNA            <1172034..>1173485
                     /locus_tag="LMJF_33_2610"
                     /product="metallo-peptidase, Clan ME, Family M16"
                     /transcript_id="XM_001685971.1"
                     /db_xref="GeneID:5654686"
     CDS             1172034..1173485
                     /locus_tag="LMJF_33_2610"
                     /codon_start=1
                     /product="metallo-peptidase, Clan ME, Family M16"
                     /protein_id="XP_001686023.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654686"
                     /db_xref="GOA:Q4Q3S5"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3S5"
                     /translation="MLAASRLARGVAETVTRENFTISRLTNGLRVITCEDGNGITGMG
                     LFSLNGPKFEEEGSFGAAAVMESLPLRSNTRMTTETISQSLGVFGNAYKVTNNREAMS
                     VMLMMPRYHRKEGLDVLNGMWLHPTDNDEEFAVAKAQTLHRSSLMSRDATSMLFELVH
                     KAGWSGRGLGNPLSPTEQQLEQLTLERFHAFHRRYTTPERTVLAATGVADHKTFVQEA
                     EVRLQFPQATAPSLHSSSAETANKAAAATAQLHPYTGGCEYVQNTMAPESMNKFQEKN
                     LSHIALFFQAIPMAHPDYFTFSVIQTLLGGGTSFSSGGPGKGMQTKLFREVLNREPNV
                     HGMECITAWYSDGGLIGLYGSAPHEHVNNLLKIIIFQAASISQRVTPVHVEMAKNQLS
                     SQLILLGEGREQLLNDMGFNLLVHNYTITPQETIQGSAQVTMARLHEVCAQLIEHPIT
                     FAVYGETKGMPEYRELVQALKKSYASLSKSTPA"
     gene            <1174416..>1175894
                     /locus_tag="LMJF_33_2620"
                     /db_xref="GeneID:5654687"
     mRNA            <1174416..>1175894
                     /locus_tag="LMJF_33_2620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685972.1"
                     /db_xref="GeneID:5654687"
     CDS             1174416..1175894
                     /locus_tag="LMJF_33_2620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686024.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654687"
                     /db_xref="GOA:Q4Q3S4"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR019009"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3S4"
                     /translation="MSALHEVLVNETIIEAVRVVLDKYTAEGHQLSASSGDAGLSVEE
                     ENLIRSGVLAGLQDLCAAAQQSLTRMASLENAKGVDGVAHLRPATALTPTTPQAWNSA
                     LARLGRNATAMQDVVQQAVSSISAYLRTGGGRKENGVEHMAATAVYAATPEVTRALEA
                     AAAAQHALAGDDTLPADAALPMTAGSIAVRLSTFSAAEWVWLSATLVLGYLVVFLVFG
                     RILGFGAVLKRRRPRTTTVLIGLPGSGKTALFVQLVHHQQLFDSRTSMRENSGYMCAA
                     AQHGRSNSTAGVKVVDCPGHPRLHQGMLRALNEAVNVVVVIDSVTVQDNQQEGVAALA
                     ELLFNVLQSPEFYGVRRLLFACTKRDEVISYASKAVRKLLEAAMVASIESRQNAMGRV
                     EIVRDGHNAVITGEGKSGRGRSVGGRRYMLSLDGADSDDGGGQAPPRRGSLRGAAGAS
                     AKSFSFDQLGIPLAFVDVSSRPNAADHKYSITVVEELLLGNG"
     gene            <1177923..>1181042
                     /locus_tag="LMJF_33_2630"
                     /db_xref="GeneID:5654688"
     mRNA            <1177923..>1181042
                     /locus_tag="LMJF_33_2630"
                     /product="putative dynein intermediate chain"
                     /transcript_id="XM_001685973.1"
                     /db_xref="GeneID:5654688"
     CDS             1177923..1181042
                     /locus_tag="LMJF_33_2630"
                     /codon_start=1
                     /product="putative dynein intermediate chain"
                     /protein_id="XP_001686025.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654688"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3S3"
                     /translation="MHKSSSSRTSVQHNKPVKVTSSTSREEVRKRPQDMRAEVEGVIH
                     VLDGGINRTPLPLQQRQSLLGGVPHELQLLSSGGTAGSRPETTQEAGSTVNLMCGELG
                     SSFMHSSFMFTSRRSSMKPDSMTVSTQIQSKGSSEAGDHGSGVGRRTIGGDIRSLDSS
                     LQSLSFACDHRISDRLFSGYDSPSMRRRSIAFAGNAADAPLPRLAQRNTLLEEATYVP
                     PAPLTATEKAAWRKATTTVILTETPTIFLYAHQDEAVSNEHADKVTAVVARNSEYAAV
                     EETYRTDEGTQFHSTGAITMRAPMKSVQTEVHPPARKDSGALQVTPWMLKDAYVAALE
                     AAEDAEEDTQEERQQQAGDAATDAVGGGAGANVEDALHDGDNIDGDGSLDDDNQSSDN
                     GQSTLMSSETVTHTMSSDGGMASSAKVPSGASATTAGVPAGRQWMLAETLLSTLRIME
                     RAVVQNNMEAVQLAYRGIAVETCGQGTGTDAANGAAIPASAVNASTPAAAMRALTAVP
                     GPLPAAISVHPTPLPDVPADGPAATSRAGGDAAATVDGKSAGRVVGTESTQPDAAAKL
                     TPSAAAASIDAPPVRLSEGIRLLWRFGSPQLTHGRGVACMTWNRRESDMLAVGYTARR
                     RLLPQGDAGNRASDSPWDMAYKRAQGQEAHGMVCCWSLKNPLAPELVLYLRGEADVTA
                     LAFSFEHPSLLAVGSSTGEIVVYDIQHDVLLPSIAAAIVGATGGQHTGSIWELQWVPK
                     GKEHGEFLTSISADGRVVQWAVGKSIERVPPDLMHLQRQPGMQVEKAFVAGVAEAEAA
                     AAVSAESAVGGKGGKKAPHRKPTQKSGARTATTRSAGDGGAAEETILSRQCGGMCFDI
                     CPSDTAVYIVGTEDGSVLQCSKSQTENYDFEYESHAELVYRVRWSPYSAAYFLTCSAD
                     WTSRLYKVGTRKAQLRFHSVRQDAVQDVAWSHTNALTFATVTAQGNAEVWTVMDAMHP
                     HANVEYRDHRRLSAVVFAEQETPVLVVGDEEGDVTVFRLDGSLYRRGDVTDDEQEAWL
                     KEAVRKQLT"
     gene            <1182826..>1183986
                     /locus_tag="LMJF_33_2640"
                     /db_xref="GeneID:5654689"
     mRNA            <1182826..>1183986
                     /locus_tag="LMJF_33_2640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685974.1"
                     /db_xref="GeneID:5654689"
     CDS             1182826..1183986
                     /locus_tag="LMJF_33_2640"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686026.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654689"
                     /db_xref="GOA:Q4Q3S2"
                     /db_xref="InterPro:IPR001781"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3S2"
                     /translation="MKDSNSVLQQVDVPVVATGHSQKDGANAPSAATRDKVNARAVKC
                     EVGSSGVDGAAMTLAVPSTSLVFSQGSNKTDHCMPHLTAPVHLRDEVQYSSAIAVGSE
                     CTAAPHQPRLSSSPRYSHSGRQVISDACKRSEPFLRGADGNYSTVYAASGLTVNAQYQ
                     TIPEEHAEYRQRNKVNLNYRGPLYVVEDVYVPCNACGGPVDPVRRVPVGSLFFHEGCL
                     HCYLCGRRTGVAGLYLQVDRQAVCSECAGRGYEHWVPRQEVESRGMVYGATRGDVYAA
                     IDAHDRGAATHRQRRIGSLPITADGGSSTLNKAVVPGALPPSLSIANVHNRQNTSARS
                     FALMRRQQYYTQSDNNVIMALPASAARSPSTAGRRKGSTAPLQYRLTNARHE"
     gene            <1185801..>1188164
                     /locus_tag="LMJF_33_2650"
                     /db_xref="GeneID:5654690"
     mRNA            <1185801..>1188164
                     /locus_tag="LMJF_33_2650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685975.1"
                     /db_xref="GeneID:5654690"
     CDS             1185801..1188164
                     /locus_tag="LMJF_33_2650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686027.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654690"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3S1"
                     /translation="MSAFNAPPPPDATNSIRGSVKQIKFDRQLRLWGADGQAALEAAH
                     VVALGVTVAISEALKSLVLAGVRTVTLVDERVVSDEDVATNYFVATTAIGSPLAVTVL
                     QHICGLGEQCKAVPVQECPREWVAKYRATVDADWAAGYVDSGRRWPASAVREAPPEAT
                     GTTSAVLRFLTGYAPLATLDNTSSSSHVSPCDSANPSPTAEAPLSSPSLILVSERYGD
                     FSSVSLLLQTCAARVHPDVPVLLVRSSGLLGMVQTYCCDRVIMRPQNPTQVQMEDLRI
                     FEPFPALQAWFDAHDPDDVVQFPTDNADAMTLHSHLPYPCVIHHAFRRWWATLPEEEK
                     RSRQRSSSSLIFPLSAKDYRAIASVVGGMIRRQSAPEEAFVEAMEKCTAKLNRPVAQR
                     LPEALEELLRDARCADPMRAVKAVQSRLSPAALMSSSAAVREMAALHVWASPDVLVWF
                     ILRAVQLFVTRKVGGELEALNGASTKPPAEEAECVAANAAPLPLGAVCAAYHMPHSGY
                     LPDLMTTTIWYRELQELYQAKHAEDVACIAAKAMELFEAALQQEEKKDCKRKDEEEQR
                     QFRGPSRASLVAVKVKPLLLQHTAIVVENIWEIRGVSFSSAYRAAAEAEWRQRLGQRL
                     AWLTRHISFDVERNADARRAACFAVAYLCKEELQRHGARAEERDLSGSAIAQEAAVLM
                     SQASQEKNAIGGDGDNDPALELFDASLAPWWSEEDSQKLFAQACEEVARWARGKGGDG
                     ACVQLPSVAASTGALAAQEAVKLLMRIRVPCTNPMLYDGYTNKVFML"
     gene            <1188729..>1192229
                     /locus_tag="LMJF_33_2660"
                     /db_xref="GeneID:5654691"
     mRNA            <1188729..>1192229
                     /locus_tag="LMJF_33_2660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685976.1"
                     /db_xref="GeneID:5654691"
     CDS             1188729..1192229
                     /locus_tag="LMJF_33_2660"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686028.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654691"
                     /db_xref="GOA:Q4Q3S0"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3S0"
                     /translation="MTSRIPLPLRLVQSDLWSATASGRSSAGSRVLTAYKPSGLPCYA
                     TSQVSAVASSGGDGRRLCAIHTRHTSSASSSAIAVEAGPQPHPEDPSDSLLTRVVDAA
                     LPGCVPYVALPVVSSLLRRGGHDTVAAAQLNQWTSRHKGLVVVTGTPSDAVFLRNAAQ
                     LDLVQQTYRVVCRLPPGVGAAARRYLRAHHSCQQPRQGSDGASTAKGMLNPYVQAHME
                     RRRQRQQLADLTIGIPLSAEFPPATAKATATAVSTLASDARLPASVRPHPLVDGGFFD
                     VARGQLRVQGTVRCYIRARAPLTASSAARVHQRSRLHSLFSAPEAVTPGHGSGAFRPD
                     EDLNESQHPWMRPGWRLGVSLDIPHMQCDVAAAGGDNVDRPRRTSVPAPRGKSLSMEF
                     CLLSLSPRDDSDVALYEVHTHGDTTADEVAAVFHAEGLRVVNDYVQDVPLAVAVEEVA
                     ACMRAAPPGLLHELPLGLQHRLRSATAEELVALPLMRMPLEDADLLAAQHTLAHLSSL
                     SPSLPFADDVERLRQVVMTAASSASGSPRHPLQRLLLNALSSLKLTNEAERRVYEQVL
                     ALTLGSGVECAGVVFPDPSDAGNVHVLQQLWLTYEQQRQRQPSLADAARAARQHPLAS
                     SLRYTTRSVLDDPAGLARVPLLQDVAMGFASDGAAESLSARDCNGSVPGGRGECSFTQ
                     AAELLSALSHSQNVEAGHRLSGDEACETAASALTRLNDAAPRWMQTEVPLPYVAAFQE
                     WCAACLAPSCCTDTAAPDAGVAALLPWPESLLRRCNGPGTSKGCGSDRVAESHRSSDD
                     GGHPAVPPRETLLEHVRLPVRVFLRVEELGELRCAYCGGVGHTWQHCVARVAEAVAVM
                     EDGGLVAKSLPLPESTASTAVGLPVSQPAPAPLATSLMDSEGITSTDDAAAALAEQAN
                     ALTRHRQYQQQHVGRIGYDGDASASPSASSAPFAVVAPLIAVPNVAATHRFKAGHALR
                     SESRKPAVHRRVMRCVYCGGRHHVTACPALRAQDSESEARRADAAAVASPDSTSSTSS
                     PHHSGPPLFCIKCGQTGHLYTRCREVPVGLHHATHCPICLQLRTSGSHDPAHCPRGVP
                     VPDGYRLNGIPVAEEGSTQRKASNWQSSSQPQAHSEDGYRPATADRQSWRGSTHVGGV
                     PRRGRRRASVLIADSFVDSK"
     gene            <1193036..>1196734
                     /locus_tag="LMJF_33_2670"
                     /db_xref="GeneID:5654692"
     mRNA            <1193036..>1196734
                     /locus_tag="LMJF_33_2670"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685977.1"
                     /db_xref="GeneID:5654692"
     CDS             1193036..1196734
                     /locus_tag="LMJF_33_2670"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686029.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654692"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3R9"
                     /translation="MLREWTSKIKSFAEGIASPDYDDEGHSGSGECEDDEVDGRVEHS
                     HYRPHDERGHARHRGSVGVTRATAHGQHNSGAVYGDAGSAAVLEDPTRRLALQYNDLT
                     GDRHAGACASVDAAAYARASSVSAVAAPSFLSLSPSPPSTAASEKNLPGNVGPLMASP
                     QAVAATQCNGAEQTPAESPGDDTVAAHSFSSSPGGAQTASASAAERRGPPQARMTSSP
                     QPDTSQPLPAQLSAPLSSPSAAPISCISPAKSAGAVLPAPVATAAPPTPPTQQPHLPE
                     QAHMLGQRVALLEAEKAHLRSDICKYQDEVRARHEQAVQYYEVKLREAAGTAADTASA
                     REANAQQQPDALRAALQVAADQLEGEKALKTALEGRVGELQQEADELRASLAAAQKEV
                     ATTTATATAASAPSGTPDATSVPAEEDWCRDHSEELNSLKNAVDVKTTQLAAQAAQLQ
                     SSEALRRSLEAKLQAAQREAMADVTDDHGKRADAARDEQHSHAQLQNEVNRLKCELEA
                     ERRRSATTQALFEDAQRKNEDLAAQLAHEQAISKSVAATLEQTRKSASASAATAAATA
                     AASAAHGEERQRLAEKLDHVEAERGVLQQEVRQLTEAAGQLQRTLDTREHEYAVAQAE
                     WAEAQKALLEKRSAFEAQMAKDRDAYQEELRRLQAQLEGEQKRGKALEADKQAAERAC
                     TAAEAHAVSAEQRCGVMQEELAALQQQLKRLKEAEQNRQQQERQRMTESEAKESGVSM
                     SAAVLTQVKKELEGKVQALEVMMEQLQRMTVDTLVRLGVDVERVVEGSRRHGGGAERE
                     PSGGDDGEEDDKEGERGWAAAGTEVPLLQLFSLLMTESLQQHSIVLRAERVQQEWEQT
                     YEQARRVNDSLNQQMADAWGVIGKLREELSLKDEAARQMKSHVDSGDARLVEVQEQLT
                     GVMHELQTLREERAGWAVRLQQAETDAESQANTVSSLQEELNTLQDMLQAKEEELQTS
                     LQGNENLQLVLDRIQENKRHEVEALTLESQLEAEELKKQLAEARRIREQHESEVACVR
                     EGFERQIASKDAEVTTMHRKLAEMRKALEKTTRRHMDGSETSIDKRVVSQLLAKYMHA
                     FVAQRKEAEDMLKVLSGLLDWDEATQEYVGLLPGPNNPQPPDGSAAQRGGARRGLFKW
                     LRSGGEEANKAGLASKWVEFLLKESEGSGGDGRANRSDVGATASVPASSTSTPLPGSQ
                     PVPSLSFPSPSPAAETATPETAASRQST"
     gene            <1198749..>1201256
                     /locus_tag="LMJF_33_2680"
                     /db_xref="GeneID:5654693"
     mRNA            <1198749..>1201256
                     /locus_tag="LMJF_33_2680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685978.1"
                     /db_xref="GeneID:5654693"
     CDS             1198749..1201256
                     /locus_tag="LMJF_33_2680"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686030.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654693"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3R8"
                     /translation="MSTYEWVIEQESPDGVTTRVVFDFADGNTDSHGNGGRANISSSS
                     YLLQHRRDRRGRGLSGGTPSAAGFFAFKEVACSEEGSSRRSSKHSNGSRSRRRRQHHR
                     GTFGKGGRESGISTMAGPAGSAYTSMSLRQRYQRMLFGGGRGGRASTVAGVSRTPTVT
                     PDASASVLASGLALSYRNDPSAGLNSDTHSLSSSLFRGTTAGGQPPSTLFMSAYGAEM
                     VEEDASQGCSGCLSRRNRCSTRRGNSSHDGGVSSVARASAACDRNAAAPQHAAGGMRT
                     AGDTPQHFSVLTAAATTAAATPPSSGHHRRVVAREESDDDDIMSDTGKVNGDGSYSVL
                     RDVWATRATCPRTIATARAADFPAFPPLHSISVEKEEEPTDTVTECCGHPAGGIDARD
                     VLSGIADAKATRRVPVSLAASEENIRLQAKVDAAEDHRRYNKMLLKKERQRRRDQGWQ
                     STGSSGNCTVSFCRTHGSYAGESSRGLRDGASAGTSRRGCRERAVCERGRLDAYQPRS
                     SSSTDSDEDDADDESCDTSSLSSLECLSTSSRDDFDVRELRADSVFAATVQSLASRAE
                     RERKKMEAREEQMLWSEAAQNKATSMTQRSPLHSPATLRGLMSSADGAATTTPALPPS
                     LATVPRRAEAASTGLLIRNGVGSGNAGRSGAVSSFFISPIHQSVAAESAAWTAGTGFE
                     FLGQGGLGGNDTASSSLLPTSRPAPWQRRGSAFTPARATMSRRRERSEDNEEGYAEEL
                     KESCDAGASSSTTHAMAADAQTSTHRARKKRKRGDRARQSVVGECGGSRALRPVAAPS
                     NGPPLEILPCSKMDMREDLLESFLMEAVLDEDDFALY"
     gene            <1202051..>1202854
                     /locus_tag="LMJF_33_2690"
                     /db_xref="GeneID:5654694"
     mRNA            <1202051..>1202854
                     /locus_tag="LMJF_33_2690"
                     /product="DNAJ family-like protein"
                     /transcript_id="XM_001685979.1"
                     /db_xref="GeneID:5654694"
     CDS             1202051..1202854
                     /locus_tag="LMJF_33_2690"
                     /codon_start=1
                     /product="DNAJ family-like protein"
                     /protein_id="XP_001686031.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654694"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3R7"
                     /translation="MSSANATSSTEPGNGDKLQQPQRQPLNVGAGQSPHITKENIESF
                     NYFQLFGLATPTASSAAAACGGSGGGSDAAIPDIDVAAVRRVYRRLSLRFHPDKDDSD
                     EARHAFEVVHTALETIIDPTKLAAYIRTLVEEGGGADGSGFPGEEVRQRQRAHQAHVE
                     AQWAADMLVQRAQERLAKEAAARQAAQEREEAAQRLLSELTSSLNTPFQLMEAELVRD
                     WDVDEEMVAVKTKEVMKVLRHLESADGAWASHLMHEGASRKRYREDTSR"
     gene            <1203698..>1206343
                     /locus_tag="LMJF_33_2700"
                     /db_xref="GeneID:5654695"
     mRNA            <1203698..>1206343
                     /locus_tag="LMJF_33_2700"
                     /product="putative minichromosome maintenance (MCM)
                     complex subunit"
                     /transcript_id="XM_001685980.1"
                     /db_xref="GeneID:5654695"
     CDS             1203698..1206343
                     /locus_tag="LMJF_33_2700"
                     /codon_start=1
                     /product="putative minichromosome maintenance (MCM)
                     complex subunit"
                     /protein_id="XP_001686032.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654695"
                     /db_xref="GOA:Q4Q3R6"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3R6"
                     /translation="MLTNRTLTEEQTIIRRHFTDFFESERYEEKYHARIQAMIVAGKA
                     RLLLDIGDFLDYVPISVGGDGGDGVGTGGAGSELGPSLGASIIRQPGKYIPLLELALH
                     DVVLRQQPEYLKVDYRSRVVHAGFEGPVGRVLSPRELYARHLNTMVALEGIVTRQSTN
                     RPRVLETVHYCVETNKFTKKEFRDQLTPMIDSSHLPTVNVMPKTDIEGHALRTELGLC
                     IFMDSQCAVLQEAPERAPTGQLPRNVEVRFDDDLVDAVKPGDRVLLVGVYMPYTTSDS
