GenomeNet

Database: RefSeq
Entry: NC_008570
LinkDB: NC_008570
Original site: NC_008570 
LOCUS       NC_008570            4744448 bp    DNA     circular CON 10-MAR-2020
DEFINITION  Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete
            sequence.
ACCESSION   NC_008570
VERSION     NC_008570.1
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02604052
            Assembly: GCF_000014805.1
KEYWORDS    RefSeq.
SOURCE      Aeromonas hydrophila subsp. hydrophila ATCC 7966
  ORGANISM  Aeromonas hydrophila subsp. hydrophila ATCC 7966
            Bacteria; Proteobacteria; Gammaproteobacteria; Aeromonadales;
            Aeromonadaceae; Aeromonas.
REFERENCE   1  (bases 1 to 4744448)
  AUTHORS   Seshadri,R., Joseph,S.W., Chopra,A.K., Sha,J., Shaw,J., Graf,J.,
            Haft,D., Wu,M., Ren,Q., Rosovitz,M.J., Madupu,R., Tallon,L.,
            Kim,M., Jin,S., Vuong,H., Stine,O.C., Ali,A., Horneman,A.J. and
            Heidelberg,J.F.
  TITLE     Genome sequence of Aeromonas hydrophila ATCC 7966T: jack of all
            trades
  JOURNAL   J. Bacteriol. 188 (23), 8272-8282 (2006)
   PUBMED   16980456
REFERENCE   2  (bases 1 to 4744448)
  AUTHORS   Seshadri,R., Joseph,S.W., Chopra,A.K., Shaw,J., Graf,J., Haft,D.,
            Wu,M., Rosovitz,M., Madupu,R., Tallon,L., Kim,M., Jin,S., Vuong,H.,
            Stine,O.C., Ali,A., Horneman,A.J. and Heidelberg,J.F.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-SEP-2006) The Institute for Genomic Research, 9712
            Medical Center Dr., Rockville, MD 20850, USA
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            CP000462.
            The annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (PGAP). Information about PGAP can be found here:
            https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI RefSeq
            Annotation Date                   :: 03/10/2020 09:25:04
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline (PGAP)
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS-2+
            Annotation Software revision      :: 4.11
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
                                                 repeat_region
            Genes (total)                     :: 4,347
            CDSs (total)                      :: 4,185
            Genes (coding)                    :: 4,154
            CDSs (with protein)               :: 4,154
            Genes (RNA)                       :: 162
            rRNAs                             :: 11, 10, 10 (5S, 16S, 23S)
            complete rRNAs                    :: 11, 10, 10 (5S, 16S, 23S)
            tRNAs                             :: 126
            ncRNAs                            :: 5
            Pseudo Genes (total)              :: 31
            CDSs (without protein)            :: 31
            Pseudo Genes (ambiguous residues) :: 0 of 31
            Pseudo Genes (frameshifted)       :: 15 of 31
            Pseudo Genes (incomplete)         :: 18 of 31
            Pseudo Genes (internal stop)      :: 7 of 31
            Pseudo Genes (multiple problems)  :: 8 of 31
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..4744448
                     /organism="Aeromonas hydrophila subsp. hydrophila ATCC
                     7966"
                     /mol_type="genomic DNA"
                     /strain="ATCC 7966"
                     /sub_species="hydrophila"
                     /type_material="type strain of Aeromonas hydrophila"
                     /db_xref="ATCC:7966"
                     /db_xref="taxon:380703"
                     /note="type strain of Aeromonas hydrophila subsp.
                     hydrophila ATCC 7966"
     gene            223..1593
                     /gene="dnaA"
                     /locus_tag="AHA_RS00005"
                     /old_locus_tag="AHA_0001"
                     /db_xref="GeneID:4490513"
     CDS             223..1593
                     /gene="dnaA"
                     /locus_tag="AHA_RS00005"
                     /old_locus_tag="AHA_0001"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005893135.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="WP_005307141.1"
                     /db_xref="GeneID:4490513"
                     /translation="MTASLWQQCLNRLQDELPSAEFSMWIRPLQAELSDNTLTLYAPN
                     RFVLDWVRDKYLIRVNGIINELCGVDGPTLRFDIGNRPHPVAVARAPARGADPVNNSQ
                     KSWESKAEAKPEPNHKSNTNVNYTFENFVEGKSNQLARAAARQVADNPGGAYNPLFLY
                     GGTGLGKTHLLHAVGNAIKERKQDAKVIYMHSERFVQDMVKALQNNAIEEFKRYYRSV
                     DALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFG
                     WGLTVAIEPPELETRVAILMRKADENQIHLPDEVAFFIAKRLRSNVRELEGALNRVIA
                     NANFTGRAINIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKLADLLSKRRSRSV
                     ARPRQLAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLKEESHDIKEDYSNL
                     IRTLSS"
     gene            1677..2780
                     /gene="dnaN"
                     /locus_tag="AHA_RS00010"
                     /old_locus_tag="AHA_0002"
                     /db_xref="GeneID:4490514"
     CDS             1677..2780
                     /gene="dnaN"
                     /locus_tag="AHA_RS00010"
                     /old_locus_tag="AHA_0002"
                     /EC_number="2.7.7.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010672286.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="WP_011704048.1"
                     /db_xref="GeneID:4490514"
                     /translation="MQLEISREALLRPLQLVSGALGGRPTLPILGNVLLDVSNGLLSL
                     TGTDLEVEMIGQVYLNSDSQDGRTTVPARKLLDICRGLPEGADIRLNTEGERLIIRSG
                     RSRFNLSTLPATEYPNIEDWESVLEFDIGQLELKKLIDATQFSMASQDVRYYLNGMLF
                     ESEGHGLRTVATDGHRLATCRREVVTESLPDHQVILPRKGVLELVRLLEAEDKPVRLQ
                     IGRSNLRAALDGFIFTSKLVDGRFPDWRRVIPRNSDKALIAGREDLRQAFARAAILSN
                     EKFRGVRLNLQENLLRITANNPEQEEAEELLDVQYEAGEMEIGFNVSYVLDVLNTLKC
                     DQIRISLSDSISSAIIEDFDSQDAQYVVMPMRI"
     gene            2783..3886
                     /gene="recF"
                     /locus_tag="AHA_RS00015"
                     /old_locus_tag="AHA_0003"
                     /db_xref="GeneID:4490515"
     CDS             2783..3886
                     /gene="recF"
                     /locus_tag="AHA_RS00015"
                     /old_locus_tag="AHA_0003"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017411497.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA replication/repair protein RecF"
                     /protein_id="WP_011704049.1"
                     /db_xref="GeneID:4490515"
                     /translation="MSLVKLQLSDFRNIQQASLALSPGLNILVGCNGSGKTSVLEAIH
                     YLGLGRSFRTHLTGRVIRQGERAFTLFAQCELEGRQVPIGLAKDKSGETQLKIAGAQA
                     QRLAELAELLPVQLIHPDGFNLLTGGPQARRAWLDWGVFHQEPTFFSLWGRVRRLLKQ
                     RNALLRQSSQYRQLAYWDQELVRLGGELAEFRASYCQAITPLIKEMTADFLPEFDISL
                     GFYRGWEKDTPLNALLEAGFERDRALGYTGVGPQKADVRLKANGVPAQDILSRGQLKL
                     LVCAMRLAQGLYLNQHSSRGCIFLIDDFASELDVDKRRLLAARLKQCASQVFITAIDT
                     GQLADMMDANDCKLFHVEQGKISETLEKAESKL"
     gene            3883..6294
                     /gene="gyrB"
                     /locus_tag="AHA_RS00020"
                     /old_locus_tag="AHA_0004"
                     /db_xref="GeneID:4490516"
     CDS             3883..6294
                     /gene="gyrB"
                     /locus_tag="AHA_RS00020"
                     /old_locus_tag="AHA_0004"
                     /EC_number="5.6.2.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704050.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase (ATP-hydrolyzing) subunit B"
                     /protein_id="WP_011704050.1"
                     /db_xref="GeneID:4490516"
                     /translation="MSENTYDSSNIKVLKGLDAVRKRPGMYIGDTDDGSGLHHMVFEV
                     VDNSIDEALAGYCSDIQVKIHSDGSVSVRDNGRGIPVDIHPEEGRSAAEVIMTVLHAG
                     GKFDDNSYKVSGGLHGVGVSVVNALSDKLLLTIRRNGHVYEQTYHLGEPQAPLKQIGD
                     STGTGTEVRFWPSPTIFSDTLFHYEILAKRLRELSFLNSGVSIRLLDERDGREAHFCY
                     EGGIKAFVEYLNQNKTPIHPKVFHFTTEQDGIGVEVAMQWNDAYQEGVYCFTNNIPQR
                     DGGTHLVGFRTALTRTLNSYMDKEDYSKKAKSAASGDDVREGLIAVISVKVPDPKFSS
                     QTKDKLVSSEVKTAVEQAMGEKLADFLLENPGDAKIVVNKIIDAARAREAARKARELT
                     RRKGALDIAGLPGKLADCQEKDPALSELYIVEGDSAGGSAKQGRNRKNQAILPLKGKI
                     LNVEKARFDKMISSQEVGTLITALGCGIGRDEYNPDKLRYHNIIIMTDADVDGAHIRT
                     LLLTFFYRQMPEIIERGYVYIAQPPLYKVKKGKQEQYLKDEDALLQYQTAMALDGATL
                     HVNESAPAIGGEALERLVNQHRSVSHLITRMSRRAPEAVLTQLIYQPELNEALLSSES
                     DLLAWCQSMEAVLNESNHGIQYQMQVRHDEERRLFVPHAVVRQHGVDREYPLSYDFLQ
                     SSEYRQLVSLGKEIANLIEEGGYIKRGEKVKPVASFVEAVEWLMGEGKRGIYIQRYKG
                     LGEMNPDQLWETTMDPEARRMLRVTIDDAVGADQLFSTLMGDAVEPRRDFIETNALRV
                     ANLDV"
     gene            complement(6409..6786)
                     /locus_tag="AHA_RS00025"
                     /old_locus_tag="AHA_0005"
                     /db_xref="GeneID:4490517"
     CDS             complement(6409..6786)
                     /locus_tag="AHA_RS00025"
                     /old_locus_tag="AHA_0005"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017780320.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase"
                     /protein_id="WP_011704051.1"
                     /db_xref="GeneID:4490517"
                     /translation="MLVPQFTILYVANPARSTLFYRELFGRPPVEESPTFAMFVFESG
                     ARLALWSSATVEPAVTQTAGAMELAFALPNDTAVDRQSAEWQARGLTLIQAPTRMEFG
                     YTCMALDPDGHRLRLYCPAPELG"
     gene            complement(6853..7557)
                     /locus_tag="AHA_RS00030"
                     /old_locus_tag="AHA_0006"
                     /db_xref="GeneID:4490518"
     CDS             complement(6853..7557)
                     /locus_tag="AHA_RS00030"
                     /old_locus_tag="AHA_0006"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704052.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YafY family transcriptional regulator"
                     /protein_id="WP_011704052.1"
                     /db_xref="GeneID:4490518"
                     /translation="MSRSERLLALLQLLRGHRYAITGSELASQLGISLRTLYRDIATL
                     QAQGAHIEGEAGIGYVLRPGFMLPPLMFSEEELDALVLGSRWVAAHADHALSTAASSA
                     LAKIEAVLPADYRQQLHANALLIGTSRGDSPVDEAPLRSAIRQQRKVTLNYRDLKEES
                     SERTVWPCALGYFDQVRVLVAWCELRQDFRHFRVDRISAMRLEAEPYPGNRGRLLKEW
                     RASQQIPQPRFIADRN"
     gene            7792..8205
                     /locus_tag="AHA_RS00035"
                     /old_locus_tag="AHA_0007"
                     /db_xref="GeneID:4490519"
     CDS             7792..8205
                     /locus_tag="AHA_RS00035"
                     /old_locus_tag="AHA_0007"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016348872.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Hsp20 family protein"
                     /protein_id="WP_010635612.1"
                     /db_xref="GeneID:4490519"
                     /translation="MRSIDFSPLYRSAIGFDRLANLIESAASNGNAGYPPYNIEQLGD
                     SDYRISMAVAGFTQEELELSFQENLLTVKGNKQADTERNYLYQGIAERGFERRFQLAD
                     YVRVKGADLKNGLLHIDLVREVPEAMKPRKIEING"
     gene            8298..8735
                     /locus_tag="AHA_RS00040"
                     /old_locus_tag="AHA_0008"
                     /db_xref="GeneID:4490520"
     CDS             8298..8735
                     /locus_tag="AHA_RS00040"
                     /old_locus_tag="AHA_0008"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010635613.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Hsp20 family protein"
                     /protein_id="WP_011704053.1"
                     /db_xref="GeneID:4490520"
                     /translation="MRNLDFSHLYSNAVGFERMARELEGLFEQKTAAYPPYNIEKRDQ
                     DGYRITVAVAGFEREELELETENGTLKVKGRKAATDERQFLHQGIAERDFELAFKLSQ
                     HVEVQGAKLEHGLLTIDLARELPEALKPRAIPIGKPEQLALPG"
     gene            complement(8809..10059)
                     /locus_tag="AHA_RS00045"
                     /old_locus_tag="AHA_0009"
                     /db_xref="GeneID:4490521"
     CDS             complement(8809..10059)
                     /locus_tag="AHA_RS00045"
                     /old_locus_tag="AHA_0009"
                     /EC_number="2.6.1.66"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017410494.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="valine--pyruvate transaminase"
                     /protein_id="WP_011704054.1"
                     /db_xref="GeneID:4490521"
                     /translation="MEFSLFGEKFTRHAGITQLMDDLNQGLTNPDAIMLGGGNPAPIP
                     AMLERFQAEAKSLLDNGELVKAMANYDGPQGKDRFTKALAALLSKELGWDISARNIAL
                     TNGSQNAFFYLFNLLAGEFADGRKKKVLFPLAPEYIGYADSALADDYFVAYKPTIEKL
                     ADGQFKYHVDFESLQVGDDIGVICVSRPTNPTGNVLTDEEIEHLDQIARDKGIPLLID
                     NAYGVPFPGIIFSEAKPFWNANTILCMSLSKLGLPGTRCGIVIADEKIIQAITNLSGI
                     INLAPGSLGPAITIPMIESGEIIALSEQVVKPFYRQKAELAVQLLREAIPDPRFHIHK
                     PEGALFLWLWFEGLPIHCQELYERLKAKNLLIVPGHYFFPGIDDPEWRHSQECIRLNY
                     SQSEELVRRGIAILADEINALYAG"
     gene            10343..10576
                     /locus_tag="AHA_RS00050"
                     /old_locus_tag="AHA_0011"
                     /db_xref="GeneID:4490522"
     CDS             10343..10576
                     /locus_tag="AHA_RS00050"
                     /old_locus_tag="AHA_0011"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005307116.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011704055.1"
                     /db_xref="GeneID:4490522"
                     /translation="MKILIATLIASSLSLNVMADEYPRPELDSAKLAQEIAAQQQQAS
                     HAVMEEAIHNLKPLALETLVVEASSADATHPES"
     gene            complement(10506..11330)
                     /locus_tag="AHA_RS00055"
                     /old_locus_tag="AHA_0010"
                     /db_xref="GeneID:4490523"
     CDS             complement(10506..11330)
                     /locus_tag="AHA_RS00055"
                     /old_locus_tag="AHA_0010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017787848.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="WP_011704056.1"
                     /db_xref="GeneID:4490523"
                     /translation="MAFILPDHPFDPDQHDGSAIGIASALGWHDSGRHQHKRHQLLFA
                     QAGCMTIELDDQVCLLPPTRAAWLPAGLPHRVLMRGVVAYRSLYFQPEPGLPTEMAVL
                     AVNPLLREIIERMAIWPWDKPAAEQHCTLALLQEELAQAPRESWQLPLPSDPRLAGWL
                     QEVKRGDTLPDRLNRLAERVGASDKTIGRIFMRETGMSYQAWRQQWRLLRALELLAEA
                     EPISRVAATLEFASDSAFISFFRQHTGQTPLRYLNSRGESHRPSSPPPPGSPAPAA"
     gene            11423..12550
                     /locus_tag="AHA_RS00060"
                     /old_locus_tag="AHA_0012"
                     /db_xref="GeneID:4490524"
     CDS             11423..12550
                     /locus_tag="AHA_RS00060"
                     /old_locus_tag="AHA_0012"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016348877.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug effflux MFS transporter"
                     /protein_id="WP_011704057.1"
                     /db_xref="GeneID:4490524"
                     /translation="MNNKLPPLWLVVGLMMFPQIVETIYSPVLTHIASQFRVSEGQAS
                     QTLSVYFLAFAAGVVCWGRLCDLVGRRPAMLAGLMTYGAGTLLALLATQFETLLLARV
                     IAAFGAAVGSVVTQTMLRDSYQGSELARVFSVMGIALSLSPVLGLVSGGQLASGFGYL
                     GVFSALLVLAVGLLLVTCWQLPETRPAITQRVALWPLAQRMVRDAALWRSAALVALFN
                     TMLFGYYSLAPFLFAGLGLSAGEFGYSGILLALATLGGSLLNKRLLGRGWSPASLIRL
                     AAALALGSGWLVWASQASLWFLLPMMGVVVAFGLAIPNVLSQALLAYREVAGSAGALF
                     GLGYYLLLSLGLAVAASLQDLGLLLGGCGLLALCCGWRRST"
     gene            complement(12555..13238)
                     /locus_tag="AHA_RS00065"
                     /old_locus_tag="AHA_0013"
                     /db_xref="GeneID:4490525"
     CDS             complement(12555..13238)
                     /locus_tag="AHA_RS00065"
                     /old_locus_tag="AHA_0013"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005307112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="WP_011704058.1"
                     /db_xref="GeneID:4490525"
                     /translation="MAHILVIDDEAAIRRFLRISLIAEGHQVSEAVGVNEGLAQYRHL
                     NPDLVILDLGLPDGDGIQVLQAIREHHQHPVLVLSARDSEQEKVRLLDAGANDYMSKP
                     FGIGEMMARIRVLLRQRAGVSSGEQRHFPQCGLTLDSSSHRVTLGEEEVPLSRKEFAL
                     LQALVCHPGKLVLQTQLLNDIWGPSHKEDTHYLRIVIASLRKKLGDNPQQPTLIETES
                     GIGYRFIGS"
     gene            complement(13269..15857)
                     /locus_tag="AHA_RS00070"
                     /old_locus_tag="AHA_0014"
                     /db_xref="GeneID:4490526"
     CDS             complement(13269..15857)
                     /locus_tag="AHA_RS00070"
                     /old_locus_tag="AHA_0014"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017766639.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase KdpD"
                     /protein_id="WP_011704059.1"
                     /db_xref="GeneID:4490526"
                     /translation="MRDEVRADALLASLEQEHRGKLKVFLGAAPGVGKTYAMLQAVRE
                     QAKEGVDILIGVVETHGRQETLALLDKLAIQPRKLHLHRQQRLEEMDLDGLLARKPAI
                     AVVDELAHSNAPGSRHEKRWQDVEELLGAGIDVYTTLNVQHLESLNDLVWQLTGVRVK
                     ETLPDQVLLEADSLVLIDLPPKELLGRLKEGKVYVPHQAKAALQSFFSLNNLTALREL
                     AMQTAASHVEGDLQLQWQAAGKTTLPLRGKLMVCLGDQHGAALVRYGHRFAQRRQLPW
                     LVVHIDSKGQRSVELEQALALASQLGAKVLTLSSPAVADTLLETAEQQQVSQLLLGKP
                     HKAPWRRSLVQHLLKQAQGLEITLVDTEKRKPSLGLKPLHPKDIRQSLLAVAIMGTTS
                     AAVWGLSHWLPPASLPMLFVLGVLATALTTSLMPAILAAVLGFVGHNLLFTAPYFSLS
                     VASHSDLLTLFVLLIVGITAGRLASRQRQQLIGLRETQQLGNALLSLSQGLATASSPE
                     EVLRQGSQAISLALGQPVFALDQHYQHRAGSTQHKPGQTDKAAIDWCLAQKQSAGAHT
                     ATLNAAEAQYHHLSDELVLGIVLANPLASSAEHQLQALLTDIRAALARIDLNERLADS
                     QLQAETDRMRAALLSSVSHDLKTPLATIMGAGSTLLEYGDRISSEDRSELLHSVQDEA
                     RRLHSYVQNLLDMTRIGSPDFQLKRDWVDLADLVENARRRLDSSWRQHKLLVHFDQQI
                     PRLYVHGALIEQVLVNILDNASRYSPAGTPIEFKVMLADPDLILDIIDIGVGIAESDR
                     DKIFNLFYTQPVGDCGSRGTGLGLAISRAMIEAHGGRIWAFSGPNGNGTCMRISLPLA
                     LNAAAA"
     gene            complement(15961..16488)
                     /locus_tag="AHA_RS00075"
                     /old_locus_tag="AHA_0015"
                     /db_xref="GeneID:4490527"
     CDS             complement(15961..16488)
                     /locus_tag="AHA_RS00075"
                     /old_locus_tag="AHA_0015"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005307109.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium-transporting ATPase subunit C"
                     /protein_id="WP_011704060.1"
                     /db_xref="GeneID:4490527"
                     /translation="MIAIRTLLTLTLLLGVAYPLAVTGLAQLLFPWQANGSLLTNAKQ
                     QVVGSALLAQKFERADYFHSRPSASDFATIGGGASNLGMSSPLRAEFAAAAARAQPEA
                     RVPALLTRSASGLDPHLPLAAALAQVERVAGQRGLDPVQLTEQVKSAAQAGILGPQVV
                     NILQLNLQLDHQKGA"
     gene            complement(16549..18606)
                     /gene="kdpB"
                     /locus_tag="AHA_RS00080"
                     /old_locus_tag="AHA_0016"
                     /db_xref="GeneID:4490528"
     CDS             complement(16549..18606)
                     /gene="kdpB"
                     /locus_tag="AHA_RS00080"
                     /old_locus_tag="AHA_0016"
                     /EC_number="7.2.2.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017410501.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium-transporting ATPase subunit KdpB"
                     /protein_id="WP_011704061.1"
                     /db_xref="GeneID:4490528"
                     /translation="MSKSASMSTDTIQVKGKKQKSQILQAMVEALYRFNPRALFGSPI
                     LFTLWLAAVMATLESLLGQPLSGVAPSLAWQLTAWLWLTLWFANFAETLAEGRGKARA
                     DSLKAGMSQLKARRVTSPQDDKGEWVPATSLLKGDLVLVRSGEMIPADGEVVAGIASV
                     NEAAITGESAPVIRESGTDRSGVTGNTTVVSDQIWVHISNNPGESTLDRMIALVEGAK
                     RQKTPNEMALDALLVGLTLIFLLVVATLPWFLDYNGTQVPRLYLLALFITLIPTTIGG
                     LLSAIGIAGMDRLVKLNVIAKSGRAVEAAGDVRTLLLDKTGTITFGNRMADELIPAPG
                     VDPSLLAQAAMLASIGDNTPEGKSILTLAGKSHTRPSQLESDIIIPFSAETRLSGLDR
                     NGHHYRKGAVDAVLRYLSLDRKAVPELILKSVDNIARQGGTPLLVCTHEKLLGVVFLK
                     DIIKPGIKARFQILRHMGIRTVMITGDNPLTAAAIAAEAGVDDFIAEATPEKKLAYIR
                     QEQADGRLVAMCGDGANDAPALAQADVGLAMNEGTQAAKEAGNLVDLDSNPTKLLDVV
                     LVGKQLLVTRGALTTFSIANDVAKYFAILPALFIAAYPQLGVLNLMQLGSPESAILSA
                     IIFNALIIVALVPLALRGVSLQGSAASLLRRNLLIYGVGGLIVPFIGIKLIDLVITGL
                     GLV"
     gene            complement(18662..20344)
                     /gene="kdpA"
                     /locus_tag="AHA_RS00085"
                     /old_locus_tag="AHA_0017"
                     /db_xref="GeneID:4490529"
     CDS             complement(18662..20344)
                     /gene="kdpA"
                     /locus_tag="AHA_RS00085"
                     /old_locus_tag="AHA_0017"
                     /EC_number="7.2.2.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017780328.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium-transporting ATPase subunit KdpA"
                     /protein_id="WP_011704062.1"
                     /db_xref="GeneID:4490529"
                     /translation="MWQEIIYPVAFVLLVLLPAPLLGNYLYRVFEGKSRWLAPLERAT
                     LACCGTDGREQDWKSYALSLLAFNGAGFGLLFLILLAQGLLPLNPQQLPGLNWQLAFN
                     TAVSFMTNTNWQAYSGEASLSYFSQMVGLTTQNFVSAATGAAVAIALFRGIARQQTTH
                     LGNFWQDLVRFCLYVLLPMALILALLLVWQGVPQSLSAYLPFHALEGQEQLLPLGPAA
                     SQIAIKQLGSNGGGFFGINSAHPFENPTALSNWLEMVALLTLAAAMVCTLGRYVKDLA
                     HSRAILIAMTIMLVLGLCLAIGQELQPDPALAHLTSEAGNWEGKESRFGPVLSSIWEV
                     ATTAASNGSVNAMHDSFAPLAGMVAMINMLLGEVVFGGVGAGIYGMMLFVLLTVFLCG
                     LMVGRTPTYLGKRLGITEMKWVVASMLVMPVGVLVIGGITLLMPDSATVIGHDGPHGL
                     SRLIYAYASAAGNNGSAFAGFAAADSWQCIAIGLAMLLGRFGYIIPVLAIAGQLARAP
                     RQERSEGDFPVSGPLFITLLIVTVLLMGGLSFLPVLALGPVAEHLSLLGGAF"
     gene            complement(20671..22020)
                     /gene="gorA"
                     /locus_tag="AHA_RS00090"
                     /old_locus_tag="AHA_0019"
                     /db_xref="GeneID:4490531"
     CDS             complement(20671..22020)
                     /gene="gorA"
                     /locus_tag="AHA_RS00090"
                     /old_locus_tag="AHA_0019"
                     /EC_number="1.8.1.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003861215.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione-disulfide reductase"
                     /protein_id="WP_011704063.1"
                     /db_xref="GeneID:4490531"
                     /translation="MAQHFDYIAIGGGSGGIASANRAAMYGKKVALIEAKELGGTCVN