                     KSFQSIVLVNHVVLTQAFTFLSRPIASVEDRLTRFAQKCVEQLGPGGVLETLSKAVAP
                     TIYGMTAAKQAILLLMVGGVERKSHNSHVRGDINVLLVGEPSTAKSQLLRFVLGIAPL
                     ALSTTGKGSSGVGLTAAVATDSYTGERSLSAGAMVLADRGILCIDEFDKMGSQDRVAM
                     HEAMEQQTVTIAKAGIHASLNARCSVLAAANPIYGFYSVQHRLAFNVGLPESLLSRFD
                     LTFIILDQHSSDYNRRIGYHILRNHMTAEAVRYDDVESRTVVDSVEAGSGRESSGAEL
                     DGRDGRRGGRAVDGEDGGSGESRLDLRMTTNSTGESIVSIDFLRAFLQMAKRGSPLLT
                     DVSRDLVCQHYVQLRAEQQDGGRDGFFITPRTLDAIVRLSTAHAKLRLSPTVEESDVT
                     AAMALLRASVNAATTATQQRKDDNQHSLSEAAAGVAGAALVPGQKRPNAAMEVVGAQN
                     GASKAGAHLSSSTEEYAVDSASGRSSRQRLCTEGAFVGDSGRGSGEAAAAVSDAAPAV
                     TAGIFSGAAAAAVDINLSRRVIEALKQLQREQRDGVSLDELHERLGGQTISAESLKLS
                     VMQLQGDAFIFESTEDGGSNTIQFI"
     gene            <1207695..>1208192
                     /locus_tag="LMJF_33_2710"
                     /db_xref="GeneID:5654696"
     mRNA            <1207695..>1208192
                     /locus_tag="LMJF_33_2710"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685981.1"
                     /db_xref="GeneID:5654696"
     CDS             1207695..1208192
                     /locus_tag="LMJF_33_2710"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686033.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654696"
                     /db_xref="InterPro:IPR008011"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3R5"
                     /translation="MLRGGLQTSPRLMARGIAGPQVLGAEVPSFRSFPYRAQDTLYLY
                     RHFLQLIYHHYGPEERKDLLFRLRNEFSSKRHLRGPRAVSAALKRGEGMLALQRQLLQ
                     SREVRRGTSRDGGAQSVDALWDQFQMVSGNVLPGLRNYENSLSVSSGSYVTQASTNNV
                     YSRRR"
     gene            <1209263..>1210642
                     /locus_tag="LMJF_33_2720"
                     /db_xref="GeneID:5654697"
     mRNA            <1209263..>1210642
                     /locus_tag="LMJF_33_2720"
                     /product="putative beta-ketoacyl synthase family protein"
                     /transcript_id="XM_001685982.1"
                     /db_xref="GeneID:5654697"
     CDS             1209263..1210642
                     /locus_tag="LMJF_33_2720"
                     /EC_number="2.3.1.41"
                     /codon_start=1
                     /product="putative beta-ketoacyl synthase family protein"
                     /protein_id="XP_001686034.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654697"
                     /db_xref="GOA:Q4Q3R4"
                     /db_xref="InterPro:IPR014030"
                     /db_xref="InterPro:IPR014031"
                     /db_xref="InterPro:IPR016038"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3R4"
                     /translation="MVTPLGVTAVDTWAGVCRGQSGTRPLIEAPHFLPGFVENDKMLS
                     PQQKAAALEKLVAALPCKVAAFVQPPAKAVLAAGKVDKAVPAADPFAPTAHEPRALRL
                     CARAVEEALADAALQLSEAVQDRCGVNIGMGIPSLADVTDVSVYLTGDAIATKAGQVY
                     YSKVPPMFLPKILGNMAAGNTAIRHKLRGPIGSSVAACATGAHCIGEAASWIREGRAD
                     VMVCGAAEACITPVSVAGFTRMRALCTRYNETPSSASRPLDITRAGFVMGEGAGVLIL
                     EALEHAVARAAPRVYAELRGFGISCDAHHVAVPHPDGLGARRCVEQALADGGDVPATA
                     VGYVNAHATGTIGDEVELMAIQRALRPSTAPSSTALHVSSAKGGLGHLLGAAGSVEAA
                     LTVLALHEQRAPPTANLTTSCLTKEQQDCGLVCIQGSAAQPLQSCEAAISTSFGFGGI
                     NTALLFTRL"
     gene            <1230030..>1230173
                     /locus_tag="LMJF_33_2725"
                     /db_xref="GeneID:5654698"
     mRNA            <1230030..>1230173
                     /locus_tag="LMJF_33_2725"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685983.1"
                     /db_xref="GeneID:5654698"
     CDS             1230030..1230173
                     /locus_tag="LMJF_33_2725"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686035.1"
                     /db_xref="GeneID:5654698"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3R3"
                     /translation="MKRCVGRSAHPKDNEKQPNNRSSTFKTERKTISGLALEGKQDRY
                     GEC"
     gene            <1230946..>1232454
                     /locus_tag="LMJF_33_2730"
                     /db_xref="GeneID:5654699"
     mRNA            <1230946..>1232454
                     /locus_tag="LMJF_33_2730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685984.1"
                     /db_xref="GeneID:5654699"
     CDS             1230946..1232454
                     /locus_tag="LMJF_33_2730"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686036.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654699"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3R2"
                     /translation="MSAAAGTAIHQHHDSHRRAPRMRPHRASLSNGTTALAHSCRWQS
                     SAAPHQDFSHITHDLVWGLWNEGNLFSLSTAELTYYLQQQQQRAGGSSTFVIDPQAKK
                     STLVRQVEEVLSAEQASITVPQDAGATVTMTGSDRVEETLDEADEYGDWGAEPGFEER
                     RHIDYMEFNPLRMGERYEPLVPRAYQLLHSDLSADVGLTALDPSKFPGQSKNKIAYLV
                     SKVNVDKANEQHFRRGLEWCLANLWNTNMNGELNIGAGRVIFYRTIAKQNRNTLPLWT
                     LQRHLYAYHPYVWFAIASASNAEAMEKLAERLGMKLVQDATTSYKISIRRSSELLDGE
                     LNAQLQCTKMNRPWDRFLITHYVRSQMPDLRFLVRARHPIKKRVTDAYLEADILRSTR
                     DSVQSVLSPELGEVCYCCERVIRKWAMRTQTGVTLQLVETRRTPLIITKAGDEGERLE
                     YEWIVVLPQKAERIDIAALSAELWDYGNVLARELEPGMEEFLSHTMTAAASY"
     gene            <1234499..>1236949
                     /locus_tag="LMJF_33_2740"
                     /db_xref="GeneID:5654700"
     mRNA            <1234499..>1236949
                     /locus_tag="LMJF_33_2740"
                     /product="putative translation initiation factor IF-2"
                     /transcript_id="XM_001685985.1"
                     /db_xref="GeneID:5654700"
     CDS             1234499..1236949
                     /locus_tag="LMJF_33_2740"
                     /codon_start=1
                     /product="putative translation initiation factor IF-2"
                     /protein_id="XP_001686037.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654700"
                     /db_xref="GOA:Q4Q3R1"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR023115"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3R1"
                     /translation="MPPKAPKGAPKAAAKKGPPNAMLAKLKMKMELQKVEEERLRLEA
                     EEEERRIREEERLAEEQRKFEEAERQKERERQKEEERLARKERKAAGKNDALDRMRAA
                     GMILPDIDRIRHDEEVRKVEENAAPKPKPKPKPKPVVAAAPPPEEEEEEGEPTELTES
                     EEEIDEDDWEAVMERDERRATRHTNNERIRAERAERKETRKAEKQRMEAEIRSKNHVL
                     EKVSNLRSPICCVLGHVDTGKTSLLDRIRSTNVQGGEAGGITQQIGATFFPRESLVSA
                     TAELIKKHKCNLNVPGLLVIDTPGHESFTNLRSRGSSLCDIAILVVDIMHGLEQQTRE
                     SIRLLREKRCPFIVALNKVDRLFDWQPHENMDIQQSLELQKAHVRSEFHTRWCQVKNE
                     LSAEGLNSELYYNNKEVRNVVSVVPTSARTGEGVCDLLLLEIQLVQQFMEGKVTYKDD
                     LQCTVLEVKPITGYGFTVDVILINGELHEGDEVCLCGQNGPIFTQIRSLLTPQPLREM
                     RVRGEYIHHKSIKAAMGVKISGNDLEYVIPGTQLLVVHANDNKEKIAELVMKDATNIN
                     EFLDPDGLGVSVQSSTLGALEALLSFLKGMKIPVASIAIGPIYKRHMHQVLSMKRREP
                     RYAVILAFDVPVSEEAREIAKKNDIDIFEANIIYHLFDKFTRYINEYEQREKDRLRSV
                     AVFPVQLKMIAESIHSTDPIIIPVTVERGQLRPGTPLSAIRKKDDSVVVIGRVMSMER
                     GNRPVEIGTPGMDLAVKINSGESGVTVGRQFDNSDIIVSHITRQSVDAVKKFKDELKP
                     DDVLLLASLIKVLKVPNK"
     gene            <1239257..>1242694
                     /locus_tag="LMJF_33_2750"
                     /db_xref="GeneID:5654701"
     mRNA            <1239257..>1242694
                     /locus_tag="LMJF_33_2750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685986.1"
                     /db_xref="GeneID:5654701"
     CDS             1239257..1242694
                     /locus_tag="LMJF_33_2750"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686038.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654701"
                     /db_xref="InterPro:IPR027865"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3R0"
                     /translation="MLTPSPLADSVVRAAAWDDGGAEFIFSDGTIMSFVDNMNTFVAV
                     RSKPSAREARRAATHAARQRQQEERRQRLSKATAAAAVQYVDSINDPQDDDDDNRELC
                     FTAWTLSRDVGKVRAALHIFNSLSEQPRLLTPLLPSEVPAPFLSPSLLTASASSVTPA
                     YLMVGSCGVWQEPGPPIDTLLLERRADLFRRHVVLGTVREWRPVSAAVSQRQPGVPSA
                     AGCSLPRSASCLIDGTAAAPTTLERATQLRVAERSPARTEYGEDSSVAPPKEVPVGTV
                     LELWCALRRVCMTVAVHRETFTVRWPAPVTRSDGSRLPPSFHARDTAAWHLLPVSPSW
                     SARISTAGSASAPLLFTYMEQTFPVRDPPDAWRTMLQLALQLDAELPGAEKEGNAPSA
                     ASASPSHTTVGALGTDHDGNAGRSASWHGCLPEPHRWSGALNQHCNTNPCRFSRLTAS
                     QAAHLAAPRTTRAVDAMRELHPRGTRLCWMYEANHCGASRESPSAVYWCLRGSAVTTP
                     ITGNLSGTAVTTGTSMAAPLRGTEVVAWVAEDGSVVRTTLEGQGYTVRHHRLHLSSSC
                     VTAPAPAVYRLQAHDTAAAMAAVDKRLPSTITPLRCHVHVSPQSPSTPLHNGGEVLQS
                     CCALSPSAMRHLCGEPNSRSSPRGNAQKKAAAAAAASAVAAASPEAFAVAVIDPQSLY
                     CLLASSTDGLQRGCTAATITPACVCSAVAALNTTLVSSEQRFPGYMDSHCNAAAGALS
                     FASMGRGVTCGRVGPLQANDAVRRLRFGRYIASVVDVAIQLSQVNCAAQRAADADRLS
                     TDPPRLAAYCGAGPAATSPSCLSPSAHGLSCRKGARSAAATTTSRSASAASVVYLTSR
                     LDGIGTFTALTNGTIRVHFDDRTLLTLIPGVNEVDEEELLATCVLRNATRCTMRAAQC
                     HPGHAMHRYLAYALPFRRYVYWRAVNPHELAVMDGGCTGVSSSERHATALQAQPQQRQ
                     RQSPSAAVMNRVLHTTARDDPSASLTSVSAMEAGASLMEPPLVDESVCLLPSLRSCSL
                     ATSFSVPGDDDDDRVATVLSKAVRAPDVKSEPPRYPLPSDPTCSPRVCLSTSNAVTSQ
                     GNLNGTGPAWGLVDTQRTVQTYYDAEVAEAAAQQVRLQELLDQNEALSKSTRALLRT"
     gene            <1244429..>1246495
                     /locus_tag="LMJF_33_2760"
                     /db_xref="GeneID:5654702"
     mRNA            <1244429..>1246495
                     /locus_tag="LMJF_33_2760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685987.1"
                     /db_xref="GeneID:5654702"
     CDS             1244429..1246495
                     /locus_tag="LMJF_33_2760"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686039.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654702"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3Q9"
                     /translation="MDSGTSSTSQPLPPPRMSPSYAVHRVLPRMVHPQFTNNSHILLP
                     QHGTSKSGSPAHAYRPCDCSLSAHTSQPRSPPLPPLSNTVGVAAPPCEPSIAAATMVV
                     HPMRAKGSGNEVTSPRLSQKPRRPLPHQTASLSPRDFVASPSGAQLPTELTEAESPKQ
                     PPEALSAKPDAVFDCAAVAVVPSTSSSFSSQLEEGSGQLFGAAMQQRKPHTLLTSALA
                     LANLHDGDDRRNVSGAFAPCLMPVFSPSHQHPRHQHHRRPSAVAFPKAATLVMSGEYG
                     TRDFQRGAWVFLLARQERLARELLEAEETSEALRCLPASCAAWCTYYRPTLGSAERGA
                     VHLTSSTDVDISLSSGVSTALTALFAPSTVMLSDTGDVAASCEATADASLSRCRLADK
                     AEGQRKGAKTPTPPPHPALAVAVYRLELLESILRDEIRTEEDEAFHIYLEKSFRYEHR
                     LLTVGTLPLERFLRSWIAIRRARRLRHALQRGKVGDMEQKARTALHATSQTLQRRSQL
                     MVAALVEQEHYYRCSLELLYTQDAAWTGVVLLRLQEQVECFPLAFGAVMSRARVCGRM
                     QGATLFSNLALAEQAIREMISAEEARQRAAFPTELEMRIVSHVREPQARKKLVDREAA
                     ERAVVHQVVGALQTHYSLREVEIEEGIERQYWRKQLMQIGIDSVVASATPRPLRRDVV
                     AAKVEL"
     gene            <1247720..>1248451
                     /locus_tag="LMJF_33_2770"
                     /db_xref="GeneID:5654703"
     mRNA            <1247720..>1248451
                     /locus_tag="LMJF_33_2770"
                     /product="putative ubiquitin-conjugating enzyme"
                     /transcript_id="XM_001685988.1"
                     /db_xref="GeneID:5654703"
     CDS             1247720..1248451
                     /locus_tag="LMJF_33_2770"
                     /EC_number="6.3.2.19"
                     /codon_start=1
                     /product="putative ubiquitin-conjugating enzyme"
                     /protein_id="XP_001686040.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654703"
                     /db_xref="GOA:Q4Q3Q8"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3Q8"
                     /translation="MPLTAAGMRTLMRQMQEVQEHPVDGVQVRPSDSMNEYHFDVDGP
                     EGTPFAAGRFHVVLIFDEQYPEVPPKGFFRTKIFHPNISERGDICVNTLKRDWSPMLG
                     LRHILVVIRCLLIEPNPESALNEEAGRLILEEYAAYERKAAMYTAINAARPNGVPRFT
                     LPEVKAEKASGSVTACASAGAAADSGASATAAAAAASASSMANGGAPSTATRGLTLSE
                     ANCHPGSATAAEKAEKSKKKALRRI"
     gene            <1252093..>1267380
                     /locus_tag="LMJF_33_2780"
                     /db_xref="GeneID:5654704"
     mRNA            <1252093..>1267380
                     /locus_tag="LMJF_33_2780"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685989.1"
                     /db_xref="GeneID:5654704"
     CDS             1252093..1267380
                     /locus_tag="LMJF_33_2780"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686041.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654704"
                     /db_xref="InterPro:IPR000409"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3Q7"
                     /translation="MQSLTERDFGLVEKLLNVIRPLLEYGKVHRCHERSADAMAVVSS
                     DSAVATVVAPSDVLREHQNQQGAGGSAAPLPADSAGGASTGMSERRMWTELAFLMSRV
                     VIAQKLFLMSYVTSDPGLMLTELSRMLLAFVHESCTAVAGSGKEARMRHVALLAQDRL
                     IFLLRVFCSLKNCTAMLGDTGDCDNAGAALKVYDAICDQVVSGQHLAWMSQIYVWFCD
                     EAARLARSGGAIPSAYVDATHDALRCILGCCTDHEGCAKAFLYSEPVACVAYMFYGLK
                     LRISEGDLLRPYEDEHPIVENAKGTAADASARQTSSTITVSDSRSDGNRLGVTVRDEL
                     ERTVMPASPIPQRPPGGGQLKTRYFTPLTASFTRQQQQQQQMPRVGTGDSASSASVAS
                     LVCPTNSSTAASIVSTSWAFDLPELSRPQLKTLLLGGRESAFDSLVFAALDVVVEVMR
                     VTRDYEHWMVLSTVSNLLLLSKKSIEVRDAAAALSLGSSSASASEVSLPLSRVVAMYE
                     NIVVLFQLLFSVMEGIGFEKSARSALSASSAPATAIHGGTEKEAKKGNRKGTPPHPGS
                     SFLSGGPSPSTQPRGARISTTVMGEVGQLPATTTVENSDKVDAVDTAQMREHIAQQIV
                     RMVLQTDVHAVFAATKRVLECDRTLFRVLHSFCMLDARSAEHAMSRKRCRKRSSGAAA
                     TEGHRKRRLSAPKAADTTAHYRGIAAGNTGSALHNPIISPTGTAAAGGHTCEGGSGCE
                     LVFDAGYRFFVTSNFGDLRHIASDVGCSKTLDGGLAENADSRSSFRIGMGTCSVRESG
                     MGDSGTIAPFSTEPLLGSAFATPQRHGQRLSNLQHPGRSEESGGNKKTVAGGGGSFAK
                     AFLKSFFGNRHAGSGAVALKRAVAHEGSDDNAEQGSSSGSSRSSSCSSCAESKAGGSG
                     SRSDSGASDDSDLLSSARGLLHGSVVGSLLSTRSFGVSGSHSPGWQRGSDSRHALKGG
                     TQHRHHRRKCKMRSAYSAWRDVPSYTALARELVRIFNLVLADTELSVDVRIGAGLLLP
                     SIVLRDIPVFRLYEGRVLIRNYLNLLLHELHYNIKLRGVSATAAADREGLPRAHVDGA
                     QEQPQSVSDIAETTASVPLQRAQASSSSMMSGRAHLTQRELIAFAPKVIETLERTFKV
                     LGVIPLTSDVASITELLLYFYCADGVAPLGVALERSFTRVVVLWLIGLVGAQCDEDID
                     RHAMEVLLHLMRRAVARGSLPKDSSTTLMVTPFGAATVVQSSNAAGVAVPGGPTVAAT
                     RLSADWANARSTARPAAANSAAGVIPSSFATPSTTNTTRLAAAATEVGVPTAAARSML
                     RGGSQLQSSGIGLNAAEQAAEADLCGCTFNKSFLGSAEFGGITTALGIEGGSGECSST
                     VEALSSVFRVLLGRSQDLLSPAGLATVLSLFTSRDSNLSRLGRECMIRSLEIPSVYPL
                     YADVILDSDTFLLTQTLSMLSTYLTSAALTPVTRRDRRLWMQRCGCVDAVIRVLVRVL
                     DSPPSTPNFMKVIPHLFQFLSAFESGESKPAQLSSTNFIASVAERLEKLEGMEYFIIV
                     TQAVLDASMGTYGSVDDGYASAGGPGAHYTKMQVIGSFRVAVYNCAAEKPIFLDLLPS
                     LLTFAKSHSDQLFTNLVEVLLHILECTSVVHSKRLADFALDHGLSQMLPYLELSGRDV
                     EERLPFTGTAADLYRFWQPILLRAPHRSRLRFTSHGGVQVSVGLWPDTGFTISAWFKF
                     DRLYLTIPLFEFHGVVSDGSSATAPLRGSSMAASLFLFGGDSMQLTINDGRRVTINES
                     QALQNFSPQTWVHVCAVLHTTHVLDVYVSGFKAGTTAFPYFAAGAEVRVNVGFTDGVP
                     HYATSRGTDASPLFSMGDIALWAQSLSRSQVEAELGSGDGTRCGTMSGGCPNTFPAKI
                     LKEGIPREMTLFRHMGVGGGAPLLGSASSTLNLSVGGLGTLMNPKSQSTGPSGMAGLS
                     PGPVSSITAGVGSDFKDDKAPGCGGAWSASAARMARFVPFENEDDMLRNVLAYPTGFP
                     VIAKLVGRYATPPKTWVDYPLLWASRGGIVRMLDWMHLVTSSAQLEGLLKLILECVRR
                     TTLAVTLDPRTYVLLTHILTNDVARYMTKTACNQLLELASAHINIFDEEHRVVINRLV
                     FEHILSDVGLYAALRRDAALHLLQRVRGLFHTSQCRYAKHNARFVSPYRFLDRLLHSL
                     VGVAARISLRLRRAVVQVAQQVVAACDMEDGLVQIFISLIALLTPEEVTVSSRRNTQV
                     KVEVPGMGSLTRGTEIPLRTANHLTTLLLSSLVECCSQSLCVSALSRTIDLPWYAMCM
                     SRYADPAAVVYATHIFFEAVQHNPALQEEVTQHQSAVVEVLTEHAVHEDLILLLLALT
                     VGATRDIDLLSSKHSLRQQLDSLLSTCSPEPNALVAPIFVQLLVIHLHRIVQSPWRHL
                     MKAQAVLQDEQRLPCRVRRYFSLVRVCSRLMILIRVRRYRALLNGNRFPEAGAYSVET
                     PILSPAHHPQWRSSGAVSGNSQNVSFACNRGAGVNTGVASTGGLANGSFVSGCHSRAP
                     PDPLSINSVSAGAAIGVCSGEDNGAATSVASPTPRSQSLRDAREFRCSDTGGCGGDGY