                     VGCVPKKAMWYAGQIADALKYGADYGFDTTLNHFNWAKLVESRQAYIGRIHQSYQNVL
                     GKNQITVIKGFARFVSSNTIEVNGEQYSADHILIATGGRPEVPAIPGAELGIDSDGFF
                     ELQSQPKRVAVVGAGYIAVEIAGVMQALGSETHLVVRKHAPLRNFDPMIHETLVEIMA
                     QEGPKLHTHAIPKAVVKNADESLTLQLEDGRHLTVDCLIWAIGRVPATDNLNLAAAGI
                     ELDEQGFIPTDKFQNTAVANVYAVGDNTGRIQLTPVAVAAGRRLSERLFNNKPGEHLN
                     YDLVPTVVFSHPPIGTIGLTEPEAIAEYGEGQVKVYRSQFTAMYSALTQHRQPTRMKL
                     VCVGPEEKVVGLHGIGFAMDEILQGFGVAMKMGATKADFDNCVAIHPTSAEEFVTMR"
     gene            complement(22097..24094)
                     /locus_tag="AHA_RS00095"
                     /old_locus_tag="AHA_0020"
                     /db_xref="GeneID:4488982"
     CDS             complement(22097..24094)
                     /locus_tag="AHA_RS00095"
                     /old_locus_tag="AHA_0020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005319489.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PAS domain S-box protein"
                     /protein_id="WP_011704064.1"
                     /db_xref="GeneID:4488982"
                     /translation="MAIYPDRKDAMSGLFSKTAKAVGRNGLSYRLLSYILVCSTVLAM
                     IITVLQLAWDYRKDVAVIEDSIGQIEASFLQPIAASLWNLDEEQVKVQIEGIMNLPNM
                     QFVMVKEMLGNSEVPLLTQGVERESYDISREFNLTYQGEVVGKLFVAASLEQIYQRLI
                     EKSVLIMVSQTIKTLVVSFCILIIIYYLVVRHLNRIANYAQKFNLDRLAIELTLEGRP
                     LPRKKPDELDTLVATLNQMRTRLNDEFAARHQAAEQLQQERDFSATLINSANMVICCM
                     EPDLNIASINPAAILLTGYHQQEILQHNWLDLFVSKAQRDELAATLADHGSIEDKEVI
                     MHDQQGHELVLQWTFAPFYEGPNLKYLIGFGYDITRLKKVEREIIQLNEQLEGKVVER
                     TRSLSDANDQLGKAYDDLKQAQQTLVESEKMASLGSLVAGVAHEINTPIGISVTASSY
                     LQERVADFKQHIDSKQLSRSYLTEFTVNLDESMQLLQGNLRRASELIASFKQVAVDQS
                     SEARYNFSLADNLHQVVVSLGHKLKKAQCEVDIQCDPKLSIFSFPGSFTQIYSNLILN
                     SINHGFDNWDKPKKITIKVEQQGEELLIDYSDNGRGIPPEILPRIFDPFVTSKRGQGG
                     SGLGTHIIYNLVVQLLRGRINCVSEPDNGAQFHIRLPIQHN"
     gene            complement(24187..27267)
                     /locus_tag="AHA_RS00100"
                     /old_locus_tag="AHA_0021"
                     /db_xref="GeneID:4488983"
     CDS             complement(24187..27267)
                     /locus_tag="AHA_RS00100"
                     /old_locus_tag="AHA_0021"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005326341.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug efflux RND transporter permease
                     subunit"
                     /protein_id="WP_011704065.1"
                     /db_xref="GeneID:4488983"
                     /translation="MRFTDIFIKRPILAISISFLIALLGVQAVFKMQVREYPEMTNTV
                     VTVSTSYYGASADLIQGFITQPLEQAIAQADNIDFMTSSTQLGSSTITAYMKLNTNPN
                     AALSDILAKVNSVRSQLPKESEDPSVTMSTGSTTAVLYIGFTSPELNASQITDYLERV
                     IKPQLFTVGGVSKVDMYGGTKYALRVWLDPAKMAAFNLTAADVMSVLNSNNYQSATGQ
                     ATGYFTLYNGNAETQVNTTEELERLVVATRDGKVIRLADIAKVSLEKSHDTYRATANG
                     REAVVLAINAAPTANPINIAHDVLEMLPSLKSNMPSTMEANVLYDSTVAINESISEVI
                     KTIAEAAAIVLVVITLFLGSFRAVIIPIITIPLSLIGVVMVMQMFGFSINLMTLLAMV
                     LAIGLVVDDAIVVLENVDRHVKEGEEPFRAAIIGTREIAVPVIAMTVTLAAVYAPIAL
                     MGGITGSLFKEFALTLAGAVFVSGIIALTLSPMMCAKMLKANEEPGKFESKVHHLLDR
                     MTVRYDAMLHAVMQKRIVVVLFAVIVFASLPMLFKFIPSELAPNEDKGVMAVLGTAPS
                     NVNLDYIQGTMEQVNKVLDEQPEVAFSQVFSGVFNANQAFGIASMVPWSQREASQKEV
                     LERVGKLVENVPGMSITTFQFPELPGASSGLPIQFVITTPNNFESLYQVASEILTAAQ
                     GSGRFVYSELDLQYDSATMKIKIDKDKAGAYGITMQDIGITLGTMMSDGYVNRIDLDG
                     RSYEVIPQVERKYRLNPESIKGYYVRAADGQSIPLGSLISIEVVGEPRALPHFNQLNS
                     ATIGAVLMPGTTMGNAIAWLDATASEKLPQGYRYDYMGEARQFVTEGSALYATFALAL
                     AIIFLVLAIQFESARDPLVIMVSVPLAISGALIALAWGAATMNIYSQVGLITLVGLIT
                     KHGILICEVAKEEQLLHGRNRMEAVMAAAKVRLRPILMTTAAMIAGLIPLLYATGAGA
                     AQRFSIGIVIVAGLAIGTLFTLFVLPVIYTYLASEHKPLPVFDESIPPKAKGSH"
     gene            complement(27283..28389)
                     /locus_tag="AHA_RS00105"
                     /old_locus_tag="AHA_0022"
                     /db_xref="GeneID:4488984"
     CDS             complement(27283..28389)
                     /locus_tag="AHA_RS00105"
                     /old_locus_tag="AHA_0022"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005307097.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="efflux RND transporter periplasmic adaptor
                     subunit"
                     /protein_id="WP_011704066.1"
                     /db_xref="GeneID:4488984"
                     /translation="MKKWMSIMLLIALALFGSVIGFNLFKQKMIANYMANMPEPEFPV
                     TTHKVETRDWVPTIEAIGFIEPNQGVTLSTEQSGTIDSISFESGDTVKPDQLLLSLDA
                     SVEKANLRASMAKLPAAKAKFDRYQNLFTKGSISRDQLDDTEATYRSLEADIESLKST
                     IARREVRAPFAGVVGLRNVFLGQYLQPGTDIVRLEDTSVMRLRFTVPQTDISRIRLNQ
                     DILINVDSYPHRQFKGHISAIEPAVNYQSGLIQVQADIPNNDGQLRSGMFARASILLP
                     AQKDQIVLPQTAITFTLYGENVYLVKEKDGVKRVEQVVVKVSERKGNDAHVVSGIKAG
                     DEVVMSGQVRLSNGAKVKIVQDQGLKVPDQVPML"
     gene            complement(28422..28985)
                     /locus_tag="AHA_RS00110"
                     /old_locus_tag="AHA_0023"
                     /db_xref="GeneID:4488985"
     CDS             complement(28422..28985)
                     /locus_tag="AHA_RS00110"
                     /old_locus_tag="AHA_0023"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005307095.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR/AcrR family transcriptional regulator"
                     /protein_id="WP_016348886.1"
                     /db_xref="GeneID:4488985"
                     /translation="MNKKERIFDAAHEVLGEQGFHGLSIAVVAKKARVAAGTIYRYFS
                     DKDDLIRQLYRHTILQCHPLVMEGVQTEEVSFEQFRRLWLNIHAIFVDEPNALKCKLQ
                     YETSPLGAELEQDPVIKAAWAPLDRFFERGLEQGLFIDLPVRVLQVLSLDCVANMALQ
                     SQVHQFELTQDQLEAVIRACWRAILTP"
     gene            29246..29322
                     /locus_tag="AHA_RS00115"
                     /old_locus_tag="AHA_0024"
                     /db_xref="GeneID:4488986"
     tRNA            29246..29322
                     /locus_tag="AHA_RS00115"
                     /old_locus_tag="AHA_0024"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:29280..29282,aa:Arg,seq:ccg)
                     /db_xref="GeneID:4488986"
     gene            29373..29448
                     /locus_tag="AHA_RS00120"
                     /old_locus_tag="AHA_0025"
                     /db_xref="GeneID:4488987"
     tRNA            29373..29448
                     /locus_tag="AHA_RS00120"
                     /old_locus_tag="AHA_0025"
                     /product="tRNA-His"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:29406..29408,aa:His,seq:gtg)
                     /db_xref="GeneID:4488987"
     gene            29469..29554
                     /locus_tag="AHA_RS00125"
                     /old_locus_tag="AHA_0026"
                     /db_xref="GeneID:4488988"
     tRNA            29469..29554
                     /locus_tag="AHA_RS00125"
                     /old_locus_tag="AHA_0026"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:29503..29505,aa:Leu,seq:cag)
                     /db_xref="GeneID:4488988"
     gene            29628..29704
                     /locus_tag="AHA_RS00130"
                     /old_locus_tag="AHA_0027"
                     /db_xref="GeneID:4488989"
     tRNA            29628..29704
                     /locus_tag="AHA_RS00130"
                     /old_locus_tag="AHA_0027"
                     /product="tRNA-Pro"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:29662..29664,aa:Pro,seq:tgg)
                     /db_xref="GeneID:4488989"
     gene            29890..30399
                     /locus_tag="AHA_RS00135"
                     /old_locus_tag="AHA_0028"
                     /db_xref="GeneID:4488990"
     CDS             29890..30399
                     /locus_tag="AHA_RS00135"
                     /old_locus_tag="AHA_0028"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011898207.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ricin-type beta-trefoil lectin domain protein"
                     /protein_id="WP_115586397.1"
                     /db_xref="GeneID:4488990"
                     /translation="MHPNSFRVSTLALVVVALSGCSYKPKPDEILMGAAPMQSTATSA
                     LVTDAGFCVALNDHNQLITQPCDQTVRQQFSWDAGALQLDQRCLVAKGVSELTMAECQ
                     DESRQWQWQEDRLFNSKADRCLDVAGRRHKPGTPLRLADCFGGANQSFAWQNKSSMFD
                     KLNLKSLIW"
     gene            complement(30404..31483)
                     /gene="pyk"
                     /locus_tag="AHA_RS00140"
                     /old_locus_tag="AHA_0029"
                     /db_xref="GeneID:4488991"
     CDS             complement(30404..31483)
                     /gene="pyk"
                     /locus_tag="AHA_RS00140"
                     /old_locus_tag="AHA_0029"
                     /EC_number="2.7.1.40"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016348888.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate kinase"
                     /protein_id="WP_011704069.1"
                     /db_xref="GeneID:4488991"
                     /translation="MRKTKIIATLGPASSSAAMVEQLIQAGANVFRLNFSHGSPEQHL
                     ALAARIRACAARLDREIGILADLQGPKIRIASFADGCIRLQPGDPFTIDAGLDSHQGD
                     QSRVGTDYPALAGELQTGNVVLLDDGRIQLCVEQVIDERIETRVLVGGTLSSRKGINV
                     LGGGLSAPALTDKDKADILTARLLEADYIAVSFPRSAADLEEARTLIRASGSRAAIVA
                     KVERAEVVASVAAMDELIHAADLIMVARGDLGVEIGDARLPGVQKRLIRRCRALGRPV
                     ITATQMMESMIASPMPTRAEVMDVANAVMDGSDAVMLSAESATGRYPVEAVAAMARIA
                     LAAEQEMEPAGHGLAASHGELARLA"
     gene            complement(31551..32888)
                     /locus_tag="AHA_RS00145"
                     /old_locus_tag="AHA_0030"
                     /db_xref="GeneID:4488992"
     CDS             complement(31551..32888)
                     /locus_tag="AHA_RS00145"
                     /old_locus_tag="AHA_0030"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019839353.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_011704070.1"
                     /db_xref="GeneID:4488992"
                     /translation="MFNFFKTRADLPVMEASPDKIRSIYRKYQWQVFLGLVLGYAMFY
                     VVRMSLNVVKKPMLDSGVVTLEELGVIGSAFLFTYAVGKFSNGFLSDYANIGRFMSVS
                     LGLSSICTILMGMNTATFFLVLMWGLNGWFQSVGSAPSCVSIFQWFSPKQRGSVYSIW
                     GGSRNIGEGISWILTATIVSYFGWKAGFIGAGIASLIAALCMYLVLKDRPQTYALPEP
                     AVAFGETPEIAKKVDPAEIRRAQLFVLKQPAVWLIAAACACMYMSRYAMSSWAVLYLQ
                     EQKGYSLIDAGFAMSAYPIAGFLGAILAGIISDKLFNANRHIPTLLYGLANVAGMCLM
                     FWGPQSRMMDAVALALIGYAIGGLVVFLAGLTACDLMPKTAVGAVKGFIGLCSYIAAS
                     IQELVSAALIKTSEIDGVTHYDFSSAQYFWLGASVVSMLLAMTVWNAKKVVNH"
     gene            33202..34461
                     /locus_tag="AHA_RS00150"
                     /old_locus_tag="AHA_0031"
                     /db_xref="GeneID:4488993"
     CDS             33202..34461
                     /locus_tag="AHA_RS00150"
                     /old_locus_tag="AHA_0031"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005307083.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_164927497.1"
                     /db_xref="GeneID:4488993"
                     /translation="MHLFFRRLALLTGCVLLPFSTLQAASLTVLTSFSEAPVKAVIEG
                     FAEQYPGVRIEVIYRRTIPSLRLLTEAGAPKVDIIMSSSPTFFNTLDKAGLLAALPNE
                     TMPPKWLTPHTLGLGNKVAVVGYSSSGIMYNRHYLAKYQLPLPTTWQQLASPLFMGHV
                     MMSSPSQSGTTHMMVESVLQQYGWQQGWALLMRLGGNLSAITARSFGVSDGISRGLAG
                     AGLVIDSYALNSQARFDHVGFNIMPDSVILPTYLGVARHSTQPASAALFIQYLLSDSG
                     QAIIATPGMAKATLSQPRLARQTRYVTDKALLYRRAGLLKALFEQTITQQRPRLKMTW
                     QGINGLNTHGEPWRVALLEQAVAKASTPPLSEQEAQDPALLALFDGLYDREQGNPQAE
                     RVMHQWRQATEARLHEAQRLVEQAARP"
     gene            34458..36890
                     /locus_tag="AHA_RS00155"
                     /old_locus_tag="AHA_0032"
                     /db_xref="GeneID:4488994"
     CDS             34458..36890
                     /locus_tag="AHA_RS00155"
                     /old_locus_tag="AHA_0032"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019839354.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAMP domain-containing protein"
                     /protein_id="WP_011704072.1"
                     /db_xref="GeneID:4488994"
                     /translation="MSRLGRMLAMPRTLGRRLILAFVTITALTGAMGMAAYVMWDRLG
                     RQIHLIVEESLPAIDGAYQLERASSRLLLLLAQLRDTRDPVQYQRLSNAVSTTLRDIQ
                     RAYLLGTPGDQTPSQRQAFEELGALVADHGRYLKPQIDHAETLQQLQKRSNWLHQDLV
                     DDAAPLLQEVEWHLTSMVASPDDMSEFGNVIKEFSALQDLTFKENELQSLVGEVIAQR
                     YQQDLESAFLFIGYKIDEIDALTSRLAEYPSTVSYRQILQDIITLVKPDGPLHRLLLA
                     DVLTHQQLTALRPRLDDAVSRYHQRVSLMVSDANRSLSALGEDSSQLVATGKLVILVV
                     LALTLLLSIFVLVVLIGRRLIKRLDLLGQELDRVAAGRLDVPVSTCGRDEIGRLGDSL
                     RHFSLQLQQMERANALNLINNTQACLITCHPDGTIESVNPSALTLFQQTGVEPGQPLW
                     QAFPAEAGVVLADQFRAGQPLHRFGHSECTLACGLGEAPRFLHLNLRRFEQGRGYRFI
                     ITITDVTRQELTARELSLRVAERTRELTENNRLLAEEVVQRLQAERTLLQTQDELIQA
                     AKMAVVGQAMTSLAHELNQPLSAMMTYLYTSRTALATGQLQALDQDLGRLDKLGRRMS
                     RIINALRHFARKSPAEEVRVRLALGALAEQAMLLLETRAKRDGCILCNELPDGLWLET
                     DPVLLEQVLVNLLVNGLDAVAGLTRREIRLQLLERSEARLRLAVVDSGAGFSEAILPR
                     LFTPFTTSKEVGLGLGLTICRSLLARCGGEIMLGSALTGGAMVIMEFALADPAGSVAH
                     QNEENAIDAVAR"
     gene            36874..38151
                     /locus_tag="AHA_RS00160"
                     /old_locus_tag="AHA_0033"
                     /db_xref="GeneID:4488995"
     CDS             36874..38151
                     /locus_tag="AHA_RS00160"
                     /old_locus_tag="AHA_0033"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017785122.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-54-dependent Fis family transcriptional
                     regulator"
                     /protein_id="WP_011704073.1"
                     /db_xref="GeneID:4488995"
                     /translation="MLLPANRPANVLLVDDDEDVLESYCHLLRLSGYHPRATTSPHEA
                     LALLADQWPGVLVSDIYMPAMNGMDLLASVQALDAEIPVIMITGHGDIPLAVRAVKQG
                     AFDFLEKPLNPQDLLGLLERACRQRSAVLARRSEIQATVDDELIGSSPQIVTLRSQLN
                     QLAQTDKDLLLEGPAGSGRHTLARLLHRISARREQAFQLHDCVSAPSLAEVQASLAQA
                     GQGTLVLQSPARLSADCQRWLGNHLLDQERKGSKSLRAIGLFDESPEALVERQQLMPE
                     LYYFLSQVRLKLPRLVERSCDIIPLFRAFLRQGCKRIGRPVPAVDRAYLETLKRHQWP
                     GNLRELRNVAELYAVGIVKLAGAEQVIPLASGKEPLDDLVEEFERRVIEDTLFLFSGR
                     VTDAAQYLGIPRKKLYLRMKKHQLDKDRFKPAT"
     gene            38203..38517
                     /locus_tag="AHA_RS00165"
                     /old_locus_tag="AHA_0034"
                     /db_xref="GeneID:4488996"
     CDS             38203..38517
                     /locus_tag="AHA_RS00165"
                     /old_locus_tag="AHA_0034"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016348893.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011704074.1"
                     /db_xref="GeneID:4488996"
                     /translation="MRCPHCMSEGVARIEDERVKRACALGLGAAGGYACAATLARMGA
                     ATGSVLGGVGTVVGALAGALGGAVLGGLMGGGLGWWLGRTLDRRLSRHYRCGVCGHRF
                     SR"
     gene            complement(38565..39377)
                     /locus_tag="AHA_RS00170"
                     /old_locus_tag="AHA_0035"
                     /db_xref="GeneID:4488997"
     CDS             complement(38565..39377)
                     /locus_tag="AHA_RS00170"
                     /old_locus_tag="AHA_0035"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010635634.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Cof-type HAD-IIB family hydrolase"
                     /protein_id="WP_011704075.1"
                     /db_xref="GeneID:4488997"
                     /translation="MYKVVVSDLDGTLLNGQHQISPRTRDTLHRLVDQGIKFVVATGR
                     HHVDVRSIRDTLGLDIYLITSNGAVVHDKQDQLIFNQALPDGVAAELIALERDPSIHI
                     NLYYGDEWLVEEEMPWLLQFHHESGFSYRLTDLASHPLDKVNKVFYIGEHEKLLQIEA
                     ELNQRYGDRLNVTFSLPDCLEVMHAGVHKGNAVRAVLEQHGLEMSQAVAFGDGMNDFE
                     MLSMVGRGVVMGNAHDRLKLALANHEQTLSSDEDGVAVYLEQLFALQGVNVA"
     gene            complement(39471..40511)
                     /locus_tag="AHA_RS00175"
                     /old_locus_tag="AHA_0036"
                     /db_xref="GeneID:4488998"
     CDS             complement(39471..40511)
                     /locus_tag="AHA_RS00175"
                     /old_locus_tag="AHA_0036"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010635635.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta fold hydrolase"
                     /protein_id="WP_011704076.1"
                     /db_xref="GeneID:4488998"
                     /translation="MNLLSPALLALTLFSAGALAVNNPYQLTPEADVATLHQQTLPDF
                     WRQHAVESAFKGKDGITIRYAALRQAKVDRAILIVNGRVESYLKYQELAWDLWRQGYS
                     LYLIDHRGQGLSDRLLADQEKGYVDQFDDYVLDLKQFHDEVIAQDQPAKLFLLAHSMG
                     GAISARYLERWPDDIEAAVLSSPMMGINLGGLPKWLAKGLAATIGTVGGWLGEPPYGP
                     GQGPYESHDFADNGLSHSEARYQAFRELYEQRPQIKLGGATAHWIYQGLTGADAAVAE
                     AGAIKTPLLLLQAGDDGVVDNAAQDAFCALARCEGGKPLRIEGAWHELFMEADPQRQA
                     ALNATLAFFARY"
     gene            complement(40508..41173)
                     /locus_tag="AHA_RS00180"
                     /old_locus_tag="AHA_0037"
                     /db_xref="GeneID:4488999"
     CDS             complement(40508..41173)
                     /locus_tag="AHA_RS00180"
                     /old_locus_tag="AHA_0037"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005307069.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CatB-related O-acetyltransferase"
                     /protein_id="WP_011704077.1"
                     /db_xref="GeneID:4488999"
                     /translation="MENPFGSWLESQVIRDHLTNPNIEAGEYSYYSGYYHGKPFEDHC
                     VRYLLGDGSMRESWDSGQWGKEVDRLIIGKFCSIASGATFMLAGNQGHRLDWVSTFPF
                     DAARFGDGVQDGFLRKGDTRIGNDVWIGSEAMIMPGITIGDGAVIATRAVVTKNVAPY
                     TIVGGNPAQPIRRRFGEEQIAMLQEMQWWDWPLQHLQAAMPLLCSGDIQALYRHWQQE
                     CTS"
     gene            complement(41173..41904)
                     /gene="trmH"
                     /locus_tag="AHA_RS00185"
                     /old_locus_tag="AHA_0038"
                     /db_xref="GeneID:4489000"
     CDS             complement(41173..41904)
                     /gene="trmH"
                     /locus_tag="AHA_RS00185"
                     /old_locus_tag="AHA_0038"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017783514.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (guanosine(18)-2'-O)-methyltransferase
                     TrmH"
                     /protein_id="WP_026080420.1"
                     /db_xref="GeneID:4489000"
                     /translation="MTPERFKRITDMLAQRQLDLTVCMEEVHKPHNLAAIVRTADAIG
                     IHRVHAVWPKTWIHKRKGTARGSQNWVDVKLHPDIGSAVAELKASGMQILATHLSDSS
                     VDFRAIDYTKPTAILVGQEKHGIGEEALALADHHIVIPMVGMVQSLNVSVAAAAILYE
                     AQRQRELAGCYQRGCPLDLEEQNSILFEGGYPIYAQLCKEKEMPYPQLGPAGEILADE
                     QWWQQMQLTRKGWAAQQEEDEWQDQ"
     gene            complement(42129..44246)
                     /gene="spoT"
                     /locus_tag="AHA_RS00190"
                     /old_locus_tag="AHA_0039"
                     /db_xref="GeneID:4489001"
     CDS             complement(42129..44246)
                     /gene="spoT"
                     /locus_tag="AHA_RS00190"
                     /old_locus_tag="AHA_0039"
                     /EC_number="3.1.7.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005897951.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional GTP
                     diphosphokinase/guanosine-3',5'-bis pyrophosphate
                     3'-pyrophosphohydrolase"
                     /protein_id="WP_011704079.1"
                     /db_xref="GeneID:4489001"
                     /translation="MYLFENLKEIASSYLPPEQVEKLRQAYVVARDAHQGQMRSSGEP
                     YITHPVAVARILGDMRLDHETLMAAVLHDVIEDTPVTKADLAELFGDAVAELVAGVSK
                     LDKLKFRDRKEAQAENFRKMVMAMTQDIRVILIKLADRTHNMRTLGSLRPDKRRRIAR
                     ETLEIFAPIANRLGIHTMKNELEELGFEALYPMRSRVLRESVRRARGNRREIIDSIQS
                     EIEGRLREAGIESQVSGREKNLFSIYNKMEKKELQFHEVMDIYAFRVRVKDIDTCYRV
                     LGQMHSLYKPRPGRFKDYIAIPKTNGYQSLHTSLVGPHGVPVEVQIRTEFMDQMADKG
                     VAAHWAYKQDGDSSGTTAQIRAQRWMQSLLELQQSAGSSFEFIEGVKTDLFPDEIYVF
                     TPEGRIMELPAGATPVDFAYTVHTDIGHACVGSRVDRHPYPLSSPLHSGQTVEIITAP
                     GARPNAAWLNFVVTTKARSKIRQFLKNLRTEESVVLGRRLLNHALGAKNIEDIPEPRI
                     KQVLADTKHENLQGLLADVGLGNAMSVMVARRMLGDELPPEEQPKSSSKKMPIKGADG
                     MLVTFANCCRPIPGDAIIAHISPGKGLVIHQEACRNIKGYSKEPDKYLPVQWEVDKEQ
                     EQEFRTGISIEIVNHQGALAELANVIAATGANIHAISTEEKDGRVYLVTLLITTKSRI
                     HLANIMRKIRVMPNVLKVSRQKN"
     gene            complement(44384..44659)
                     /gene="rpoZ"
                     /locus_tag="AHA_RS00195"
                     /old_locus_tag="AHA_0040"
                     /db_xref="GeneID:4490260"
     CDS             complement(44384..44659)
                     /gene="rpoZ"
                     /locus_tag="AHA_RS00195"
                     /old_locus_tag="AHA_0040"
                     /EC_number="2.7.7.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014291110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit omega"
                     /protein_id="WP_005307060.1"
                     /db_xref="GeneID:4490260"
                     /translation="MARVTVEDAVKQVGNRFDLVLVAARRARQIAVQGKDPLVDEEND
                     KPTVIALREIELGLVNNQVMDTQDRYEQQEQEAAELAAVAAIAEGRG"
     gene            complement(44739..45365)
                     /gene="gmk"
                     /locus_tag="AHA_RS00200"
                     /old_locus_tag="AHA_0041"
                     /db_xref="GeneID:4490261"
     CDS             complement(44739..45365)
                     /gene="gmk"
                     /locus_tag="AHA_RS00200"
                     /old_locus_tag="AHA_0041"
                     /EC_number="2.7.4.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017785120.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="guanylate kinase"
                     /protein_id="WP_016348898.1"
                     /db_xref="GeneID:4490261"
                     /translation="MAQQGTLYIISSPSGAGKSSLLNALLTQHNSAGKMQLSVSHTTR
                     ATRPGEEHGVHYHFVKVEEFKALIERGDFLEWAEVFGNYYGTSRAAIEACLAQGIDVF
                     LDIDWQGARQIREQMPTKSIFILPPSREELERRLIGRGQDSAEVIKGRMEKAIAEMVH
                     YDEYDYVIINEDFEQALFQLRAVIECQRLELRQQQQAQQNLLQQLLAE"
     gene            complement(45637..46719)
                     /locus_tag="AHA_RS00205"
                     /old_locus_tag="AHA_0042"
                     /db_xref="GeneID:4490262"
     CDS             complement(45637..46719)
                     /locus_tag="AHA_RS00205"
                     /old_locus_tag="AHA_0042"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704081.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 9 protein"
                     /protein_id="WP_011704081.1"
                     /db_xref="GeneID:4490262"
                     /translation="MPLFQTPPSSICILRLSAIGDCCHALALVRVIQRTWPTTRITWI
                     TGKIEATLFADLPGVEVIAFDKSKGWRGYRDLWQTLRGRQFDALLHLQAAMRASIATL
                     GIRAKVKLGFDRERASDGQWLFTNHKVPSPASPHVLDGFLAFAKELGIQDLTPDWQLP
                     ISAEHQAWAKEKIDGKPTLLICAAASKAFKNWTAAGYAALADHAAGKGFQVYLCGGPA
                     KLERDLAADIQRLSHSKPVDLVGQTNLKQLLALIKEASLVLAPDTGPTHMAALVGTPV
                     LGLYAHHNPDRTGPYLCRDYAVSVYQELVEQETGKPLAELGWRTRLKDPDAMSKITRE
                     RVIAAFDRLCADRQLPAGKQLGISEQ"
     gene            46888..47601
                     /locus_tag="AHA_RS00210"
                     /old_locus_tag="AHA_0043"
                     /db_xref="GeneID:4490263"
     CDS             46888..47601
                     /locus_tag="AHA_RS00210"
                     /old_locus_tag="AHA_0043"
                     /EC_number="2.7.1.166"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005319464.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-D-manno-octulosonic acid kinase"
                     /protein_id="WP_011704082.1"
                     /db_xref="GeneID:4490263"
                     /translation="MQIQTEHNQICWYAEGAFRDPSPELFDPAWWQTHRQVVGSSIGR
                     GVTWFVKDESRHLVLRHYYRGGMVGKVVRDRFWFEGVESSRAMAEYTLLAKLSAQGLP
                     VPRPFAARMAKQGPFYRADILIERIRGAKDLVALLKQGPIAGEVWHKVGQTVRRLHDA
                     GVYHADLNSHNLLLDKEGKVWVIDFDKGAIRSPGNWQQANLERLLRSFNKESQLHTSF
                     HFVPENWQALMNGYQGKAS"
     gene            47672..48535
                     /locus_tag="AHA_RS00215"
                     /old_locus_tag="AHA_0044"
                     /db_xref="GeneID:4490264"
     CDS             47672..48535
                     /locus_tag="AHA_RS00215"
                     /old_locus_tag="AHA_0044"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005307035.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor domain-containing diguanylate cyclase"
                     /protein_id="WP_164927498.1"
                     /db_xref="GeneID:4490264"
                     /translation="MDMLKAPLREAITRFDLALMADAIALLEAGLWSWSPQQGVQRDL
                     SCLRLLGLNEAGLDDLGWLERVHPDDVGNLQEALTACQSGRVAQIRLEYRILHHDGHY
                     VRLEERARRDVHGQVLGVVCLLDSQTLPVEERNGTDPLTGLESRSHFELLLDERLASE
                     SGSFSLLQFSVDHRAKIQQLFGEVACDAMLAKLARIVRHELRREDPFARWDEDGFILM
                     LSQTDRLSGLEIAERLRLEIADASLLPQRPVTVSIGLVQSQAGEQIDHLLARLATCHG
                     QARREHNTVVG"
     gene            complement(48543..49397)
                     /locus_tag="AHA_RS00220"
                     /old_locus_tag="AHA_0045"
                     /db_xref="GeneID:4490265"
     CDS             complement(48543..49397)
                     /locus_tag="AHA_RS00220"
                     /old_locus_tag="AHA_0045"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017785117.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DMT family transporter"
                     /protein_id="WP_011704084.1"
                     /db_xref="GeneID:4490265"
                     /translation="MNYLIGVTLLWSFSFSLIGVYLAGQVDAYFSVLTRIVLASLVFL
                     PFLRRRWLRPDLVAKLMALGATQLGIMYLFYYHSFLLLTVPEVLVFTIFTPIYVTLIH
                     DLLERRFKPTYLWGALLAVLGAAVIRFDGLTESYVLGFLVVQGANICFAIGQVGYKVL
                     LAREKEQPPQLAVFGCFYLGALVVALPAWLLLGTPQYPTSTLQWGILLWLGIGASGLG
                     YFLWNKGATQVSSGVLAIMNNALIPAGLLVNLLLWGKDTDLLRLTLGGLLMLASLWVC
                     QRHGVSER"
     gene            49441..49899
                     /locus_tag="AHA_RS00225"
                     /old_locus_tag="AHA_0046"
                     /db_xref="GeneID:4490266"
     CDS             49441..49899
                     /locus_tag="AHA_RS00225"
                     /old_locus_tag="AHA_0046"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017410513.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011704085.1"
                     /db_xref="GeneID:4490266"
                     /translation="MAEIEALIQRLWRQLPQIGAFAFTASNAEGSATDWCGSGEGEVV
                     VTDHQGGWLFAEQGRYTTPHGRVLAMHNRFWWQRGEQGIRLSHLRYEQPVVLFELLPQ
                     ADGCWLTAEPHLCGQDHYSAELTPSGDGFLLGWQITGPRKNERLSYRYQE"
     gene            complement(50054..50215)
                     /locus_tag="AHA_RS21650"
                     /old_locus_tag="AHA_0047"
                     /db_xref="GeneID:44157216"
     CDS             complement(50054..50215)
                     /locus_tag="AHA_RS21650"
                     /old_locus_tag="AHA_0047"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019839363.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011704086.1"
                     /db_xref="GeneID:44157216"
                     /translation="MSGILTTLCGGLVVIAGWQYRQRLMGLLGLLMVLLPWLFDSKLQ
                     AMLSYALSA"
     gene            complement(50200..51099)
                     /locus_tag="AHA_RS00230"
                     /old_locus_tag="AHA_0048"
                     /db_xref="GeneID:4490268"
     CDS             complement(50200..51099)
                     /locus_tag="AHA_RS00230"
                     /old_locus_tag="AHA_0048"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005907396.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EamA family transporter"
                     /protein_id="WP_164927499.1"
                     /db_xref="GeneID:4490268"
                     /translation="MRSYLLLLAIGLLWGSQFIFMHQAVTELPPIMVAAGRALCGSLT
                     LGLLCLFMRLKSEHTPWRTYMLIALLDATLPFIMVAWGQQYVDSAIAAVVMGCIPFVT
                     ILMAPLLVSGEKITKGGLVSVVIGFVGVLVLFWPKLTSGMNAGLLGAMAILFGASCFA
                     IGLLMIKRFAKDHPVVVARNILISSAIQLLLAAPFVTDLSALTMPSQHAIGAVAVLGV
                     FCTGLVYFLYMALIQKAGPTFASFSNYLVPLFGVMLGALFLGEKIQSTTGVALALILG
                     SVALNQWAQQRRVQREAALCQAS"
     gene            51191..52165
                     /locus_tag="AHA_RS00235"
                     /old_locus_tag="AHA_0050"
                     /db_xref="GeneID:4490269"
     CDS             51191..52165
                     /locus_tag="AHA_RS00235"
                     /old_locus_tag="AHA_0050"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010635646.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_011704088.1"
                     /db_xref="GeneID:4490269"
                     /translation="MELPLSRLDLNLLTVFDMLMQERNVTRAAERLHLSQSTVSHALG
                     RLRTALDDPLFVMSRREMMPTERAKALAGPVRQALAMLEQGLRQAKGFDPASARRIFR
                     IATPGSVEHGLVPALVERLHRHAPHCRLEVCELADSDYERELEKGELDLVIGFADANH
                     LSPRLWREPWFNNPLVCLSPLGSELPDVLGPDDLVSRPHIHTSSWGHSQAMVDLWLAR
                     FGVERELGVRLPSFMAVPPLMATGRYLVVVPEMIGRHFCRYYPLRLHQLDPDIPIVYL
                     MAGHPLTAHDEAIGWFKGLLHRLAFERYGADALGSPAQRGADQFNPAK"
     gene            complement(52144..53157)
                     /gene="trpS"
                     /locus_tag="AHA_RS00240"
                     /old_locus_tag="AHA_0049"
                     /db_xref="GeneID:4490270"
     CDS             complement(52144..53157)
                     /gene="trpS"
                     /locus_tag="AHA_RS00240"
                     /old_locus_tag="AHA_0049"
                     /EC_number="6.1.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005319451.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan--tRNA ligase"
                     /protein_id="WP_011704089.1"
                     /db_xref="GeneID:4490270"
                     /translation="MHNPVILTGDRPTGKLHIGHYVGSLRQRVEAQHHYRQFVMIADL
                     QALTDNGHNPAKVTDHVLEVMADYLAAGLDPTKTTFCLQSALPALAELTTYYLNLVSV
                     ARLERNPTVKAEIQQKGFERSLPAGFLIYPVSQAADITAFRATHVPVGEDQLPMLEQT
                     NEIVRRFNTLVGKEVLTECQPILSDTGRLPGIDGKAKMSKSLGNTIELGMSAEEIKQA
                     VFAMYTDPNHLKVSDPGQVEGNTVFAYLDAFHPDKALVAEMKAHYQRGGLGDMRCKQV
                     LNDCLQTLLAPMRERREAAIADKHQLLRLLQQGTEQARALTDEVLAEVKGAMGLDYFA
                     GLN"
     gene            complement(53349..53783)
                     /locus_tag="AHA_RS00245"
                     /old_locus_tag="AHA_0051"
                     /db_xref="GeneID:4490271"
     CDS             complement(53349..53783)
                     /locus_tag="AHA_RS00245"
                     /old_locus_tag="AHA_0051"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010635648.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein"
                     /protein_id="WP_010635648.1"
                     /db_xref="GeneID:4490271"
                     /translation="MNGTYYKHILAAIDLSEDNRKVIEKAVDRARSNGAKLSVIHVDV
                     DLKDLYTEMIDIDIDNVQDQVIAEAKEKLEAFLASVDYPIEKKLVICGDLSERVNQAV
                     RDYQIDLLVCGHRQSFWSLLTSSARQLMNTVPCDLLVVPLQK"
     gene            54250..55437
                     /locus_tag="AHA_RS00250"
                     /old_locus_tag="AHA_0052"
                     /db_xref="GeneID:4490272"
     CDS             54250..55437
                     /locus_tag="AHA_RS00250"
                     /old_locus_tag="AHA_0052"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005307017.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="trans-2-enoyl-CoA reductase family protein"
                     /protein_id="WP_011704090.1"
                     /db_xref="GeneID:4490272"
                     /translation="MIIHPQIQGCVARNCHPIGCRAAVLQQIASVRAAGSFNGPKRVL
                     VLGASSGFGLASRIALTFGAGADTVGVSFERGPSDKGPGSAGWYNNIWFRKEAEQTGR
                     IAINLIGDAFSIGMRQQAIDTIRQQLGQVDLVIYSLASGIRVLPDGTQVRSVLKTTSQ
                     PFSGWGLDLEHDTLVQQSLDPATPEEIRDTVSVMGGEDWQLWLQALQQADCLAPGAQT
                     VAYSYIGPESTYPLYRDGTIGYAKEHLHATAETINLQLAELGGHAWVSVCKALVTKAS
                     AYIPVLPVYLGLLMGVMKERGVHEGCIEQMQRLFATKMYGPQGVVADGNRLIRMDDHE
                     LDPAIQAAVSALWSKVTPDNFHALGDFAGLRQDFMQLNGFELPGVDYGAPVDLASLTE
                     LLP"
     gene            complement(55453..57243)
                     /locus_tag="AHA_RS00255"
                     /old_locus_tag="AHA_0053"
                     /db_xref="GeneID:4490273"
     CDS             complement(55453..57243)
                     /locus_tag="AHA_RS00255"
                     /old_locus_tag="AHA_0053"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017785112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GGDEF domain-containing protein"
                     /protein_id="WP_011704091.1"
                     /db_xref="GeneID:4490273"
                     /translation="MALALLWMTQLQATPSLLKEAELQAARDPVGYLQRLDANPQQDM
                     EQFYARALAQAALGRYPQALLDNARARGLASAQQETLRLLDFRLQQIALTLDTEAPDQ
                     ALTLLEQLKPAVAGHPQQTSEWHALNGLALYRTQQLSAAIAELKTAFRLKQTIPDSTL
                     ASLQCARLLMTLGNLYADLNLAREAESYYLEALQRMVQLDEPNSQTIIRANMARLYID
                     TDRPAQARRLLDNLLSNPALAPDYRAIILGYQAMALNAERDWAGALRALDEAQALYQQ
                     LGYPEAGVRLLETRARALQGSGEKQLALQLLTSQGPAGAGSKALQASLLADQGRYPEA
                     YQALNEYVNDYKQHFNQTLSQHASAFQAEMDLARSEASNRVLQQENENKRQQLLHQQS
                     ARHYQLALVGLLASALLLLGVTTHRLHRSSRHLYKLATFDQLTELPNRRALLERLATQ
                     WQQEGPLTLLIIDIDHFKQINDRHGHQAGDRAIQRLARELRSWAPDLQLVGRWGGEEF
                     LVAVPLPAADCWYLAEQLRQRIGQIDKPRMTISIGVAGRSAADDGLGQLIHRADMAMY
                     QAKRQGRNQTILAAEPLNPEQPEALASSVA"
     gene            57453..57977
                     /gene="ftnA"
                     /locus_tag="AHA_RS00260"
                     /old_locus_tag="AHA_0054"
                     /db_xref="GeneID:4490274"
     CDS             57453..57977
                     /gene="ftnA"
                     /locus_tag="AHA_RS00260"
                     /old_locus_tag="AHA_0054"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010672333.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="non-heme ferritin"
                     /protein_id="WP_016348910.1"
                     /db_xref="GeneID:4490274"
                     /translation="MLAKAMIEKLNEQINLEFYSSNLYLQMSAWCEDKGFEGAANFLR
                     QHAVEERQHMERLFTYVSETGAMPLLGAIDAPPHEFKSLGDIFRTTLEHEYHITKCIN
                     GLAHVAFTTQDYSTFNFLQWYVAEQHEEEKLFKSIVDRLSLVGEDGKGLYFIDKELAE
                     LAKGAPASIMDGNA"
     gene            58135..59322
                     /locus_tag="AHA_RS00265"
                     /old_locus_tag="AHA_0055"
                     /db_xref="GeneID:4490275"
     CDS             58135..59322
                     /locus_tag="AHA_RS00265"
                     /old_locus_tag="AHA_0055"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704093.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)/FAD-dependent oxidoreductase"
                     /protein_id="WP_011704093.1"
                     /db_xref="GeneID:4490275"
                     /translation="MMKQFDVVVIGAGAAGLMCAAQAGYRGRSVLVLDNAKKPGRKIL
                     ISGGGRCNFTNHQAGPHAFLSANPHFCKSALARYTQQDFIDLVDRHGLRYHEKTLGQL
                     FCDESAKEIVDILLTECDWAGVALQFQTEILTVSKTDDGFMLTTSQGEISCHSLVVAT
                     GGLSMPKLGATPYGFKLAEQFGLKVLPTRAGLVPFTLHQAEKEAFVDLAGVSLPVAVT
                     AEDGTCFKEAMLFTHRGLSGPAILQISSFWLAGEKIHINLLPELDIAATLREWAQAHP
                     AQELKTVLGRELPKRFVDKLVELGQLVSKPMRQYNERELEAVATLLGDWQILPNGTEG
                     YRTAEVTLGGVDTNELSSKTMEARKVAGLYFIGEVVDVTGWLGGYNFQWAWSSGWVAG
                     QYC"
     gene            complement(59510..60730)
                     /locus_tag="AHA_RS00270"
                     /old_locus_tag="AHA_0056"
                     /db_xref="GeneID:4490276"
     CDS             complement(59510..60730)
                     /locus_tag="AHA_RS00270"
                     /old_locus_tag="AHA_0056"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005307004.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_011704094.1"
                     /db_xref="GeneID:4490276"
                     /translation="MEKSLSTDQPLAAATAHDALNRTTYPVIAAISFSHLLNDMMQSV
                     LLAIYPLLKLGLNLSFAQIGLITLTYQFTGSLLQPLIGLYTDRRPMPYSLPFGMGFTM
                     IGLLSLSQAASFGAVLLSAMLIGIGSSVFHPESSRVARMAAGSQPGLAQSLFQIGGNL
                     GSAIGPLLAALIIVPQGQGSAAWFSLFALVGVIVLSLVGRWSSHHAANFHKRMKAHLG
                     HGLSRRQIGWSLATLGLLMFSKFFYMASLSSYYTFYLMDKFSLSLDSAQLYLFAFLFA
                     VAAGTVLGGPIGDRIGRKRVIWISILGVAPFTLLLPHVDLFWTSVLSVIIGLILASAF
                     SAILVYAQELVPGKVGTISGLFFGFAFGMGGIGAALLGQLADATSIETVYQVCAYLPL
                     IGLLTAFLPTLRKG"
     gene            60918..61556
                     /gene="leuE"
                     /locus_tag="AHA_RS00275"
                     /old_locus_tag="AHA_0057"
                     /db_xref="GeneID:4490277"
     CDS             60918..61556
                     /gene="leuE"
                     /locus_tag="AHA_RS00275"
                     /old_locus_tag="AHA_0057"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005326407.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="leucine efflux protein LeuE"
                     /protein_id="WP_011704095.1"
                     /db_xref="GeneID:4490277"
                     /translation="MFESLGVINVWTYLVGLFFIIIAPGPNSIYVLRTGASRGVGPGY
                     QAALGVFVGDAILIFCAYLGIASLIRTTPLLFTLVRYLGALYLLYLGVKILHANFIAR
                     REGQASVVEHGERYFSKALTLSLTNPKAILFYVSFFVQFVDFNYAHTWVSYLVLASML
                     EAMSFVYLTLLIFGGTLMARFFARKVRLARLGNGLIGLFFMGFAARLATLSS"
     gene            complement(61600..62286)
                     /locus_tag="AHA_RS00280"
                     /old_locus_tag="AHA_0058"
                     /db_xref="GeneID:4490278"
     CDS             complement(61600..62286)
                     /locus_tag="AHA_RS00280"
                     /old_locus_tag="AHA_0058"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017410523.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone"
                     /protein_id="WP_164927500.1"
                     /db_xref="GeneID:4490278"
                     /translation="MKNDMHRILWFLLAGTLSSQAMAIDIGAMTIAMAPNEEFIARTV
                     TNNSGSPKVYEVQMEKISNPTATGTSVPTVPGELLFAPKRFTLHAKRMQNVKLYYKGP
                     ADGQERYYRITFTESPAAQLDESGQARRRGALEMKLALQSTLVVRPRQVRFQYQLDPA
                     RSSITNTGNTYFEFMVKRGCLQADSEADSKYLLPGETYQNPTIGQAGNQKLIVYQSRF
                     IRVGKDCWPD"
     gene            complement(62289..63908)
                     /locus_tag="AHA_RS00285"
                     /old_locus_tag="AHA_0059"
                     /db_xref="GeneID:4488596"
     CDS             complement(62289..63908)
                     /locus_tag="AHA_RS00285"
                     /old_locus_tag="AHA_0059"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017410524.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_164927501.1"
                     /db_xref="GeneID:4488596"
                     /translation="MMNPAYKWLLAMVIATSWASQASAAVIKYNLVDADLRHFLFIEN
                     QEDHNLFITPTDYLDPRLTGGNAWTTDSRQVSLAYADNGHNYTVTNYNIDMWENGPVK
                     YPYINQRCIKSWAGCDPQTAEAMNKPASVNETGFFGLMKAATGYAHAKLSSAFFGYLR
                     TMPAGGILNREMNLCMTTRIYDAAAGERCINQDSGTWYVKRTQHKKAGHLRFIQTNAI
                     SEVIVDSNGAPYVLPGSQGCENYRLGTRDGVLCRFLDYDFNQDGSQSFSDPYIYTNIK
                     NAALNSAIVGGDVQMSANLTNWALKGADYNVSYLRGQSSIYLFLSSNFFKQVVRLGLQ
                     EQLTRNLINFNMRNIKAPESGFYEFSGTTEIIIKPRDFSVSILSSEGVSNPYREGNVG
                     KDILSFSYNISDSGPISADMLEITVSQDIGAPYQGLCTFYPAGQAVPEQAVPIPTRLV
                     FDSTNHGTASRHAVRCDQTPLDIRTLGIQDSQPPQEWNDPVSGKSITRFYKLALEFDL
                     TDPMVQRTIGNDLWEGEVQQSGTITIKGTWR"
     gene            complement(63908..66385)
                     /locus_tag="AHA_RS00290"
                     /old_locus_tag="AHA_0060"
                     /db_xref="GeneID:4488597"
     CDS             complement(63908..66385)
                     /locus_tag="AHA_RS00290"
                     /old_locus_tag="AHA_0060"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017410525.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial biogenesis outer membrane usher
                     protein"
                     /protein_id="WP_011704098.1"
                     /db_xref="GeneID:4488597"
                     /translation="MPKSETMVRDMLKKTCLLPLSLLMVVSASANSAAPLKIANVIIP
                     ASFAQALAEGLAVPVRLQYTDEKNRLDTLTDNPIGNATLLLQDGKLHLLHIDFGAGQQ
                     QGLLNDQLTAMLASEEKRTFSAEGSLQIDANASMQLDLVAMLLTIRVSRDAFGQARQP
                     DNRVTLTPTVDTLTGVHRYNLGYSFNSNRQNGHSDSNFLQLDSTVGMGAHHMALDASL
                     YNLGEPEQSGDIYRAMYERDLDDRRIAAGMVSTWDLQTLGVVTGLSTGRIYGASYGNQ
                     AQSRKQKADTSTTPVQVFMPANGEVRVYREDRLISLQNLAIGNQNIDTSAFPSGVYNV
                     TVEVYVDGRLTSTTTQRVTKLGGSLGFTQEWGWQWWGGMMEGAQNNGDSPLLGVSLAR
                     SLDTLELATTTYAFKDAAVGEARANWQATDRVSAQLQTMLASDQSWRFASSLALQAHD
                     NASLWLSQEKLETGSALTVSNAELYSAGITLNLGGWVSGLGQLTFNTLHDRQMNSDRS
                     YADYYQHLYAGKYGNLSLRASLQSDSGTLNGFNNKSITLDYSIPFDNLFSFGMSSNEQ
                     GQTTANVNYQKRMDGVINLASFNASRMMHGSDEHNMALSGTLGFENRVIGGTMTLGRG
                     HGGDMNGNLIARGALVTTEDALVASSRSSSGAGLIINTGIDRQGQMLAKVNGQDYPLH
                     GEQTFLALPPYGEYEIELLNSKRGKDSYDINTGKQRYTLFPGNVATLDASSTIKEMVT
                     VFGILRAEDGSLLANARIDNHIGTTVTNEEGEFSLDVDKANPMLTFRQGNDFCEAELD
                     LEKYSGAAWVGIITCQGLPTYAMVREY"
     gene            complement(66437..67102)
                     /locus_tag="AHA_RS00295"
                     /old_locus_tag="AHA_0061"
                     /db_xref="GeneID:4488598"
     CDS             complement(66437..67102)
                     /locus_tag="AHA_RS00295"
                     /old_locus_tag="AHA_0061"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010635657.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011704099.1"
                     /db_xref="GeneID:4488598"
                     /translation="MNLKMLLAWMLFIPGVSQAINVGSVTTFIDAGSQDVAKEIENGS
                     AQARLVTISVSRISSPEEGGQEIPMEVAGELMLSPSRLMLPAHAKNNVRFFYKGPQDG
                     KERYYRIRWLDTALSMDDQSNNRRQAVATTSAQIGTILVVTPRQQHFAYNLQNGMLSN
                     QGNASYRTVAYGPCLDRKAQAQCKETYYDLPGKQRRFKKVDMQDPQSHLGLWLGQEFV
                     VVK"
     gene            complement(67162..67737)
                     /locus_tag="AHA_RS00300"
                     /old_locus_tag="AHA_0062"
                     /db_xref="GeneID:4488599"
     CDS             complement(67162..67737)
                     /locus_tag="AHA_RS00300"
                     /old_locus_tag="AHA_0062"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000730972.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrillin MatB"
                     /protein_id="WP_011704100.1"
                     /db_xref="GeneID:4488599"
                     /translation="MKKTLIALTVAGLGFAAAAQAAVEATPAIATWKATAKKDTESAL
                     VVTPLDSLSFQYAEGIKGFNTVNGLFDVAIKGDASATDFTLKAKKLSGTLNHLSGGST
                     VDVGVLWQGAPVSTTAYTTLIDTAAGITGGNLSPLASSFKDDTQRSTAQGSFTFNIES
                     ATVNGTEAAFETLPDGLWSGEVNVEFVANWS"
     gene            68337..68960
                     /locus_tag="AHA_RS00305"
                     /old_locus_tag="AHA_0063"
                     /db_xref="GeneID:4488600"
     CDS             68337..68960
                     /locus_tag="AHA_RS00305"
                     /old_locus_tag="AHA_0063"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017410528.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator transcription factor"
                     /protein_id="WP_011704101.1"
                     /db_xref="GeneID:4488600"
                     /translation="MAKILVVDDHPAIRMAVNILLQQDDHHIVAEVDNGVDAVLMARK
                     YQPDMVVLDIGIPRLDGIEVIKRLKEMDADIKVVILSAQATHHIMVRCLQAGANGFIS
                     KLDDLSLLKTVLVKIGKGQLYFPRDVIAGAKNAHEVDRKDLLSALSDREMSVLLQICQ
                     GQTNKQIAESMLLSEKTVSTYKSRLMQKLNVTTMVDLISLAKRQELL"
     gene            68957..72550
                     /locus_tag="AHA_RS00310"
                     /old_locus_tag="AHA_0064"
                     /db_xref="GeneID:4488601"
     CDS             68957..72550
                     /locus_tag="AHA_RS00310"
                     /old_locus_tag="AHA_0064"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017410529.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter substrate-binding domain-containing
                     protein"
                     /protein_id="WP_164927502.1"
                     /db_xref="GeneID:4488601"
                     /translation="MTMRHWFAALLVCCCASWASAHELAAPYLHVYARNDSEYLEKQT
                     LPLHAEDWLWLRNRGRLVLGVPMPDNPPMDITLRANAYEGVTADIVGMLSHLLRVEIV
                     VKNLPSRAAAIAALKRGEVDLLSTSNAYEEEQQLLLTDKYMPDDPAIYKNIHVKERDI
                     RTVAVPEYYLPALDVMRYLPKVQIKMYSSRYSALSAVAYGQVDAVMLDMISGNFIVNK
                     FYQDSIQLLKPLYIDTHGFSFSLERKNQRLKKIINIALDEILEGKREEIAKRWNGGGL
                     SIGASKVELTSEQWAWLGQQKKIRMAVNSGVPPLSFLDINDTLHGVVADLLQVLRAKL
                     GVEIEVVPVKTPGQMLQLLDGGQVDIAVLSPSEERRSRYLFSRAFVLDPLAYVVGVRH
                     EATAPETLLKTGTVAIIKDFISEQAIEEEYGKLTTRKFERIEDALRCVASETCDVTVL