                     REETDPPLDQAPFDDIAGLHRPLVLPASVFNIRGDDHSSSSSAVGSGDVSQWKPPVLL
                     PEMWAGLPRSLPPTTARMSARLTPQASATAATHRLAAAASSSTSAVGGNDADDVFRRV
                     CQVPAAHVVSQVSAYPMQHHLRLEARGADNCGGGDGAAASMVASVKVGNAHLKEMPAW
                     RVHSRKHRRAFSALRVSVLLWLPLQVKRCRWASKPHSLPYEEDLSRRHAGTLFCIRML
                     HRFASMSNYFYLLVNSPMQTAALSSLVAYISRAMLLEQLDMWDQMVRSMVVAPARESA
                     VVTATAPATVADVPQPQQQEKETPVSPTASQPADDGIEPAEGADGDWEGVEAVSDDYT
                     GSASLDATPRVLSTDPVMVNATKPIASHHSRSSNSSTDAGSVGRGRAQKGDEVELASA
                     LPLSSLPETLLRPLTCPSSMMFRSAGSSSAQLDKMTVLESPHPSLTLCSEELDDADVA
                     SAAAQPRCRVTVEDGDGSSVTNGSFDVVGLPLIQPTDEQPKHRRELPLRPQSLQQRGK
                     ALPPHTYTETQADEIGSSATARAAASVRGITPTAAPTATAAAVEPDDSNTDSVVKPDA
                     TGNCDDDDGTSSVSSAAASLSSHSSTVSTSLIPTSASSNLPSTALDAKKAVSTPLVSF
                     SNLPGVPAPLRCHGLSDVYAMNIASIIESVGEVVRRDAVSILRALIRSSLDTLPMPNW
                     IGGPAYGSCGGLLFQLLFNISAKAAAAGDSTTTLVRYFLLCVGNAVKEQRDRDLMQAP
                     NHDQTLSSSKGDVSAKTPMTGLSGSPLGTLTVGRHAPSSTASPLLLGCRTSTFSEAPG
                     STTTVGAGASLFGNAGGLSANVPLASAAVLVTGVPPSTVSSSTAERPFPIGAVGIGGG
                     DDGGGCSPQHGDAPLSPARYHVPLSQGLRGTMSAEPGNAQHQSRSSSATTATGACSDV
                     FLFNVSHFTDLIVDMLAIQVLDLPMTTHFFLTLLVLCQGWPNRYVDQLSWQVMRACIA
                     VLNRPSTQDASVSLIESVYTLSTLVLRRGWKHKGVLESLLRVLYRVFVSLPPAWMPDA
                     DARHRKRLITLIFRHLVRTYVGTKELEKALTVRTLTQRLSLYDDFRMVFSLSNEDECC
                     ATFEQYCIDQFSSIDTLMSSRLKAKADLAFKASIKARSEYIKRIKTFNGQYRQVMEVP
                     ERYRRAALRVAYTSRFSSFVATTPHVDSSQLHWLLSSTCALHENHTVSHATLWRKGLT
                     TNGTAADSGTAAGTVTSQINASDGAEHTLYHFMDPQMNYGALKGVRWGGRCASQTPIA
                     KAATRATTACGTPGHIGVSDASRASIAEETAEGPMSAHSASTQIKMADKVVGAEATTA
                     TEEYPPKNDLVHAVQCEELVQHIAVLVPPLSTHCRPYLGDEAFPAALKELPITLTPSA
                     ITLLRYLVAPHETVRFLSNGFRINGIHTTPCLILLTNVTLKVIGFSRVTEAGDIILCE
                     NEFDDDDAHSRGAASGSSIHSNSTLCYHQDVGSVSDDGKGSLAKSTRRNPFSVASMTR
                     QLQKLFSDKSAKRRQQQDGTRVAQAVRQVMGCNYRNIYWTYRVSSIRAVRSLHYMHLD
                     TAVQLQLYYDNGPMLSVVDATQSMNPSAKKEFIKVLKDVVGTQQCTFMDESQRAASMR
                     THLVRWATGLLSNYEYLRFLNEAAGRTNRDLNQYPVFPWVLANYTSATLDLEAASTFR
                     DFAYPMGAQTETRRATVARLFEDTRELYDADTGKSYPFHHGTHYSTSGGVLYFLIRVQ
                     PFTTYARLLQGGDFDLATRLFDSVAASFTSCVTGPADCKELIPEFYVNSGFLANADHL
                     NFGTKSDGHAVGDVRLPPWAKNSRQVFTAVMRYALECPYVVAHLHQWIDLVFGVRRRG
                     PLALERYNVFQRMTYGEEVVQALKNAETPHDCDVIVAEVDNFGQTPLQLFQERHPSHH
                     ELAPIVKASAADGSVMGVGGGVMASSDSHGNGDGGSAAVWTAVNSISAVALGGLYTSA
                     TAAAACAAATAGAGIQVGVTSSNLLSSGSFASGQTYTQAFYREAPKVTWMLIHAMDET
                     QTWFVLRDPPGSVLQHPPPSALKDMFGFSSDAVLHFSVLRTSKKLACAYARLVPVADT
                     DYYLCWHEREAQLMRYTTGEAAFHSAISFHPRDVSGSRISAVAVGPRESVLLVATSSG
                     AVYCLLPDDTGDGQLHARGTLCHHRSSVTKIALDSRRHRAVTITDSTGDDEPILWRVQ
                     RSGCCFVCRLQVKQLLRMPARTLMSPTRETTADAAEARTVVDVAIDTVSGNVALVTAR
                     SLLLFDNNGEPFGMGTLPSPTSLHPVGTATLEDDNGDVGVVVSRPVLCVADITAVAFY
                     QTSEWAAGMGVLLTGHRDGSLSAWRTTRLPPHSVVPGKIAMVEFHTRLFSGTAAPTAA
                     AAGAGVAGPQDTAVAVAAAGAGGRGSIFMGGAAPLSSSGTSAGALGAPVILAAAGATS
                     HPVTALHQENAGVPTFLVGYANGTVRQLVFEDPALSYVGVSGGGDGAASGSSGNAGDD
                     RSQRR"
     gene            <1268852..>1271371
                     /locus_tag="LMJF_33_2790"
                     /db_xref="GeneID:5654705"
     mRNA            <1268852..>1271371
                     /locus_tag="LMJF_33_2790"
                     /product="putative GTP-binding protein"
                     /transcript_id="XM_001685990.1"
                     /db_xref="GeneID:5654705"
     CDS             1268852..1271371
                     /locus_tag="LMJF_33_2790"
                     /codon_start=1
                     /product="putative GTP-binding protein"
                     /protein_id="XP_001686042.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654705"
                     /db_xref="GOA:Q4Q3Q6"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3Q6"
                     /translation="MAAEEAHALCIVLYEPLAEKPFAEWVASDAVRQGLKDEIDEVVT
                     AAIPQQADDTDGVASADTASPTQHIPMAMIANTLAAQQTVNDRRHTGGAKQQHPLLLC
                     LVVIVFWDGQAEASKASLAQLKQLGDKKWIASHVPLWVEHVEVLVQALNAKRGAASIM
                     NNKVALVASLRKKLQASAMAAKGWWREGALQRAGRYADPNASAETLSPAASTNGGSDS
                     SSPAAATAGTVAALGETDISVDAVRRAVDNGQGETFFLLSDRDRAGLASKVETLKQNC
                     EVAEVGCAPVMMEPRELHLVHGATGTSGAPMSANAGGSKTATGAPSPPAAASSSPTTT
                     LMAQEFLLRRRCPPAALFELRLAMCGNVDSGKSTLTSVLTRGCCDDGRGLARAFVFKH
                     KQEVMTGRTSSVSENHLGFSAEGGVVNYALLQPHRTEAERRPLAPSEVAQHLMASAAA
                     ASGATHSATGGSGAHTMRQCTPKELATRSSKVVTLYDLAGHERYLKTTVLGMTRNMPD
                     YACIVISANNGIQRMTKEHLALCLALKLPFFIVVTRIDSTPPNIHDETLSNIHKLLKI
                     PTVRKLSYPVRRHDEVTLAAKNLRHDRIAPIFEVSNVTGAGIPDLLQFLNLLPTRKDW
                     RQARDMPKEMIIDSTFFVTGVGTVVGGIITQGVFRVNETVLLGPDGFGNFRPVVIKSI
                     HIKGVDSIAAEAGKDAALCLKKEKRSAIRKGNVLVDAAHSPKSFWQFEAEIVILYHST
                     TITANYEPVIHSTTVRQSARITYVAQEVLRTGDKSLARFHFIYRPEYMKEGQRLIFRE
                     GRTKGIGIVTKLICEPNDLVLAKNKLRKKMQEKLHAPVVAK"
     gene            <1273478..>1273933
                     /locus_tag="LMJF_33_2800"
                     /db_xref="GeneID:5654706"
     mRNA            <1273478..>1273933
                     /locus_tag="LMJF_33_2800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685991.1"
                     /db_xref="GeneID:5654706"
     CDS             1273478..1273933
                     /locus_tag="LMJF_33_2800"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686043.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654706"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3Q5"
                     /translation="MSSSQAAVVKKSSSTLQRLVVDPLMNMAHKIEGHSVKKVKSMEP
                     AMAEWIKAQEATGADAATISRQRFLREQHQLMSYRVVRFFEECRYIASGEYYKNYNIG
                     CFLQDARFATQAFFIFLMAVMAGRRSVYPPISPSSPLAVALDHKANPNY"
     gene            <1275549..>1276970
                     /locus_tag="LMJF_33_2810"
                     /db_xref="GeneID:5654707"
     mRNA            <1275549..>1276970
                     /locus_tag="LMJF_33_2810"
                     /product="transcription elongation factor-like protein"
                     /transcript_id="XM_001685992.1"
                     /db_xref="GeneID:5654707"
     CDS             1275549..1276970
                     /locus_tag="LMJF_33_2810"
                     /codon_start=1
                     /product="transcription elongation factor-like protein"
                     /protein_id="XP_001686044.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654707"
                     /db_xref="GOA:Q4Q3Q4"
                     /db_xref="InterPro:IPR000313"
                     /db_xref="InterPro:IPR001222"
                     /db_xref="InterPro:IPR003618"
                     /db_xref="InterPro:IPR017923"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3Q4"
                     /translation="MATYVPGDRVWVYIEGDGWWPACVLSDEEMGTRTPGFDLAVQFY
                     AGVEQPATLYELNSHADAANICFFETSSEKAVTGNPELEAAIRCACAHAEANPLKSAS
                     AIVGGARVAAGGSGAAGSSGAAVVDRAASKRVRDMGDDDTGVYSSGAAASRSVSGYHH
                     LRSDKLHELSSKISSAVAAADLTAVRAALCQLDGVDVYLTELEDTKIGVAVGSVLSQP
                     VLKPLWPLARAMISFWARHLPAETLAAIRSVQQRQLPVPATSAAAAAEPPSPLSKQQP
                     AFPAVPSGSAFASSVSPSAATAAGGAGAGAAGGAGSGDVAPTQRKTFYDNVYQLLDSP
                     LSTTRYDDTVIDEVARRLTAEITDRDERQMLLLRLREEELSFIRDHLLSGEWTPKKYL
                     DQPSEVFTTKSEKARQEQRIQEKMKAIEAADNAMLNITSLFKCGRCGKRHCTFYEQQT
                     RSADEPTTKYITCLDCKNTWTQE"
     gene            <1278400..>1280181
                     /locus_tag="LMJF_33_2820"
                     /db_xref="GeneID:5654708"
     mRNA            <1278400..>1280181
                     /locus_tag="LMJF_33_2820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685993.1"
                     /db_xref="GeneID:5654708"
     CDS             1278400..1280181
                     /locus_tag="LMJF_33_2820"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686045.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654708"
                     /db_xref="GOA:Q4Q3Q3"
                     /db_xref="InterPro:IPR000313"
                     /db_xref="InterPro:IPR017923"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3Q3"
                     /translation="MSASTSADYPVNSWVWVRQSGYPWWPAMVLDPAQAGQDPPEGTD
                     VVLLCGPSASATLVFASSADAEQLRPYHGAAEDAELIEAGRSDESCAAAIEEMLAAVA
                     STDAAPSEEGLHTTPSASGAAMGHGNHAFSGEDDVDWEALAAEAEAAMAEPQSAVAQE
                     KHKKDKKHNKRKSNGSSGGDGHADCDGSRKTRKDKSSKGHRRHRGGDADSANEAEVSS
                     GGDNDDSKNDEDVFQRRKGAFSSRSAMKKVKYERQSKLEEYDLGPGTLSDYSPRNDPA
                     YYYRKVRSARRAASSTELRTCTQELRGFMSRCLSGAATALDVEADILGVLRQLKNVDV
                     TLAQLQETGVGVAIGSLLRFFTPPVVQLAQAILNYWFHSLPQNTQQQLSAENEVDRCS
                     IETCSDGVAGDNELGRIGVNLFSCFTNEEINDAPASVDVMALCGSIEDALERRCDSDA
                     QMLVLFAFGDTSDTGKALRRLLLEGKIYVEDIINHTGNLPLLVRTRQRRPANMQFTFD
                     SPAPQDRSDIDSPNSPYAAFSPNDDGSTGSPTFGSPTGRTTTALYSCPHCGANDAYQS
                     SYSVQAHDNMPDILRCKKCGQTWNVAE"
     gene            <1282256..>1282954
                     /locus_tag="LMJF_33_2830"
                     /db_xref="GeneID:5654709"
     mRNA            <1282256..>1282954
                     /locus_tag="LMJF_33_2830"
                     /product="D-alanyl-glycyl endopeptidase-like protein"
                     /transcript_id="XM_001685994.1"
                     /db_xref="GeneID:5654709"
     CDS             1282256..1282954
                     /locus_tag="LMJF_33_2830"
                     /codon_start=1
                     /product="D-alanyl-glycyl endopeptidase-like protein"
                     /protein_id="XP_001686046.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654709"
                     /db_xref="InterPro:IPR007921"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3Q2"
                     /translation="MLYSSIRYGRNCTGTNETVKPLGPCVTPLGTILGVFNGVFGYSN
                     CNDSYVSTELRYINLTVPELNNETGQLTYISKQFYTGLAWQCVEYARRYWMQRGTPQP
                     AYFDSVLGAADVWNLTFVRLLSNASITLPLRRYWNGDRVTDNHQIPAIGDIIIYPVQD
                     GGFPYGHVAVIANVELSTHGAIYVAEQNWANAVWSSPHHNYTRRIPMFYDMLTSTITL
                     DDSEHQIIGWMRYG"
     gene            <1285827..>1287143
                     /locus_tag="LMJF_33_2835"
                     /db_xref="GeneID:12981202"
     mRNA            <1285827..>1287143
                     /locus_tag="LMJF_33_2835"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722346.1"
                     /db_xref="GeneID:12981202"
     CDS             1285827..1287143
                     /locus_tag="LMJF_33_2835"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722394.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2835"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2835"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981202"
                     /db_xref="UniProtKB/TrEMBL:E9AEH4"
                     /translation="MAHPSQRRCSGGRHRATVMCALLAVIFVLGDLYDASARAQEQVR
                     GLAELERGSLRQAAESLGRGYNLYKAVDKDGILDSEGSQSRSDEEAINTETAASSGAA
                     SSISKAEDNPSIESDLSSSAATTDAGTAEWSTSFHSESVSASQNPGSSSSARSSYPFT
                     TSSSSETNKADQPGDGSPSTTLTNTTTTATTETPTAKRPADDHGRGTAVVLFFFILLI
                     AGLIMYGARLCPSACPFVTQNGGDRCSGPHSFIQQQHPRYTTLRGDDNAYRRMERSSA
                     VAGAAAGGRKPRRFYQPQRGGGDSEGQCDIFVELKDKPTKAVRSAGARLSDDATDSFS
                     LMVDNNPAAENGLIGSLASSAGPVTVQVPTQSKSSLMSLRKGKLGLVSTTPAASFSSG
                     STTEMTGSNARSPLYRPTADTRSGHAEAVAMPPTTTQPRVEDDWEW"
     gene            <1290981..>1291757
                     /locus_tag="LMJF_33_2840"
                     /db_xref="GeneID:5654710"
     mRNA            <1290981..>1291757
                     /locus_tag="LMJF_33_2840"
                     /product="hypothetical protein"
                     /transcript_id="XM_001685995.1"
                     /db_xref="GeneID:5654710"
     CDS             1290981..1291757
                     /locus_tag="LMJF_33_2840"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686047.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654710"
                     /db_xref="GOA:Q4Q3Q1"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR025163"
                     /db_xref="InterPro:IPR026893"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3Q1"
                     /translation="MTSVIQRLRRIEVEGLENLRNLGGYHTNNSTKTTRWGVVYRSDQ
                     LFRVPADVAQMVLVDQLHIRHVYDLRANTEVSAKRYSLPHMQYTSLPIEMSNANRFLK
                     EGENLKQVATAHRFMQEIYREFVRSYAPTMGLIIKGIIDSKASCDNAFLIHCTAGKDR
                     TGWCCYVLLTLLDVMEEEKRSDYLLTNTFVGIPADAWDYDGAEGMGEEAMTALWTVFD
                     EYLDAALDELNKMGGIYKYAKSHMGLTDEDIDELRELMLE"
     gene            <1293074..>1294339
                     /locus_tag="LMJF_33_2850"
                     /db_xref="GeneID:5654711"
     mRNA            <1293074..>1294339
                     /locus_tag="LMJF_33_2850"
                     /product="D-alanyl-glycyl endopeptidase-like protein"
                     /transcript_id="XM_001685996.1"
                     /db_xref="GeneID:5654711"
     CDS             1293074..1294339
                     /locus_tag="LMJF_33_2850"
                     /codon_start=1
                     /product="D-alanyl-glycyl endopeptidase-like protein"
                     /protein_id="XP_001686048.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654711"
                     /db_xref="InterPro:IPR007921"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3Q0"
                     /translation="MFPFAFEYPCEATFAHQMQNKQPSTLLASFFAYYHFLIPMRSRR
                     SPAGDIEDRADVAAATVLHSSSSSSSAAAAASMMQDQVLRCVRKEPGPSNAAICDAYA
                     MRLLQEATEEERCRGPHWRARCSPSILVALLIWATIGLVVYMKVDSSHLRPGAALATT
                     SVETPLSQLPESCRGHYCLQEGGKEPFGAVLGAHNGVFAYSNCNSDTCISSLQYQMAI
                     PLPPGARTALDAPHATTRLMTTGMKWQCVEYARRYWMLRGTPTPAFFGAVKGAADIWD
                     SLTHVTFLDNATTAPLLKFKNGARLGYGGSAPRVGDLLIYPRDTENVFPYGHVAVVVK
                     VEMPTKAEADDSYMDAGAASPKPRQRHSHVYVAEQNWDSVTWPNPYHNYSRSLPLVVL
                     ESAEGRPLQYTIEDSLHGIQGWVRYDDEP"
     gene            <1294755..>1296212
                     /locus_tag="LMJF_33_2860"
                     /db_xref="GeneID:5654712"
     mRNA            <1294755..>1296212
                     /locus_tag="LMJF_33_2860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685997.1"
                     /db_xref="GeneID:5654712"
     CDS             1294755..1296212
                     /locus_tag="LMJF_33_2860"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686049.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654712"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3P9"
                     /translation="MSSPPQDPPDGVKSDGGGGRSRSFKPRPSPLAFPRDRAYGTLGN
                     NNDNGGEGCSSAGVGSTRQSGLLMTSGTNRRLSSDSMPLWSYAASPIIQIRDHCHQQW
                     LAVLLTVVLLLVTFYFVFGLSAPIRAERCATPFGSLLGESRGVAAYSNCRNDYGGDHM
                     ENFVSVGLQRLYTGSKWQALEYTRRYWILTSLLTFPSFPRADHTILADAANAVNGRRG
                     SRGSSVVPLERYTNLFLSSQVLQNSSEDMPVMKLNGEANNLSASVRLRNWRQALVQPH
                     DIVVYAKNSRTLPSAHVAVVTAVRGPFHSVAAAGKEVHWFIVKNASVQGRQPMAPGST
                     LPQLLLSQEHEVVSGAVPPKNMTGSDTARRPSSGGCENVSADEKGEEMVRGGSVLYYK
                     VFVAEQNWDNSNWETLSYLTRSDWHNKTNRNTITKGNSNRKESSATQQRRAATQLRNF
                     TRVLLLHEYSNPHGFFLEDTHNNLILGWVRASSDA"
     gene            <1297515..>1297862
                     /locus_tag="LMJF_33_2870"
                     /db_xref="GeneID:5654713"
     mRNA            <1297515..>1297862
                     /locus_tag="LMJF_33_2870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685998.1"
                     /db_xref="GeneID:5654713"
     CDS             1297515..1297862
                     /locus_tag="LMJF_33_2870"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686050.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654713"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3P8"
                     /translation="MSQDTMYRHQLWHIEDPTLSVSQARLKLLFDFDPPSQYRLQPNG
                     PLLHGIRPSCVLCGSVSPPGGCTAASAAAPITIRRMGVFGRVGSAPVQYEEPLVTEWA
                     DVGLPPTSRREDA"