                     PLRVAKYYINSKFPDSLLITGELFDSIPIGAAFAVSPKQHMLRDILDRVIAIIPPDEL
                     EGLSNRWRVSTQQEAITWQELVREFGGIIALIMLLTIWIGLWGLSLHKQVRQRRAAEV
                     ALSAQLKFIEDLVDGTPHPIYARDREDRLVLCNSTYASFFGEDKSRLLGSTMAEDVQR
                     WPFLAPLFEDLSTARTVRCARQGDHRLSMATGSVAVYHWVQPYYDLEGNVQGGIGGWI
                     DVSERLRLLEELALASQDAQEANRAKSTFLATMSHEIRTPMNAIIGLLELTLRRDRLH
                     EEDKTSLSIAHGSAKDLLSLIGDILDISKIESGRLELRPEPHEITALTASVVTVFTAL
                     ARQKNLQLELAAGEPRWVQIDGICYKQILSNLISNAIKYTEQGAVRVELQSKTSDGWC
                     TLQLVIRDTGIGIAPAEQARLFQPFGQARQPEHIQRSGTGLGLMISRSLCESMGGSLL
                     LESEPGHGTCISIEMKVPLASAVESVTPVALGTMTGHHRRLRVMIVDDHPTNRLLVSQ
                     QLAYLGHDATAAESGREALALFANTPFDVMITDFNMPGMSGFELTRQYRALELSRGTH
                     RCLILGLTADARQEQVSEGLTAGMDDCLFKPVGLEELERCLCRHMQHEEQREIERCVQ
                     EIKQCLGPLTGNQPALMLPLLHEFVRASDDDLRGLQQAAEGGELARFLDYVHRLKGGA
                     RIMGAMKLVAVCSETESAGIGPQGLPRALQPLQHAYGIVRQAIMQMQAEPE"
     gene            complement(72586..73026)
                     /locus_tag="AHA_RS00315"
                     /old_locus_tag="AHA_0065"
                     /db_xref="GeneID:4488602"
     CDS             complement(72586..73026)
                     /locus_tag="AHA_RS00315"
                     /old_locus_tag="AHA_0065"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017766465.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011704103.1"
                     /db_xref="GeneID:4488602"
                     /translation="MSQKGVLVALLAGCCAIAAQAGTQTYQLNWPATASKSTGMEISL
                     THPGQQPVNSVSTSSPVQTEAINLSNPDFNTTYQLQARTLYASLPEQAGTDFKLVLNG
                     QPLPQHHALPLTQATRYFLSYLAPAAKPDQTGEAAYELLVYWHG"
     gene            73199..74872
                     /locus_tag="AHA_RS00320"
                     /old_locus_tag="AHA_0066"
                     /db_xref="GeneID:4488603"
     CDS             73199..74872
                     /locus_tag="AHA_RS00320"
                     /old_locus_tag="AHA_0066"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005904980.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_045788751.1"
                     /db_xref="GeneID:4488603"
                     /translation="MLENQMMLLAVFERAALMLMTLFFLTRTRPFQRLFQKRDHTPAE
                     LVLVAAIFCLFAVFSTYTGIPVEGALINVRIIAIISGGILFGPWVGIPAGVISGLHRY
                     LIDMDGHTSIPCLIASIIAGLLATWLHLRCRKSRLWLYGILAGMLCEGLTMLLIWLLT
                     EPHAVGVEIVSHIAYPMIAGALCIGLIIKLVQDLDDEKELIAAKQAKLALDIANKTLP
                     FFQNIDRHSLSQVCGIIRSEISADAVAITDTRDVLAYVGVGKDYYELDEHHAISDMTQ
                     RAVLLDQIIINNDLRQYHLSDFHSVIIIPLRENGSVSGTLKIYYRRTHSITSSLKEMA
                     VGLSQLISTQMEVSRIEQLKEMTRKAEFTALQSKINPHFLFNALNAISSLIRIRPQQA
                     RQLIANLADYLRYNLNKGDTLIDIQEELQQVRDYVAIEQARFGDKLEVVFEVDDVHIQ
                     VPSLLLQPLVENAILHGIQPRSAPGRVTIEVKQLAGGIRVAVRDTGYGISQAVIDGVA
                     AGRVESRSIGLMNVHQRVKLLYGDGLHLKRLEPGTEVSFYLPDQESMPC"
     gene            75002..75733
                     /locus_tag="AHA_RS00325"
                     /old_locus_tag="AHA_0067"
                     /db_xref="GeneID:4488604"
     CDS             75002..75733
                     /locus_tag="AHA_RS00325"
                     /old_locus_tag="AHA_0067"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011898220.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator transcription factor"
                     /protein_id="WP_011704105.1"
                     /db_xref="GeneID:4488604"
                     /translation="MLKAIIVEDEYLAREELAYLVGQHSTIEIVASFEDGLEAFKYLQ
                     DHEVDVVFLDIQIPSIDGLLLAKNLHKSSHPPHIVFVTAYKEFAVEAFELEAFDYILK
                     PYNEPRLISLLQKLELAGKSQTGQGSEPGTPHNRTVNLVKGERIIVTPCEQIYYAEAD
                     EKLTYVYTRDDRYVMTMTLSEFVSRLPAEGFFRCHRSYCVNINKIREIVPWFNSTYLI
                     RLHDLPFEVPVSRSNIKAFRQLMRL"
     gene            75843..77033
                     /locus_tag="AHA_RS00330"
                     /old_locus_tag="AHA_0068"
                     /db_xref="GeneID:4488605"
     CDS             75843..77033
                     /locus_tag="AHA_RS00330"
                     /old_locus_tag="AHA_0068"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005321675.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_016348936.1"
                     /db_xref="GeneID:4488605"
                     /translation="MTKEMNRTRYLTLLGTIITQFALGSVYTWSLFNAQLSDKLDEPV
                     SQVAFAFGLLSLSLAVASSLAGKLQERFGVRNVTLGAGVLLGIGFFLTAHASNLAMLY
                     LCAGILVGFADGTGYLMTLSNCVKWFPERKGLISACSIGAYGLGSLGFKYINLLLLSS
                     NGLETTFQLWGLIAMSMVLVGGMLMKDAPKQAAAVQQSESRDFTLAEAMRKPQYWMLA
                     LMFLTACMSGLYVIGVAKDIGENMVGLPAVVAANAVAIIAMANLGGRLVLGILSDKMS
                     RIRVITIAQLITLAGMALLLFVPLNANLFFVAVACVAFSFGGTITVYPSLVSDFFGLN
                     NLTKNYGVIYLGFGLGSIIGSIVASLFGGFMATFNLILVLLVVALVLSLTIRLPAPVS
                     VERA"
     gene            complement(77107..78231)
                     /locus_tag="AHA_RS00335"
                     /old_locus_tag="AHA_0069"
                     /db_xref="GeneID:4488606"
     CDS             complement(77107..78231)
                     /locus_tag="AHA_RS00335"
                     /old_locus_tag="AHA_0069"
                     /EC_number="6.3.4.18"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010672348.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-(carboxyamino)imidazole ribonucleotide
                     synthase"
                     /protein_id="WP_011704107.1"
                     /db_xref="GeneID:4488606"
                     /translation="MILPPATLGMLGGGQLGRYFVMAAHRLGYKVVVLDPDPASIAGA
                     AADHHIVAAYDDPTALHDLASRCAAVTCEFENVPATALALLEQYQPVRPAAGAVRICQ
                     DRREEKAFLSRAGIPVAPNQTLLPGEPLPALPASLFPAILKTAREGYDGKGQWTIQAA
                     DQLPAALAASGVPCVLEQRLALEGEFSLTLARSPSGAIGALPLVQNWHSGGILDQTRS
                     PANVPALEADARRIAEQLIAALDYVGVLTVELFLVAGKLLVNELAPRPHNSGHPSLDN
                     AECSQFELQVRALCDLPLPSRIAVRPAMLLNLLGDLWQAGTPDWAALLALPGVHLHLY
                     GKGEPRPGRKMGHVTITAADWPTVEETCQRVRQLLGLPPR"
     gene            complement(78228..78737)
                     /gene="purE"
                     /locus_tag="AHA_RS00340"
                     /old_locus_tag="AHA_0070"
                     /db_xref="GeneID:4488607"
     CDS             complement(78228..78737)
                     /gene="purE"
                     /locus_tag="AHA_RS00340"
                     /old_locus_tag="AHA_0070"
                     /EC_number="4.1.1.21"
                     /EC_number="5.4.99.18"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005321668.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-(carboxyamino)imidazole ribonucleotide mutase"
                     /protein_id="WP_011704108.1"
                     /db_xref="GeneID:4488607"
                     /translation="MNTPPLIGLVMGSDSDWPVMQAAARILKEHGVPYEARVVSAHRT
                     PDLLFEYAASARERGLRAIIAGAGGAAHLPGMVAAKTTIPVLGVPIPTRQLKGMDSLL
                     SIVQMPKGVPVATFAIGEAGAANAGLFAVSLLSVAQDGDAPRYQQQLDGFRANERDRV
                     LALTLEDPA"
     gene            complement(78800..79102)
                     /locus_tag="AHA_RS00345"
                     /old_locus_tag="AHA_0071"
                     /db_xref="GeneID:4488608"
     CDS             complement(78800..79102)
                     /locus_tag="AHA_RS00345"
                     /old_locus_tag="AHA_0071"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005306985.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005306985.1"
                     /db_xref="GeneID:4488608"
                     /translation="MQTEIRTLLTVITEANLEPTLLRTLTREGLRGYTITDARGRGDH
                     GERNASWSESGNIRLEAICSREQAERLLAHLQSRYYPDYAMVAFLQPVEIVRPEKF"
     gene            complement(79107..80033)
                     /locus_tag="AHA_RS00350"
                     /old_locus_tag="AHA_0072"
                     /db_xref="GeneID:4488609"
     CDS             complement(79107..80033)
                     /locus_tag="AHA_RS00350"
                     /old_locus_tag="AHA_0072"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005357081.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium-dependent bicarbonate transport family
                     permease"
                     /protein_id="WP_164927503.1"
                     /db_xref="GeneID:4488609"
                     /translation="MLDVVVLFFLFGLLAGLVRSELKLPPALYDTLSLFLLLAIGLKG
                     GVGLAQQSLQPLLPQLALVILLGMLQTLAGFAVLRLKMNRVDAAATAAHYGSVSVATF
                     AVGVNWLTERGISFESQLSIFLAVMEIPAILVGIVLAQGISRQTRWRRLAHETFLGKG
                     VTLLLGGMAIGYLAGPDGIAPLKPLFVDLFKGALALFLLEMGLIVARQCQDLRRHGLF
                     LLGFALLMPLASAGLGLVIGQLVGLSLGGLTLLATLAASASYIAVPATMRIAVPQANP
                     GLSLSAVLGVTFPFNIMLGIPLYHSWARHFTE"
     gene            80145..81047
                     /locus_tag="AHA_RS00355"
                     /old_locus_tag="AHA_0073"
                     /db_xref="GeneID:4488610"
     CDS             80145..81047
                     /locus_tag="AHA_RS00355"
                     /old_locus_tag="AHA_0073"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005306980.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_011704110.1"
                     /db_xref="GeneID:4488610"
                     /translation="MLNYKQLYYFWHVARSGSVTRAAEQLHLTPQTVSGQVAELELSL
                     GVALFNRVGRRLALTTAGRQALEQAGAIFSLGADLEHTLRHASQELTMQVGIADSVPR
                     TLAFELLAPAMALATPLRLVCHEERAEQLFSELASHKLDMVLIDRPLPPDSGVRGYNH
                     ELGRSPLALFASPELAARARQGFPASLEGLPLLIPGEKSATHDSLLAWYRQQGIHPHL
                     VGQFDDSTLMKSFGKAGMGIFPAPLAMADEIARLYGVERIATLAEVTLSYYLVSAGRH
                     LSHPGVQAVMEGAKQRLAALGGNK"
     regulatory      81083..81260
                     /regulatory_class="riboswitch"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00174"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="cobalamin riboswitch; Derived by automated
                     computational analysis using gene prediction method:
                     cmsearch."
                     /bound_moiety="adenosylcobalamin"
                     /db_xref="RFAM:RF00174"
     gene            81312..83147
                     /locus_tag="AHA_RS00360"
                     /old_locus_tag="AHA_0074"
                     /db_xref="GeneID:4488611"
     CDS             81312..83147
                     /locus_tag="AHA_RS00360"
                     /old_locus_tag="AHA_0074"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005321654.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="WP_011704111.1"
                     /db_xref="GeneID:4488611"
                     /translation="MSKKLLAAALLPTAAFAQTTIPVNPTLVITANRVEQPISSVLAP
                     VVVIDRAEIESRQVQSLPALLKTLPGVQITTLGGRGHMSSLFIRGTNSNHSLVLMNGR
                     PIAAMVAGTPDLSQIPLGNIERIEYIRGPRAAVYGSDAIGGVINLITKTSAKNGSETH
                     LKGGVGSNGYGQGQLRTVQALGQQTDMNMMIGYERTDGFDVVANAQQPDRDGFDSLNG
                     QFGLSHAFNDAWSADFNAQGYDNQTEMDDAYQSADQSRVQAFQYDGGLKYQSGALSSR
                     LEASYGENKLKSWLESKGESSAEPIHTGLTRFSWINSWSGVEGLNLTGGADWQQEQLK
                     SDTRSYGQAFNAPDRDNTGLFVVGSYRWQALLWELSGRTDDNKQYGRHNTWSAASGLD
                     LDDNHNVRLSYGTAFKAPTFLDLYYPGYENPALKPEESKNLELGFSGRYTGWDWSLNL
                     YRNQIQNLIACQSASSTCRPDNTDAEIRGVEVALGLETGPLRHDLSFDYTRAEDKNDG
                     DQQLLRRAKQKASWLTQVQLGPVDLSTELLYVGKRDDKNFSSFPAERVELGSYTLINL
                     GASYGVTPQFTLGGRIDNLFDRDYAPAYGYASAGTEFKLTADYRL"
     gene            83265..84059
                     /locus_tag="AHA_RS00365"
                     /old_locus_tag="AHA_0075"
                     /db_xref="GeneID:4488612"
     CDS             83265..84059
                     /locus_tag="AHA_RS00365"
                     /old_locus_tag="AHA_0075"
                     /EC_number="5.1.1.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate racemase"
                     /protein_id="WP_011704112.1"
                     /db_xref="GeneID:4488612"
                     /translation="MANILVFDSGMGGLTIYREIRRALPAHNYFYCFDNANFPYGELS
                     EAALTEVCTRLVSHMVVEHDIDLVVIACNTASTIALPSLRAAMTVPVVGVVPAIKPAA
                     ALTRNGCIGLLATPGTVSREYTHELIAQFAPGKRVLLKGATELVVEAEHKLAGLPVNM
                     ALLREVLADWLEGEEHPDTLVLGCTHFPLLDEEIRQLMPACQLVDSGSAVAKRVAHLL
                     AGLVTTPTRLEDVGGKAYCTRLDAQTQKLTAPLQAWGLSSLEEVRF"
     gene            complement(84078..84569)
                     /locus_tag="AHA_RS00370"
                     /old_locus_tag="AHA_0076"
                     /db_xref="GeneID:4488613"
     CDS             complement(84078..84569)
                     /locus_tag="AHA_RS00370"
                     /old_locus_tag="AHA_0076"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016348943.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding protein"
                     /protein_id="WP_011704113.1"
                     /db_xref="GeneID:4488613"
                     /translation="MNLSKFPVYVQAAILALVLALVGYLVAQALQFSLKAEVIFAVGL
                     AIGGFVVPLFLNRAPAGVAELASSQETCTLYVGNLPYRANEIAVRELFAEQGQVISVR
                     LMKDKATGKRRGFGFVEMPAADAAKAIAALNDKEYQQRTLKVREANDKRDKDEREGSE
                     VDA"
     gene            85173..86723
                     /locus_tag="AHA_RS00375"
                     /old_locus_tag="AHA_0077"
                     /db_xref="GeneID:4488614"
     rRNA            85173..86723
                     /locus_tag="AHA_RS00375"
                     /old_locus_tag="AHA_0077"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:4488614"
     gene            86944..87019
                     /locus_tag="AHA_RS00380"
                     /old_locus_tag="AHA_0078"
                     /db_xref="GeneID:4488615"
     tRNA            86944..87019
                     /locus_tag="AHA_RS00380"
                     /old_locus_tag="AHA_0078"
                     /product="tRNA-Glu"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:86978..86980,aa:Glu,seq:ttc)
                     /db_xref="GeneID:4488615"
     gene            87251..90168
                     /locus_tag="AHA_RS00385"
                     /old_locus_tag="AHA_0079"
                     /db_xref="GeneID:4490974"
     rRNA            87251..90168
                     /locus_tag="AHA_RS00385"
                     /old_locus_tag="AHA_0079"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:4490974"
     gene            90266..90380
                     /gene="rrf"
                     /locus_tag="AHA_RS00390"
                     /old_locus_tag="AHA_0080"
                     /db_xref="GeneID:4490975"
     rRNA            90266..90380
                     /gene="rrf"
                     /locus_tag="AHA_RS00390"
                     /old_locus_tag="AHA_0080"
                     /product="5S ribosomal RNA"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00001"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="RFAM:RF00001"
                     /db_xref="GeneID:4490975"
     gene            90487..90562
                     /locus_tag="AHA_RS00395"
                     /old_locus_tag="AHA_0081"
                     /db_xref="GeneID:4490976"
     tRNA            90487..90562
                     /locus_tag="AHA_RS00395"
                     /old_locus_tag="AHA_0081"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:90520..90522,aa:Thr,seq:ggt)
                     /db_xref="GeneID:4490976"
     gene            complement(90612..90866)
                     /locus_tag="AHA_RS00400"
                     /db_xref="GeneID:44141855"
     CDS             complement(90612..90866)
                     /locus_tag="AHA_RS00400"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010635577.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_016348944.1"
                     /db_xref="GeneID:44141855"
                     /translation="MRLLLLINSNNKRELIGMKAGLTEIGSAGLFHEYLQTLGINKPP
                     LTSIDKQWEYTRNERLVAAIQIEASGQARFYLDARQISVN"
     gene            90960..92225
                     /locus_tag="AHA_RS00405"
                     /old_locus_tag="AHA_0082"
                     /db_xref="GeneID:4490977"
     CDS             90960..92225
                     /locus_tag="AHA_RS00405"
                     /old_locus_tag="AHA_0082"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016348945.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytosine deaminase"
                     /protein_id="WP_011704114.1"
                     /db_xref="GeneID:4490977"
                     /translation="MLIKNLRLVGREGMWQILCQDGLIRAIEPMSTHLLAAHELDGEE
                     GLAIAPFIEPHIHLDTTQTAGEPSWNLSGTLFEGIERWAERKALLTHEDVKQRVIQTL
                     KWQIANGIQFVRTHVDVSDPNLVALKAMLEVREEMKEWVELQIVAFPQEGILSYPNGK
                     ALLEEALKLGADVIGAIPHFEFTREYGVESLHYVFDLAEKYQVLVDVHCDEIDDEQSR
                     FIETLATLAYERGMGHRVTASHTTAMHSYNGAYASRLFRLLKMADINFVANPLVNIHL
                     QGRFDSYPKRRGITRVKEMLEANINVCFGHDDVFDPWYPMGTANLLQVLHMGLHVCQI
                     MGYEQINDSLKLISSHSARTLNVQDRYGIEVGKPANLLILPAENGFDAVRRQVAVRYS
                     IRHGRVIAQTTPSRTSIHLAQVEPVDFRR"
     gene            92313..92690
                     /gene="crcB"
                     /locus_tag="AHA_RS00410"
                     /old_locus_tag="AHA_0083"
                     /db_xref="GeneID:4490978"
     CDS             92313..92690
                     /gene="crcB"
                     /locus_tag="AHA_RS00410"
                     /old_locus_tag="AHA_0083"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016348946.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fluoride efflux transporter CrcB"
                     /protein_id="WP_016348946.1"
                     /db_xref="GeneID:4490978"
                     /translation="MQTWLYVAAGGAIGACLRFGIAELMALLLGRHFPYGTLMVNVVG
                     SFIMGIAFALISHGHVVEHPLKPLLMVGILGALTTFSSFALDTVVLAQQGAYLKAALN
                     IGLNLFLCLAMVVLGMQLVASRV"
     gene            92756..93508
                     /gene="ubiE"
                     /locus_tag="AHA_RS00415"
                     /old_locus_tag="AHA_0084"
                     /db_xref="GeneID:4490979"
     CDS             92756..93508
                     /gene="ubiE"
                     /locus_tag="AHA_RS00415"
                     /old_locus_tag="AHA_0084"
                     /EC_number="2.1.1.163"
                     /EC_number="2.1.1.201"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005307268.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional demethylmenaquinone
                     methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol
                     methylase UbiE"
                     /protein_id="WP_011704116.1"
                     /db_xref="GeneID:4490979"
                     /translation="MSEQTTTTHFGFKTVASTEKETLVAGVFHSVAAKYDLMNDLMSF
                     GIHRLWKRFTIDCSGVRKGQKVLDLAGGTGDLTAKFSRIVGETGQVVLADINDSMLKV
                     GRDKLRNLGVANNVSYVQANAEALPFPDNHFDVITIGFGLRNVTDKDKALASMFRVLK
                     PGGRLLVLEFSKPVSEVIAKLYDLYSFKLLPKMGEIVANDSESYKYLAESIRMHPDQQ
                     TLAGMMENVGFEQVEFYNLTQGVVALHRGYKF"
     gene            93517..94125
                     /locus_tag="AHA_RS00420"
                     /old_locus_tag="AHA_0085"
                     /db_xref="GeneID:4490980"
     CDS             93517..94125
                     /locus_tag="AHA_RS00420"
                     /old_locus_tag="AHA_0085"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017410819.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011704117.1"
                     /db_xref="GeneID:4490980"
                     /translation="MPMDAMVTAVIETSLNQLLRLDKQSPERLRKLTGKVLKLELREL
                     KPLWFVFSERRLDVLAKFEGEADAVLSLSLTALGLLKDPSALTRYIREEKLDLSGDPQ
                     LVQAFSVLLGELNIDWEEELSRYTGDVLAHTLLRGASQARRLLGRELCRSQRQLAEYL
                     TEEIRLAPGPLEVASFNDDVELLAQQMKAVELRLARFEQQVA"
     gene            94125..95765
                     /gene="ubiB"
                     /locus_tag="AHA_RS00425"
                     /old_locus_tag="AHA_0086"
                     /db_xref="GeneID:4490981"
     CDS             94125..95765
                     /gene="ubiB"
                     /locus_tag="AHA_RS00425"
                     /old_locus_tag="AHA_0086"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010672357.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ubiquinone biosynthesis regulatory protein
                     kinase UbiB"
                     /protein_id="WP_011704118.1"
                     /db_xref="GeneID:4490981"
                     /translation="MTPKEFKRLYRIISILLEQGIDELVPARYQPWPGRLARRSLFWL
                     KNKRQGLNRGARIRLAFEALGPIFIKFGQMLSTRRDLLPPDIAEELALLQDRVPPFCG
                     QAARRQIEASLGCTIETLFDDFDETPLASASIAQVHTARLKENGREIVIKVIRPDIEP
                     VIEADLRLMQALARLVARFVPQSGRLRPIEVVEEYRKTILDELNLMREAANAIQLRRN
                     FTGSEALYVPEVFTEHCREQVLVMERIYGIPVSDIAALEANGTNMKLLAERGVEVFFT
                     QVFRDSFFHADMHPGNIFVSYEHPENPLWIGIDCGIVGTLNREDKRYLAENFLAFFNR
                     DYRRVAELHVESGWVPPDTKVDEFEFAIRTVLEPIFEKPLSEISFGHVLLNLFNTARR
                     FNMQVQPQLVLLQKTLLYVEGLGRQLYPQLDLWQTAKPYLENWMYQQVGPKAVWNAIK
                     EKAPFWAEKLPELPELVYETLRQTRHQQRHFDQMFADFRRHSRRQGQARYLLGVGASL
                     LLAGVFLLTQKQHIEWGQISLAGAGLCWLLGWLRTRSH"
     gene            95806..96054
                     /gene="tatA"
                     /locus_tag="AHA_RS00430"
                     /old_locus_tag="AHA_0087"
                     /db_xref="GeneID:4490982"
     CDS             95806..96054
                     /gene="tatA"
                     /locus_tag="AHA_RS00430"
                     /old_locus_tag="AHA_0087"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005900501.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="twin-arginine translocase subunit TatA"
                     /protein_id="WP_011704119.1"
                     /db_xref="GeneID:4490982"
                     /translation="MGGISIWQLLIIAVIVVLLFGTKKLRGIGGDLGAAVKGFKKALS
                     DEPETKSEQKDAEFPPKQLNEAAGQPSDAAKQKDKDQA"
     gene            96058..96501
                     /gene="tatB"
                     /locus_tag="AHA_RS00435"
                     /old_locus_tag="AHA_0088"
                     /db_xref="GeneID:4490983"
     CDS             96058..96501
                     /gene="tatB"
                     /locus_tag="AHA_RS00435"
                     /old_locus_tag="AHA_0088"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017783283.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Sec-independent protein translocase subunit
                     TatB"
                     /protein_id="WP_011704120.1"
                     /db_xref="GeneID:4490983"
                     /translation="MFDIGFWELVVIGVVALVVLGPERLPVAIRTASHWIRLIRSTAN
                     SVKAELEQELKLQDLHNDLKKAEQLQMNNLSPELQESIEQLKTAAQSVTRPYEQQNTI
                     QPASAVAEVKEEPVAPISVATPDEEPTVIPAARAQPSAEQGEVKP"
     gene            96498..97253
                     /gene="tatC"
                     /locus_tag="AHA_RS00440"
                     /old_locus_tag="AHA_0089"
                     /db_xref="GeneID:4490984"
     CDS             96498..97253
                     /gene="tatC"
                     /locus_tag="AHA_RS00440"
                     /old_locus_tag="AHA_0089"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019839946.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="twin-arginine translocase subunit TatC"
                     /protein_id="WP_011704121.1"
                     /db_xref="GeneID:4490984"
                     /translation="MSQAEQPLISHLVELRTRLLRSISAILLVFIALIYFSNNIYDFV
                     AQPLLSQLPEGTSMIATDVATPFLTPIKLTLVVSFFVAIPYLLYQAWAFIAPGLYQHE
                     RRLIMPLVASSAVLFYAGMAFAYYVVFPLVFGFFTSTAPAGVTVATDIASYLDFVLTL
                     FFAFGVAFEIPVATILLCWTGVTSPKSLREKRPYVIVGVFVVGMLLTPPDVFSQTLLA
                     IPMWGLWEIGLFFARFYVKEESEEKQEQTEEGS"
     gene            97365..98150
                     /locus_tag="AHA_RS00445"
                     /old_locus_tag="AHA_0090"
                     /db_xref="GeneID:4490985"
     CDS             97365..98150
                     /locus_tag="AHA_RS00445"
                     /old_locus_tag="AHA_0090"
                     /EC_number="3.1.21.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017411798.1"
                     /note="magnesium dependent; involved in quality control of
                     mutated Tat exported substrates; not involved in the
                     Sec-independent protein export system; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNase TatD"
                     /protein_id="WP_011704122.1"
                     /db_xref="GeneID:4490985"
                     /translation="MIDIGVNLTSSQFADEQADLVARARAVGVEALILTGTDLVGSRE
                     SATLAARWPGYCFSTAGVHPHDAKSVDEATLPALRELAALPQVVAIGECGLDYNRDFS
                     PRPVQDAVFDAQLALAAELGMPVFLHCRDAHARFIEILRPWLPKLPGAVLHCFTGSDE
                     ELDQCLALGLHIGVTGWLCDERRGQLLREQVARIPAGRLMIETDAPYLVPRDLKPRPK
                     RNEPAFLPHIAQVVAACRGEAPEALLAHTRATSAAFFQLPLQE"
     gene            98154..99173
                     /gene="hemB"
                     /locus_tag="AHA_RS00450"
                     /old_locus_tag="AHA_0091"
                     /db_xref="GeneID:4490986"
     CDS             98154..99173
                     /gene="hemB"
                     /locus_tag="AHA_RS00450"
                     /old_locus_tag="AHA_0091"
                     /EC_number="4.2.1.24"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704123.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porphobilinogen synthase"
                     /protein_id="WP_011704123.1"
                     /db_xref="GeneID:4490986"
                     /translation="MATTLPGAFPGRRLRRVRKHDFSRRLVRENVLTANDLIYPVFVL
                     EGENRREAVTSMPGVDRLSIDLLLKEAAELVALGVPAIALFPVTPLEQKSLLAEEAYN
                     PDGLAQRATRALKVSFPELGVITDVALDPFTTHGQDGIIDDEGYVLNDITTEILVKQA
                     LSHAAAGVDIVAPSDMMDGRIGAIRAALEENGFINTQIMAYSAKYASCYYGPFRDAVG
                     SAGNLGKSNKATYQMDPANSNEALHEVALDIKEGADSVMVKPGMPYLDVIRQVKDQFG
                     VPTFAYQVSGEYAMHMAAIQNGWLKEKESIMESLLCFKRAGADGILTYFAKRAAQWLQ
                     EDARR"
     gene            99396..101438
                     /gene="prlC"
                     /locus_tag="AHA_RS00455"
                     /old_locus_tag="AHA_0092"
                     /db_xref="GeneID:4490987"
     CDS             99396..101438
                     /gene="prlC"
                     /locus_tag="AHA_RS00455"
                     /old_locus_tag="AHA_0092"
                     /EC_number="3.4.24.70"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019446320.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptidase A"
                     /protein_id="WP_011704124.1"
                     /db_xref="GeneID:4490987"
                     /translation="MNNPLLTMDSLPPFSQIQPDQVQPAVTQAIADCKQKISDVLAQR
                     DPHTWDSLIAPLEEVNDRLARIWSPVSHLNSVLNSEALRAAHDACLPLLSEFQTYVGQ
                     HEGLYQAYRELAESDDFPLLSGAQRKEIQNTLRDFRLSGIGLPAEAQQRYGEIQARLS
                     ELASRFSNNVLDATQGWNKLVTDEAELAGLPQSAQAAARQLAELKGKEGWLFTLDIPS
                     YLPVMMYADNRALRAELYEAFTTRASDQGPNAGKWDNSAIMTELLALRRELAQLLGFA
                     NYAELSLATKMADKPEQVVNFLTDLAAKSLPQGKAELEEIRAFAAEQHGQGELAAWDL
                     AYYAEKLKQHKFSISDEQLRPYFPASKVVKGLFEVVKRVFGMKVRERLGIDTWHPDVR
                     FYDIFDAEDELRGSFYLDLYAREHKQGGAWMDVCLGRRYRQDGSLQKPVAYLTCNFNG
                     PVDGKPALFTHNEVVTLFHEFGHGIHHMLTRIDVAGVAGINGVAWDAVELPSQFLENW
                     CWESEALAFISGHHETGEPLPADLLEKMLTARNFQAAMQMLRQLEFALFDFRLHQEFD
                     PASTDQIPALLDEVRSQVAVMTPPAFNRFQHSFSHIFAGGYAAGYYSYKWAEVLSADA
                     FSRFEEEGIFNPATGQSFLKNILEKGGSKEPMELFRAFRGREPQVDALLRHSGIAA"
     gene            101643..104186
                     /locus_tag="AHA_RS00460"
                     /old_locus_tag="AHA_0093"
                     /db_xref="GeneID:4490988"
     CDS             101643..104186
                     /locus_tag="AHA_RS00460"
                     /old_locus_tag="AHA_0093"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005307287.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EAL domain-containing protein"
                     /protein_id="WP_011704125.1"
                     /db_xref="GeneID:4490988"
                     /translation="MRRALESVYQIISSLSHSSGQGYFDTFVSEIAAAVGADFVLISG
                     RDQAGLSFKVHAAHPASLDITNFSFPVSATLREITLQEGETWFSDRVQQLFPHAAVLQ
                     AWHIQAYAGIALKSAQGETVGICSVLFKRPLTNMDKVMGLLRLLAPLAGRELALMLQQ
                     PAPPQPEYHDFLHTMMSHAPVGIGKLDLNGKILWTNPAIEKMLGYSQSELLHRTAAEL
                     NHPEDWLRSAACYEELKRGERTAFTQEKRYLHRDGQVLWGRVTVTLVRDDQLQPDYLM
                     VVLENIDPLKRHAEQLKLSHRVYDNLSEAILVCDADSRIISVNPAFEQITGYSEEEVC
                     GQRPSMLKSGLHDQAFYADMYHALERVGVWRGEVWNKRKNGKLYPQQLMISTLREGGR
                     ISQYIAIFSDLSQTKLAEQKIAAQANYDNLTGLPNRWLFGRCLSRFCERGERFALMVL
                     DLNNFKAVNNSMDHHAGDALLREVSDRLVSRVRTEDLVARIGGDEFAFLVPGIVNRRQ
                     AEVFAKQVIGGFARPFMLANQHLYVTATIGITLCPGDGLESDELLRNAEQALFAAKRQ
                     GRLLGSYCASMREEVRQRHQMQQDLAEAIKLEQLTMAYQPIWDNRSGRVAKLEALVRW
                     YHPHWGQVSPADFIPLAEEAGLIQGLGALVLWQSCRDLARLQQSGFPDLQMSINRSTL
                     EFQTIDPEASEWLKVIHHFGLDPADIVIEITESLLMETSDQHRVRIDALREAGCKLAI
                     DDFGTGYSALNYLRNFPVDLVKIDRAFVRHIPFNEQDRLLLDGIINIVHNLGMQVVIE
                     GVETREQLNFLCQKGCAFTQGYLLSRPLAYDDLTEYLQLNDKSMFLQTS"
     gene            104281..105027
                     /locus_tag="AHA_RS00465"
                     /old_locus_tag="AHA_0094"
                     /db_xref="GeneID:4490989"
     CDS             104281..105027
                     /locus_tag="AHA_RS00465"
                     /old_locus_tag="AHA_0094"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005307291.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class I SAM-dependent methyltransferase"
                     /protein_id="WP_011704126.1"
                     /db_xref="GeneID:4490989"
                     /translation="MQILLEDPAKAPQAEALASQLGQTDLPQFALVFTAARLELRKLD
                     EPKLGAVYVDFVEGAVAHRRKFGGGRGQSIAKAVGLKAGAMPRVVDATAGLGRDAFVL
                     ASLGCKVTMIERSPVVAALLQDGLARAALDPEIGPWVRERMQLRHGPAVETLLGLTER
                     PDVIYLDPMFPHKQKSALVKKEMRVFQSLVGPDLDADALLPAALAMADKRVVVKRPDY
                     AGWLNEHKPSMAIETKSNRFDVYVMAALAG"
     gene            complement(105087..105356)
                     /locus_tag="AHA_RS00470"
                     /db_xref="GeneID:44141856"
     CDS             complement(105087..105356)
                     /locus_tag="AHA_RS00470"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017784655.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="modulator protein"
                     /protein_id="WP_077392356.1"
                     /db_xref="GeneID:44141856"
                     /translation="MSTYQPISCDLYDWLEIAASWQLPVTLTGRDGRQWEDKIRTIEA
                     RAGVEYLLLQGGERLSLAELATMALSWQGEEKLIRFAPPAPADSQ"
     gene            complement(105382..106362)
                     /locus_tag="AHA_RS00475"
                     /old_locus_tag="AHA_0095"
                     /db_xref="GeneID:4490990"
     CDS             complement(105382..106362)
                     /locus_tag="AHA_RS00475"
                     /old_locus_tag="AHA_0095"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016348956.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4382 domain-containing protein"
                     /protein_id="WP_164927504.1"
                     /db_xref="GeneID:4490990"
                     /translation="MKPLTLIGLTALLTACGGGGGGDNNSPQQAQLSLAFSDAPVDAV
                     SKVCIAVANISIHPVAGTEQSWTTASFLTSTQDDGCTPSGETIPLDSAGRPLFTYIDL
                     LHYQGSVSRPLLASQSVEPGDYSQMRLRVLDGREVANQFLDGTPYSYVKRDDGVIKPL
                     EVPSSELKLDAFTIAANGLSAFTTEFDLRQAMVLPGHEQYYKLKPRGVRLVNNTQVTT
                     VKGTVAAGLCGGQLTDKAFVYFYQPRSDDNYPDMADSDNGFYASAPVLPQSGGGFGYE
                     LGFVNLGSYDLALVCNGNEDDPALAGDPLQLEQVQQAQAVVAPATSINFQ"
     gene            complement(106568..108058)
                     /gene="gppA"
                     /locus_tag="AHA_RS00480"
                     /old_locus_tag="AHA_0096"
                     /db_xref="GeneID:4490991"
     CDS             complement(106568..108058)
                     /gene="gppA"
                     /locus_tag="AHA_RS00480"
                     /old_locus_tag="AHA_0096"
                     /EC_number="3.6.1.40"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017788479.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="guanosine-5'-triphosphate,3'-diphosphate
                     diphosphatase"
                     /protein_id="WP_011704128.1"
                     /db_xref="GeneID:4490991"
                     /translation="MHNSPLYAAIDLGSNSFHMLVVREVAGALRTVTKVKRKVRLAAG
                     LDPEFRLSRAAMERGWDCLRLFSEQLQDIPADNIRVVGTATLRLATNVDEFLSEAERV
                     LNHSIEIISGEEEAKTIYEGVSWTSAGEGNRLVIDIGGASTELVIGEHSEAKLLNSLH
                     MGCVTWLNNHFGDGELSEARFKQAIAAAKAVLEKVAEDYRALGWRTCVGASGTVQALQ
                     EIMLAQGKSERVTLPKLQELMGQAIACGKLDQLQLEGLAAERLTVFPSGLAILIAIFE
                     TLGIESMTLAGGALREGLIYGLLGNNHDCDARDRTADSLINRYQLDKEHAERVRDTAV
                     EAFNQLQPAWRLSKRYGRPILRYAALLHEIGLCIEYKKAPQHAAYIIDNIDMPGFTPA
                     QKKLLSALLFNQRDEFKLEPLEKQGAVTGRQAIRLARILRIALILCMRRTQGTVPRFT
                     LEADEDALTLTLPSGWLDEHYLRASELRFEVERQQKMGWPTRLLEA"
     gene            complement(108073..109362)
                     /gene="rhlB"
                     /locus_tag="AHA_RS00485"
                     /old_locus_tag="AHA_0097"
                     /db_xref="GeneID:4490992"
     CDS             complement(108073..109362)
                     /gene="rhlB"
                     /locus_tag="AHA_RS00485"
                     /old_locus_tag="AHA_0097"
                     /EC_number="3.6.4.13"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005307299.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent RNA helicase RhlB"
                     /protein_id="WP_011704129.1"
                     /db_xref="GeneID:4490992"
                     /translation="MSKTHLTTDKFAQMGLEPEVLAGLESKGFHYCTPIQALSLPLLV
                     EGHDLAGQAQTGTGKTLAFLAATFNYLLTHPLTKPRLINQPRAIIMAPTRELAVQIYN
                     DAESMSASTGLKLGLAYGGEGYDKQLAVLEQGVDILIGTTGRIIDYFKSKVIDLSNIQ
                     VVVLDEADRMFDLGFIKDIRFLFRRMPPATERLSMLFSATLSLRVQELAYEHMNHPEH
                     VQIEPEQMTGVRIKEELFYPSNEDKMLLLLSLMEEEWPEKAIVFANTKHVCEDVHAWL
                     ENDGHRVGLLTGDVPQKKRMKILEDFTKGTVDILVATDVAARGLHIPDVTHVFNYDLP
                     DDAEDYVHRIGRTGRAGKSGHSISLACEDYAFNLPAIEEYIHHPIPVSKYDREALLDD
                     VTAPKRVFRNRQPVNRNMRDRQGGGNSNNRRRPPRKS"
     gene            109476..109802
                     /gene="trxA"
                     /locus_tag="AHA_RS00490"
                     /old_locus_tag="AHA_0098"
                     /db_xref="GeneID:4489138"
     CDS             109476..109802
                     /gene="trxA"
                     /locus_tag="AHA_RS00490"
                     /old_locus_tag="AHA_0098"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_462806.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin TrxA"
                     /protein_id="WP_005307306.1"
                     /db_xref="GeneID:4489138"
                     /translation="MSDKIVQLSDASFEADVIKADGAVLVDFWAEWCGPCKMIAPILN
                     EVAQEYAGRVTVAKLNIDHNADTPPKYGIRGIPTLLLFKNGEVAATKVGALSKTQLKE
                     FLDGNL"
     gene            110010..111275
                     /gene="rho"
                     /locus_tag="AHA_RS00495"
                     /old_locus_tag="AHA_0099"
                     /db_xref="GeneID:4489139"
     CDS             110010..111275
                     /gene="rho"
                     /locus_tag="AHA_RS00495"
                     /old_locus_tag="AHA_0099"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014290642.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination factor Rho"
                     /protein_id="WP_005307308.1"
                     /db_xref="GeneID:4489139"
                     /translation="MNLTELKNTPVSELVQLGESMGLENLARAHKKDIIFAILKAHAK
                     GGEDIFGDGVLEILTDGFGFLRSADGSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIR
                     PPKEGERYFALLKVNEVNYDRPENSRNKILFENLTPLHANERLRMERGNGSTEDITAR
                     VLDLASPIGKGQRGLIVAPPKAGKTMLLQNIAQSIAYNHPDCELIVLLIDERPEEVTE
                     MQRMVKGEVIASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNT
                     VIPSSGKVLTGGVDANALHRPKRFFGAARNVEEGGSLTIIATALIDTGSKMDEVIYEE
                     FKGTGNMELHLSRKIAEKRVYPAIDITRSGTRKEELLTTGDELQKMWILRKIVHPMGE
                     IDGIEFLIDKLAMTKTNDEFFDAMRRQQK"
     gene            111382..112389
                     /locus_tag="AHA_RS00500"
                     /old_locus_tag="AHA_0100"
                     /db_xref="GeneID:4489140"
     CDS             111382..112389
                     /locus_tag="AHA_RS00500"
                     /old_locus_tag="AHA_0100"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019841057.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_115586398.1"
                     /db_xref="GeneID:4489140"
                     /translation="MKHVLLILLSWLLVLPVGAAETQPPRTALVADEGLQGHLDYLTD
                     RLQLGQFAAIDTLLDSLAVGQREYLLCQLLATLNSQPRATSPQLLAWVRAQSFKAPSW
                     LVDKEVDGFLVQQPAYDFAAAARQVLSRWQQQAWQDNYRQQLEEGTFEFKQIYNSRNP
                     DLAQQQQALLTVLDRQPLPLLQREAHTLAAMSIFLPDNRLLRLLAERTGDSALYQKLW
                     HQPVDHDSVAALASVGRFHQGQAASDLLIAASRNARLKLPALQQLSQLSPLPDTAQQF
                     LLAELGNRQYSGQVASLLLQMDEPRLLAQLADRLTRQEKRHASPVMLPDSGTPAARPG
                     L"
     gene            112420..113889
                     /gene="ubiD"
                     /locus_tag="AHA_RS00505"
                     /old_locus_tag="AHA_0101"
                     /db_xref="GeneID:4489141"
     CDS             112420..113889
                     /gene="ubiD"
                     /locus_tag="AHA_RS00505"
                     /old_locus_tag="AHA_0101"
                     /EC_number="4.1.1.98"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017411793.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxy-3-polyprenylbenzoate decarboxylase"
                     /protein_id="WP_011704131.1"
                     /db_xref="GeneID:4489141"
                     /translation="MKYKDLRDFIAQLEQSGQLKRISREIDPYLEMTEISDRTLRAGG
                     PALLFENPKGYTMPVLTNLFGTPDRVAMGMGQPNVAALRQVGIWLSYLKEPEPPRGFK
                     ELMEKLPIFKQVLNMPTKRLSSAPCQQRVLEGEAVDLDQIPIQHCWPGDVAPLVTWGL
                     TITRGPYKKRQNLGIYRQQKIGKNKLIMRWLDHRGGAIDFREWQEAHPGERFPVVVAL
                     GADPATILGAVTPVPDTLSEYAFAGLLRGSRTEVVKAVSCDLEVPASAEIVLEGYLEP
                     GEMAPEGPYGDHTGYYNEVDEFPVFTITHMTMRKDAIYHSTYTGRPPDEPAVLGVALN
                     EVFVPLLQKQFPEIVDFYLPPEGCSYRMAVVTIKKRYPGHAKRVMLGVWSFLRQFMYT
                     KFVIVCDDDINARDWKDVIWAITTRMDPARDTTLIEHTPIDYLDFASPVSGLGSKMGL
                     DATNKWPGETNREWGQPIVQDEAVKQKIDALWDELNILG"
     gene            114058..114756
                     /gene="fre"
                     /locus_tag="AHA_RS00510"
                     /old_locus_tag="AHA_0102"
                     /db_xref="GeneID:4489142"
     CDS             114058..114756
                     /gene="fre"
                     /locus_tag="AHA_RS00510"
                     /old_locus_tag="AHA_0102"
                     /EC_number="1.16.1.3"
                     /EC_number="1.5.1.41"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005355899.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H-flavin reductase"
                     /protein_id="WP_011704132.1"
                     /db_xref="GeneID:4489142"
                     /translation="MQRIKCRVEELREYVDTIWHVALTPLQEVSFKPGQYLLVVMSDS
                     DKRPFSIANSPTRPGMLELQIGATPENAYAGQVLARMREQGEIEIELAAGKAFLREES
                     PRPLILMAGGTGFSYARSILEYLIDTGSKRPVFFYWGVRQAHWLYEQEQMQQWERDYA
                     PLTFIPVVQEPEVDWTGKTGLVHKAIMDDFVSLHDYDIYVAGRFEMAGAAREEFKILG
                     AEPERIFGDAYEFI"
     gene            complement(114886..115143)
                     /locus_tag="AHA_RS00515"
                     /old_locus_tag="AHA_0103"
                     /db_xref="GeneID:4489143"
     CDS             complement(114886..115143)
                     /locus_tag="AHA_RS00515"
                     /old_locus_tag="AHA_0103"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010672374.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="accessory factor UbiK family protein"
                     /protein_id="WP_005307315.1"
                     /db_xref="GeneID:4489143"
                     /translation="MIDPKKLEEIAKQVHNSLPPGIRSMGEEVEKKIRQVLQSQLGKL
                     DLVSREEFDVQTKVLLRTREKLTALEAKLAQLEQQLGAKGE"
     gene            115445..117862
                     /locus_tag="AHA_RS00520"
                     /old_locus_tag="AHA_0104"
                     /db_xref="GeneID:4489144"
     CDS             115445..117862
                     /locus_tag="AHA_RS00520"
                     /old_locus_tag="AHA_0104"
                     /EC_number="3.1.1.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704133.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipase"
                     /protein_id="WP_011704133.1"
                     /db_xref="GeneID:4489144"
                     /translation="MKKKLIYAAVVSAMLAGCGGSDDNKGDTSSYLDYLLTGSNAVRP
                     SALAARASDGTLKFSTETADLSNPVSAMSTLDGWSTTQAIQIVPVTSSGIQVQAPAAA
                     EFAASVAPLYLLELSFDSAALRPNGVKKVLTYGVDFVVAAAAGKLNLVPLKPLNPSSY
                     YMIVATDSLKDSSGNAVKAGNDYGNYKNNVGSNAQEQTINGLIALQEGLFKAATGVST
                     DHVIFSDWFGTQSGADVLVAVKGAAASVLKSPTLDAAALWKQDAKGNTSLPGTYTLSV
                     TGSNAFLTQLDAEQFLPQEQKDAIATAFGPGAPLNPIAQATKVYTGTVKLPYFLASPA
                     TAGSWDKAKTQSWHGAIPSLYAIANALKASDSEVIAGLVGAGVDPALLATLIADPTRQ
                     AELLAEASKLIGVTLTSGGKPLDAEQNIGRFNPLPMLEEVQSVPMRVFAKDALNTITD
                     VIIYQHGVTSVKENAYALALGQIYAGMQAGKKVALVVIDHPLHGERGFALSGSMATVT
                     TSDNPTPYLNLSYLTVARDNLKQSVADLLGLRLAVGLANAKGAIGTAGSLKVHFLGHS
                     LGAISGTNLLAVANQPIGNAQADALFKFDTGGLAMPGGGIAPLLLNSPTFGPTIKMGV
                     LTSGSAELKAGFTAYAPNCKTAVPTCFVNEFLPSLSTTQQAAAASTLQSYSFAAQSVL
                     DSADPINLGRGIQSSFPLFATEIVGDGALSLSDQVIPNSIASAPLGGTEPLFKVLALQ
                     PLTATGAASHNAARFLAGGHSSLLAPDENFDPSGDVTTEMQSQFASFFMSGGTAVKVT
                     NGSLLKQ"
     gene            complement(118002..118835)
                     /gene="glpG"
                     /locus_tag="AHA_RS00525"
                     /old_locus_tag="AHA_0105"
                     /db_xref="GeneID:4489145"
     CDS             complement(118002..118835)
                     /gene="glpG"
                     /locus_tag="AHA_RS00525"
                     /old_locus_tag="AHA_0105"
                     /EC_number="3.4.21.105"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704134.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rhomboid family intramembrane serine protease
                     GlpG"
                     /protein_id="WP_011704134.1"
                     /db_xref="GeneID:4489145"
                     /translation="MIQLLVLDNARMAQALVDYLSTLGISCELTQSELGVSVWLADEQ
                     RLAQAQLEVKRFLAEPTHPRYMEASWQSGRADARIDYSKGMTDPVTDFLHQAGPLTLV
                     VIIACLAIYGLDAIGLPIFDELAFHPTLAQFTDWQAWRYFTPAFIHFSVLHLVFNLLW
                     WWYLGGQIEQRLGSGKLLILLLVGAALPNLAEFFASGPLFGGLSGVVYALLGYCWLRS
                     KLQPACGLTLPPALMGFMLFWLALGFFDLLGTRTANMAHLAGLLVGLLQGWLDRHHQP
                     A"
     gene            complement(118832..119155)
                     /gene="glpE"
                     /locus_tag="AHA_RS00530"
                     /old_locus_tag="AHA_0106"
                     /db_xref="GeneID:4489146"
     CDS             complement(118832..119155)
                     /gene="glpE"
                     /locus_tag="AHA_RS00530"
                     /old_locus_tag="AHA_0106"
                     /EC_number="2.8.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005897984.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiosulfate sulfurtransferase GlpE"
                     /protein_id="WP_011704135.1"
                     /db_xref="GeneID:4489146"
                     /translation="MDQFAHISAHDAHQKLAAGAARLVDIRDPQSFETAHAVGAFHLT
                     NGTLVRFMNEVDFDTPVIVMCYHGNSSQGAAQYLLQQGYDEVYSLDGGFEAWRREFPI
                     QAGDA"
     gene            119226..119912
                     /locus_tag="AHA_RS00535"
                     /old_locus_tag="AHA_0108"
                     /db_xref="GeneID:4489147"
     CDS             119226..119912
                     /locus_tag="AHA_RS00535"
                     /old_locus_tag="AHA_0108"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017788484.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysE family translocator"
                     /protein_id="WP_011704136.1"
                     /db_xref="GeneID:4489147"
                     /translation="MSGYCRDRSQFPSIPGAGCRLGWGLLLLLRALFMETSLLLSMAG
                     FALAMSITPGPVNLVALGSGARHGFAASLRHVVGATLGFILLLLLMGLGLGATLLQWP
                     LAAELLRWAGVIFLGWMAWQLLVDSGRVEGVDGVAPSFWYGALMQWLNPKAWLAASMG
                     MGAYGSAGGVGQVALFSGLYLVICLGSIACWAYAGSRLQGVLLAPQRLRWFNRAMALL
                     LLLCAAYLVR"
     gene            complement(119909..120742)
                     /locus_tag="AHA_RS00540"
                     /old_locus_tag="AHA_0107"
                     /db_xref="GeneID:4489148"
     CDS             complement(119909..120742)
                     /locus_tag="AHA_RS00540"
                     /old_locus_tag="AHA_0107"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017410830.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_011704137.1"
                     /db_xref="GeneID:4489148"
                     /translation="MSRADTAPDHHSFWHDPALPFIEARAVQDGRRVCYDKHSHPHFS
                     IGAITGGHSHYLNQRSRQEVGRGHLVLMNPEEVHACNPVADEPWSYLMFYLNTGWLQR
                     QQEEAGLGDTFRPFDMTASQDPLLYQGLCRLHRQLWQEQDPLAREVACHQFSRQLLAR
                     LTPASWDDRPPQHLQRAAELMQDDCSSPLTLAQLSAVAGLTPSHFVRSFSRHYGMTPH
                     AYLLDQRIRHARTLLKRGEPLAEVALASGFADQAHFQRQFKRRVAATPGHYRNQLTRL