     gene            <1298522..>1299766
                     /locus_tag="LMJF_33_2880"
                     /db_xref="GeneID:5654714"
     mRNA            <1298522..>1299766
                     /locus_tag="LMJF_33_2880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001685999.1"
                     /db_xref="GeneID:5654714"
     CDS             1298522..1299766
                     /locus_tag="LMJF_33_2880"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686051.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654714"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3P7"
                     /translation="MASASALGLSSSTSPPRHWGSDLLLRKVPLYAQARRYAAVDPDD
                     PQSEGNTLGYGPSSYPLLAAVRSCYNMLNREEVAAETFSLGATTAVVDRSPFNGIDRA
                     GYAHVSAQRKWSVADPLAADSASPNSEQSTALARRAAAAALLDDAIGPVTLAQVLEPW
                     FGVIEDRLCAGAQQQQLGELVRSDKQKRGKESAKWSNSGAAAAPEDGENVENDSGRVA
                     DADASRMLRRKRMYDEEEETHGAVYTRLESVILHYSAATQEEKEVLRSARVANNDSSA
                     DALVTGESSTATPPSQETWGSRMLSLVTFTVAAEAGSGAARRSDEEVEQQQKVLAYLK
                     RVRWIATQWSSTTNQMAFKDAGASAPSWGQMTESQRVKAEMLHAQGQRRRFRRPRRGG
                     DDGAKGNGEDADAALENELGSA"
     gene            <1344081..>1352327
                     /locus_tag="LMJF_33_2890"
                     /db_xref="GeneID:5654715"
     mRNA            <1344081..>1352327
                     /locus_tag="LMJF_33_2890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686000.1"
                     /db_xref="GeneID:5654715"
     CDS             1344081..1352327
                     /locus_tag="LMJF_33_2890"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686052.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654715"
                     /db_xref="GOA:Q4Q3P6"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3P6"
                     /translation="MMASGDYIYVNDLDDGGLMGATVRRHEHSSSLFVGATHDSAGES
                     QSQYDYLDGSLVGTYDGGGDGALTALELEDFVGVDGSNLASVLSESNSVFDIGAEEAN
                     MQTQSPSVASRSVSGADFDTLPITPMAKQPIDEPHVASASVPKPAAPNSAVSARHLNL
                     RVNTVADLKRPSTPDKYFEIFGGASGLAVGHNNTASYGANTSTGDARHRSAKDTSNYC
                     ATNAAVTAAGKGVAAAGHISKHSTLHPGMAAAGVPTRPSAPPAPPPLHPFPSVSQPHN
                     DSEGFGFGIDTFLHGNQLGFGRQPSFKRLTPALQGELKKPYFLLHFEDGDTNTTAAGA
                     AAAAAAVAAKRHPEASASGTSLRAASAGDRNAEEFSTWLEALEPKAAGLLASVRGGSC
                     TTHAGSAIGENFKREVDIFMKNLLGDYDMFAGATAAAAVNNSSVSGVSQLFVGGSGHL
                     NKRRGSGPSCPGDSQPADLDAFLGDARALTPPLRSPTLTVEQVKQRPRQSGAVGAHTS
                     LVGSPTVKTTVPTTMTAGTPFGGKGGKGSTGAYTRSSATASASPQPPTRGHATKCRRH
                     IWSTSLGPNKSTSAAAVNGDVVPDPTFAVATEALPTTNFAKAAAKPANGLPAQRSCGT
                     AASQTVAAVTCVPSHASTGETSASVAGTAKPATGKATTASAKPDGSVGDVGRARNSAT
                     PSTATPYPYMDEDLLAGGYMTRPPQLIRSPVESSSTVLPAARVAMEAPFTNKESGERS
                     GSNTSDVVALAARGCRTSLLDGHHISASQQRLSLLQQKLRPSRHNRTRMDGDSKTTSD
                     SDGAGMTASGALQQVPASSSREGSQESPIRAWNDPYGRAATSLPSESVTAGSSKTRLD
                     SRRNGDSTLGDVGKTFLSFKEAAGEGDLVDSGGTRANVLPPPIFLCHNNSAQEGMTAN
                     SSTSGSGATSSHLHCICKTGGTTTLTGCTRRSSRGPGADPVTVEPIALKKYLPIPLRP
                     SFLNRRASASQTDCEAATSGEHGAAATSPRRRLTEFRNGDYMLPAFLPKSRVSATTAE
                     DLHLEALKQQDRDRQTQQANEERRQRIQAFMSKRKAEKQLEELQRRQLLVQEGKLKMC
                     REMQEQQRILEATPHLETFGTVGSGLNAIKAAKRVSKSSPQRDRAVQQSVPAAGLIPK
                     AAMVATVISPHIEVAAPAVEDTLPPAGRGKGNGAVAKTNVRAVVVFTSSSGAEKGGVP
                     VTVKDDDNGRRRSSGSTAPSATASGLFNEGTVGVAELSENSKTLKVQQPQERTRFFPV
                     DEFLRISDAEAPKQVERPVSTRASGVVAGVLSNAALPRRRLSSLTLTVMNRRFLGGVN
                     VALLLASTEKAHHASLTAILEVVEGVLSHMPPHGELFASIAFVAGGNTQDLLCDPERA
                     VRSTFSTSPLFGPTLDNVTYVAVTGIGHLSAMVTESYKRCDLAAQWQQPSAGLLVMSL
                     LLKQPRGSDVLLSSYLITDAGCDGSTYVAALRKAQHTPFALFHSALGGPTLTTALMSV
                     DVDDTATLVPLLNVQHRLASVTNKPCHVGSVRRFLELAQQELQNRIKDGKSGRRRSSG
                     STIAKVTSERRRNSVSISSSNSVSDSTSCSPSLSGHQGRKQHPMSRAQLHKRLLEQVA
                     TAQSILNDPASYRPKAVREPPQARCAKALTSTAPKSTSAAPPLSAATSPRAQRRSADD
                     GAMPSLDLAAPCKRLSTSKAPATVNTVPLPSHSTGSALARKNSPSSTAGEEPPIQLTQ
                     LLATRRGSDAPNVESDASATAKASLSPATTHVNHQIAQFRPLQQNSSPLAGCSSASVS
                     LSTAYVRRGNDGGAAPQRTWFMNFEDVGDSTTASVGSRPAAGTLLKKGEREVLQDPPL
                     STATTTAAKPLQERCNAGDSELSQRGKPALGGGADGLTQRPMCVPPGVRSRSVGAGRK
                     GLLAAPTRIGPNGPQWPSMTAMDPGDIPAVPCVDSIDSSLVHDVSVSARQSLTAHDGE
                     RAPIPTSTKVRTLVIVDPRCCETSNVTYDNTMVIATTDDDFEEYDVDEVCEVSPAQES
                     IQADLLTELCKTLLLGGNASILGAESRPTGACAQVLKSVVHTIFADMNREGTHRRGRL
                     SVSIVKVKGESVVDLLKDSGEAQKLVIAISPLFGSCVHGVTYSNITNSATFNATIDAA
                     LRRAATEDNGRDYGFLFCSLIFKLQLEEEGDVLVCSLVATFAGEHVGLYTSVLDRSPL
                     VPRALFHYALGGPSYTIALLGIGSEESRANQMLQVQRRLGEVSNRATHPGSVAKFVAG
                     IRNDLTPNLIAKYESTHDQDERAATKAMIGRLAEMVKDADALLHDFDHHQPKAYLHED
                     RERRTTPAGTAAVTGSDSGSPAMTVPRRNNVNGTNDSNLTNKVSAASAVAATAPPATS
                     RPATQRSLPSITAVNPEGEDNHIQSLVCLEQVLMGAGSVAVHGNSILCTSQGGMRYDS
                     DEVIVCDESHRSLSSKLMDKLVAKFLAGYHTGLLAADSSYSAFTPLMLRCIANSILDA
                     MLGRETGPREGLTSSASFKPPTVTGELYVSIALIKDEVTADLLPTDADATYHRFEMEH
                     KPLYGPRVAGVASHLVSTPQDFDHYLAVAIDNADPALQSADPGIMVVLLSLTQRVTKP
                     TKDVLVSSLLCTAVFDAVHHYELVLGGDTSEPLELFHNILRGPCFTVALFGISDEEEN
                     PGKLLRALHGITQARNRPAEVNSVSRHIRELQRGIVKLKERMTPSSNEEKEYILSRVK
                     VAEHLLADAEALQRNALSSVQPRPFVPLGGAPHLRA"
     gene            <1358091..>1366178
                     /locus_tag="LMJF_33_2900"
                     /db_xref="GeneID:5654716"
     mRNA            <1358091..>1366178
                     /locus_tag="LMJF_33_2900"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686001.1"
                     /db_xref="GeneID:5654716"
     CDS             1358091..1366178
                     /locus_tag="LMJF_33_2900"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686053.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654716"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3P5"
                     /translation="MQSAHATASQLTASQPSCETFGSHSTLQGSTELQQQQSPSSKRG
                     PVGSSTDSPTCTVSASDDNALGYALSDGCYVPLWEEVESIPSLRPLPQPLVVSRDTES
                     PTGSRSDSNDKVSLLSSSTAADRRLFSSQRQGPGCGADRHRRHSQALETPKGDADLQP
                     WKITSRTTQLQKLSDSSSSSSKTWETEASRKNSGVTAPPRLSRLEGSGRVSPRPREAS
                     SIPPAASARQPTGGRLEPLGRAVSCDSAPAALASSYPLRVGTSTMFDTTSSDGKLITP
                     AASAATYFRDTCSTESGAGTASFFLREPVLAKSSSSSVGQRVASGGSPRAAWPLSWRG
                     TPGDCGRPIGGAPHANRALRSGDPMTQVCQPSSATRQSSSSVASDGGLLSPMRVSPQG
                     SGMPAAGAAHHATSSRGSEVFSIHTLVSRIKNVDNFDYGLQALGFPVEDCRRVSKASA
                     GMRGERSSGDFGSFLMVASNRSGVKYQGGHSPRSPAAKTGSTARGGGSFAGASSLPPL
                     TRRQSKLPLTSSGVRDAFPSSFFGPSGVPPRSSKSASATASSSTAQTSTSTSLSKTLS
                     RTMVPMTIGDERPVSTGDGLLPPAAPGALRASAGAAAARPQLGGANEPSFTTSVAPAA
                     VVATPPSASRSGIDSSGTLVSASFRSIVLHPRRLPYKLDVVYGDLADSSSNLTGNNSP
                     RRSAAHGSSSNGPVAGCGGGGATGFRSTARSWSATDQSERGDDGGTLAVVEGEESDSL
                     SAAHWMPGSLVWRFGEDNFQDYEALVSLAVSPSSSSSSPSDGSSSFGESNLGLTLEAG
                     TATPRQLRRQRDDLGGDGSFTLEAPADGGVPLAKETGRCSGRDCVWASGDYGSSLEER
                     RLPRRSRDTFLPFEDGSANCSRGFTSFALSSFLRDARPTSLKGMVWDSFSSVAPSSPV
                     NSSAQDTSSPPSTSGKTAVMACENGRTGGLSHPSLFQGMSSTTAGTQAVPLAIVSATS
                     IAAHTSTDPLEVPAQSSPLTIRGGASASTTSESVTGAAGPNHQVTRPPMNVGSAAGLA
                     HQNQAGQVAATGPDGVSSSNGAAEAPAELVRAGVLRWSKPLQAARMNRNTVSPSHGAT
                     AARSARRTQDELPASELEVLRPNEWCDVRGLTVLECCGAAATNAPATARVFVVDGGYT
                     VRVVQDNLVGDCKTDECVQRCAAAMTAASGANAPDKASVAASPPLPSLLIDTAATRFI
                     EGGENAIAIVMDTVGDFLQRRRVAAAAAAVSLQDSMRGRGGASPSSSLSSLAPSTHAA
                     AFPTASVARAMCMRVVETFRSFKGTRAKTHPDCVADLKVAVALVPVNLQLDSPPTPRP
                     TSAPTARAGSPAEISPYAGEKGVVYDVIYTACTRDTCCRPLEVATSPVFGACLNECQW
                     HVVEDESDIAVVFELAQSLAEVARGRQQQRQCFLYIQFLHQCFIPDVAAARGAGAATS
                     PVLTQRRDSRHSDIVVSSFTITTSPYSSVLEPILDQRADTPWPLLRYALGKGPCTVLA
                     VVNVHEEDEEAAYPLSILQRLKSMQHPRPRCGSMRSYIAEQRNKISDHKWRLANITES
                     RSETQATIKRLTVLISKLECCAKDAEDFLSDPTSAHVPVYVDARKAVPEVGGADPLVH
                     TFSPTREAAPTCEAPQVLALVQHYSPVTVFASYSPRTVSSGPKETTARWLAAPARASP
                     MDSTAPRTVSLTAQLSLTHSTRVQVDEITSLSAANTSELDWERCATWRRLGERFRSGF
                     NATVAVVQESARENRAWSLRVILELVHSVLKDSWGRVSNRPAKVGDDDQPSFSSRQVM
                     RVAASVYHCSDSAVADLLRTSSTSRIATGASVLGTVSFAPAKMAVRPLAGACAPVNVS
                     SKLIASPGELEMLLRGAVERLRAAQAAAEDAASHDGVQDALTRQCLLAPGYTVMSIEL
                     TQQVTGARRRSHASIDAEHFFNDSEDVYVSTLTVVNLGGHYALLSEAIKAGTPAGDRH
                     EDDPIAPHAGRTAATIPATSSGAEPLTARALLARLLVDRRHMVVCAVVLPAVPTPEAA
                     DQLLCTVRDFVKHVASQAATGAPSLGSVRHFIAHLRGVLRVAEHRKGGVSYSLISIRD
                     AVKRAFAVLRDPRSVAFTFYPFTQEDAEALALPASPLRVDRAAVESASVREYGSSDAL
                     TSGTVPTISGGGGRRTPTLSTAETENEKRRVPRAAALRATPTKATRPNSGVHGAFDCR
                     AVGTAMSARTALLGNAATYYGICYDCKEDPLLLCRDVAMLLCRSAPRRRLCAPTTATP
                     ATTTARTKVQHPSDIREEKDEDKQVTVPSVVVLNAATTSAHVCRRGTWVRVPVPSTLP
                     PAPDQLQYFSFGADELVRIKPTSIGMKSSRLMRAVSCVSRGRTAALLLSDTESCEATS
                     SIAWLTLRTVIGGIFQSLSVKEVEGVRHCAAMRAFLIEQDSKDVFADLLAPNLTPAHP
                     RQPLTRLDYSPFCGPIPSDTTAVPVKDLQDVNVALTSVLLGARLAHESTTLTAAEQLQ
                     GCIVLHLTFHQYIPATAGVLADVVVSSLWCVHMGSSVGWMEALHKAPSTATGALLRYW
                     LGGPCYTTAIVGFSRYVGVRAATWRAIIDTQRRVSLVVLRMPRFGSVRAYMDYLSETV
                     GRCTKKAPAAAKLRDQLGSAVTVTGASSALAASSPRQKWKCDGSSQMMAGVADAAARV
                     IVLLREAQNMIDRSGDDGITPTKQLGLLAHDEKMFAALDAV"
     gene            1369681..1373963
                     /locus_tag="LMJF_33_2905"
                     /pseudo
                     /db_xref="GeneID:12981203"
     misc_feature    1369681..1373963
                     /locus_tag="LMJF_33_2905"
                     /pseudo
                     /db_xref="GeneID:12981203"
     gene            <1379369..>1384630
                     /locus_tag="LMJF_33_2910"
                     /db_xref="GeneID:5654718"
     mRNA            <1379369..>1384630
                     /locus_tag="LMJF_33_2910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686002.1"
                     /db_xref="GeneID:5654718"
     CDS             1379369..1384630
                     /locus_tag="LMJF_33_2910"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686054.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654718"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3P4"
                     /translation="MFGGVPPGAADGFMYGRQNPTMMHGSSYGTSTMGPYAGPMGSMY
                     GMGSLMGSMGGGSYGMSGYGASGFGGSLYGGSLFGNTGSLYSTGGSLYGNNDPNAVIG
                     SMRGSFMGSMFGGFGSIYQVDGPHTSLGVVRKQSIPGFSYTFGSNLGTTAYRPSFHVD
                     SAASRSGSIRDNTFRTSTLMNASEHEAEPKAKAEETARQHGSTGVDKDGKTIAEEPES
                     IMKKRTPPTEAPKSPPTACQQGSGDTADQAAVLSSDFRIHNVAVLEQAGAGSATVTKK
                     GETCVMKGKSFAMDEVVEYKPANKRAAVESRHLNDLIEHVLAGHNSAILVADDGKAVG
                     AAKAAVETTMTKLIEELRKPARNSYAGLSMTMCSLPSNTTVRDLLVHDAKTMPLKTGN
                     SPLFGPAVVGLKSEPIESGARFVELYDTALKRGDQKSIMVCMVVVLQMRPASGEGKGE
                     VFLSSVFIGVSRTGPKAFHDIIDKLPASAHEIFRYAIDGPTACVHVVSVSHDTADATV
                     LEEAAKVGAVQNSPARSGNVHRFIDFTESQLKSMLKRRDASTGSEKAEFDNHVKRLNV
                     VLQDAKSLLSNPQKTVPHVYQTEAGANTAATLAEPKTRASPEAAAEGEAKDKPTAAAD
                     YRPLSTNIAALVIADVAEARAYSVKDTTVTVSGRPFSVDEVVMREAVKSKAMETKTTG
                     RVLTAFLKGYNGAVIVADSTAVAANGMESPTMSILFSAVAGALENTGCRGVRVSIALL
                     RGSGSACDLSGTAAELKPIEILSSPLFGPILQNAALHRIRAQEDLQKIVDKAREQVRP
                     LWNADSAVHITLLHCFVEGDDVYVSSLLFSFSSSACKLYDQVLRQQRHSMHDLFRYAF
                     GGAATTAFVVSVAKEDQVADVVASLGTQHSASVLRNRSPRQGSVRNFIAYTKASLDKR
                     RGRLATLSDDSTEKAAMTKAMAPMERMLSDHEKVMADPASNFPQAYPAENGSDKEANS
                     EAPAAAGAARQEFDRCLTDNGNRDLPSGEQPRQSPQKPAAGSTPSARPEEPIAGFAEL
                     RVVAFVGRDVAEGAKQLSLGSKDYTVDEIVKRMRSSSGTTTGPSVKMADIESRFAGVH
                     NCSLISASSVTDAISAEEPVWMYFQKCLNSAFAGGKPGEEMCVDLSFAVVSADELLAD
                     LLSDETTAETKPLEIVSSPIYGPRIHNTRSVAVRSADEVAKMMEKIHLRAESHLGAIR
                     TGDVMVVGTALLRRRTSEGDVLVASLMGTLTGPSVKAYKEAAEKAPVARRTLLSGAYG
                     GPSATVTLLNIGAEDESAQGMLSTAMALSKNQRNLVSRSGGVEAFVRFIEGTMKREQA
                     RAAAASGEAKELHLQKMNRLQPVIEDHKKLLHDFTAPIPAYPITRSSSRDTPKAERKG
                     ATVPGTSSASAAISSGPRKAPQSTKVPTPGSTTKKELAEPNRIQTVVVVTPNRKTLSS
                     TAVVPVTRADETHITIRIAGEQRTVECDEAVSRLDHFSAVRSDKLSAVAQHFVSGFNT
                     AILCCDVGGSSAGPTACAKTVHHAIQAKPENSELYMSITAVKDDGNAKDLLAPSGSSG
                     YTPLKVSNSLIFGPWVHGATMARLVSVAQFDGAFSAAYVEATKDGAACVVSLVLKAME
                     KKDVIVNSLLVSLSTQLNAHAAAVSAPLKADRKLYQYAVHGSCLCVGLLGLPDKVDKE
                     GIAECLEVYAKMRTIENRPLRSGSVRRFLAYSIKAAADVKSRAERVTDELERAMYKQR
                     LASLEKMVGDARALIESPEGRIPTTYM"
     gene            <1390098..>1391033
                     /locus_tag="LMJF_33_2920"
                     /db_xref="GeneID:5654719"
     mRNA            <1390098..>1391033
                     /locus_tag="LMJF_33_2920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686003.1"
                     /db_xref="GeneID:5654719"
     CDS             1390098..1391033
                     /locus_tag="LMJF_33_2920"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686055.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654719"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3P3"
                     /translation="MSYGGYDQGYGGNQVYVGGFGCNMQDYSYQQQQTMPYQAHGGYN
                     PYGQLDVYPPQQMSGVTGNASGAYQYHGCTQPCGDDAHSTALKSSKSFTGPPADVERK
                     QSTVSRTRSVASRSKGGGTGMARHGSVFFGARERDTQVAISTRGGMSVRGLDEEESEE
                     LKQYYGDMACRNEERRMDGLKAVRSYRGDIEDGEDVGKPRRVTNRRNIDGRSATGYGG
                     INFKRKAAMRNGEQWGEVEIRNRSNGNGGRSRSMERPVVQQPMPGPSMYMSPAVFEEP
                     AVVPQIYNREDVHSYSNISDSFSEADEGAPRDFDY"
     gene            <1398571..>1402707
                     /locus_tag="LMJF_33_2930"
                     /db_xref="GeneID:5654720"
     mRNA            <1398571..>1402707
                     /locus_tag="LMJF_33_2930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686004.1"
                     /db_xref="GeneID:5654720"
     CDS             1398571..1402707
                     /locus_tag="LMJF_33_2930"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686056.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654720"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3P2"
                     /translation="MTANAAPDSQNTMVADGYGWMGPTDYHPMSANGTGTIEYNGFGS
                     MVPGGYIMGDGRHNYLGGYGSMGPGGYGTMNGSVSGNYGSMGGDENGMTSMYGMGGPM
                     GSMYGMGVPMGSMYGMGDNPMGSMYGMGGPMGSMYGMGGNPMGSMYGMGGPMGSMYGM
                     GGNPMGSMYGLSCYNSMGMGSNGASMYGIGRTNSRLSFRSTGGYVGGTFGSLWRAPSA
                     YTSRPKQDISIPPPSSSLHEEMREEKDDAADTSKDSGVKATARGEATVGAEESKTHAV
                     EGTGADKKDAGAKDAEKGRDRAVPTAMASSHRLTKQVNDNVHVIAVVEKESMLNRPDK
                     SVTVGTTTYQMDEVAVAPVNIEKSDLLRDILEQTHCGHNVSMLALCGSQPYTACTEPI
                     TAVVKRMMESFAEDKAQVTQVKASAVSFAEGGSMIDLLEANAKPAKAEMGSNPIYGPC
                     VMNASEKDIMSATEAAEVVIGTAVKAAKESLVVIMYKIKQIRPVTTNGAAPAKDVYVS
                     SMLVAMANDAGMQNLKAAEKHATAEPALIFTNAIGGASRTVAIVWIPEKDAEKLVGGA
                     AAHSQDLREIKNTPTRSGNIKRFIDYTERAAAANTKASPETTAKIDRMLKDAKELLAS
                     PEQTPLMAYNLFGSNPSASQPETVPPSGEAAARKADVPAAPAVEKPAETVGVASDATP
                     TATLESEKQVRLVVCVDGTATVLAERVRADEVVVRTHPDEVPESDMLKTLRAVFGKGR
                     NVALLSAETQSRIPLKNQYTWKSIAEILTKAFESPPAQAKDTCIELFMSVVHKRQVLC
                     DLMANGAASAGPKPLGTASSPLFGPVLVDTTCRTLRQALDVKPALEQALQAAPAHLTE
                     PDSMIVMTAVLKQLQTNDDVVVASFMAASGPSAAGVCGAMSKNPDYSRSLLSYAIGGP
                     CVTSLLVCVGNDHESDEAAKSSLTDMHALTKQPNHTSRDGSVMAFIDYAKKGLEANRL
                     KLERAQGEERDRLTAVLKRLQIMHDDYENFLKCRGESMPAYYLGDKRVSPAPRMSGGK
                     PEDATDATASAHKKPQKDMGVKTSAPIRVSAVIMDGDDDASGAANKTPMDVTDKDLII
                     NGQRYTPTEVVQVKGGSIRSAMIDEMHKIVLDGYNAAMLTSDVGGSTVGISMAVKTIT
                     VIMRGLPKDSEAFWSVTVSKDNKVKDMLADNSPYYDLHLASSPLFGNVPYGANIVPVT