                     G"
     gene            complement(120746..121447)
                     /locus_tag="AHA_RS00545"
                     /old_locus_tag="AHA_0109"
                     /db_xref="GeneID:4489149"
     CDS             complement(120746..121447)
                     /locus_tag="AHA_RS00545"
                     /old_locus_tag="AHA_0109"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005320651.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding cassette domain-containing protein"
                     /protein_id="WP_011704138.1"
                     /db_xref="GeneID:4489149"
                     /translation="MLELRNVSTHYGKIQALHDVSVQVKEGEIVTLIGANGAGKTTLL
                     MTLCGEPKPSSGSIWFEGEQIDSLSTARIMRKDIAVVPEGRRIFARLTVEENLLMGAF
                     FVDKAEQRGLLDQIFTLFPRLHERLEQRAGTMSGGEQQMLAIGRALMSKPRLLLLDEP
                     SLGLAPIVIQQIFDTIEQLRRDGMTIFLVEQNANQALKLADRGYVLENGHVVLQDTGA
                     ALLANPAVRQAYLGG"
     gene            complement(121458..122231)
                     /locus_tag="AHA_RS00550"
                     /old_locus_tag="AHA_0110"
                     /db_xref="GeneID:4489150"
     CDS             complement(121458..122231)
                     /locus_tag="AHA_RS00550"
                     /old_locus_tag="AHA_0110"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005320649.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_011704139.1"
                     /db_xref="GeneID:4489150"
                     /translation="MSANQKLMEVSDLSMRFGGLLAVNGVKLDVDKGEVISIIGPNGA
                     GKTTVFNCLTGFYRPSGGIIRYKGEEIQGLPGHLIARKGIVRTFQHVRLFKDMTAVEN
                     LLVAQHRHLNTGFLAGLFKTPAFRRAEREGLEQSAFWLEKVGLKDLANRAAGNLAYGQ
                     QRRLEIARCMATRPELLMLDEPAAGLNPHETDELNELISNLRDEFGVSVLLIEHDMKL
                     VMEISNRIFVVNQGTPLAHGKPDEIRSNPAVIKAYLGES"
     gene            complement(122228..123496)
                     /locus_tag="AHA_RS00555"
                     /old_locus_tag="AHA_0111"
                     /db_xref="GeneID:4489151"
     CDS             complement(122228..123496)
                     /locus_tag="AHA_RS00555"
                     /old_locus_tag="AHA_0111"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019841062.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="high-affinity branched-chain amino acid ABC
                     transporter permease LivM"
                     /protein_id="WP_044798805.1"
                     /db_xref="GeneID:4489151"
                     /translation="MKRQLVHACIASLVLLVLSFWLLGFKLETDGTRLLVTSRLDVSL
                     AWLLGGATLVFWFQLLRGQISRLFQASISGFSVGFTKLVLPSQEEAPRLYNITAVLVL
                     LFAVSWPFMASRGAIDLATLALIYIMLGLGLNVVVGLAGLLDLGYVGFYAVGAYSYAL
                     LNTYFGLSFWECLPIAGLTAATFGFLLGFPVLRLRGDYLAIVTLGFGEIIRILLNNMT
                     SLTGGPNGISGIPKPTLGGLEFNRTVKDGGFETFHEFFGIAYNANHKVIFLYLMALVL
                     VIATLFVINRLLRMPLGRAWEALREDEIACKSLGLNPTIIKLTAFTIGACFAGFAGSF
                     FASRQGFISPESFVFIESAIVLAIVVLGGMGSQIGVVLAAIVMTVLPELAREFNEYRM
                     LMFGLLMVFMMIWRPQGLLPMTRPHLELKK"
     gene            complement(123496..124422)
                     /gene="livH"
                     /locus_tag="AHA_RS00560"
                     /old_locus_tag="AHA_0112"
                     /db_xref="GeneID:4489152"
     CDS             complement(123496..124422)
                     /gene="livH"
                     /locus_tag="AHA_RS00560"
                     /old_locus_tag="AHA_0112"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704141.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="high-affinity branched-chain amino acid ABC
                     transporter permease LivH"
                     /protein_id="WP_011704141.1"
                     /db_xref="GeneID:4489152"
                     /translation="MSEHFLYLVQQLLNGLTIGSTYALIAIGYTMVYGIIGMINFAHG
                     EVYMIGSYVAFMVMAGLMMMGIDSTFLLLGGAFLVSIVITGTYGWTIERVAYRPLRGG
                     NRLIPLISAIGMSIFLQNMMRMAQGSRDIAMPTLISGGWTLGEADGFQASLSWMQLII
                     FVVTFITMLALTQFIGRSRMGRACRACSEDIKMANLLGIDTHVVISITFVLGATLAAV
                     AGVLLGMYYGVINPYLGFMAGLKAFTAAVLGGIGSIPGAVLGGLLLGVVEALTAGYLS
                     TEYKDVMAFALLIGVLLFMPTGILGRPEVEKV"
     gene            complement(124487..125608)
                     /locus_tag="AHA_RS00565"
                     /old_locus_tag="AHA_0113"
                     /db_xref="GeneID:4489153"
     CDS             complement(124487..125608)
                     /locus_tag="AHA_RS00565"
                     /old_locus_tag="AHA_0113"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011899243.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_016348967.1"
                     /db_xref="GeneID:4489153"
                     /translation="MNKLSKMAVRTAVSMALFGSVSLVHAADTIKIGIAGPVTGPVAQ
                     YGDMQFTGGKMAVEQINKAGGIKGKQIEAVIYDDACDPKQAVAVANKVINDGVKFVVG
                     HLCSDNTLPASDIYEDEGVLMVTPASTNPKITERGYQLVLRTIGLDSDQGPTAAKYII
                     EQVKPKRVAVIHDKKQYGEGIASSVKAALDKAGVKVVAFEGITAGDKDFSALIAKLQK
                     ENVDFVYYGGYHPELGLILRQAGEKGLKAKFMGPEGVGNKDISAIGGPASEGLLVTLP
                     NKYDLVPANAPLVAAFKAKGQDSSGPFVWTTYAAVQTLAAGIAKAGEDDPAAVAAAIK
                     AAPIDTVMGTLSWAPSGDLKGFEFGVFQWHADGTSTQVK"
     gene            126044..127048
                     /locus_tag="AHA_RS00570"
                     /old_locus_tag="AHA_0114"
                     /db_xref="GeneID:4489154"
     CDS             126044..127048
                     /locus_tag="AHA_RS00570"
                     /old_locus_tag="AHA_0114"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005897967.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="substrate-binding domain-containing protein"
                     /protein_id="WP_011704143.1"
                     /db_xref="GeneID:4489154"
                     /translation="MATIKDVASRAGVSISTVSHVLNHTRRVSEDATQKVLEAVAELN
                     YAPNSVARSLKINSTKTIGMLVTTSANPFFAEVVQGVEAYCFEQGYSLILCNTENQPP
                     RQQHYLRMLMEKRVDGLLVLGTDIDTPLRDMLRIHKNVPQVVLDWGTECDFANVINDN
                     ARIGARLAVRHLLEQGHRDIVCITGQLAKPTTQQRLDGVRDALGEQGLTLKDEQIFEG
                     DYESQSGFDAMQRILALKPRPTAVFAFDDPMAIGAICAAWEAGVKVPDDISMIGYDDV
                     EMARFSSPPLTTIRHPKAELGLLAVQQLVSRIRNKELEVESMTVQPELIVRRSVKSLR
                     "
     gene            complement(127118..128437)
                     /locus_tag="AHA_RS00575"
                     /old_locus_tag="AHA_0115"
                     /db_xref="GeneID:4489155"
     CDS             complement(127118..128437)
                     /locus_tag="AHA_RS00575"
                     /old_locus_tag="AHA_0115"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016538685.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-phospho-alpha-glucosidase"
                     /protein_id="WP_011704144.1"
                     /db_xref="GeneID:4489155"
                     /translation="MKKFSVVIAGGGSTFTPGIVLMLLENQHRFPLREIKFYDNDGAR
                     QEVIAEACRVLLREQAPDIAFSYGTDPKAAFSGVDFVMAHIRVGKYPMRELDEKIPLR
                     HGVVGQETCGPGGIAYGMRSIGGVLALVDYMEQYSPDAWMLNYSNPAAIVAEATRRLR
                     PHARILNICDMPIGIEGQMAQIAGLPSRKEMRVRYYGLNHFGWWTRIEDLAGNDLMPA
                     IKAHVAKHGYVPKQAGHAEASWNDTFAKAKDVWALDPDTLPNTYLKYYLYPDYVVAHS
                     NPEHTRANEVMEHREKHVFSACRAIVAAGNAAAGELEIDEHASYIVDLATAIAFNTQE
                     RMLLIVPNRGAIPNFDPEAMVEIPCLVGSSGPEPLQVGNIPLFQQGMMGQQVAVEKLV
                     VEAWIERSYQKLWQAITLSKTVPSASVAKAILDDLIAANKEYWPPLQ"
     gene            complement(128440..130026)
                     /locus_tag="AHA_RS00580"
                     /old_locus_tag="AHA_0116"
                     /db_xref="GeneID:4489156"
     CDS             complement(128440..130026)
                     /locus_tag="AHA_RS00580"
                     /old_locus_tag="AHA_0116"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_709515.3"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS transporter subunit EIIC"
                     /protein_id="WP_011704145.1"
                     /db_xref="GeneID:4489156"
                     /translation="MLSQIQRFGGAMFTPVLLFPFAGMVVGIAIMLKNPMFVGETLAN
                     PQGLFFQIVHIIEEGGWTVFRNMPLIFAIGLPIGLANKAQARACLSVLVSFMTWNYFI
                     NAMGMTWGDYFGVDFNQAVGGESGLAMVAGIKTLDTSIIGAIAISGIVTALHNRLFDR
                     QLPVFLGIFQGSSFVTIVAFFVMIPCAWLTLQGWPKVQMGIASLQEFMLVSGPLGVWV
                     YTFLERILIPTGLHHFIYGPFIFGPAAVEGGIQLYWAQHMLEFSQSTRPLIELFPQGG
                     FALHGNSKIFGAMGIALAIYATAAKENKAKVAGLLIPATLTAMLVGITEPLEFTFLFI
                     SPLLFAIHALLAATMATVMYLFGVVGNMGGGLLDQFLPQNWIPMFHNHAGMMFTQIAI
                     GLTFTGIWFLIFRTLILKFNLKTPGRDESEIKLYSKADYQAAKKQRGYDIAGHILAAL
                     GGAENINSLNNCATRLRISLRDASLVAPDDAFKQLGAHGVVRHGDSIQIIIGLHVPQL
                     RENMESLMNNPSSSSFVTES"
     gene            130311..131018
                     /locus_tag="AHA_RS00585"
                     /old_locus_tag="AHA_0117"
                     /db_xref="GeneID:4489157"
     CDS             130311..131018
                     /locus_tag="AHA_RS00585"
                     /old_locus_tag="AHA_0117"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017783267.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_010635556.1"
                     /db_xref="GeneID:4489157"
                     /translation="MIYKSVADRLRIRVNGADCRVGDVLPSEKTLASQFGVSRMTVRK
                     AVDMLIEWGLVERRHGSGTYVTKKDVQHETKGLSGFTELMREQGRSLTSEVLEFRTMP
                     APPAIASQLRIKVNEPVYFSNRVRSVDGRALLVEESYMPVRLFRTLSVAHLEGSKFAY
                     IENECQLPIAGNYESFSAVLADRRMAELLHIEQGAPILRLTSLSYGENGEFLNYSIMF
                     RNANDYHVDYHLRRARG"
     gene            complement(131099..132625)
                     /gene="norR"
                     /locus_tag="AHA_RS00590"
                     /old_locus_tag="AHA_0118"
                     /db_xref="GeneID:4487498"
     CDS             complement(131099..132625)
                     /gene="norR"
                     /locus_tag="AHA_RS00590"
                     /old_locus_tag="AHA_0118"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704146.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitric oxide reductase transcriptional regulator
                     NorR"
                     /protein_id="WP_011704146.1"
                     /db_xref="GeneID:4487498"
                     /translation="MISTDSLARIALDLQLGISHQDRFHRLIQSVRSLLNSDASALLR
                     YEGGQFIPLAIDGLMQDVLGRRFALKDHPRMEAIARAGDVVRFPADSSLPDPYDGLLP
                     DHDDFKVHACVGLPLFSDQALIGALTIDGMNPTQFDAISDEELRLVGALAAAALNNAL
                     LLERLARQSSEPLVPGTRPGPEQPEMIGQSPAMARLRHEIEVVANSELNVLILGETGV
                     GKELIAKAVHRGSQRAKAPLVYLNCAALPESVAESELFGHVKGAFTGAIHNRAGKFEL
                     ADQGTLFLDEIGELSLPLQAKLLRVLQYGDLQRIGDDTPLKVNVRILAATNRDLKQAV
                     VEGQFRADLYHRLSVFPIHAPALRERPGDIPLLAGYFCERCRLSLGLEQLRIQPQALQ
                     LLERHDWPGNVRELEHAIHRAAVLARAEQGSQTPTLASHHFNLAAGPLPPSTSPAMAP
                     MTPLPGGLGLRAATDAFQLALIEQTLAAHNGNWAATARALELDSGNLHRLAKRLGLKA
                     "
     gene            132796..134283
                     /gene="norV"
                     /locus_tag="AHA_RS00595"
                     /old_locus_tag="AHA_0119"
                     /db_xref="GeneID:4487499"
     CDS             132796..134283
                     /gene="norV"
                     /locus_tag="AHA_RS00595"
                     /old_locus_tag="AHA_0119"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005320624.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic nitric oxide reductase
                     flavorubredoxin"
                     /protein_id="WP_011704147.1"
                     /db_xref="GeneID:4487499"
                     /translation="MSIHVKNNIHWVGQRDWEVRDFHGTEYKTHKGTSYNSYLIREGK
                     NVLIDTVDHKFSREFVQNLAAEIDLATIDYVVINHAEEDHAGALTELMARIPGTPIYC
                     THNAIDSITGHHHHPEWNFHPVKTGDSLDIGNGKQLVFIETPMLHWPDSMMTYMTEDA
                     VLFSNDAFGQHYCDEHLFNDEVDQTELMEQCQRYYANILTPFSPLVTAKIKEVLGFNL
                     PVSMVATSHGIVWREDPTQIILKYLEWADHYQEDRITLFYDSMSNNTRMMADAIAQGI
                     HEVDPGVAVKIYNVARHDKNEILTQVFRSKGILVGSSTMNNVMMPKVAGMLEEITGLR
                     FRNKRASAFGSYGWTGGAVDRIQTRLMDAGFDISISLKAKWRPDGSALAECREHGRQL
                     ARQWALHPLDAPRPLATTQATPAPEMPAAVTAAPKATAAAAEWDDDQAMLCTVCQWVY
                     DPAQGEPDQLVAPGTPWAQVPDSFLCPGCGIGKEVFEPCAVEACV"
     gene            134280..135446
                     /gene="norW"
                     /locus_tag="AHA_RS00600"
                     /old_locus_tag="AHA_0120"
                     /db_xref="GeneID:4487500"
     CDS             134280..135446
                     /gene="norW"
                     /locus_tag="AHA_RS00600"
                     /old_locus_tag="AHA_0120"
                     /EC_number="1.18.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010635553.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH:flavorubredoxin reductase NorW"
                     /protein_id="WP_011704148.1"
                     /db_xref="GeneID:4487500"
                     /translation="MSTTTQSDAGISREIVVIGSGFAAQQLVKSLRKLDAEQPIRLIT
                     ADSGDEYNKPDLSHVVSRGCAAAAMTRQSGSDFAEQQRIALLPHCPVLGIDPVRRLVL
                     TEQGEFPYGQLVLATGASAVRPELPGSEHLVTLNSQQEYAAVEGAIQQARRILVLGAG
                     LIGCELAMDMASDGREVTLLDLADSPLSALLPATLTQPLQQALRSQGVSLQFGTGLAR
                     IDGQPGDGWRVTLTDGRTSEQDLVIAAIGLRPNLALARGAGLAVERGILVGDRLQTSD
                     PHIFALGDCVQWQGQLLPFLQPIVLGANALARTLLGTPTPLALPPMLVKVKTPRYPLQ
                     LAGRTQGEDLAWQCRWNSHGMVAEARDQAGELCGFVVGGDQMSAAFPLLRQLPR"
     gene            135498..135839
                     /locus_tag="AHA_RS00605"
                     /old_locus_tag="AHA_0121"
                     /db_xref="GeneID:4487501"
     CDS             135498..135839
                     /locus_tag="AHA_RS00605"
                     /old_locus_tag="AHA_0121"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017780588.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1971 domain-containing protein"
                     /protein_id="WP_011704149.1"
                     /db_xref="GeneID:4487501"
                     /translation="MAMQLIPSHWVVRRSTPFFTRQNVPQALLTHHNTAAGVFGQLCV
                     MEGTVTYHGFADEQAEEPEISLVIRAGEFATSPPQYWHRVELSEDARFNIHFWAEQAE
                     SDQPLFNSRKA"
     gene            135961..137178
                     /locus_tag="AHA_RS00610"
                     /old_locus_tag="AHA_0122"
                     /db_xref="GeneID:4487502"
     CDS             135961..137178
                     /locus_tag="AHA_RS00610"
                     /old_locus_tag="AHA_0122"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019840750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S binding protein"
                     /protein_id="WP_011704150.1"
                     /db_xref="GeneID:4487502"
                     /translation="MSVIEAVTMAAGLAYLVLLAWQARSGWQWRLALGLLLMLWLLAA
                     DSLLWLGVGLVAAVLVFWHQRRPLPALEALDSQWLRTRTRQLLLLCWGLVTLQYGLHV
                     WQLGQGMSPWLVRPDVVDGFLPIAGGLGLRAWLGQGLVDPHHPAATVTVLVLSLSALL
                     LGRVFCAWFCPLGLVGEWLHGLRSRWITGEWTPPRWLDVVLRGQKFLVLAFLLFIVLI
                     AVPGAALPGYFTSPYHQAADMKMGAFFFNLTLISALCLGWVLLLTATFRQGFCRYLCP
                     YGAWLALLGLLTPLRIRRDPARCLRSAGHDCDKCSRACPSRIQVHQLIAVRSLECTSC
                     LSCVAACPKRADALHLGTQGRRLAPRQLLGLLCLLLLVLPLLAYGLLGIWVSLTPLAD
                     RAQLLQLLPQLTH"
     gene            137466..138692
                     /locus_tag="AHA_RS00615"
                     /old_locus_tag="AHA_0123"
                     /db_xref="GeneID:4487503"
     CDS             137466..138692
                     /locus_tag="AHA_RS00615"
                     /old_locus_tag="AHA_0123"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017410840.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="low affinity tryptophan permease"
                     /protein_id="WP_011704151.1"
                     /db_xref="GeneID:4487503"
                     /translation="MGQKPSLVGGACIIAGVCVGAGMLGLPSAGAGAWTIWSVLAITL
                     TMIVMTLSGWMLLESYQGYPLRVSFDTVTRELLGEKLNALNNLTVYFVGGILLYAYIT
                     SAGLIIDGMTGIGSQWGSVLFTLGFSGLVWHSTRAVDRISVVLVIAMGLSFVFGISGL
                     SLNIKPTLLFDTLSEHASYAPYALAMLPVALTSFGYHHSVSSMRAYYGEERRARYAIL
                     GGTAIALLFYLIWLVSVFGNLPRSEFGPVVAQGGNVDVLLKALASVIESEAVASALNL
                     FSMAAILSSFIGVGLGVFDYLADLFKFDNGRGGRAKSWAATFLPPLLLSLLFPFGFLM
                     AIGYAGAVATLWTCIIPALLAWKVRAGKGKQGDKQGGFRAPGGMPMIAGVFLFGVLTA
                     AFHLLNMAGLLPVYTG"
     gene            complement(138783..139262)
                     /locus_tag="AHA_RS00620"
                     /old_locus_tag="AHA_0124"
                     /db_xref="GeneID:4487504"
     CDS             complement(138783..139262)
                     /locus_tag="AHA_RS00620"
                     /old_locus_tag="AHA_0124"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017410844.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DM13 domain-containing protein"
                     /protein_id="WP_011704152.1"
                     /db_xref="GeneID:4487504"
                     /translation="MQLKTLALLLASHLLVGAAGFAAGIYTLPILIAPPAPANEQVAA
                     RQAQASFHGTFRRDLQDSDRLHWGEGQVSIGPDAISLMGKLAPGPDYQLYLSPVFVET
                     EADFARLKEKMVKIGPVKTFDNFIVPLPADVNPADYDSVIIWCETFGQFITAARYRQ"
     gene            complement(139376..139780)
                     /locus_tag="AHA_RS00625"
                     /old_locus_tag="AHA_0125"
                     /db_xref="GeneID:4487505"
     CDS             complement(139376..139780)
                     /locus_tag="AHA_RS00625"
                     /old_locus_tag="AHA_0125"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017766343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011704153.1"
                     /db_xref="GeneID:4487505"
                     /translation="MKRAIQAALLAITMVAGAQAADKITTVPVQFAKGAHSAQLKGSF
                     TGYDTIHYTLVAKAGQTMTVKIGGSSNANFNVFAPGAQPGQAEAIGRNDGDGQWQGAL
                     PASGKYLIQVYQMRASARRGEQVPHTLAVSIQ"
     gene            140006..140512
                     /locus_tag="AHA_RS00630"
                     /old_locus_tag="AHA_0126"
                     /db_xref="GeneID:4487506"
     CDS             140006..140512
                     /locus_tag="AHA_RS00630"
                     /old_locus_tag="AHA_0126"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017780595.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AAA family ATPase"
                     /protein_id="WP_011704154.1"
                     /db_xref="GeneID:4487506"
                     /translation="MLIIFSGLPGSGKSTIARALAQRLGAVYLRIDTIEQAIRDAERT
                     AEEMGPAGYFVAYGLARENLKLGSTVITDSVNPIQLTRDAYHDIARSVGVPCLDVEVV
                     CSNSKLHRERVENRTVDIEGLALPDWQAVIDRDYQPWNSERLVLDSATLSVTQSVEKI
                     VAALGKPL"
     gene            complement(140673..141233)
                     /locus_tag="AHA_RS00635"
                     /db_xref="GeneID:44141857"
     CDS             complement(140673..141233)
                     /locus_tag="AHA_RS00635"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_139348869.1"
                     /db_xref="GeneID:44141857"
                     /translation="MDFFQSDIGKVVLGGIVTISAQIFLSLFTWFKESRAEKNKKTKE
                     AEFLAINLVIVLDDFVGECFNSINDSMQQDERGLWGTTVKYPSITLPIGEYTSLPSGL
                     MFEIISIPKRLRDILENLKLVGEESYPPDYFEYHKYRREHFSRIGLQALNQINALNKY
                     YQIPDIRNDDQYDPKACFMHFINKAT"
     gene            complement(141378..143447)
                     /gene="glyS"
                     /locus_tag="AHA_RS00640"
                     /old_locus_tag="AHA_0127"
                     /db_xref="GeneID:4487507"
     CDS             complement(141378..143447)
                     /gene="glyS"
                     /locus_tag="AHA_RS00640"
                     /old_locus_tag="AHA_0127"
                     /EC_number="6.1.1.14"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016348983.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine--tRNA ligase subunit beta"
                     /protein_id="WP_011704155.1"
                     /db_xref="GeneID:4487507"
                     /translation="MAQHTFLVEIGTAELPPKALRSLAEAFADNLKSELTKADLAFGD
                     VEWFASPRRLALKVSELAGEQPSKSVEKRGPAVAQAFDAEGKPTKAAEGWARGNGITV
                     EQAERLVTDKGEWLVHTAKVEGRPAKDLLGELVSQALAKLPIPKMMRWGDKTIQFVRP
                     VFTVTLLLDGELVPAHILGIDSARTLRGHRFMGESEFTIDNASQYPQILQERGMVIAD
                     FMARKVKIKADAEAAAAAFGGVADLDDALLEEVTALVEWPVVLTANFEEKFLAVPAEA
                     LVHTMKGDQKYFPVYDKNGKLLPKFIFVTNIESKDPSQIISGNEKVVRPRLSDAEFFF
                     KTDLKQTLASRLPRLETVLFQQQLGTVKAKVERIETVAGFIAERIGADVAQAKRAGLL
                     SKCDLMTNMVGEFTDTQGVMGMHYARHDGEDEAVAVALNEQYMPRFAGDALPSGLVAC
                     AVALADKFDTLAGIFGIGMLPKGDKDPFALRRAAIGALRIMTEKQLDLDLVELVEEAV
                     RVYGDKLTNKTVVTDVVDFMLGRFRAAYQDEGIGADVVLAVLARRPTRPLDFDRRVKA
                     VSHFRSLDAALALAAANKRVSNILAKVEGELPTAVKPELLVDAAEKALATQVAELQAE
                     LAPLFAAGDYQAALTRLAALREPVDTFFNEVMVMADDEALKANRLALLNNLRNLFLQV
                     ADISLLQ"
     gene            complement(143457..144380)
                     /gene="glyQ"
                     /locus_tag="AHA_RS00645"
                     /old_locus_tag="AHA_0128"
                     /db_xref="GeneID:4487508"
     CDS             complement(143457..144380)
                     /gene="glyQ"
                     /locus_tag="AHA_RS00645"
                     /old_locus_tag="AHA_0128"
                     /EC_number="6.1.1.14"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010672400.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine--tRNA ligase subunit alpha"
                     /protein_id="WP_005339464.1"
                     /db_xref="GeneID:4487508"
                     /translation="MQKFDVKTFQGLILQLQDYWSRQGCTIIQPLDMEVGAGTSHPMT
                     CLRALGPEPIACAYVQPSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSL
                     KELGMDPEIHDIRFVEDNWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVT
                     GEITYGLERLAMYIQGVDSVYDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEHADVEF
                     LFHCFEQYEKEAQNLLALEKPLPLPAYERILKAAHSFNLLDARKAISVTERQRYILRI
                     RTLTKAVAEAYYASREALGFPMCQRSENKQG"
     gene            144590..145171
                     /locus_tag="AHA_RS00650"
                     /old_locus_tag="AHA_0129"
                     /db_xref="GeneID:4487509"
     CDS             144590..145171
                     /locus_tag="AHA_RS00650"
                     /old_locus_tag="AHA_0129"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704156.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-3-methyladenine glycosylase I"
                     /protein_id="WP_011704156.1"
                     /db_xref="GeneID:4487509"
                     /translation="MELRCAWVTKDPEYIEYHDKQWGRPVHDSRELFAKLCLDGQQAG
                     LSWITILKRTESYHRAYADFDPVRIAQFDEQDVERLMQDTGIIRNRLKVQSIIKNARA
                     YLALGAEGVDFVDYLWGFVGGAPIVNQRQGNGDIPATSAESDAMSKALKKRGFTFVGS
                     TICYAFMQAVGMVNDHLVTCPCHAECQQGPARQ"
     gene            complement(145248..147284)
                     /locus_tag="AHA_RS00655"
                     /old_locus_tag="AHA_0130"
                     /db_xref="GeneID:4487510"
     CDS             complement(145248..147284)
                     /locus_tag="AHA_RS00655"
                     /old_locus_tag="AHA_0130"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019840757.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bacteriohemerythrin"
                     /protein_id="WP_011704157.1"
                     /db_xref="GeneID:4487510"
                     /translation="MSALLRNVSIRHLLLSASLVILITMALAGLWRSSLTARLGELPN
                     QLIVSANEQIALQELRYHTTQVQQFLTDAAVSGEMDSIGEAEQHAQAARQLLERLPQL
                     KAPLTPLLARQLEIGKRMVDIYLKEGREAGNQLMKQPTEGFDALTDNIASQVEAVLEQ
                     QQHQFQQREQDIRGQSEALQHQDMLQLAVSLAIILLMLLLIYFKTVGPLQHLMGQLVE
                     LANHSHNLTFRLHSQGKDEFAYLAEVFNRFLGNIDSLIGTVQQVSRKTHDKMALLMSH
                     SGSTLSSMQQAQQNTDMLATAINEMTATVHNIEHNTEQASQDTLLTQQQAHDGQRQVS
                     QTISLIRQVADHIEQSAGEVTQLDQESTQIGNILQVIRTISEQTNLLALNAAIEAARA
                     GEQGRGFAVVADEVRQLATRTQAATVDIQQRIEALQHNTRHAVTTMHTTRNVSEQAVS
                     QAAGTGETLTAIVEAITRVNDMNGHIATAAGQQAQVTEETNRNVMEVASIARECLELA
                     RQSRSHTRDMNQANEEIGLISDQFDVSKAGSATQDQELLHWNEAFMVQVSSMDNQHLG
                     LFEAMNRLYQAVLDKSPAQLRKQRLDELLKLATQHFADEERVMEQAGYPELRRHKQEH
                     ARLLAELDTLMQRNGTDDEEFNMELLVFLKNWLLNHISKVDKQYSGTLRQAGIA"
     gene            147537..148193
                     /locus_tag="AHA_RS00660"
                     /old_locus_tag="AHA_0131"
                     /db_xref="GeneID:4487511"
     CDS             147537..148193
                     /locus_tag="AHA_RS00660"
                     /old_locus_tag="AHA_0131"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005307410.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="OmpA family lipoprotein"
                     /protein_id="WP_011704158.1"
                     /db_xref="GeneID:4487511"
                     /translation="MHFKTLVPAVALLVALTGCTTNPYTGESQTSKGAWGALAGAATG
                     AAVGALSSSKGDRKKGILTGVAAGAALGGGIGYYMDVQEAKLREKLQGTGVSVTRNGD
                     QLILNMPNNVTFDSSSAQLKAAGANTLSGVAMVVGEFDKTRLNVVGHTDSTGSRELNM
                     KLSAQRADAVAAQLIGQGVTGSRISTSGVGPDQPVATNSTAEGKAQNRRVTITLTPTA
                     "
     gene            complement(148461..148808)
                     /locus_tag="AHA_RS00665"
                     /old_locus_tag="AHA_0132"
                     /db_xref="GeneID:4487512"
     CDS             complement(148461..148808)
                     /locus_tag="AHA_RS00665"
                     /old_locus_tag="AHA_0132"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017780599.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RidA family protein"
                     /protein_id="WP_011704159.1"
                     /db_xref="GeneID:4487512"
                     /translation="MPAITRIGTTQRWSDVVIHNGTLYVVEVPATDTADIHQQTREVL
                     ESLQRLLEANGSGVDKILMANIYLKDIANIAAFNEQWDAWIPAGTAPVRACVQARLAH
                     EGYKVEVQLTAAV"
     gene            complement(148830..149075)
                     /gene="tusA"
                     /locus_tag="AHA_RS00670"
                     /old_locus_tag="AHA_0133"
                     /db_xref="GeneID:4487513"
     CDS             complement(148830..149075)
                     /gene="tusA"
                     /locus_tag="AHA_RS00670"
                     /old_locus_tag="AHA_0133"
                     /EC_number="2.8.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005320582.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfurtransferase TusA"
                     /protein_id="WP_005307416.1"
                     /db_xref="GeneID:4487513"
                     /translation="MSALFCDATHELDAIGLRCPEPVMMVRKKVRLMADGETLLVSAD
                     DPSTTRDIPSFCRFMDHTLVASETEQAPYRYLIRKGQ"
     gene            149247..149438
                     /locus_tag="AHA_RS00675"
                     /old_locus_tag="AHA_0134"
                     /db_xref="GeneID:4487514"
     CDS             149247..149438
                     /locus_tag="AHA_RS00675"
                     /old_locus_tag="AHA_0134"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005307420.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005307420.1"
                     /db_xref="GeneID:4487514"
                     /translation="MQVSYGRLQAYAGMGFLSFAMIVMGSPIGNTGTWFGSMVMIGLG
                     LWIELSDYYDEDEDENDQS"
     gene            complement(149511..150749)
                     /locus_tag="AHA_RS00680"
                     /old_locus_tag="AHA_0135"
                     /db_xref="GeneID:4487515"
     CDS             complement(149511..150749)
                     /locus_tag="AHA_RS00680"
                     /old_locus_tag="AHA_0135"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017783253.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_011704161.1"
                     /db_xref="GeneID:4487515"
                     /translation="MKWLSFSLIALLSLPVGASQVEVLHWWTSGGEARAVEVLKSEWT
                     EQGNQWNDFAVQGGGGKSAMTVLKSRALAANPPEAAHLKGFELREWAGLGFLRDLTPM
                     AEHLGWYPQLPPMVRETLSQNGALMAVPTGIHRVNWLWLNRKIFERNKLTPPTSWAQF
                     VTVADRLKQQGITPLAIGNEPWQLAVLFETVALGEGGKAFYRKAFVEQDSATLTGPDM
                     VRVLTRFQQLRGYVPEKYAGLKWHQATNLLESGGAAMQIMGDWVKGELSAGNYRPGED
                     IECLPSPGSANLFSYNLDSIAMFKQRDPAQLQAQGELAQLLMTPRFQQEFNRVKGSIP
                     ALTKPDMSKFDRCAIRSYQDFLLAEREGNLLPSMAEGMATPTNMRQAIMDVLSNFFND
                     PRANPQQTALHLERAMRSTR"
     gene            complement(150754..152199)
                     /locus_tag="AHA_RS00685"
                     /old_locus_tag="AHA_0136"
                     /db_xref="GeneID:4487516"
     CDS             complement(150754..152199)
                     /locus_tag="AHA_RS00685"
                     /old_locus_tag="AHA_0136"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017412568.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAMP domain-containing protein"
                     /protein_id="WP_016348991.1"
                     /db_xref="GeneID:4487516"
                     /translation="MNTRWFWRALVPRSLLSRMLLLLLLAILLSQTILTGIWMQQIQK
                     RELEGMLSTTRNLALSAASTVNFFKSLPLQYRHIALDQLRNMGGSRFFVSLNEEEIHI
                     SAIPDSERKTLVLKEVQGVLTRKLSDAMAIKVDFSRPEELHVFNNDTLLADLPSSWAR
                     YTLSLEPINPPVLVTQIEIEPGEWLYLAALLPAPYMTLDDTVMPSNQVRFIALMTVFL
                     CFFTFLLVRWQTRPLRRLAKAAVNLGKDIDQPSLKEEGASEIVAATRAFNIMQHRIRR
                     YIDDRERLFSSISHDLKTPITRLRLRVELLDDEQQIAKFNKDLDELELMVKGALQTVK
                     DTDIHENIEQLDIDAMLEQMAEAMNLHDERLTIEGHCKQPYRGKPLALKRCIGNLVDN
                     GIKYGQRVRIIIMDDEEMLILFIMDEGPGLPEDQFERIFEPYYRLSTDLAGTGLGLGI
                     ARNIAHAHGGDLVLENRPQGGLQATLSLPRQ"
     gene            complement(152251..152973)
                     /locus_tag="AHA_RS00690"
                     /old_locus_tag="AHA_0137"
                     /db_xref="GeneID:4490318"
     CDS             complement(152251..152973)
                     /locus_tag="AHA_RS00690"
                     /old_locus_tag="AHA_0137"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016348992.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator transcription factor"
                     /protein_id="WP_164927505.1"
                     /db_xref="GeneID:4490318"
                     /translation="MSTSKQLLIVDDDQEIRELLNEYLTRAGFEVLTAAEGNEMRKLL
                     AQHNPDLIILDIMMPGDDGFTLCQQIRRDSQVPIIMLTAASDEADRVIGLELGADDYI
                     TKPFSPRELQARIKALLRRAEFRQPEKEKEPSRRLRFAEWTLDTLSHQRTHEDGSLLD
                     LSGSDALLLGMFLQQPGVVLDRDTISDATRGRESLPMERGIDVQISRLRQKLGDNGKS
                     PRIIKTIRGSGYMLIAEVHEIP"
     gene            complement(153298..154461)
                     /gene="fadA"
                     /locus_tag="AHA_RS00695"
                     /old_locus_tag="AHA_0138"
                     /db_xref="GeneID:4490319"
     CDS             complement(153298..154461)
                     /gene="fadA"
                     /locus_tag="AHA_RS00695"
                     /old_locus_tag="AHA_0138"
                     /EC_number="2.3.1.16"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011070436.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA C-acyltransferase FadA"
                     /protein_id="WP_011704164.1"
                     /db_xref="GeneID:4490319"
                     /translation="MKDVVIVDCIRTPMGRSKGGAFRNVRAEDLSAHLMKSILLRNPN
                     LDPNEIEDIYWGCVQQTLEQGFNIARNAALLAGIPKQVGAVTVNRLCGSSMQALHDAS
                     RAIQVGDGDIFIIGGVEHMGHVPMSHGVDFHPGMAKSVAKASGMMGLTAEMLGKLHGI
                     SRQQQDEFAARSHRRAHAATVEGRFAKEIVGLEGHDASGARFFYDYDEVIRPETTVET
                     LSQLRPVFDPVNGTVTAGTSSALSDGAAAMLVMSADRAKALGLTPRAKIRAMAVAGCD
                     AAIMGYGPVPATQKALKRAGLTIGDIDLFELNEAFAAQSLPCVKDLGLQDVVDEKVNL
                     NGGAIALGHPLGCSGARISTTLLNLMEEKDATLGVATMCIGLGQGIATVFERV"
     gene            complement(154483..156630)
                     /gene="fadB"
                     /locus_tag="AHA_RS00700"
                     /old_locus_tag="AHA_0139"
                     /db_xref="GeneID:4490320"
     CDS             complement(154483..156630)
                     /gene="fadB"
                     /locus_tag="AHA_RS00700"
                     /old_locus_tag="AHA_0139"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704165.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fatty acid oxidation complex subunit alpha FadB"
                     /protein_id="WP_011704165.1"
                     /db_xref="GeneID:4490320"
                     /translation="MIYQGETLTVSYLEDGIAELRFDAPGSVNKLDRATLLSLSEAIA
                     ALQQERELKGLILTSGKDAFIVGADITEFLELFDLPQADLLGWLKKANDIFSAIEDLP
                     VPTLSAIKGHALGGGCETILSTDFRLADTSAKIGLPETKLGIMPGFGGTVRLPRVIGA
                     DNALEWITTGKDYRADDALKVGAIDAVVAPDALQSAAVQMIKDAVKGKLDWQGRRAAK
                     KAPLRLSKLEAMMSFTTAAGMVAAVAGKHYPAPMTAVKTVEAAAGMSRDEALAVEAQG
                     FIKLAKTDVAKALVGIFLNDQHIKALAKKAAKQAAKATSHAAVLGAGIMGGGIAYQSA
                     SKGIPAVMKDINEKALALGMGEATKLLNGQLEKGRIDGIKMGQVLSAITPTLSYDNVK
                     HVDVVVEAVVENPKVKAAVLGEVEGIIGEDAVLASNTSTIPISLLAKELKRPQNFCGM
                     HFFNPVHRMPLVEIIRGEQTSDETINRVVAYAAAMGKSPVVVNDCPGFFVNRVLFPYF
                     FGFNKLVADGADFAAVDKVMEKEFGWPMGPAYLLDVVGIDTGHHAGDVMAQGFPARMS
                     KEGRTAIDVMYEVNRFGQKNGKGFYAYEQDKKGKPKKVADAASYELLAPIAKPKQDFD
                     KDAIIARMMIPMINEVVLCLEEGIVATPAEADIALVYGLGFPPFRGGVFRYLDTIGLD
                     RYVAMADQYADLGPLYRVSDKLREMAAQGKTFY"
     gene            complement(156833..158770)
                     /locus_tag="AHA_RS00705"
                     /old_locus_tag="AHA_0140"
                     /db_xref="GeneID:4490321"
     CDS             complement(156833..158770)
                     /locus_tag="AHA_RS00705"
                     /old_locus_tag="AHA_0140"
                     /EC_number="6.2.1.16"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017783251.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetoacetate--CoA ligase"
                     /protein_id="WP_011704166.1"
                     /db_xref="GeneID:4490321"
                     /translation="MHNLCLWQPDQERIQQSNLQHFMAEVNRFHGLQLHSYAQLYQWS
                     VEKTTRFWPLVWQHCGVKGELGNIVAENRQEMQRTRWFPDSRLNFAENLLRRQDDTPA
                     IISRIEGSPSQTLSWRELADQVARLAQWLRGQGIGRGDVVAAYLPNIPQTVVAMLATT
                     SLGAIWTSTSPDFGEASVVERFGQTRPRVLFAVDGYHYNGKAIDIQDKVAGVVGQIDS
                     IEQTVIIPLLGHPLQLGHDWRQILASQPDASLQFEPMAFNDPLYILYSSGTTGKPKCI
                     VHGIGGTLLQHLKEHQLHCDIKPGERIFYFTTCGWMMWNWLVSALASGATLVLYDGSP
                     FYPDGNVLWDLARDEEVALFGTSAKYLDALHKQGYAPIKTHQLPQLRLICSTGSVLSP
                     EGFDYVYQQIKRDVQLSSISGGTDICSCFVIGNPISPVYRGESQGRGLGLAVQVFNEA
                     GQPVQGEKGELVCTKPFPAQPIGFWGDASGDKYHAAYFERFDNIWCHGDWIELTPTGG
                     ILFYGRSDATLNPGGVRIGTSEIYRYVEQLEEVEESIVIGQQWQQDERVVLFVKLKPG
                     LMLDEALRERIRQQVRLHCTARHVPARILQVDAIPRTKSGKIVELAVREVVHNRPVNN
                     THALADPEVLSQYRDRPELAS"
     gene            158961..160283
                     /gene="pepQ"
                     /locus_tag="AHA_RS00710"
                     /old_locus_tag="AHA_0141"
                     /db_xref="GeneID:4490322"
     CDS             158961..160283
                     /gene="pepQ"
                     /locus_tag="AHA_RS00710"
                     /old_locus_tag="AHA_0141"
                     /EC_number="3.4.13.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704167.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Xaa-Pro dipeptidase"
                     /protein_id="WP_011704167.1"
                     /db_xref="GeneID:4490322"
                     /translation="MSSYSQLFAQHLDTLQQRTRDILQQQGLSGLAIHSGQTHRIFLD
                     DQDYPFKVNPQFKAWLPVLDNPHCWLLVDGVNKPVLLFYRPVDFWHKVAELPNAFWVD
                     FFDIRFLTRPEQVADHLPANKQEWAYLGGHLEVAELLGLGQPNPEAVLNYLHYHRAYK
                     TAYELECLRDANRIGVRGHIAAKDSFMAGASEFEINLAYMKAVGQGANEAPYGNIVAI
                     NRNAAILHYTHLSAQRVPDAERYSFLIDAGVDVHGYASDITRTWAWRRGEFADLIAAL
                     DAQQQEIIEEIKPGRRYSELHLQMHHRLARLLQATELVDMSVDEMIHTGVTNVFFPHG
                     LGHFLGLQVHDAGGFMQDERGTHLSAPEQFPYLRCTRVMEVGQVFTIEPGLYFIDSLL
                     EPLRLGEQGKRVNWNKVEALRPYGGIRIEDNVVLHANGVENLTRQAGL"
     gene            160283..160900
                     /locus_tag="AHA_RS00715"
                     /old_locus_tag="AHA_0142"
                     /db_xref="GeneID:4490323"
     CDS             160283..160900
                     /locus_tag="AHA_RS00715"
                     /old_locus_tag="AHA_0142"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005307443.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YigZ family protein"
                     /protein_id="WP_011704168.1"
                     /db_xref="GeneID:4490323"
                     /translation="MAADYSIPAAPLEVSEEIKKSRFITYIAHTPTVEAAKAWIGDIK
                     QQHPGARHHCWAFVAGAPQDSQVYGFSDDGEPSGTAGKPMLAQLMGAGLGEIAAVVVR
                     YYGGVLLGTGGLVKAYGGGVGAALKQLETRIKRQQTASLIQCDYTDMGAVEALIQAHQ
                     GQLLAADYGASVTLQVAWEAAVWSRIAQELTDRTQGRVSLRPLDG"
     gene            160937..162394
                     /locus_tag="AHA_RS00720"
                     /old_locus_tag="AHA_0143"
                     /db_xref="GeneID:4490324"
     CDS             160937..162394
                     /locus_tag="AHA_RS00720"
                     /old_locus_tag="AHA_0143"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002540760.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transporter"
                     /protein_id="WP_011704169.1"
                     /db_xref="GeneID:4490324"
                     /translation="MQILSIIRIVGLLVALFSSTMLLPALVAFGYRDGGGAEFVNSFF
                     IALLLGAALWFPNRHQKKDLRSKEGFLIVVLFWVVLGSVGALPFLLGEVPGMTVSEAF
                     FESFSGLTTTGATVLTGLDNLPKAFLFYRQLLQWLGGMGIIVLAVAILPLLGIGGMQL
                     YRAEIPGPVKDNKVTPRIAETAKALWFIYLLLTSLCALAYWMAGMTLFDAICHSFSTL
                     SVGGFSTHDASIGFFNSPAINLITVVFLLLASVNFALHFMVFAHKPVRLSNYLRDSEL
                     KVFLSIQCVLVLICFVSLLFHGHYATWQEALNHGLFQAVSLGTTTGYSTTSYAEWPSF
                     LPMLLMFSAFIGCCAGSTGGGIKVMRFMILFLQGMRELKRLVHPRAIYTLKLGRRAVP
                     ERIVEAVWGYFATYIILFFIFMLLLLMTGLNEVTAFSAVAAAFTNVGPGLGEVSANFG
                     KISATAQWILVVAMLFGRLEIFTLLVLFTPAFWRS"
     gene            162402..162926
                     /gene="hemG"
                     /locus_tag="AHA_RS00725"
                     /old_locus_tag="AHA_0144"
                     /db_xref="GeneID:4490325"
     CDS             162402..162926
                     /gene="hemG"
                     /locus_tag="AHA_RS00725"
                     /old_locus_tag="AHA_0144"
                     /EC_number="1.3.5.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017410859.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="menaquinone-dependent protoporphyrinogen IX
                     dehydrogenase"
                     /protein_id="WP_024945460.1"
                     /db_xref="GeneID:4490325"
                     /translation="MDKILVLYSSRDGQTRKIVDAMLAETEGCEVVMQDLHSLPKCNL
                     SKFKKVLIGASIRYGNFHPSLFSFIHAHHEQLEVANAAFFCVNLTARKPEKQTPQTNA
                     YMKKFLRLSPWKPKTLGVFAGALQYSRYNWWQTRIIQLIMKITGGSTDTSKDLEFTDW
                     EKVRGFARDFWSKR"
     gene            163371..164921
                     /locus_tag="AHA_RS00730"
                     /old_locus_tag="AHA_0145"
                     /db_xref="GeneID:4490326"
     rRNA            163371..164921
                     /locus_tag="AHA_RS00730"
                     /old_locus_tag="AHA_0145"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:4490326"
     gene            165116..165191
                     /locus_tag="AHA_RS00735"
                     /old_locus_tag="AHA_0146"
                     /db_xref="GeneID:4490327"
     tRNA            165116..165191
                     /locus_tag="AHA_RS00735"
                     /old_locus_tag="AHA_0146"
                     /product="tRNA-Glu"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:165150..165152,aa:Glu,seq:ttc)
                     /db_xref="GeneID:4490327"
     gene            165420..168337
                     /locus_tag="AHA_RS00740"
                     /old_locus_tag="AHA_0147"
                     /db_xref="GeneID:4490328"
     rRNA            165420..168337
                     /locus_tag="AHA_RS00740"
                     /old_locus_tag="AHA_0147"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:4490328"
     gene            168433..168547
                     /gene="rrf"
                     /locus_tag="AHA_RS00745"
                     /old_locus_tag="AHA_0148"
                     /db_xref="GeneID:4490329"
     rRNA            168433..168547
                     /gene="rrf"
                     /locus_tag="AHA_RS00745"
                     /old_locus_tag="AHA_0148"
                     /product="5S ribosomal RNA"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00001"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="RFAM:RF00001"
                     /db_xref="GeneID:4490329"
     gene            complement(168638..171214)
                     /locus_tag="AHA_RS00750"
                     /old_locus_tag="AHA_0149"
                     /db_xref="GeneID:4490330"
     CDS             complement(168638..171214)
                     /locus_tag="AHA_RS00750"
                     /old_locus_tag="AHA_0149"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017411121.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional acetate--CoA ligase family
                     protein/GNAT family N-acetyltransferase"
                     /protein_id="WP_011704171.1"
                     /db_xref="GeneID:4490330"
                     /translation="MKPSGLDRLFKPQSIAVIGASTDPQKAGHVVIRHLLAGQFKGPI
                     LPVSPHSTAIAGVLAYGDIDSLPLAPDLAIVCTRRERVLTLIEALGKRGAGAAIILAA
                     DFTAPEREQLQQLSQQYGIRLLGPNSMGMLLPGQGINASFSPIAAKPGQVAFLSQSAA
                     VSTTILDWAKQHELGFSAFISLGDHCDINFGQLLDQLSRDSVTRAILLYMDKLQDARH
                     FLSAARAASRNKPILVLKSGRHEPDNGLDNVYDAAIRRAGMLRVRDTHELFAAVETLS
                     HSLTLKGERLAIISNGRGLANMAIDKLLERGGKLAMPPRDIGSDADINDYQQALDDLL
                     QGDEADAILLIHAPSLTARGAALARSLIDYVKQHPRARRFNILTNWAGEYSAQEGRRL
                     FSEAGFPTYRTPESAVAAFMHMVEYRRNQKQLMETPASLQGDRLNLELCQQLIRQALE
                     RKQLTLDTHLAHPILQAAGLSTLPTWIVSDAIEATLTAEQIGYPVAVKLRSPDILHKS
                     AVHGVMLNLRTSAEVAQAADAILDRVRQHDPSARIEGLLVQRMARRSGGLELRIRLQQ
                     DPVFGPVILLGESGAEPQEMMAALPPLNQALARYQIIGALKSRKIREQASPERLDIDA
                     LGQVLCQLSELLLAFPEIQQLDLHPLQACGAEMVVLDASLTLQPAEEGRCRLAIRPYP
                     TELEEGAWLKDQSHVLLRPIRPEDEPAHKQFVLKVSDEDRYKRFFADVGELGHEELAR
                     MTQIDYDREMAFVAVGQDGPFDQQILGVVRAISNPDLSDAEFAILVRSDLKGLGLGKL
                     MMEKIVRYARERGIGQLSGMTMPSNRGMINLAKRLGFKIDIQLEDGVVNMELPCASQG
                     QA"
     gene            complement(171287..171478)
                     /locus_tag="AHA_RS00755"
                     /old_locus_tag="AHA_0150"
                     /db_xref="GeneID:4490331"
     CDS             complement(171287..171478)
                     /locus_tag="AHA_RS00755"
                     /old_locus_tag="AHA_0150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005321308.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011704172.1"
                     /db_xref="GeneID:4490331"
                     /translation="MMPHLIEINSSLLFDEYLQSLGVPQTQLDQEQDIYLQERHLAAV
                     RQIQGELKFYLRASALTRQ"
     gene            171648..172520
                     /locus_tag="AHA_RS00760"
                     /old_locus_tag="AHA_0152"
                     /db_xref="GeneID:4490332"
     CDS             171648..172520
                     /locus_tag="AHA_RS00760"
                     /old_locus_tag="AHA_0152"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019840081.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter substrate-binding domain-containing
                     protein"
                     /protein_id="WP_011704173.1"
                     /db_xref="GeneID:4490332"
                     /translation="MIRIWLCCVMLLAGSVPAAEVPIRAWNLLLDHPNPAVAALLRLS
                     LDLTVPEYGPYRLIASPPMEQGRAVKELQSGELVQIGVFAPDEERERTLLAIHVPLAK
                     GLLGWRVCLIRQGDEGRFANIRSLTDWQQAGLRIGQHRSWPDTRLLKENGLNVVVGSL
                     YDALFNMLRKQRFDCFLRSVIEIEEELKQHPELAIEPHLVFRYPLALLFFVSPKYPEL
                     AKRIELGLQRARQSGDYERVFEAGFGSTIRRLQLDRRVMLELSNPDLPAGSRAMMQDP
                     SLIYAPALSAVSAQ"
     gene            complement(172509..173402)
                     /gene="ilvY"
                     /locus_tag="AHA_RS00765"
                     /old_locus_tag="AHA_0151"
                     /db_xref="GeneID:4490333"
     CDS             complement(172509..173402)
                     /gene="ilvY"
                     /locus_tag="AHA_RS00765"
                     /old_locus_tag="AHA_0151"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005321302.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HTH-type transcriptional activator IlvY"
                     /protein_id="WP_011704174.1"
                     /db_xref="GeneID:4490333"
                     /translation="MDLRNLELFLHLADSLHFGKSADAMAVSPSTLSRAIQRLEQETG
                     CILFERDNRSVRLTPAGEKLREFGGALLQEWRQLKQELRRSDEPLQGRLRVFCSVTAS
                     YFLLPEVLERFRRRYPQLEIKLETGDPALAVDKILTDEADLAIAARPDALSSKLEFAS
                     LQQVPLVFIAPRTAPQQSQWFSQGEPDWERLPLILSEQGLARKRCDQWLRNKGIAPNI
                     YAEVAGNEGIVAMVALGFGVGLVPAAVIDHSPMGEKVRIVEPKPALKPFDVGIAVLKK
                     RLEEPLIRAFWDTARGQGSLR"
     gene            173624..175105
                     /gene="ilvC"
                     /locus_tag="AHA_RS00770"
                     /old_locus_tag="AHA_0153"
                     /db_xref="GeneID:4490334"
     CDS             173624..175105
                     /gene="ilvC"