                     EAQVEPIVREVRNEVREKGGVGYIAVILRIVQSDGDVCVPSFLVAIAGESVEEYEKVL
                     LTRSSASLLGTAIGGPCNSIYVAGIRGKSGEMAQPVLELAAKMMRVHNGPLRSCSLNR
                     FITQTELAVAAMQRKIEASGGAPNPQLLSQVGRIGTMLKDAQNMLKSPGGSAPAVYKR
                     "
     gene            <1406459..>1408435
                     /locus_tag="LMJF_33_2940"
                     /db_xref="GeneID:5654721"
     mRNA            <1406459..>1408435
                     /locus_tag="LMJF_33_2940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686005.1"
                     /db_xref="GeneID:5654721"
     CDS             1406459..1408435
                     /locus_tag="LMJF_33_2940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686057.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654721"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3P1"
                     /translation="MSPAPGVRRVAPLPAVPQATSPAATAPPPQPPSMVRQNSMNGLS
                     YGSMGSGFGSMRGGFGSMGAGQMAGSAYGTMGASYGSMGAGYGSMNGNMNGGGSAYGS
                     MGDQGATLYGSMGGENCMGSMTGGQMGSMYGMGGPGSMMGGSMMMPTSSMYGMGGPMG
                     SMYGMGGMSTMGIAAQWGSLANMSMGGHGSQVKRSGISSGYGGFVSEATRVDTDELCP
                     QIGTFENAKDLPRSGKRGGNHLYSRGKHEKPVATGNSTVTALTIRRKSDVKLGGSAAS
                     ASNGTTTHSDTKVSRGASRALPSTAATGNGAAGKLRAKVPSNYNVHSLILVEKATGAD
                     VITVGDPSTVVFEKGGKKETFEVDEALSLASAKDDVDSVLLSELRGNWFNGHNSALML
                     CAGKGRVEATQDVARQFLRKCVERLEKNEKDMAVKFDITMTMVSLRCADQCCDLLKPG
                     ASYEKMMMGSSPVYGPCLLGLETKVHKTASECVSSFDAGLKNAKEDKEIVAAFFVLKT
                     IKKTGAEEEVHLSSLCIALCGETVAHKTDIRDKAASSPHRLFRYAVDGACVTVSGLWI
                     VSKDVDAREGLEVERKMREVKNQPPRSGNVKRFVDYTYKEIMRQKEKLESATGSEKKT
                     REAQIERMEEMVKDAKELLTSPENTRPKGYSMGR"
     gene            <1412994..>1413299
                     /locus_tag="LMJF_33_2955"
                     /db_xref="GeneID:12981204"
     mRNA            <1412994..>1413299
                     /locus_tag="LMJF_33_2955"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722347.1"
                     /db_xref="GeneID:12981204"
     CDS             1412994..1413299
                     /locus_tag="LMJF_33_2955"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722395.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2955"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2955"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981204"
                     /db_xref="UniProtKB/TrEMBL:E9AEH5"
                     /translation="MPLPPFAPNQWRGQRGSPCVYRMANSWCCQARPPLCLCCRDVRR
                     CLTPSPCLLVLSASIVVLAPLFRKETEKSVCMCVCVCVCACRVGGVASNALKGRERV"
     gene            <1414963..>1416975
                     /locus_tag="LMJF_33_2960"
                     /db_xref="GeneID:5654722"
     mRNA            <1414963..>1416975
                     /locus_tag="LMJF_33_2960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686006.1"
                     /db_xref="GeneID:5654722"
     CDS             1414963..1416975
                     /locus_tag="LMJF_33_2960"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686058.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654722"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3P0"
                     /translation="MREAPNGMYGLGAASGYDGLGGARNGVDGFGFMGPGRMSNYGTT
                     GGNQNGMASGLGCMGGGQDGMGSYGSMAGGGPDGMNGMCDNPMGSMYGMGVPMGSMYG
                     MGGNPMGSMYGMGVPMGSMYGMGGNPMGSMYGMGVPMGSMYGMGVPMGSLYGMGGMGS
                     MYGMGGMGSMYGMGGMGSMYGMGFGSMYGGSYHSLVDAASRRASFLNRNSLIRADVKT
                     VNNDTNGCSGEKDAKIAEDKKDGDKKNSKSSEVKPEEAKGDAKDPKAAEKKVTDKKDS
                     ADKKPSVEAKSADKKDTKDTKDTKDTKDTKETKESDKMEAKDKNGEKKDGEAPVAKSD
                     GPLKFSGTKIRSLALVCKSGKEAKVTVKGRDTVVMEDKETKLDEAILIEASKKPVEAA
                     TLSEVRNQWVLGHNATIMIGSDATRRTQAVDFMREYLTTCTGKLAASSEYFSIYVTMT
                     ALEGADKGRDLLKEDAAVGKLVLASSPVYGPALNNMTTKEVNTKETMEAVLKEGMGRA
                     KEGEIVCSYLVLKQCRKSSAGVMVYLSSLNVTFVGPNVEHLLGLKAKRPEEPCRLYRY
                     SVGGGSHTMCAGFVSDDEASAAKVFEALREMREVENTEPRSGNVKRFIEYTKKEIPKC
                     KEKVSSTTEESKKADYETMLKRMEMMLKDAEAIEKDPKTVAPKAYV"
     gene            <1423537..>1428267
                     /locus_tag="LMJF_33_2970"
                     /db_xref="GeneID:5654723"
     mRNA            <1423537..>1428267
                     /locus_tag="LMJF_33_2970"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686007.1"
                     /db_xref="GeneID:5654723"
     CDS             1423537..1428267
                     /locus_tag="LMJF_33_2970"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686059.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654723"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3N9"
                     /translation="MPSTSATENSGHCMATMMPPRSAGTPPPLQHSNGKELSRPARAL
                     VEAPECFANGQYFGLPCTLGNEDSDARSNSAVSICSGDKSEELRCRAQRNRRWKASAN
                     SDPGTRDEDAVCPAAVSSVSSYYFSGHNVLTEATHECAGEQRFMENRDGMGMFHSPSS
                     QASERAGDTAEQSSRPLGLLGATSPSVVQPATRMARVRAAALAASSRAMSSTELDDPY
                     HVLSMPTAGTLYSSSRAASDRDSVDGESRFTARISQQDMYYMNTSTLTMSIDAPASPS
                     TRQQRDGAAPRGGSASIASSCDRVYVPGIWEYGEWMLTARPATMETLSGHSTGTKTLA
                     TDHDRRAAQFPSPATIDVTMEPSSQPSPTMTVCSPRTARPTTVSNELPAGTALTSKAH
                     SVLSARGSQLPRGAADNDASPERKERPPVSVYKSAAATAPPPPLGTSTTPDVCITMKD
                     FTTGMRSPTRNVVNDSTAVNGAVRQRVESRSHRCSTGFAETIAAGQRRRVSDSGAPFS
                     DASSSLLAAGNALQQPPPRPSYANDAANSGESKKHMATPPILNGFLGGHQPAFMTTAS
                     LNASAAALVPDHAPLLGFGVHPVRKGVDSRSCVPSPVASPASTAMPLLLSPQALATAG
                     QPTSTACPARPPEVPRAPARDSGGGSPALPPSLDNTATECPSDVSRRAGSHSTATTVA
                     GATSSTTSTLSDDLIPSSSPKNGCAQSSDLKSPAIGPQPLSDSNGNTLLILSSGVRKP
                     TPPSPRAVAASETSMSAAGAQNRSDVHVATSKLTAATPAASTSTASTPAMSPLASSRG
                     LSDEGAASHATDTMCRPAFQTNKPAPHQLPKELPQGLRVDGQTSKPVNPMAITLSSRP
                     GAARKATRPQEEANGGGAVASRRSRKDAVCPTRSACDWRRRLGFKQNREIVLPDSKSL
                     RVSMPSLLEFRSLAMREQGKEMMPSTEEVSTHLMTRWNAVCVLVVVDEDAVRKPCLVV
                     SGLSVRVYEEDKSVTLANSRMAHGMMRVLKGRGGATHSRFLRSASYDVDEDSDDSDAL
                     VVGIRGGVGLSNRATSSSGGGLPSNLKSFVLLPDKKVRRSQSGKDDSADPCTVEFDNY
                     LRKFDVDETLSRLAGRKECRSVALDQLVRTWVTGHNTCLLLGNGNGRSTQSLDVTVGA
                     VESAMGILRERLNDPASRVELHICMGEVADDEDNGGTMVLDLLASSSSDEDDDSDDGE
                     QEKGARWRRKEVPRASQRSGTTRPPVQLARSPLFGTFVKGLRSVKIDGATTATSAIGR
                     TLTLGFMRFNMSTHSSRSNSMSNLSSLSSAALSKVRISFATLRLKTICRGADMRSARL
                     SARESATSKKKFGGQVRHSRSVEYRADVLVSSLLLVYFGTEYMVLDTLVQRSQAYRAT
                     AREEDEGIVHPNAPMRDQKPDFHPASWPNAVGFLQSLLCDALGGRTRTMACLCLSEYD
                     TRATLWLRAVSRARRITNMTPNCGNVRNYLLYLLEQYENLAALQNRRKQDARLFLPAL
                     GTQANSKHHKRGRLSAVSSSKEFDQWSVYCIEKMIAELDAFVATPTGNTPSLERLEIA
                     NEISATTQSGPLSSHPLAFFSRNS"
     gene            <1429494..>1433039
                     /locus_tag="LMJF_33_2980"
                     /db_xref="GeneID:5654724"
     mRNA            <1429494..>1433039
                     /locus_tag="LMJF_33_2980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686008.1"
                     /db_xref="GeneID:5654724"
     CDS             1429494..1433039
                     /locus_tag="LMJF_33_2980"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686060.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654724"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3N8"
                     /translation="MQQVATKPASSFAPIKSSATAFGASMPSQGQVADPNLYGMPAGY
                     PSANQLEVQPMEQANYDANASKATYAKRLRHGEECKSATVDGVQRADKPVLGAADPQR
                     VNSNLPSDCPAVARSMGDQAHNTFNVDRGSFAHDAYRNGCLGAGSFHGGMPGSMMMGR
                     MGSMFGMGGPMRSMYGMGSMYGMNVSRPASLFGSMYGSQYGMVPMESIYSLGGSMNRI
                     GSMYGMGMSMRSVTGPMGMMGCPTGSMYGMNPGSQFGPNGFSSVYGDQFQHGMRGSQY
                     SGASNFGMFGVGSGYQPQLGYGPTGITRAGEASGTNGAADAGAFPPGPVEQPAALSNK
                     APLRAVTQTSGAEKKSSERKSGVVGLLVISAAANPATTVMLSSDPPIAMAADEVLRTG
                     PSAQATAVAIIRSPTCQGVYNSVKAGHNAALLLATDGTTESRSMAAEVVRQVLAEALS
                     ETAKAAASHGSLGYFDARVSACALRSATEAIDCVEGDAVTNVEVGSHPVFGTAFMNVG
                     TVTVRRMETHMPQVDAAITAACGRPDAKVAVIEAVVKQVRPSQKGSSSTAVLLSSILF
                     LVSNVTTEQQSYFEAFRNGASVPPALIKGCIGGACHTVAVLCLPNCTDPSAANEAMAS
                     LNTICNIQNSTPRSGNLARFIAFATGESEKMRQKPKVDTAVLEKVNAMLADGRSILQD
                     PRNTVPVAYPCSPQSTLSRAVNTPQLSSRDINAHATEKGRDASNPIRVVVIASSQASN
                     TFPQTFNVGPDDKSIVDAASGTKASVLELVTCAPEDWRSTTPELVNEVQTLFQNGNNT
                     AIVGTVSPNEVSMLSKQPLWMSYKGMVSSLLSVATQKYKFAEVSLSIAVVGGNELLAD
                     LLVGMDSAAPAAQTSQKLSVAYSPLFGPTVYKATIIKQPTPLQLESTINGALSHVPTI
                     MQQYPNKKTVIIASAVMKGVTATDVYTSSMLAASVVDPTVLIDILDKKPDAPHELFDY
                     AFGGPCCTLFLAHVIQGDSGVGKLIELINRLNATQNRSVRTCSVKKFIAFAEESLKKA
                     DIKLAAAKSETEKETILRSKKSMEVFHAEYKTLIEDPEHHDPKTYRRSGGGIGSSGTG
                     AATATAANSSAGKTRSLATPITGGVSADKSRRSADADEKSSERNAKADDAKSSGSRHS
                     SSHRIASADGKKRRHSSSRAKADHKHHHRSSNGKK"
     gene            <1439693..>1440691
                     /locus_tag="LMJF_33_2990"
                     /db_xref="GeneID:5654725"
     mRNA            <1439693..>1440691
                     /locus_tag="LMJF_33_2990"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686009.1"
                     /db_xref="GeneID:5654725"
     CDS             1439693..1440691
                     /locus_tag="LMJF_33_2990"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686061.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.2990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.2990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654725"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3N7"
                     /translation="MQVQGSMYPRQMERAVHQQQPQSMQGNRQAVASRAYHLEPINPL
                     QLRQQGGSMPGMIMQQPGGGMMDGLSAYGPRPMVRGVQDGHMGPPPADVARAAGDGTQ
                     GIYGNCSMSYGDAGMGGVHKLQNGHAVLLTAGCAGQASDWNNINFNGIFDSAVNPQVQ
                     SSVAVQDDCKPLPFPPGNLLAQYPPEYQQQLICYYRLLRLQYPELYQQYVDYYVMYYE
                     PLYHPAPSSLSKDNLDAKQPRKKDSLLPKTQWAHMQPQQPVTQQPVYQPPPPMEPVLQ
                     MEHALPPESMGRTTSNLSRGMKRQSSLRRQNSMRRNEVNQLKNEGSLKRLPSMRQQ"
     gene            <1445724..>1448696
                     /locus_tag="LMJF_33_3000"
                     /db_xref="GeneID:5654726"
     mRNA            <1445724..>1448696
                     /locus_tag="LMJF_33_3000"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686010.1"
                     /db_xref="GeneID:5654726"
     CDS             1445724..1448696
                     /locus_tag="LMJF_33_3000"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686062.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.3000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.3000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654726"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3N6"
                     /translation="MRDGDLAREHTSKHLSRKQSRSGSSFRHPSQQQSVGGGPPPNSG
                     LNVVLPSQQYQRRPSQQPYPCALQQEQQPCPQGVGFPSSAHPMNSSNGQTCDNDGSAR
                     HHCNGSIQPGEFSGNPLIARCNSRLLFAAGGAGQELQQKHAPYPSSPGDEGNANRPTQ
                     YAQGQLYPPYRGGPSFPPQQLTNVRHLPPLPYVMTPQGMMAPPLLYLLPMQGCPLMPN
                     MLPQQQQQQQCCEIPDTSNGAAPSQHNAMNGSVMPASPQAPWGGQQHVLLDRPQAVSP
                     QPTLVSYPSFLAENTATSVAPTAALSAAADPQAATRAAGGILLPRTQSILNRVSSFKK
                     VAQPASKGGQTRQQAVDMQQRLYARKQERIRLEQEMQVREAATKAARDQRLRELLQRQ
                     ASRNFAQESTTTATPRVLMESPKSGRLSSDSASESRPVLPSEPALALKQASPALSPST
                     PPTTDVPLPPQEPRNQQLPMSVASLHSPAGSHASRGSLGMAASRSGETAVIAKGKGPS
                     GGAGTVTAVDAPAAPAAGTQQLWHRSPSLVLYEIPLRCAKTVTGKGEEQIDCSTFPVR
                     LVGSKLRVMDAVKQTTTEYAIDEIVTHRRGSTFVESRLLQKVGEVLVAGYSASVLSLD
                     SKGLGKPLAAFESAAWLAKQRLFRNLISTVKNMQSTYSKQVGSRDFFEAAFSFALVKK
                     VSAEKAAEWKTTNPATSQRGYEVVDLLQTEPRVVQLKMHSCVLSGHRIGRVEYRTLRS
                     ESEFTQALVSAQANANIVLGRLADAVAADPNNEATAREQASVLQVITCVLTHRKAGAV
                     SLQEQMAEPAEAVYKREAESDVISSDDEDDANVLGAFQSHNVPSACSDIIMNCLTCIG
                     SQQSHELWTAALEHDQGTAPTSLFASAFGGPAYTVILASMDPSKVESAATLVTQSAMS
                     MKLHRRPLNGSARRLIRTSKYMTAALQKKLNSANCPSGPQQRDLKADICKYAEALDSL
                     REVVGSIEARRLSVSGST"
     gene            <1454961..>1458074
                     /locus_tag="LMJF_33_3010"
                     /db_xref="GeneID:5654727"
     mRNA            <1454961..>1458074
                     /locus_tag="LMJF_33_3010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686011.1"
                     /db_xref="GeneID:5654727"
     CDS             1454961..1458074
                     /locus_tag="LMJF_33_3010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686063.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.3010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.3010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654727"
                     /db_xref="GOA:Q4Q3N5"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3N5"
                     /translation="MHDAGHNSMYGAGGMYAHPDARGMMDDINEIIVTKLFSSRRDLD
                     RLASAQDFSRRFDSNWGSYRFAGADSYGGSLCRANSAAGGSLMNLSGKPGASSITGCG
                     TGAAGVDPDGNDGRSVHEKMPASEEREAATKEAADERVDASRNVRRSGLADTDASKPS
                     GKSTPSTVKPSSSGAQSGETHDAPTQSSTEASGKTNKSKDVSGGAPDKGPKTSTQQST
                     EPKPTPAGANDRGMAALQSVKGGAGKASKTMNAQETKSRTTESIDDIPLLADDVRPKP
                     KPAAPNAPTPQTSAVTKPPASKPSEPPNEATETAHAVDSSSTTNATRGSTANGEGRPA
                     RPRSRQATRPVSRLTSMSVVEFPVAEEVNDEMVDGGLHDPEKEAALRAEQRRERENAA
                     RAARDERQRQQQLIEEAQKQREEEAQRRRQKKEDEARQRKEMLTKMDEERKRERDAAL
                     AARERQREEEKRRFEDMKRLEEAKEAARAAALIAERQRKLEAEKAEAEEKTARSVSRQ
                     RSRRPTSRPASRLRGAIPEQPPDVTAGQIKDTLADEALGKSEHPDNESHHSHAAQALR
                     AAQADRKTEPRAEGRHTSKSPADVRCASSTPAEVREERAARSQRSQSPLPQQKQPASA
                     EGVMSGPPSHSAARPPPNSNPTPQSKVLNNSCRSQPKEDKSVSSAGKSSASRPANMVK
                     TLVLVEELRDSNHALAMTGNSISYKGQTIEVTEVKTRPEDNFNYHSSVVHDVSEAVCS
                     GYNAAVLAVDAPNTASRFDSPVWSILNRIVRTLLQENSNQAGQLRSDFQLTCAMGYLY
                     KDKVKDLLTSAEPESPFTKIGVNPSPIYGPRLTNLTYDAVTDPGAFEDVLTTTLSRAS
                     EDAAIQNLTEGVIAAFLLIMQTRETDGKPDIYLSSLVVTTAGDDTFPYQSAISHTRNE
                     YATVFHLVLGGPSCTCFMLNIADDDNVCKAGETEESVQERIERVLGLLQKMSALPNYD
                     LRSGSVKRFIKYVELSHKNAQARLEKEEDDVQRRKVERYLREQERLLQDAYRLLQEWN
                     INCGGEL"
     gene            <1463838..>1466765
                     /locus_tag="LMJF_33_3020"
                     /db_xref="GeneID:5654728"
     mRNA            <1463838..>1466765
                     /locus_tag="LMJF_33_3020"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686012.1"
                     /db_xref="GeneID:5654728"
     CDS             1463838..1466765
                     /locus_tag="LMJF_33_3020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686064.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.3020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.3020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654728"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3N4"
                     /translation="MTSVASTLYRASDLRGSVAMETNPDASRLGTPNEFTASVLIKRG
                     KTREHRMNAVMERDGASTAQDESQLLKEEARNAWCTQDAFVDFDTDSSDSDAQSGGKT
                     DPTSAFMDDGSASSDSCYASFYTSKGDDSDTSLDDTPSPSYGEYEESNEYDDEAEEDE
                     GLVGSDASRINGNSFSSTDPGRNISVMFGVSRSSVSPEQRSSIKGSSVSALPPFTISG
                     APSSHGTHVALLVTGVSDRPRRARGSAASMMMPPYTTTTVLNPSMSVSLVLSAFGTFS
                     NGTSAPPADLPVDLRKHESGNAGTRHPQSLERNNSMMFSQMYFTGSEAHQAEARSPLY
                     NDHGCDRSNQELPTLAWGDEKRRQMASMMQMETMLPLHAHANRVSHNEDSVDGGIYGF
                     WPSDDKKSEDAMSTRPLVSKMNSTLPSFLRYADARSPCTIAGETRAASCGTKQGDKQL
                     KTCAGGRQEGRNDHSSNSTGRLPRGSSLLHAHTRNGGSSPGEAFLSDKALSPNAIIGV
                     LRGDFDNRDISLDSRFLDTDPHHKSGSTSMEAKGHSRQPPASSRHAVTADGTVDRHGA
                     STATVGDSETSSGHRVEEPVRRRRSGDAILSICRTASFGHPRESFSVTRSLSSGQAHS
                     LGPVPSQQTLIGVWRLLSFREQGDTPLTNVEHVPQKRTSKKKHSKDKKRSKKHEKHRR
                     PRHTAEGGHVGIDTGRSVDARDDANRDDGAHVSAAPMCKESDTMRSPARLSGVSAAGG
                     APAECHTGVTCCCPSSPPGLGWAAGKQGSLRSSMEANGQPLRRHQAVLQDLSMGAPPA
                     RKGTPPTAGNLKIRLLPSRVPVRTVFDAPDTLTAPHSHNSSAEKVDDAAANAHVPQPS
                     GADVARAVGSASVDAAQKPDRFEKFEEPSVESPTATVRRLTVRSGSSKALMNHVRGCN
                     TSSDSDGSAQRLLAAPATQVRLSVSPPNGRLRIHSYDGLAAHNGERSLRSLTRPQEGL
                     PPL"
     gene            <1475135..>1478359
                     /locus_tag="LMJF_33_3030"
                     /db_xref="GeneID:5654729"
     mRNA            <1475135..>1478359
                     /locus_tag="LMJF_33_3030"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686013.1"
                     /db_xref="GeneID:5654729"
     CDS             1475135..1478359
                     /locus_tag="LMJF_33_3030"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686065.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.3030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.3030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654729"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3N3"
                     /translation="MPTYQEMHSSRLRRSKHSAEPVEAAQRQEENEMNGHFHTPMLQP
                     EEPPTTPTRSVAKRIDVPARLDDSRRLGYTKTSPNARHAFTEANTATRGLVPMRRYMA
                     VSTSDSMESAVVFHSPDQAAVRVVSGVLSASEPQSSSSGASPMKVGSDAVNLTLVEDD
                     DSDNLEDRGIEDDQIDDGYGAGVVFELYKPMELRRAEHTFSKGSPLPPAVLTRRLPAG
                     GVSGRRYNCSNGSREQVGGRYPTLSQSSRLEDIRRLPPHGGEMCKSSNICVDRTRTMT
                     QEDMVRNSSADSFSIDGAGTVFQNSGQPQRIDSSMNSQFFFKSRQRRNGMNTSVVHGC
                     SHHDSMSSPSESPQMSADVAAPTLLNVSGPHLLCSDQVALISHCRGQSRHTHANHHLN
                     NHNHRHSDGDAAGEAASLMDGIVLGMASVDPLTGDGGAGMTTSLSMTDGFDLVRTPIT
                     GLRAMVLGNNAVEEEEAAEDPEMRARQAEQLKHFYSKVVRQHRNCAKSGAPAGGNSLP
                     TSATGSTSTLQAPQVFRINDTAADCVAPVHEFGAPILSQSSPLGDEGRTALVLESVVA
                     KKSKKREKRVMFNINGMEQPHTAGGGVANLPHHGTPQPTCALVPHAPSPLALQYFGIE
                     MTSSSGEAEVNDLVTWESPLPPASLRMARRAGDMQNQLKAATGTTRTETLTSSADGAV
                     PALLSPVTPVQGSPCMSSLHTPRRENEDDEHLLTDPLTPSASANFAQQQLPTFVRMAT
                     ASPSPPAPPSTILEKLSIIFAEAPRKRCFSGGKASTASTKHRKAAMALVAGAGDAIVL
                     PQSSTTFVPPSRSPYSHLVPPNVLNSLEVCLPDRDSSKKGSSRPRHPPQTSLCISCAQ
                     TKYPSPLQSVEGSVPPVQHIKSRSTATQVFMPPWLRAAQAVSDRELPSEPMQKPSITV
                     PMVVTAAAGLTTEKRNGKLDKKSRCNSQHSSASSFPIVKSHAVKTDPPLLPTQSSIRL
                     FREESPREWASSKPSSPSVSGDEVSVLRPSALKRHISIPHKTTTTAAGSGAGVGAGRE
                     QQMSEFTKGTRSISGDPDTTSSSATRSSGHAVPSLLAITVPRHT"
     gene            <1479411..>1483424
                     /locus_tag="LMJF_33_3040"
                     /db_xref="GeneID:5654730"
     mRNA            <1479411..>1483424
                     /locus_tag="LMJF_33_3040"
                     /product="ABC transporter family-like protein"
                     /transcript_id="XM_001686014.1"
                     /db_xref="GeneID:5654730"
     CDS             1479411..1483424
                     /locus_tag="LMJF_33_3040"
                     /codon_start=1
                     /product="ABC transporter family-like protein"
                     /protein_id="XP_001686066.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.3040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.3040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654730"
                     /db_xref="GOA:Q4Q3N2"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3N2"
                     /translation="MAEVEACCADVDGQAVAVLARYMGWRAAKRVDAWWTTAVEADVP
                     SSQPPIASSASFSGIVPSFAFSNDIVLEEALELAYMADGVLRLAEDRRWLERFVTILQ
                     YVLLRRVSLIEEAQLYRCLRERALFPCHPATHKRKGAVQGDRGTQRSTWAAAWRVHHR
                     PTWLAPLSGGARFLCLPLSYFPVEAVLPYVACETWLSDRLLSTMLPRWERLCVRSLQR
                     LQKLAPPVPTLKNGARAERMSSKVQYWFLRYTAPIMRTCVEQQRAAAHRFCMQELSTA
                     AGYDNAASSDLPRGSLALLWRCLRSMCTCSASAASTSADSAVPNKDTSRLVRRVLILR
                     AVSQAVTVTLQVCCPRLTVRYVTELMVAGYCAQRERSSSSPKLTTTTTDAAAASPVDT
                     LLSSMAAEMGWALVAGVAEALLTRFTGITGHQLSLLLADAATRRVEQELLCVDEAFYC
                     RWLRGVPGEADSVEATGVAASPGRRVPPVGMLPARPLVTADDVLATGRRGGERMFALH
                     DAVVKRSLRYAALIARAAVTREWRPLVGAAVTAWVNVPALLSSFSVAVGYSTPSDLAR
                     LLSRREESLPSRSPVGLRLLLEVLVDEESDTTAPPDTQQRRRRRLRNPYLALVACSSV
                     WTFEHLLADTKRSVANLCAHVCQLKAVYAAVAVYPYAVSSVRHDTTAADVIAAMQEDV
                     RCVLYYSVYQMEHTCRKRCGGAVAASPLLHPLLDPEETALLQQPSALSYLPAHVDYFD
                     LFSLPYRFVLRQLGLEMVFAYRTAAGMQQESQQMAEEWWAQALFNSTFNPLTSALHEV
                     LQLTASCATVLLLCLQLVDGMWVVCPLPLSVLLRQAHAVQFYRDLLRSGVAVQRLEDG
                     VAPLQQLCENLPHAVVSDAATLLRSSLQGKSPSAAPLSALQRRRRHWRQVLTASRPEL
                     CFAADDGIVGGLRLRGGVSWHHVYFTYPQLFVAPNAEDTEQESARDTCGVRPTIADAC
                     FACPAVGMTAVVGPSGAGKSSLNLLLRRLYDPVAVVELAHEGGIARSPPDEQLGAYVD
                     LNRVGATADAEDVLVEVLRLALVESALPPPSNNVTPHSPSPLRAANGQRVTSQPSPTA
                     SAAPVTSPRYRLRVQPGYIALDGIPLSLFATAYVRQWLGWLRQTPHVQPRQSFLSNVR
                     GTAMHVAVCDVQRALRVCGCDAFVEEKQRTLRDAVGHLSGGEAQRLALASVVAVLLAR
                     SRVETLNGMPLHDSDVGTAAAAAAVGGLVLDEPTSNLDAANENHLLAALEALQGGGGE
                     ADSEAGRGLPLFTWMISHRMSSLRSAQHMVVVEDGRVTASGPPAEVTEANLFAKTQLQ
                     LQQLTDVWASAGANAAS"
     gene            <1483827..>1486313
                     /gene="TDBP1"
                     /locus_tag="LMJF_33_3050"
                     /db_xref="GeneID:5654731"
     mRNA            <1483827..>1486313
                     /gene="TDBP1"
                     /locus_tag="LMJF_33_3050"
                     /product="tyrosyl-DNA phosphodiesterase 1"
                     /transcript_id="XM_001686015.1"
                     /db_xref="GeneID:5654731"
     CDS             1483827..1486313
                     /gene="TDBP1"
                     /locus_tag="LMJF_33_3050"
                     /codon_start=1
                     /product="tyrosyl-DNA phosphodiesterase 1"
                     /protein_id="XP_001686067.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.3050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.3050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654731"
                     /db_xref="GOA:Q4Q3N1"
                     /db_xref="InterPro:IPR010347"
                     /db_xref="InterPro:IPR027415"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3N1"
                     /translation="MIELMVCPLTVLCAWLFHAALSGREGSQTQPVFLHCCHCPFFYL
                     VAAATVRAASVDAHPAAPPSLCGYPFVCRATLSSLSFPSVYTRRATTQTSHLCVSAWI
                     CLPTRSCSRSSPFPRCRGRRLRCAHPNCVADPSLPPHHIPRRALMNGGGAARHAEAGF
                     PFWVNDIDSFPSALQRHAPLSRSLLRLRDLFRCDVADPGECWQHILLSSYVTDLRWLL
                     ATVPELSAVTGKLVVLSGEKGTATLRRTTGDPSSPYTAVPPLMDRVNPFMTALREQAS
                     GTSPLHTALSRERLAVLEPPLPVAFGTYHTKMALCINGKGLRVSIFTANLVEQDWCWK
                     SQGIYVQDFPWKPVTERSNDDSAGTIMVETAARSTSNSNNGSNTFTKGAEFVAHLRHY
                     LMRCGVSLASACASPADAASAAGPLGIFETDFLSHIDFTAAAVWLVSSVPGTYAHGEV
                     CPVYRVGLCRLGEVLRRSALTTATAPASVDLSWQYSSQGSLNPAFLNSLQAAMCGESV
                     AVIESGDAPRGVRDVQVVYPTEEEVRNSWEGWRGGGSLPLCVQCCHEFVNARLHCWGS
                     SEAGHMAKRAFPRPAKVAAVHASREDAVDVDGVDSDGGEGTPVSLAGSCAAYRRFALP
                     HIKSYAAVAPDRSCVRWFLLTSANLSQAAWGSLSRKVNQHGSRQQLVRSYELGVLYDS
                     HSAIYQSASSWFSVVAKSKIELPNACNSRAMLYETPLGIGTQDVCLYTPYNLLCPTPY
                     ASTAALRAHRDAPDKGEQAVAGAALDCSDVPWVLDMPHRGRDAYGLEVEEAFESIVSP
                     NLSKWQPRTRAMETAPLRNIGAPRKRTREA"
     gene            1489227..1491410
                     /locus_tag="LMJF_33_3060"
                     /pseudo
                     /db_xref="GeneID:12981300"
     misc_feature    1489227..1491410
                     /locus_tag="LMJF_33_3060"
                     /pseudo
                     /db_xref="GeneID:12981300"
     gene            <1492385..>1515040
                     /locus_tag="LMJF_33_3070"
                     /db_xref="GeneID:5654733"
     mRNA            <1492385..>1515040
                     /locus_tag="LMJF_33_3070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686017.1"
                     /db_xref="GeneID:5654733"
     CDS             1492385..1515040
                     /locus_tag="LMJF_33_3070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686069.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.3070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.3070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654733"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3M9"
                     /translation="MQGEHFSLHNTVSFMSLDELDSDNTASYTAENPSDQTKQDDLSV
                     TAAERSSKASSLILGPPETTPISYLSHSHSSASFVSLEPVEEPAALRAQQEEAPALQR
                     VGTPVEPQTRLAVTTHRVRLDGDLWARVVDECPDLLKQEFTSDVCDATALPRTSMQRL
                     VFTAGSLIADFQLSHGGLAKKELNRQLANSPFTRTWALYERVAETRETSPTRATPPAA
                     LRASESFASLEPVEEPAALRAQQEEALAAVPMTAFEEEAPALQRVGTPVEPQTRLAVT
                     THQVRLDGDLWARVVDECPDLLKQEFTSDVCDATALPRTSMQRLVFTAGSLIADFQLS
                     HGGLAKKELNRQLANSPFTRTWALYERVAETRETSPTRATPPAALRASESFASLEPVE
                     EPAALRAQQEEALAAVPMTAFEEEAPALQRVGTPVEPQTRLAVTTHRVRLDGDLWARV
                     VDECPDLLKQEFTSDVCDATALPRTSMQRLVFTAGSLIADFQLSHGGLAKKELNRQLA
                     NSPFTRTWALYERVAETRETSPTRATPPAALRASEGFASLEPVEEPAALRAQQEEAPA
                     LQRVGTPVEPRGGHFEGTPPVATRSVTPPAALRASESFASLEPVEESAALRAQQEEEP
                     VAVPMTAFEKEAPALQRVGTPVEPQTRLAVTTHQVRLDGDLWARVVDECPDLLKQEFT
                     SDVCDATALPRTSMQRLVLTAGSLIAYFQLSHGGLAKKELNRQLANSPFTRTWALYER
                     VAETRETSPTRVTPPAALRASESFASLEPVEEPAALRAQQEEEPVAVPMTAFEKEAPA
                     LQRVGTPVEPQTRLAVTTHQVRLDGDLWARVVDECPDLLKQEFTSDVCDATALPRTSM
                     QRLVFTAGSLIADFQLSHGGLAKKELNRQLANSPFTRTWALYERVAETRETSPTRATP
                     PAALRASESFASLEPVEEPAALRAQQEEAPALQRVGTPVEPQTRLAVTTHRVRLDGDL
                     WARVVDECPDLLKQEFTSDVCDATALPRTSMQRLVFTAGSLIADFQLSHGGLAKKELN
                     RQLANSPFTRTWALYERVAETRETSPTRATPPAALRASEGFASLEPVEEPAALRAQQE
                     EAPALQRVGTPVEPQTRLAVTTHRVRLDGDLWARVVDECPDLLKQEFTSDVCDATALP
                     RTSMQRLVFTAGSLIADFQLSHGGLAKKELNRQLANSPFTRTWALYERVAETRETSPT
                     RATPPAALRASEGFASLEPVEEPAALRAQQEEAPALQRVGTPVEPQTRLAVTTHRVRL
                     DGDLWARVVDECPDLLKQEFTSDVCDATALPRTSMQRLVLTAGSLIADFQLSHGGLAK
                     KELNRQLANSPFTRTWALYERVAETRETSPTRVTPPAALRASESFASLEPVEEPAALR
                     AQQEEAPALQRVGTPVEPQTRLAVTTHRVRLDGDLWARVVDECPDLLKQEFTSDVCDA
                     TALPRTSMQRLVFTAGSLIADFQLSHGGLAKKELNRQLANSPFTRTWALYERVAETRE
                     TSPTRATPPAALRASEGFASLEPVEEPAALRAQQEEAPALQRVGTPVEPRGGHFEGTP
                     PVATRSVTPPAALRASESFASLEPVEESAALRAQQEEEPVAVPMTAFEKEAPALQRVG
                     TPVEPQTRLAVTTHQVRLDGDLWARVVDECPDLLKQEFTSDVCDATALPRTSMQRLVL
                     TAGSLIAYFQLSHGGLAKKELNRQLANSPFTRTWALYERVAETRETSPTRVTPPAALR
                     ASESFASLEPVEEPAALRAQQEEEPVAVPMTAFEKEAPALQRVGTPVEPQTRLAVTTH
                     QVRLDGDLWARVVDECPDLLKQEFTSDVCDATALPRTSMQRLVLTAGSLIAYFQLSHG
                     GLAKKELNRQLANSPFTRTWALYERVAETRETSPTRATPPAALRASESFASLEPVEEP
                     AALRAQQEEEPVAVPMTAFEKEAPALQRVGTPVEPQTRLAVTTHQVRLDGDLWARVVD
                     ECPDLLKQEFTSDVCDATALPRTSMQRLVLTAGSLIAYFQLSHGGLAKKELNRQLANS
                     PFTRTWALYERVAETRETSPTRVTPPAALRASESFASLEPVEEPAALRAQQEEEPVAV
                     PMTAFEKEAPALQRVGTPVEPQTRLAVTTHQVRLDGDLWARVVDECPDLLKQEFTSDV
                     CDATALPRTSMQRLVFTAGSLIADFQLSHGGLAKKELNRQLANSPFTRTWALYERVAE
                     TRETSPTRATPPAALRASESFASLEPVEEPAALRAQQEEALAAVPMTAFEEEAPALQR
                     VGTPVEPQTRLAVTTHQVRLDGDLWARVVDECPDLLKQEFTSDVCDATALPRTSMQRL
                     VFTAGSLIADFQLSHGGLAKKELNRQLANSPFTRTWALYERVAETRETSPTRATPPAA
                     LRASEGFASLEPVEEPAALRAQQEEASALQRVGTPVEPQTRLAVTTHRVRLDGDLWAR
                     VVDECPDLLKQEFTSDVCDATALPRTSMQRLVFTAGSLIADFQLSHGGLAKKELNRQL
                     ANSPFTRTWALYERVAETRETSPTRATPPAALRASESFASLEPVEEPAALRAQQEEAL
                     AAVPMTAFEEEAPALQRVGTPVEPQTRLAVTTHRVRLDGDLWARVVDECPDLLKQEFT
                     SDVCDATALPRTSMQRLVFTAGSLIADFQLSHGGLAKKELNRQLANSPFTRTWALYER
                     VAETRETSPTRATPPAALRASEGFASLEPVEEPAALRAQQEEAPALQRVGTPVEPQTR
                     LAVTTHRVRLDGDLWARVVDECPDLLKQEFTSDVCDATALPRTSMQRLVLTAGSLIAD
                     FQLSHGGLAKKELNRQLANSPFTRTWALYERVAETRETSPTRVTPPAALRASESFASL
                     EPVEEPAALRAQQEEAPALQRVGTPVEPQTRLAVTTHRVRLDGDLWARVVDECPDLLK
                     QEFTSDVCDATALPRTSMQRLVLTAGSLIAYFQLSHGGLAKKELNRQLANSPFTRTWA
                     LYERVAETRETSPTRVTPPAALRASESFASLEPVEEPAALRAQQEEEPVAVPMTAFEK
                     EAPALQRVGTPVEPQTRLAVTTHQVRLDGDLWARVVDECPDLLKQEFTSDVCDATALP
                     RTSMQRLVLTAGSLIAYFQLSHGGLAKKELNRQLANSPFTRTWALYERVAETRETSPT
                     RATPPAALRASESFASLEPVEEPAALRAQQEEAPALQRVGTPVEPRGGHFEGTPPVAT
                     RSVTPPAALRASESFASLEPVEESAALRAQQEEEPVAVPMTAFEEEAPALQRVGTPVE
                     PQTRLAVTTHQVRLDGDLWARVVDECPDLLKQEFTSDVCDATALPRTSMQRLVFTAGS
                     LIADFQLSHGGLAKKELNRQLANSPFTRTWALYERVAETRETSPTRATPPAALRASES
                     FASLEPVEESAALRAQQEEEPVAVPMTAFEEEAPALQRVGTPVEPQTRLAVTTHRVRL
                     DGDLWARVVDECPDLLKQEFTSDVCDATALPRTSMQRLVFTAGSLIADFQLSHGGLAK
                     KELNRQLANSPFTRTWALYERVAETRETSPTRATPPAALRASESFASLEPVEEPAALR
                     AQQEEALAAVPMTAFEEEAPALQRVGTPVEPQTRLAVTTHQVRLDGDLWARVVDECPD
                     LLKQEFTSDVCDATALPRTSMQRLVFTAGSLIAYFQLSHGGLAKKELNRQLANSPFTR
                     TWALYERVAETRETSPTRATPPAALRASESFASLEPVEEPAALRAQQEEAPALQRVGT
                     PVEPRGGHFEGTPPVATRSVTPPAALRASESFASLEPVEESAALRAQQEEEPVAVPMT
                     AFEEEAPALQRVGTPVEPQTRLAVTTHRVRLDGDLWARVVDECPDLLKQEFTSDVCDA
                     TALPRTSMQRLVFTAGSLIADFQLSHGGLAKKELNRQLANSPFTRTWALYERVAETRE
                     TSPTRVTPPAALRASESFASLEPVEESAALRAQQEEEPVAVPMTAFEKEAPALQRVGT
                     PVEPQTRLAVTTHQVRLDGDLWARVVDECPDLLKQEFTSDVCDATALPRTSMQRLVLT
                     AGSLIADFQLSHGGLAKKELNRQLANSPFTRTWALYERVAETRETSPTRVTPPAALRA
                     SESFASLEPVEEPAALRAQQEEALAAVPMTAFEEEAPALQRVGTPVEPQTRLAVTTHQ
                     VRLDGDLWARVVDECPDLLKQEFTSDVCDATALPRTSMQRLVLTAGSLIAYFQLSHGG
                     LAKKELNRQLANSPFTRTWALYERVAETRETSPTRATPPAALRASESFASLEPVEEPA
                     ALRAQQEEAPALQRVGTPVEPRGGHFEGTPPVATRSVTPPAALRASESFASLEPVEES
                     AALRAQQEEEPVAVPMTAFEEEAPALQRVGTPVEPQTRLAVTTHQVRLDGDLWARVVD
                     ECPDLLKQEFTSDVCDATALPRTSMQRLVFTAGSLIADFQLSHGGLAKKELNRQLANS
                     PFTRTWALYERVAETRETSPTRATPPAALRASESFASLEPVEESAALRAQQEEEPVAV
                     PMTAFEEEAPALQRVGTPVEPQTRLAVTTHQVRLDGDLWARVVDECPDLLKQEFTSDV
                     CDATALPRTSMQRLVFTAGSLIADFQLSHGGLAKKELNRQLANSPFTRTWALYERVAE
                     TRETSPTRATPPAALRASESFASLEPVEEPAALRAQQEEALAAVPMTAFEEEAPALQR
                     VGTPVEPQTRLAVTTHRVRLDGDLWARVVDECPDLLKQEFTSDVCDATALPRTSMQRL
                     VFTAGSLIADFQLSHGGLAKKELNRQLANSPFTRTWALYERVAETRETSPTRVTPPAA
                     LRASESFASLEPVEEPAALRAQQEEAPALQRVGTPVEPRGGHFEGTPPVATRSVTPPA
                     ALRASESFASLEPVEESAALRAQQEEEPVAVPMTAFEEEAPALQRVGTPVEPQTRLAV
                     TTHQVRLDGDLWARVVDECPDLLKQEFTSDVCDATALPRTSMQRLVFTAGSLIADFQL
                     SHGGLAKKELNRQLANSPFTRTWALYERVAETRETSPTRATPPAALRASESFASLEPV
                     EEPAALRAQQEEALAAVPMTAFEEEAPALQRVGTPVEPQTRLAVTTHRVRLDGDLWAR
                     VVDECPDLLKQEFTSDVCDATALPRTSMQRLVFTAGSLIADFQLSHGGLAKKELNRQL
                     ANSPFTRTWALYERVAETRETSPTRVTPPAALRASESFASLEPVEESAALRAQQEEAP
                     ALQRVGTPVEPRGGHFEGTPPVATRSVTPPAALRASESFASLEPVEESAALRAQQEEE
                     PVAVPMTAFEEEAPALQRVGTPVEPQTRLAVTTHQVRLDGDLWARVVDECPDLLKQEF
                     TSDVCDATALPRTSMQRLVFTAGSLIADFQLSHGGLAKKELNRQLANSPFTRTWALYE
                     RVAETRETSPTRATPPAALRASEGFASLEPVEESAALRVQEEDEAPAAERAAEPQEAP
                     VAASTEVPPARDLWQSIAEPEGYSRDDLGCAEPAALHAQEEDEAPAAERAAEPQEAPV
                     AASTEVPPARDLWQSIAEPEGDSRDDLGCAEPAALHAQEEDEAPAAERAAEPQEAPVA
                     ASTEVPPARDLWQSIAEPEGYSRDDLGCAVPAALHAQEEDEAPAAERAAEPQEAPVAA
                     STEVPPARDLWQSIAEPEGYSRDDLGCAEPAALHAQEEDEAPAAERAAEPQEAPVAAS
                     TEVPPARDLWQSIAEPEGYSRDDLGCAVPAALHAQEEDEAPAAERAAEPQEAPVAAST
                     EVPPARDLWQSIAEPEGYSRDDLGCAVPAALHAQEEDEAPVAERAAEPQEAPVAASTE
                     VPPARDLWQSIAEPEGDSRDDLGCAEPAALHAQEEDEAPAAERAAEPQEAPVAASTEV
                     PPARDLWQSIAEPEGYSRDDLGCAEPAALHAQEEDEAPAAERAAEPQEAPVAASTEVP
                     PARDLWQSIAEPEGYSRDDLGCAVPAALHAQEEDEAPAAERAAEPQEAPVAASTEVPP
                     ARDLWQSIAEPEGYSRDDLGCAEPAALHAQEEDEAPAAERAAEPQEAPVAASTEVPPA
                     RDLWQSIAEPEGYSRDDLGCAVPAALHAQEEDEAPVAERAAEPQEAPVAASTEVPPAR
                     DLWQSIAEPEGYSRDDLGCAVPAALHAQEEDEAPAAERAAEPQEAPVAASTEVPPARD
                     LWQSIAEPEGYSRDDLGCAVPAALHAQEEDEAPVAERAAEPQEAPVAASTEVPPARDL
                     WQSIAEPEGYSRDDLGCAEPAALHAQEEDEAPAAERAAEPQEAPVAASTEVPPARDLW
                     QSIAEPEGYSRDDLGCAEPAALHAQEEDEAPAAERAAEPQEAPVAASTEVPPARDLWQ
                     SIAEPEGYSRDDLGCAEPAALHAQEEDEAPAAERAAEPQEAPVAASTEVPPARDLWQS
                     IAEPEGYSRDDLGCAEPAALHAQEEDEAPAAERAAEPQEAPVAASTEVPPARDLWQSI
                     AEPEGDSRDDLGCAVPAALHAQEEDEAPAAERAAEPQEAPVAASTEVPPARDLWQSIA
                     EPEGYSRDDLGCAVPAALHAQEEDEAPAAERAAEPQEAPVAASTEVPPARDLWQSIAE
                     PEGYSRDDLGCAVPAALHAQEEDEAPAAERAAEPQEAPVAASTEVPPARDLWQSIAEP
                     EGYSRDDLGCAVPAALHAQEEDEAPVAERAAEPQEAPVAASTEVPPARDLWQSIAEPE
                     GDSRDDLGCAVPAALHAQEEDEAPAAERAAEPQEAPVAASTEVPPARDLWQSIAEPEG
                     YSRDDLGCAEPAALHAQEEDEAPAAERAAEPQEAPVAASTEVPPARDLWQSIAEPEGY
                     SRDDLGCAVPAALHAQEEDEAPAAERAAEPQEAPVAASTEVPPARDLWQSIAEPEGDS
                     RDDLGCAVPAALHAQEEDEAPAAERAAEPKIFGVIGTEEIREDAMGEDEAEVSCLVTS
                     VSPRCSLVGTSGSVESISGALSGMQLVDLKPSKPRVTQHKVKLQGRHWVKVIFLPVVT
                     EAFREDVAHALDVRVGDIQHVELASGSLVGTFVVVHAFDFLTASEVDEKLCAYHFPLT
                     WEHYPKSPDTTTGHFFEGEALSTIRRTSRCINSALKCRLPPADTELSRPTSAALKPHP
                     PPRAAQEASRSTLSSGGRTCSAAASSPAVRESLPVVPAVHGAPPAMEKRTSASNLSSP
                     MEHHYAGNDGSESSMRLSRKTAPAPVAKAVRAPAAPETVSTKHRVGFVGNQWYTILKT
                     QRDNFVAAFVKGTGEKLGYEPDSVTKVQCDENTGDTIVSFRVTHPSVLPRKQIDLVLR
                     SAPYTDVWKLYYKNAPPEEQKTMHNGVKTFHRVGFVGSKWKEVKNRGIARFIEAFAAD
                     TATALNVTPQAVHIADYAVADDIVVDFYVTHPGTDSAEVIDGKLEQFDYQRVWDLYGI
                     PSEVDEQQRVVPCVMKCSNASRRTSPSSTCRLRMPDTNSVSQVDSFCPRCQRRLSSKQ
                     EFLQPDESSGWHPQPMHSHTSSISDAVRTALMEDSYSAIRKPSSTPPLPHLAHRYAPH
                     QKLEGQASQQPSAYQTRGISLMRVAQMTSRVPWHTSVNSSLIPHPPRQRSLSNTTRYR
                     QRRVNLRELESELSRKQRQHKHQERQKQLDREMRRSLNYSKLSLPTGSTTNVSGSFLP
                     PIPPCYTKVRTGPQRMKRGMGSLLE"
     gene            <1517003..>1523575
                     /locus_tag="LMJF_33_3080"
                     /db_xref="GeneID:5654734"
     mRNA            <1517003..>1523575
                     /locus_tag="LMJF_33_3080"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686018.1"
                     /db_xref="GeneID:5654734"
     CDS             1517003..1523575
                     /locus_tag="LMJF_33_3080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686070.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.3080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.3080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654734"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3M8"
                     /translation="MAHLYVCHSAPPLAQSATKEGPVTYLDQVVSAATKGVVSGHKSE
                     RSARGCVFNLSSTSARRWSPLTERRGFKGATEESAFEYAESAAVDAASLISEPESALQ
                     PSSHLSSLPERASDSPRNAPPVAVHRKWPRQRLLPSMLTRIRQAHGATFEAATVTATA
                     HHPYNDGQAFPAAASARGVGRACAVSMPTLAEAMKPLQQLPPSRPSPAVAPEPCAAAA
                     ASFASVQQLLINYEALSRRDLIIDFYAAYPIQPVVAFELSQPELPAAALRAVTRKPPP
                     PLLPSPSTSEKRSVPSLKKATAAMCARSASSVHLNRLRLVFPGALWPFILRHHYQLLT
                     RTLRRDVEASAFPSEAVEDLSLHAAGAEMEVTLSLKESPDSQSKISTTLSASSFAESW
                     EVYNLVAFFFSREVPLTLPQSVVSPPWGHESSTRASTATTHAAVDEAASSPQPTAVPP
                     PPLPPVLRKHQMAPTLFTQASLSKISAAAATSAAYQPLKLMVPLLFLEEASAALQKLI
                     DTAPSQLRLALLRDTMYAVPDANDVQVNSWAVQPTGLYVKLLLHCADGNGMHVALDSE
                     TAINRCPYTETWDVIRSYTAGLASVAVEVPIVAKRCASTPRAAPASQQMNRSITATAC
                     AVATTVTAATPQSESFVCSASPCTEEVRRSWLLSEDAVLNASEYTKSEWHSVSTTSTV
                     YSFIARNGAILSADSSSASANESFFSASPVAATSCQKRAVKSLKRRATTTTEIHTTPT
                     IAPAIAPGWVNELTSKSLLTQTSSTQLLLCGTLSESNVKSIGVPRTGSATTRTPLLSP
                     RVRPKKEDTSSVTDVLERRTQAVAESAANSSERFPPGTITAESTMGHPNAYVTDSMKA
                     SSAAKTANKSLLAPFLFPTLLPIPRNSSGKSPVIGHEQAASRVLCDADKQSAKSLQED
                     EITQAMFDREEEAAATELHDPFKPQLEQKPMSLSRYMATERQLAHQQQRISFEASRYA
                     RVADTGITNTESSTTPSPSEDTAMATDFAMQKADLDGAQGTHVSSTVGEKWETLWEHY
                     PLQLQRALKEDVHAFFGVLTGAIAKVIVRSIDKLHEEVMGAPGVVLQPSSLERKAEAS
                     VTVPTTSHVFSPATVELLPVLRMLHMTDFYTAHAQRHLCPLRSFAVSSRCSAAEAAVQ
                     HRAVPIESLVDATAKAVTINQVEVLSPLSASVASSPAKNEPKFHDELSSTLQDPLLAE
                     RGNDVTKTAIHDANAVLVPTKTEMALQAVTVADGSARQADFSVPTAAPERSALLHRRA
                     LTESSAACAPVRVLLRRFFDVPGLTDETLAGELEAMRALFFAETCAVLDTPDDVVEDL
                     QLSGHLTVHATVRLPTTNSVAEWCSLLLEHDYPKLNELLHEWAAARAPQAPLHVEAKV
                     EPDAMSCSTLLSSCTLKLSPTASAAPVESDGRDASSHAVYVEGDVWPALIEQRADVLR
                     EALISDATAALSTIEASVHRVSAVPYANGALFTFHLHSHGSTSLRAVEDALQQCSLTA
                     VRALRRRFDGTSRYLGNHKVTGTMYRAHLEGKAWKQVLEEHGDLLTETFVRDTLQCLR
                     GSEDAAVSVTVAVTGIAAKPDGITIAYDVASTTACADVDRGRVAHAIMKYPFPQLRKM
                     YDSFMLAREPLEHSKNALRIVPRHLSTAYDVAEVPNQRQCSHVGLALEMPLDPLEASL
                     ATLAPDGKAETAGPLTVGSKAEMMDGQKVYELNYLSAPAAVLAPPVVEVPREAAVVPS
                     ARASLVDSAQATEKPPPATVVPNVRVVGLERGRTEVDIRVANPPSPLPRLQTSLPQRS
                     EPRVHQQEQQQQRRHEEQRRITEQPTNASEYRAPTYAATVSFMETEYEEDGEAEEDTA
                     SSESDGFAEHTAALPPTPLRRSTAPRPAVSARAAPLSTTAAPVIRIPVTPSTPLKVLN
                     NAASVERRTPCAVRPNACLPKTLQSAAAPAVPSLSPVFNRIAAASSHVPVKQALRAAS
                     APAQKSPLSALDSSLAGEEPMHLPTLYAEGEGKMHGVSRTSAPSSLARSPSLVRVCQA
                     APITVADVRMEHSPKVDVLDAKSTVRAVPILSCPRPSAHCYSGTGTAPCALLQTSQAN
                     MTAGHLYTAPKMPSSEPTSLYHSHSPQMITLASCSQCGSASKMRSSVLSSLPASPLPT
                     TRMLPRHSSSFVFVATEPIRSLQRLQDDFDLIERAIRARYSCMQRELMATVTAALAGL
                     "
     gene            <1526472..>1530695
                     /locus_tag="LMJF_33_3090"
                     /db_xref="GeneID:5654735"
     mRNA            <1526472..>1530695
                     /locus_tag="LMJF_33_3090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686019.1"
                     /db_xref="GeneID:5654735"
     CDS             1526472..1530695
                     /locus_tag="LMJF_33_3090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686071.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.3090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.3090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654735"
                     /db_xref="GOA:Q4Q3M7"
                     /db_xref="InterPro:IPR000980"
                     /db_xref="InterPro:IPR006641"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR017072"
                     /db_xref="InterPro:IPR023097"
                     /db_xref="InterPro:IPR028231"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3M7"
                     /translation="MQVVFSFVPEYDQDDDDDSATHRFVTAAERQKEAERDRRLREEA
                     RRELENLRNEPLSDAGDSGQRSDDEEDQRSEEANLADFETNEFMHWIEAGASDRFAAP
                     RHEIDEKGLRDDLEFKLEQTGLGKTTESAVSATCPERLKEALVEPRVLPDGSVCKFSL
                     QREVYWVLRQLRNAGQPFAHNTRICALASRPFAEIVDEPVVVALGYALQKMTVEHYEP
                     GHLMVYHQTPLHPLLCALLEGSVLAEDARHTIAPASYAYNATTGQRQEPAIGETYVGF
                     DALARHPIGEGDPLWYGDRRERHYAQRKPCFIELGRLLVRLVELNRLFLGLEYRRQRM
                     IASLKDHPDARVQDQRTILNSLVFESAVEADIWLTFVDSLQGLHGTDPYLRIRELGLE
                     DAFEEFSITGLQYQENLRSNTAVTLCPSNAHMNLCDWAANVGRTLARPLDGEQILSLF
                     TKALVSQFSKAPVLASMVVDVFCAEGDLIVSYKRSERSDQIFSLASMFTEHAQYFLEL
                     LEMERNDLVKLYFVLDQKLVYDILNLEGLYQRREDTDWWRARDEAMSFVVIRLLEVLP
                     TQVRTQLTANAEYVVSVSSAQRLSTFCSQGPYAATRLQLSDFDGAARLWEPQWNVVEA
                     LPATKEVHDVSRVCAVYRGNSGVTAFAFIDEHGTVLATTRWVDCALSTVSGRERAVLQ
                     AAQLRKLFTQCRPTVMAIGASSIACLPLLRTLETFLREQVHQSAVVDVPVVWASVEVP
                     RYYSVTTYARLELPQTENIVVTSVALARYVQDPLQVLCSLFEGEQTALQLCRTIRISA
                     SHDRQLYQRLAWEMSLWVAAVGLWVGDIVFRPNTAATLQFVPGLGPAKARVLASAILH
                     SDVPQSRRQVEQLLEPYGAAIVQNAAPVLRVRSPEQCDAELLWHPLDATLIPSQWYAI
                     ACMVAKATASSSTLPAEVLLVGLLGMAQEERRAALYRVDVPSMVAKVKASAAALADVG
                     RREVELVVDELVANGRSFARRPYRRLTNVEFMSCITGITYLSSADINALSKGAGAGSS
                     SGSRGTFVVREGDYVTGTITNVQGGSTPGIRLATSRGVTAFIAAVDICDEAMRVDLLE
                     YIRRSEQLRDWNRHENGDARPPERAEAPVWLRRGALLQGTVSRCVWARCELHLQWCRP
                     REELAGSGDDNGEKETAMPSYGNMERGGASSSVNSLNTAQVEQQVRVFATKMSRHPLF
                     RDVSKNGAADMLRDKEIGESLLRPRTASVHRVVCEVKVGSNATNHWVISEERHANGQF
                     YYKVEDRVVDRQWEFTDVDDFLCNFVEPMVKLIQSIRVHRRFEDSTEYVQAALDAQRE
                     VSGGFAYAFAETESKRHLYQVYSSGGNETYHFPLHITSEFIYIRLPFFHDGKASNKWV
                     PCKSAEKVSETVKNYARAMSKRSVNGELH"
     gene            <1531833..>1533230
                     /locus_tag="LMJF_33_3100"
                     /db_xref="GeneID:5654736"
     mRNA            <1531833..>1533230
                     /locus_tag="LMJF_33_3100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686020.1"
                     /db_xref="GeneID:5654736"
     CDS             1531833..1533230
                     /locus_tag="LMJF_33_3100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686072.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.3100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.3100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654736"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3M6"
                     /translation="MLRRGLLSLVRALSTDASLVSLPPNVQRCEVFRNVVSLDEEELI
                     YAELSRILQREGQTTIWKGSTPEDKVIKHVYLEMFGTEKQFTEVKNWQKREVRHLPGL
                     LWSPTLLRVLSDVAPPLMGAIPDTARVVEHQIPGYEMHVEHPTVGTSFLYLNLLSDTV
                     LDFDDESTGRRGQVLLPSRALLCVSGEARWGFRFGERTEEVHTYVAANGTRRRVETDM
                     RLSVQLWKLNPGLLDGRLLQERLEESMEMAGKRLAEEAAKRVELEKDCKEEATALQPP
                     DVQTPSVTAAIDPKCPLNTFLAAAMENVSGKGVLGGDLAQPGGCLASGQAGAKKTMGD
                     IRQDYGQYKQQFSKVYGILQDLKVMQDSGQPLNDLWLKKKMTESSSVDAEKDREDGFD
                     ASDIEGTWDKVDAKARFYKAKLKSMDYDGTAFLNSRMPDISQDAPLDMRSTIRKMAPH
                     VKDGDKILASLPNSG"
     gene            1534336..1537112
                     /gene="LmjF33.3120"
                     /locus_tag="LMJF_33_3110"
                     /pseudo
                     /db_xref="GeneID:12981205"
     misc_feature    1534336..1537112
                     /gene="LmjF33.3120"
                     /locus_tag="LMJF_33_3110"
                     /pseudo
                     /db_xref="GeneID:12981205"
     gene            <1537886..>1538803
                     /locus_tag="LMJF_33_3130"
                     /db_xref="GeneID:5654739"
     mRNA            <1537886..>1538803
                     /locus_tag="LMJF_33_3130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686023.1"
                     /db_xref="GeneID:5654739"
     CDS             1537886..1538803
                     /locus_tag="LMJF_33_3130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686075.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.3130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.3130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654739"
                     /db_xref="GOA:Q4Q3M3"
                     /db_xref="InterPro:IPR009003"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3M3"
                     /translation="MAEGAAAAAGASALAAASQRRGCCFPILSFLHVPGKMTKPLWLM
                     MGTAFTFRTREMVEAACGQPAAPPSLLLTAKHSFSPWDYTKDASQLKIPKEYQKPRFV
                     IGRVYRTDADGRAVAADAVGLRLLAQHPVHDVALLAVDAASLKLLQCATDDSPAYALD
                     LAHEALPLCKEPYPAASDGLLIGFRGVGRLGELDTLDPSVLQRLPPHEREALLKDLQD
                     VEGKQRRATTTVSVLDARGMCKGVGDLATCYHGMSGGPLVTTTGQCAGVMYGHHPDAP
                     GCIGYTPCVDFAGWLEEEVQRYTKRCDSH"
     gene            <1539340..>1542357
                     /locus_tag="LMJF_33_3140"
                     /db_xref="GeneID:5654740"
     mRNA            <1539340..>1542357
                     /locus_tag="LMJF_33_3140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686024.1"
                     /db_xref="GeneID:5654740"
     CDS             1539340..1542357
                     /locus_tag="LMJF_33_3140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686076.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.3140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.3140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654740"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3M2"
                     /translation="MTWCTAEQVAELISVARLRGDVDQATRKSADLRFLDLCATAVNA
                     GDALIHVATEGSASPALRLNALLAVETLFTDKGWCEGAQFSDRSTVTKRLLHLVATDP
                     SFLPQRNVDAGLLRCLAMIVALEFPTTEWQEWVRQCAVKLAEGDTRSCAALCAVVAES
                     YRNYCLWSFLANDVVGFLLHAQIMTPPLRTTVMRLFLDLMRKRPRPSVERDVPSAKNC
                     LLLSAEVRQLVLAALLERVEELGPLTGSSSDIFVADCTASFAAASRLVTDAESASIVF
                     RCSSFFLVRLQTVAAASGCVVPAELRDFAEQLLECLISTLQLYPDVAGADFTADGLLS
                     CLIYFMTRPDALERGDAAQLSAELLEYFIDDEAVPLGCGSGDAANLAGAVLELYLEHH
                     SAQRPLAVVALNGLLRATPVMDGCLTEAVALALRSVSRVYEASENVVVDALDDAVQAE
                     MLTQVSQLLLRTTDPYAHVMLIDALAHCFYRSQNQSLCTQLVELLQRLYMRRLESRDE
                     CDVCVRYACVYVAGRLVDELRSREWCGQLLSPEWMQLAMQQLCNGDAFGVFSAASTLC
                     TLLCVAPASAAHISRHAAVWEEGLAQLCHHATLRSVAALVTLTLKHLSGLSLAPSALA
                     SLPHNCELVIRSCNVVLGFCRTPSPSRHLVLRSLVDFFAAHTRTLLRGDAPAIAGMSV
                     SEPLSSLAAVLLTEEYALELAQDEPSCRGLATFAAIHCIACGSVQPSSVPAAASALVS
                     VLQYAVQQCFASQTISCVCGHLTCVLLTQPAQLDEAAPRVLHALFRDGVDIGEGRKGA
                     NYGGVAFLVSVLLLRSPHALLQSACVGDASGAVDAAEHLIGLQRAFGWWLSLAPFMDA
                     IQFLYFTAATCRLMDAVVTLPPEVLISLGCLKTCCQYVLPSAHVKKLPSRPLSGGHLL
                     QHLAVAWIDIDRRYSRTSKPQLLEKELHTFLLSLDSLYELLCGQSFSSSTARNLVKAS
                     PSETTAAVLGYMEHLGWANVLGEARQQVLAAPV"
     gene            <1542920..>1543375
                     /locus_tag="LMJF_33_3150"
                     /db_xref="GeneID:5654741"
     mRNA            <1542920..>1543375
                     /locus_tag="LMJF_33_3150"
                     /product="putative 40S ribosomal protein S13"
                     /transcript_id="XM_001686025.1"
                     /db_xref="GeneID:5654741"
     CDS             1542920..1543375
                     /locus_tag="LMJF_33_3150"
                     /codon_start=1
                     /product="putative 40S ribosomal protein S13"
                     /protein_id="XP_001686077.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.3150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.3150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654741"
                     /db_xref="GOA:Q4Q3M1"
                     /db_xref="InterPro:IPR000589"
                     /db_xref="InterPro:IPR009068"
                     /db_xref="InterPro:IPR012606"
                     /db_xref="InterPro:IPR023029"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3M1"
                     /translation="MVRMHGNGRGKASSALPYRRTPPAWLKIASRNVVKMVCKSSRKG
                     MMPSQIGMELRDSMGIAQVKNVTGRKILRILKHNGLAPEIPEDLYFLVKRATQMRKHL
                     ERHTTDRDTKYRLILVESRIHRLARYYKRVKQLPPTWKYESSTASAMVA"
     gene            <1544043..>1545512
                     /locus_tag="LMJF_33_3160"
                     /db_xref="GeneID:5654742"
     mRNA            <1544043..>1545512
                     /locus_tag="LMJF_33_3160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686026.1"
                     /db_xref="GeneID:5654742"
     CDS             1544043..1545512
                     /locus_tag="LMJF_33_3160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686078.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.3160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.3160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654742"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3M0"
                     /translation="MRRSWVARSLRRTALLSSFRVSNSVSEEKAKWEQKKEEAAEKGF
                     ARRDRADDRVLMSQLFEAPESISGGIAVANFPPKQRDTTDFDAYQLSTTDFTSLVTPH
                     GAPSKSGLGAGFGVREDKRLGFLRPRHPLQPYAGSTSIVPKFDENGLPIDETLTPEQV
                     IQKRREYMKSYEGTNMSAREHFLLVDLDFQKDAMLFGNTREEFERNVTKLKNVIIAYN
                     KWEWTDNFYFYTTVLLKLLTVWVLMECLQQFYELRLFASYYDDFVEAMEAEMSALELK
                     RKADLAAAAEELRRHKPDFKSVLEVIARKRVHLADVEARAAEEALRKKEAESEEQASP
                     TAGGLGDLLWEALRVNKGCASIKAEPVAKLSALDIKNPSASHPMDTTFQERHNEQRRK
                     ADEAREMRRLTALSRSSAHDGVWSHVWNRICRVFHAQQRLRREEVVQYSYAGVPTSIP
                     SMRALRRILLPRSEDVVQIVREEMMAYKQEKARRYAHPL"
     gene            <1546158..>1547747
                     /locus_tag="LMJF_33_3170"
                     /db_xref="GeneID:5654743"
     mRNA            <1546158..>1547747
                     /locus_tag="LMJF_33_3170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686027.1"
                     /db_xref="GeneID:5654743"
     CDS             1546158..1547747
                     /locus_tag="LMJF_33_3170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686079.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.3170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.3170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654743"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3L9"
                     /translation="MRGSSGISDGEVLIRLDTSVLESRLNAFTDQWETALKSIRAQAE
                     ACAVDVRSVAADVNAIQSFLLSYHNLNMRTALAAHPTEASDDAAASATQGLLDRFVAA
                     ATESGSTENTLGMVAVARRLLDENAALRVSLDSATAVLSTHTASNADLVHEVEQLRQQ
                     TTQQSALLQNITLWLRMLGLAIDDGAAEASGDGTSLLMSASAESAGDAHSMESVLSRS
                     PLLLSFRQTLLRDLTERLSSVVDQQSKDFHDTVARLEDRLRRGGKGAAYLAGAQSTGV
                     AEDMQETVRSLSKRLSDMDKRVVKRDEFAALMRTKADSLLLPAKADNAALTDLEARLV
                     TRCTELEERCAFADAERSEFRALLRSVIVSQAHPTVAAAPPSLQEASRTNEQVQSEAR
                     ARGTLLGEILPAVRNGSSVAAPAPPFKHKAFLPHSRGASASQQLYRVLGTSHGSGVHG
                     VTLGSTTQTEYAKPLGSVAATQHASLPVKAAPSPKADESVVAIGMTPTQGAYAAFVSE
                     QLTRRQIASLPALPYEKTTSR"
     gene            <1548733..>1550571
                     /locus_tag="LMJF_33_3180"
                     /db_xref="GeneID:5654744"
     mRNA            <1548733..>1550571
                     /locus_tag="LMJF_33_3180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686028.1"
                     /db_xref="GeneID:5654744"
     CDS             1548733..1550571
                     /locus_tag="LMJF_33_3180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686080.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.3180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.3180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654744"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3L8"
                     /translation="MRFATLRVTPLSAVAVFLLVVIGVCFGELAVASSTLTTALSSHV
                     LSLTLSGAGAGSNWPTSTNALSTVTSTVNSTVCSGLSSGVSHCNAFLIRVSETTLGLQ
                     LSIVTSTALAGNSTYYLLSQWVHGNSTTISTTLTRLTSACATALGTSLSSLEVATGAY
                     AVPCRNSDTYSYLPACAPAEVPVTTVYILAPSSDLQVYFSAYLCGLTATETCRKSIVV
                     QFPSETSPYTVVNITGLPKALEAVLAYVADVRAGFAGMPQAVGPAVGSTTAAVTARAV
                     ELRYRGMHAVLFSTNEKTRIYSSTTRMTIECHASFGYWALVFIAILPLCAILFRYVWF
                     RGRQRSKKQERRRVVDDEMRIMQGCTNPADAPGAESGPPPGFDASVTGIGSTTPQWVM
                     NANGNYYDANAADDNAVAQADAATHQMYVTPDTGETHQYVVDGASDAGGAVATAASQP
                     SQQTGNATDDNAIYQTYVNPETGETYQYTTGATAAGQEQGQAAEASVAQGAQNTAAGD
                     SYQTYVDPSTGETYQYTQVDADAGAREYQYVDSVTGETYQYANPNAAGVYEYVDPTTG
                     ETYQYTAEAGENNSTAAGQEHGAAGTGNVYVDPQREEMYEYEAPQK"
     gene            <1551420..>1551731
                     /locus_tag="LMJF_33_3190"
                     /db_xref="GeneID:5654745"
     mRNA            <1551420..>1551731
                     /locus_tag="LMJF_33_3190"
                     /product="small nuclear ribonucleoprotein SmD2"
                     /transcript_id="XM_001686029.1"
                     /db_xref="GeneID:5654745"
     CDS             1551420..1551731
                     /locus_tag="LMJF_33_3190"
                     /codon_start=1
                     /product="small nuclear ribonucleoprotein SmD2"
                     /protein_id="XP_001686081.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.3190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.3190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654745"
                     /db_xref="GOA:Q4Q3L7"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR027248"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3L7"
                     /translation="MDSEQPKKVPRTETKTKELLRTTVADGPFSLLDTAMKEKKRVFI
                     QCRNSKALLAHVIAFDKHFNLVLKGVQEITESHGSEQKQRTIENLFLRGESVIFIVKL
                     P"
     gene            <1552639..>1553643
                     /locus_tag="LMJF_33_3200"
                     /db_xref="GeneID:5654746"
     mRNA            <1552639..>1553643
                     /locus_tag="LMJF_33_3200"
                     /product="putative cation transporter"
                     /transcript_id="XM_001686030.1"
                     /db_xref="GeneID:5654746"
     CDS             1552639..1553643
                     /locus_tag="LMJF_33_3200"
                     /codon_start=1
                     /product="putative cation transporter"
                     /protein_id="XP_001686082.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.3200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.3200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654746"
                     /db_xref="GOA:Q4Q3L6"
                     /db_xref="InterPro:IPR003689"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3L6"
                     /translation="MTHSGTPSPSSCEATENENYSLVWHVFALFVILSCSLLGTVLPI
                     LGKRVAAFRVPEYAYAIGKSVATGVVLGVALIHMLKPANESLTSECMPSALCNLSKSL
                     AYIICIASVAAVHSLEACLRVFFDDFGAVQNPPIANGESQHLLSGSQAGGHHFHPSAS
                     AFDSREGSVDSQILSAVLLEFGVSLHSLFVGLTVGVCADAELYTLMCALSFHQFFEGV
                     ALGSRLVDAALTLRTEYVFAAVFVLSAPLGTAVGIMCVCEHMINTKGSIYLRTQGILD
                     SVCAGILLYIGFQLLVGDFYADMQSTVHNVRSPRGFLLAMLVALWAGVSIMVLIGQHV
                     "
     gene            <1556417..>1559071
                     /locus_tag="LMJF_33_3210"
                     /db_xref="GeneID:5654747"
     mRNA            <1556417..>1559071
                     /locus_tag="LMJF_33_3210"
                     /product="putative beta prime cop protein"
                     /transcript_id="XM_001686031.1"
                     /db_xref="GeneID:5654747"
     CDS             1556417..1559071
                     /locus_tag="LMJF_33_3210"
                     /codon_start=1
                     /product="putative beta prime cop protein"
                     /protein_id="XP_001686083.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.3210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.3210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654747"
                     /db_xref="GOA:Q4Q3L5"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR006692"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR016453"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3L5"
                     /translation="MSAGTAATVEFTASSQRVKMVDMHPKEPIFIAALYSGGINLYNY
                     QTQALVRSFDTGTGLPVRCVRFIPRLQSFVCGCDDMNLRVFNYNTMERTKIFQAHDDY
                     IRCVAVHEQLPLVLTCADDMTIRQWDWSKGWTLQMTYEGHQHFCMAVAFNPKDSSTFA
                     SASMDCSIKVWRIHIPTPNYQLEGHEDGVNCVEFYPRGDKPYLLSGSDDRTVRLWDYQ
                     TKACLQVFSFHDDNVASVLFHPDLPVIYSISESDSIAAFSTETFRLLYSCNHSDMGRG
                     WSLTTKRHSNMLIAGFDNGVRAYKVGVDKPVFSMDANGRVLVATGNEITRMDIKAVGP
                     ETPDGEVLNVATKDMGTVETTARSIVHAGNGQFICVLGDDSYTIISSLSLRPKSYGQC
                     VSFVWGPESGAYAVLEGSTTLKIHKGFKGRAALSLPEAANKLFGGPLLAVRTSSSIMF
                     YDWGTLALIRQIDETPTALEWNSTGELVALVTSSSVFLLKFNADAVAQYLEQNTTTGD
                     DGLDFSFDLVEELDEKVRDVAWVGDCFVYMNQVHRLNYYIGGEINNIAVLSRNQYLLG
                     YLPKENRLFCIDKKKNITSYLLQVNAIEYMAAIVREDFDAANALLPTIDVSLRDKLSR
                     FVESRGLLQMALEIATDDERRFDLAVQLKQLLLAHEIASAANVASHWKQVGDIALEQG
                     YFEMAIESLEKCNDWSGLLLIYTSLNDMEAISRLGDRCLQRGQANLAFTCYHLTQRHA
                     ECVELLQKTGKTGDAAFYARTYYPSLIEDAVAKWRVSVASIPRVSQALASPAAYPNLF
                     PSLRNVDLLPPKGSEADAPLNAQPPPPGASASLHGSCTAPTVADWFQPAAAAPQQLMH
                     PPPLPDNVDSEPSGMQELADEEETWGED"
     gene            <1562693..>1564297
                     /locus_tag="LMJF_33_3220"
                     /db_xref="GeneID:5654748"
     mRNA            <1562693..>1564297
                     /locus_tag="LMJF_33_3220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686032.1"
                     /db_xref="GeneID:5654748"
     CDS             1562693..1564297
                     /locus_tag="LMJF_33_3220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686084.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.3220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.3220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654748"
                     /db_xref="GOA:Q4Q3L4"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3L4"
                     /translation="MFPFGYTISGTQRSALEEAYNRKKEYLNARVTPLYASTNPASLW
                     NAIVKYRLVVENEGGAAADTYDDLLLTYEGYRNMVYDVLFHVTPDEDAAADAQVRDWR
                     RSVYFHHPFLSPATFLAFARSSQGAVPAAPLYAFAAKRLLLFRIRVELELDASAPPPI
                     FVNRAQRAIGGRLPCPPSASSPLSNGLTQEDIEVFISDLVPNLRLVRDMPPWMLPYYL
                     CHASRKFIFMCDTRGVGAIPIDAFMKSEVFSELLRMFESDAQDAVIAYPKGCIVEVPA
                     KFASPAADADDTVAALVLSYEGDGNALSDVYQMQLLDGEVKIQVPREQIYWSIASMDY
                     VPAELLSMDNWFSLALMSRIYEHFTALDADGDGVLTREELSHYSNDSFTQLSIQRVFE
                     CHVSHSGTRHIMDYKTYLNFVIATEHAATRPAMRYIWALLDLDGTKTHIKIATLHCFC
                     KEIASELLANGLMVDISAQSILSEIVDMINPAWHEWVTFEDIERSGQQATVLPVLLSY
                     RNFYAYDCREQTAASANDEYADISEK"
     gene            <1564937..>1565257
                     /locus_tag="LMJF_33_3230"
                     /db_xref="GeneID:5654749"
     mRNA            <1564937..>1565257
                     /locus_tag="LMJF_33_3230"
                     /product="putative 60S ribosomal protein L44"
                     /transcript_id="XM_001686033.1"
                     /db_xref="GeneID:5654749"
     CDS             1564937..1565257
                     /locus_tag="LMJF_33_3230"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L44"
                     /protein_id="XP_001686085.1"
                     /db_xref="GeneID:5654749"
                     /db_xref="GOA:Q4Q3L3"
                     /db_xref="InterPro:IPR000552"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3L3"
                     /translation="MVNYPKKKVMHCGDARCNAHKSFKVVQYKAGKARLFARGKRRYD
                     RKQSGYGGQTKPVFHKKAKTTKKIVLKLQCSGCKSIRQVVLKRTKHFELNDKKKTGNK
                     DPTW"
     gene            <1565849..>1566280
                     /locus_tag="LMJF_33_3240"
                     /db_xref="GeneID:5654750"
     mRNA            <1565849..>1566280
                     /locus_tag="LMJF_33_3240"
                     /product="h1 histone-like protein"
                     /transcript_id="XM_001686034.1"
                     /db_xref="GeneID:5654750"
     CDS             1565849..1566280
                     /locus_tag="LMJF_33_3240"
                     /codon_start=1
                     /product="h1 histone-like protein"
                     /protein_id="XP_001686086.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.3240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.3240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654750"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3L2"
                     /translation="MLRFTHRALARKAAVKAGSRTSAAAGATAALHAAPAAPQNAVSI
                     PPIPGVRSVRAFRTQKMEALQPQPAAATAGRKAFAAKGSKHVKAALKSRPSKKVKLPK
                     KAAAPSRAQQAQQVKHAKQLKAPKSAAKEISKKAKTAKARK"
     gene            <1568218..>1569282
                     /locus_tag="LMJF_33_3250"
                     /db_xref="GeneID:5654751"
     mRNA            <1568218..>1569282
                     /locus_tag="LMJF_33_3250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686035.1"
                     /db_xref="GeneID:5654751"
     CDS             1568218..1569282
                     /locus_tag="LMJF_33_3250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686087.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.3250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.3250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654751"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3L1"
                     /translation="MAQKAAEERKAQAAKSVKAQLVRQPSKVLDKKKQAANEKRFLTT
                     LQQRLERRKARVAALVEKTARMEAAKAKAKAKAEAKMEALAKAEAAAKAEQRFEEAIR
                     RRQEQRAARVKVLVKKRTEVATAEAEAATASQENEFTAELNRLMEERDARVKAIIAEH
                     MNAAEVADSEKKAETPARAPKAAASTSRKSQRNVNASSTTLLETSDDATAPATVPRKA
                     APTEVKAVEAPAKKPTTPRRRGRPASAPPHVPTDVPSAASVEALDEAAAATSAVQEAS
                     AADELLPSPSQSRRLAAADLEELASAHEDFVAHLEKAKERATALPSTRVAPVPSALAS
                     SSAAQRTWVIAENPTGLFRL"
     gene            <1570435..>1573284
                     /locus_tag="LMJF_33_3260"
                     /db_xref="GeneID:5654752"
     mRNA            <1570435..>1573284
                     /locus_tag="LMJF_33_3260"
                     /product="ABC transporter family-like protein"
                     /transcript_id="XM_001686036.1"
                     /db_xref="GeneID:5654752"
     CDS             1570435..1573284
                     /locus_tag="LMJF_33_3260"
                     /codon_start=1
                     /product="ABC transporter family-like protein"
                     /protein_id="XP_001686088.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.3260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.3260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654752"
                     /db_xref="GOA:Q4Q3L0"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3L0"
                     /translation="MRLTDAPWFAIPLATVTAVRVVTAIVNLSNRRELRLRVGSRAAR
                     DAESLIDAVGRLADNTGDGVYPSTEDPTATVIDLNTTHRRIKVSRARLRSLSCGLLPL
                     FDCYAVACRCGTVPDAAKADVWNCLCAVVEAHLQAYVSADALAANVSEAATALAMCEM
                     LLERRYHVTRFLEAPLASSRLLLSTPPRHLLAEAVRKNRDESCTMRSLVLFARLLHNA
                     CTPPAKALLALLAVVNVTYISRLMCTTSSATVPSALRYTIDVLHEGTATGAAQFCTWR
                     RFVRQVATSAPGRMLASATLGAVVSHLFNSAKEAASDAVLRRFHMTLKMDTLLALTRF
                     DFVADAHWPLPGRVYSALGVVTNFSFADVDRLLDVVAERVQRWRTVWRLPVACMVGWL
                     TRQGLDWLQRCWTRACLMTLFLVRYGAGEQGCCTAPRERVGGAECRLSLPLCRAHYGL
                     QVLLLAAVSPSDTASASSAVVQFLAEHIRWPLSPRPCLRATKQVLRAVSTADGAVEVL
                     RVRYNAVRELCASPAEDAQVPASFAATLSLRRASGDGLFLPPSWPSTLTMDFGILGGD
                     VLEDVMNKVFSSSNGIPIMAAVAATEAQSRAQHGTTSLPPEDAVAAVYDVARVVDSGA
                     VFVVPPARPWTLVSSFQFDVQTAQLHYDEHEAYTQSVATLVHVQHTHRPTLDGQPWAH
                     YNTPPSLLCPRNDTSAAWRVTFDHVFFRYPGTERDVLHDITFDVAAGGFLGIVGYSGA
                     GKSTLLLLLSRVYAPTQGHIRINGHPIECIPPRALRRRLGNCWQCDRDTCFLEGISVE
                     RNVAYGNLSAACGGAITAALQQACIDTAVAARPSGSREPLRCSEWSGGEVTRLMLARA
                     FMVPADDAGVYMFDECTNGLDSVTEAKLFPRDLCRRRNATRIMVSHRLASVRVADEIL
                     VLAHGRIVERGTWAQLLRGGDDSFFCTLYRAQAVS"
     gene            <1573770..>1574954
                     /locus_tag="LMJF_33_3270"
                     /db_xref="GeneID:5654753"
     mRNA            <1573770..>1574954
                     /locus_tag="LMJF_33_3270"
                     /product="delta-12 fatty acid desaturase"
                     /transcript_id="XM_001686037.1"
                     /db_xref="GeneID:5654753"
     CDS             1573770..1574954
                     /locus_tag="LMJF_33_3270"
                     /codon_start=1
                     /product="delta-12 fatty acid desaturase"
                     /protein_id="XP_001686089.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.33.3270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.33.3270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654753"
                     /db_xref="GOA:Q4Q3K9"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3K9"
                     /translation="MKSVLKAGLKKDVDVRVPSAELTIKQIQDLIPAKYFERSAVWSM
                     FYVFRDICQLLVVYCIMYRAVMPALAGLESRMYEAAGATWASWSLVSAVKLAVWNVFW
                     FVQGLNGTALWVLAHECGHQAFSPYRSLNNAVGLLLHSSVLVPYHSWRITHGNHHKHT
                     NHLTKDTVFVPRKESKVIDLLEETPLVMVSNMLIMFIFGWPGYLLFNVASQDYGRRTN
                     HFEPSSPLFRKEDAHDIVLSDIGIFAALTVLGLCTYQYGAYNVLCWYVVPYMWVNFWL
                     LYITYLQHTDIRIPHYNHEHWTFVRGALAAVDRDYGFLINNWLHHIHDSHVVHHLFSQ
                     MPFYHAIEVTRHHIKAILGDNYVEDRRPLIDALCTSWKECAYVVPSEGVSVFYGFNKK
                     RA"
CONTIG      join(FR796429.1:1..1583653)
//
DBGET integrated database retrieval system