                     /locus_tag="AHA_RS00770"
                     /old_locus_tag="AHA_0153"
                     /EC_number="1.1.1.86"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005133363.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ketol-acid reductoisomerase"
                     /protein_id="WP_011704175.1"
                     /db_xref="GeneID:4490334"
                     /translation="MANYFNTLNLRQQLAQLGKCRFMQREEFADGCNVLKGKKVVIVG
                     CGAQGLNQGLNMRDSGLDISYALRKAAITEKRASWQKATDNGFAVGTYEELIPTADLV
                     LNLTPDKQHSDVVKTVMPLMKQGAALGYSHGFNVVEEGQQIRADITVVMVAPKCPGTE
                     VREEYKRGFGVPTLIAVHPENDPKGEGMAIAKAWASATGGDRAGVLESSFVAEVKSDL
                     MGEQTILCGMLQAGSLLCYDKLVAEGTDPAYAGKLIQFGWETITEALKQGGISLMMDR
                     LSNPAKLRAFELSEQLKTLMRPLFEKHMDDIIAGEFSRGMMADWAEDDAKLFGWREET
                     GKSAFENAPAFAGKIAEQEYFDNGVVMVAMVKAGVELAFETMVASGIYEESAYYESLH
                     ELPLIANTVARKRLYEMNVVISDTAEYGNYLFANAAVPLLREHFMPTLKAGDLGASKA
                     EGQSVDNLALLAANEATRNHPIEKIGQVLRGYMKDMKRIAVGG"
     gene            complement(175254..176903)
                     /gene="pgi"
                     /locus_tag="AHA_RS00775"
                     /old_locus_tag="AHA_0154"
                     /db_xref="GeneID:4490335"
     CDS             complement(175254..176903)
                     /gene="pgi"
                     /locus_tag="AHA_RS00775"
                     /old_locus_tag="AHA_0154"
                     /EC_number="5.3.1.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010635529.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-6-phosphate isomerase"
                     /protein_id="WP_011704176.1"
                     /db_xref="GeneID:4490335"
                     /translation="MKNINPTQTQAWQALEAHFAANKETRLKDLFAQDPKRFDKFSLT
                     FGGDILVDYSKNLITEETLKLLVDLAKETDLRSAIDAMFNGDKINMTEGRSVLHVALR
                     NRSDRPIECDGKDVMPEVNAVLAKMKGFCEKIISGEWKGYTGKAIQHVVNIGIGGSDL
                     GPVMITEALRPYKNHLQMHFVSNVDGTHIAETLKKIDPETTLFLVASKTFTTQETMTN
                     ALTARDWFIKIAGDKAHVAKHFAALSTNGKAVAEFGIDTNNMFEFWDWVGGRYSSWSA
                     IGMPIALSVGFENFEALLQGAFEMDMHFATASYEQNVPVLLALIGLWYNNFYGAESEA
                     ILPYDQYMHRFPAYFQQGNMESNGKYVDRNGKPVDYQTGPIIWGEPGTNGQHAFYQLI
                     HQGTKLIPCDFLAPAISHNPIGDHHPKLLANFFAQTEALAFGKSKEQVEAEFLAAGKT
                     LEQVKDLVPFKVFEGNRPTNSILFKSLTPKTLGALIAMYEHKIFVQGAIWNIFSFDQW
                     GVELGKQLANKILPELNTDAAVTSHDCSTNGLINTWKAWKA"
     gene            177320..177508
                     /locus_tag="AHA_RS00780"
                     /old_locus_tag="AHA_0155"
                     /db_xref="GeneID:4490336"
     CDS             177320..177508
                     /locus_tag="AHA_RS00780"
                     /old_locus_tag="AHA_0155"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005307469.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="holin"
                     /protein_id="WP_005323764.1"
                     /db_xref="GeneID:4490336"
                     /translation="MKAVLSLFALSLIATGLIGLLTMVLTSAAPTLPLRVLAVIGAVL
                     GGYVLVQPLLNRVARRLV"
     gene            complement(177635..178471)
                     /locus_tag="AHA_RS00785"
                     /old_locus_tag="AHA_0156"
                     /db_xref="GeneID:4490337"
     CDS             complement(177635..178471)
                     /locus_tag="AHA_RS00785"
                     /old_locus_tag="AHA_0156"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019446533.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mechanosensitive ion channel"
                     /protein_id="WP_011704177.1"
                     /db_xref="GeneID:4490337"
                     /translation="MEPEIITEAQTWLVNNQGLLIEYAVNIAAALITLLVGYIAANLI
                     SSAVVKVMQARKLDTTVTHFVGSILKYAILVFVVIAALGRVGVQTASFVAIIGAAGLA
                     IGLALQGSLSNFAAGFLLIIFRPIKAGEFIEVAGTNGVVQSVQLFTTTLTSGDNKMVV
                     VPNSAILNGTIVNYSRMDTRRVDMTFGIGYGSDLRKAKQILERLVSEEPRILKEPAAT
                     IAVAALADSSVNIVVRPWVKTGDYWGVWFDFHEKVKLTFDAEGIEIPFPQMVMHMQKP
                     QA"
     gene            complement(178658..179254)
                     /gene="slmA"
                     /locus_tag="AHA_RS00790"
                     /old_locus_tag="AHA_0157"
                     /db_xref="GeneID:4487420"
     CDS             complement(178658..179254)
                     /gene="slmA"
                     /locus_tag="AHA_RS00790"
                     /old_locus_tag="AHA_0157"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012157032.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoid occlusion factor SlmA"
                     /protein_id="WP_011704178.1"
                     /db_xref="GeneID:4487420"
                     /translation="MASSNQKQSRRDQILQALAHMLETSPGQRITTARLAAEVGVSEA
                     ALYRHFPSKARMFEGLIDFIEDSLLSRVNLIMAEEKDTMARCHHILQLLLVFAERNPG
                     ITRILNGDALLGEHDRLRDRISVLFDKLETQIKQVLREKRLREGQGFQLDETMLANLL
                     LAYTEGRISQFVRSEFKIKPTAGFEDQWQFIRSQLLQS"
     gene            complement(179324..179782)
                     /gene="dut"
                     /locus_tag="AHA_RS00795"
                     /old_locus_tag="AHA_0158"
                     /db_xref="GeneID:4487421"
     CDS             complement(179324..179782)
                     /gene="dut"
                     /locus_tag="AHA_RS00795"
                     /old_locus_tag="AHA_0158"
                     /EC_number="3.6.1.23"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005321291.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dUTP diphosphatase"
                     /protein_id="WP_011704179.1"
                     /db_xref="GeneID:4487421"
                     /translation="MTTQIELKILDARIGTEYPLPAYATPGSAGMDLRALLDAPLTLA
                     PGDTTLVPTGLAIHIQDPGLCATILPRSGLGHKHGIVLGNLVGLIDSDYQGQLMVSVW
                     NRGNDNFTMQPGERIAQLVIMPVVQASFQLVDEFNQSERGEGGFGSSGRQ"
     gene            complement(179823..181025)
                     /gene="coaBC"
                     /locus_tag="AHA_RS00800"
                     /old_locus_tag="AHA_0159"
                     /db_xref="GeneID:4487422"
     CDS             complement(179823..181025)
                     /gene="coaBC"
                     /locus_tag="AHA_RS00800"
                     /old_locus_tag="AHA_0159"
                     /EC_number="4.1.1.36"
                     /EC_number="6.3.2.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005339500.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional phosphopantothenoylcysteine
                     decarboxylase/phosphopantothenate--cysteine ligase CoaBC"
                     /protein_id="WP_011704180.1"
                     /db_xref="GeneID:4487422"
                     /translation="MRLADKRILLGVSGGIAAYKSAELVRRLKDQGAEVRVVMTRSAK
                     EFITPLTLQAVSGHPVADSLLDPAAEAGMGHIELAKWADLVLIAPASANLMARMAAGM
                     ADELLTTLCLATPAPVALAPAMNQQMYLNAATQANLKTLASRGILLWGPDSGSQACGD
                     VGPGRMLDPLELVELCCQQLAAEPLLAGVRLLLTAGPTREALDPVRYISNHSSGKMGY
                     AIARAAREAGAEVTLVSGPVALAPPAGVTRVDVESAEQMHQAVMSRVGECDLFIGCAA
                     VADYRPAQVANQKIKKTGDNDQMQLTLVKNPDIIAAVGALSDKPFTVGFAAETVDVEQ
                     YALDKLQRKRLDMIAANDVSRAGQGFNADDNALTVFWQGGQAPLPLADKLTLARHLIA
                     LIADHYRH"
     gene            181173..181847
                     /locus_tag="AHA_RS00805"
                     /old_locus_tag="AHA_0160"
                     /db_xref="GeneID:4487423"
     CDS             181173..181847
                     /locus_tag="AHA_RS00805"
                     /old_locus_tag="AHA_0160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010676114.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="JAB domain-containing protein"
                     /protein_id="WP_011704181.1"
                     /db_xref="GeneID:4487423"
                     /translation="MSIKEWPEDERPREKLLRQGPGGLSDAELLAIFLRTGVSGLSAV
                     DLSRHLLQQFGSLRALLGAEQRAFCAAHGLGPAKYAQLQAVLEMGKRHLAEQLQRGDP
                     LTSPQLTRDYLQAQLRDRPREVFALLLLDNQHRVIQFVELFYGTLDSASVWPREIVQI
                     ALKHNAAAVILAHNHPSGVAEPSRADRQITDRITAALALIDIRVLDHLVIGDGITVSF
                     AERGWL"
     gene            181984..182220
                     /gene="rpmB"
                     /locus_tag="AHA_RS00810"
                     /old_locus_tag="AHA_0161"
                     /db_xref="GeneID:4487424"
     CDS             181984..182220
                     /gene="rpmB"
                     /locus_tag="AHA_RS00810"
                     /old_locus_tag="AHA_0161"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018347033.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L28"
                     /protein_id="WP_005307492.1"
                     /db_xref="GeneID:4487424"
                     /translation="MSRVCQVTGKRPAVGNNRSHANNATKRRFLPNLHTHRFWVESEK
                     RFVSLRVSAKGMRIIDKRGVEVVLAELRASGVKV"
     gene            182232..182399
                     /gene="rpmG"
                     /locus_tag="AHA_RS00815"
                     /old_locus_tag="AHA_0162"
                     /db_xref="GeneID:4487425"
     CDS             182232..182399
                     /gene="rpmG"
                     /locus_tag="AHA_RS00815"
                     /old_locus_tag="AHA_0162"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010847629.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L33"
                     /protein_id="WP_005307500.1"
                     /db_xref="GeneID:4487425"
                     /translation="MAKGIREKIRLNSSAGTGHFYTTTKNKRTMPEKMEIKKFDPVVR
                     QHVIYKEGKIK"
     gene            182493..182948
                     /locus_tag="AHA_RS00820"
                     /old_locus_tag="AHA_0163"
                     /db_xref="GeneID:4487426"
     CDS             182493..182948
                     /locus_tag="AHA_RS00820"
                     /old_locus_tag="AHA_0163"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017788283.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011704182.1"
                     /db_xref="GeneID:4487426"
                     /translation="MFKLSRKGWNNVIIVVVLIVITLLHRLELAQQENSAKRARPLLP
                     DSAVVLTWQGPSWQIERIGQGWRSGPDLGLSSAQLAAHIEAWQGWLLPPGESVRGNPV
                     TLKIWVAGQTDPIEVGLYQDSGKFAALLPPSTWLSLSQEQYRSLLRPAP"
     gene            182978..183790
                     /gene="mutM"
                     /locus_tag="AHA_RS00825"
                     /old_locus_tag="AHA_0164"
                     /db_xref="GeneID:4487427"
     CDS             182978..183790
                     /gene="mutM"
                     /locus_tag="AHA_RS00825"
                     /old_locus_tag="AHA_0164"
                     /EC_number="3.2.2.23"
                     /EC_number="4.2.99.18"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010676112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional DNA-formamidopyrimidine
                     glycosylase/DNA-(apurinic or apyrimidinic site) lyase"
                     /protein_id="WP_011704183.1"
                     /db_xref="GeneID:4487427"
                     /translation="MPELPEVEVSRQGISPWLTGIKVTRVVVRDGRLRWPVPGEIQEL
                     VDLTIHRVSRRAKYLLLETDFGTAILHLGMSGSLRVLDIGTPAEKHDHVDIELANGKL
                     LRLNDPRRFGALLWTREPAEAHALLAKLGPEPLTDAFNADYLRERAKGRSTAIKTFLM
                     DNQVVVGVGNIYANEALYAAGIHPKRAAGNISAERLGTLVAEIKRVLAEAIRQGGTTL
                     KDFTSADGKPGYFVQQLQVYGRGGQPCFHCHTLLSEIRLGQRTTVFCSHCQR"
     gene            183969..184850
                     /locus_tag="AHA_RS00830"
                     /old_locus_tag="AHA_0165"
                     /db_xref="GeneID:4487428"
     CDS             183969..184850
                     /locus_tag="AHA_RS00830"
                     /old_locus_tag="AHA_0165"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017788284.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF535 domain-containing protein"
                     /protein_id="WP_011704184.1"
                     /db_xref="GeneID:4487428"
                     /translation="MARFLYPDDSARKTFNRAKFVLRSLLYRQQLSRVFELFQAEPLK
                     ALPAHYPELLDKPMRPYRFAGSTATERAEMLENHYRLMLARYPDLIDPLYLGDGIELG
                     RYPESGCRIVLRHDGTFRREAELALSIVDPQGKRLYSCAFSLAGTPNRLAVVIGSVQG
                     PEPCIEQAQDKVRALTKEGHGLRPKSLVVMLVMELAEAMQAEHISAVRMKAHIYQARR
                     YSKKKKACLQADYDELWQEFGAIDLDSNFVRLQPAQRKPLEEIASKKRAMYRRRYEWL
                     DQLTLASQQLLGPRLAG"
     gene            complement(184904..185386)
                     /gene="coaD"
                     /locus_tag="AHA_RS00835"
                     /old_locus_tag="AHA_0166"
                     /db_xref="GeneID:4487429"
     CDS             complement(184904..185386)
                     /gene="coaD"
                     /locus_tag="AHA_RS00835"
                     /old_locus_tag="AHA_0166"
                     /EC_number="2.7.7.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005321264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pantetheine-phosphate adenylyltransferase"
                     /protein_id="WP_011704185.1"
                     /db_xref="GeneID:4487429"
                     /translation="MTNKVIYPGTFDPVTNGHTDLIGRAAKLFDEVVVGVANSPSKRP
                     LFDLDERVQLARQVTAHLPNVKVVGFSGLLVDFAREQQANVLIRGLRAVSDFEYEFQL
                     ANMNRRLMPELESVFLTPAEENSFISSTLVKEVALHGGDIRQFVDPAVAAAIKAKQTK
                     "
     gene            185610..186653
                     /locus_tag="AHA_RS00840"
                     /old_locus_tag="AHA_0167"
                     /db_xref="GeneID:4487430"
     CDS             185610..186653
                     /locus_tag="AHA_RS00840"
                     /old_locus_tag="AHA_0167"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 9 protein"
                     /protein_id="WP_011704186.1"
                     /db_xref="GeneID:4487430"
                     /translation="MKRILVVRNDKIGDFMLAWPSFAMLKRSMECHVTALVPAYTAPL
                     ARLCPWIDEIILDPGSRADKEQQRALQARIKAAAFDASICLFSNSRNAMLVWKAHIPY
                     RLAPATKLAQVLYNQRLIQRRSRSQKPEYEYNLDLVRRFLADQQVSAVEPQGPYLSFD
                     AKSLQQVREQVAARLRLDAGRPWLMVHAGSGGSANNLSIEQYARLIIKLNQACPELQC
                     ILTAGPGEERIAEQLAAELLAHGGNGWIYRSDEGLPKFCQVMANAALFVAGSTGPLHI
                     AAALDVPTIGFFPAHRSATPLRWRPLNSEGRHLAFSPPEDSDHPEDMSQLDPKTMAAA
                     IARWAPPFWRTEH"
     gene            complement(186723..187511)
                     /locus_tag="AHA_RS00845"
                     /old_locus_tag="AHA_0168"
                     /db_xref="GeneID:4487431"
     CDS             complement(186723..187511)
                     /locus_tag="AHA_RS00845"
                     /old_locus_tag="AHA_0168"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017788286.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 2 protein"
                     /protein_id="WP_011704187.1"
                     /db_xref="GeneID:4487431"
                     /translation="MNKPTLAAVLIVKNEAENLRPCLASLDGLVDEIVIMDSGSQDET
                     PTIAAEFGARFFVNPVWPGFGRQRRLAQSHVQSDWVLWLDADERLTPELKAAIAAVMA
                     NPASDTIYSIPRLSWVFGRFIRHSGWYPDRVLRLYPKALTSYNEVLVHEKVEVRANMK
                     IVNLHGDLLHFTYRDLEHYLVKSAGYARAWADQRTARGKKGSLSQGLVHALGCFLKMY
                     LLKAGFLDGKQGLLLAILSAHSTFVKYADLWIRQQPQAPDQADK"
     gene            187753..188868
                     /gene="waaF"
                     /locus_tag="AHA_RS00850"
                     /old_locus_tag="AHA_0169"
                     /db_xref="GeneID:4487432"
     CDS             187753..188868
                     /gene="waaF"
                     /locus_tag="AHA_RS00850"
                     /old_locus_tag="AHA_0169"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017786118.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipopolysaccharide heptosyltransferase II"
                     /protein_id="WP_011704188.1"
                     /db_xref="GeneID:4487432"
                     /translation="MKILVIGPSWVGDMVMSQSLYKAIKANHPDSELHVMAPAWCGAL
                     LERMPEVDKAIPMPLGHGDFKLGARRRLGKQLAAEKYDQAIIQPNSMKSALIPWFARI
                     PVRTGWKGEHRFGLLNDMRSNKSAFPLMVEAYLALAYPKAQMKSRADIPTIPQPALNV
                     DLINQEKALERLGLDRARPVLVLCPGAEFGPAKRWPEGHYAVVAQKHLDEGWQVWIFG
                     SAKDSAVANTIRDRINPLSRPNCHVLAGKTNLYEAIDLMALAGRVIANDSGLMHVAAA
                     LNRPLIGVYGSTSPLYTPPLADRVEIVHTDIECRPCFKRTCKFGHLKCLIELMPEQVI
                     EAGRRLECSETPAPPLALPPGEPPRFVAEPGKRGEPH"
     gene            188870..190135
                     /locus_tag="AHA_RS00855"
                     /old_locus_tag="AHA_0170"
                     /db_xref="GeneID:4487433"
     CDS             188870..190135
                     /locus_tag="AHA_RS00855"
                     /old_locus_tag="AHA_0170"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010635519.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-D-manno-octulosonic acid transferase"
                     /protein_id="WP_011704189.1"
                     /db_xref="GeneID:4487433"
                     /translation="MGYRLLYNLLIHLGLPLALLALYKPKKGKPGFGKRWAEHLGRTP
                     ATGQEAPLWIHAVSVGETLAISPFIRALKAERPDLPILLTTTTRTGAEQAARLGDLVE
                     HRYAPLDYPWAVAAFLNAVKPRALWVMETELWPNWLAACEERHLPVTIINARLSERSC
                     RRYGRFQGAFDALSQPLTHLLCQHQDDADRFHRLGLGRERLAVTGSIKFDIQLDEQVQ
                     ARGRALRQLLGAERPVWIAASTHQGEDEQVLAAFDRVLAAQPSALLILVPRHPERFER
                     VAALCAPYGCVRRTAGGAVGEHDKVYLGDTMGELPLMLAAADVAFVGGSLVKVGGHNL
                     LEPAALGKPCLSGPAYFNFSDITRQLVAQGGAAVVADAAALGEQVSALLADESRRREM
                     GEQARAVVLRNQGALARTLSHCLASLEND"
     gene            complement(190206..191462)
                     /locus_tag="AHA_RS00860"
                     /old_locus_tag="AHA_0171"
                     /db_xref="GeneID:4487434"
     CDS             complement(190206..191462)
                     /locus_tag="AHA_RS00860"
                     /old_locus_tag="AHA_0171"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349012.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS ascorbate transporter subunit IIC"
                     /protein_id="WP_011704190.1"
                     /db_xref="GeneID:4487434"
                     /translation="MEFFNFLMFDVLSEPAVLVGLIALIGLIAQKKPVTECIKGTVKT
                     IMGFVILGAGATLVVNSLGDFATIFQHAFGIKGVVPNNEAIVSIAQQSFGKEMAMIMF
                     FAMLVNILIARLTPWKFIFLTGHHTLFMSMMVAAILSAGGMSGIPLIAVGSLVVGVTM
                     VLFPALAHPYMKQITGSDDVALGHFSTCSYVLAGWIGAKFGNKAHSSEEVQVPKSLLF
                     LRDTPVAISFTMGIIFLITSAFAGPEFVASVAKGKHWFMFSLMQSITFAAGVYVILQG
                     VRMVIAEIVPAFKGISDKLVPNAKPALDCPIVFPYAPNAVLIGFLSSFAAGLVGMVLL
                     YLLGLTVIIPGVVPHFFVGAAAGVFGNATGGRRGALLGAFANGLLITFLPVFLLPVLG
                     DLGFANTTFSDADFGVVGILLGLIVR"
     gene            complement(191523..191810)
                     /locus_tag="AHA_RS00865"
                     /old_locus_tag="AHA_0172"
                     /db_xref="GeneID:4487435"
     CDS             complement(191523..191810)
                     /locus_tag="AHA_RS00865"
                     /old_locus_tag="AHA_0172"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005307531.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS sugar transporter subunit IIB"
                     /protein_id="WP_026142047.1"
                     /db_xref="GeneID:4487435"
                     /translation="MKILVVCGHGLGTSLMMEMSIKSILKELAVTAEVDHRDLASAGS
                     ERAEIFVATRDIAEQLVSMGVDGRLVSLDNMVDKAAMKEKLAIALRELGAL"
     gene            complement(191843..192286)
                     /locus_tag="AHA_RS00870"
                     /old_locus_tag="AHA_0173"
                     /db_xref="GeneID:4487436"
     CDS             complement(191843..192286)
                     /locus_tag="AHA_RS00870"
                     /old_locus_tag="AHA_0173"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005894035.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS sugar transporter subunit IIA"
                     /protein_id="WP_005307534.1"
                     /db_xref="GeneID:4487436"
                     /translation="MLTQLLTEEVISIEAGARDWRHAIELATAPLLANGTIEPSYVAA
                     LYRSHEELGPYYVLGPGLAMPHARPEDGVNRLGLALTVLKEGVNFGSEGNDPVRLLVT
                     LAASDSNSHVETIAQLAELFMNEEDVAAIMAATSKDDILRILARY"
     gene            192539..193561
                     /locus_tag="AHA_RS00875"
                     /old_locus_tag="AHA_0174"
                     /db_xref="GeneID:4487437"
     CDS             192539..193561
                     /locus_tag="AHA_RS00875"
                     /old_locus_tag="AHA_0174"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017788291.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family DNA-binding transcriptional
                     regulator"
                     /protein_id="WP_011704192.1"
                     /db_xref="GeneID:4487437"
                     /translation="MSEAKKRRSTGRVTLNDVAQLAGVGAMTVSRALRTPELVSDKMR
                     ERIEAAVDELGYIPNRAAGALASATSQTIVVIVPSLTECGCGEVIAGLQQTLRGEGYQ
                     IMLGDAQHLKQQEESLLTSFLQHNPAAVVLFGSDPGETIRQRLQAARLPVVEVGAMAR
                     SPIDMNVGVSNFDAGYQLTRHLIERGYRNIGFLCARQEQWMLQQRMQGWQKALLDNYL
                     SPDAIINTSERPSFSTGAAMLGEFLLRWPELDALVCVNDELAAGVLFECQRRHLNVPG
                     KLAIAGFDDLDVARACYPALTSVRIPYQRMGEEAADLILRQLVGEPVMGSALTLDFQL
                     QKRQSS"
     gene            193591..194571
                     /locus_tag="AHA_RS00880"
                     /old_locus_tag="AHA_0175"
                     /db_xref="GeneID:4487438"
     CDS             193591..194571
                     /locus_tag="AHA_RS00880"
                     /old_locus_tag="AHA_0175"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006233331.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_011704193.1"
                     /db_xref="GeneID:4487438"
                     /translation="MFKALLLENQDGKTVPTLTRLDESQLPAGEVRVAVSYSSLNYKD
                     GLAITGKGKIVRQWPLVPGIDFAGTVLESADDRYQPGDKVVLTGWGVGEGHWGGMAEQ
                     ARVKADWLVPLPAGLDERQAMCIGTAGLTAMLCVLALEEAGVTPQSGEILVTGAAGGV
                     GSTAVALLAALGYQVAALTGRPEAQGELLTALGASRIVPRSELLEPAKPLEKQLWAGA
                     VDTVGSQVLAKLLAQMNYGGAVAACGLAGGFDLPTSVMPFILRNVRLQGVDSVMCPLA
                     RRQLAWQRLARDLPASFFAQAVTEIGLEQVAEAAEAITQGQIAGRTLVKL"
     gene            194904..195239
                     /locus_tag="AHA_RS00885"
                     /old_locus_tag="AHA_0177"
                     /db_xref="GeneID:4486807"
     CDS             194904..195239
                     /locus_tag="AHA_RS00885"
                     /old_locus_tag="AHA_0177"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005342063.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2799 domain-containing protein"
                     /protein_id="WP_016349018.1"
                     /db_xref="GeneID:4486807"
                     /translation="MRLSVIVFAVLLGGCASHSDDPCEKVWSEVGEADGKLGFTAERV
                     EFHQAQCGEKVDAELWKQGHQKGLAWYCRPEHLYLAGRSGGEYRGVCPNDVQARRLFE
                     QGRQGWTDQ"
     gene            complement(195253..195423)
                     /locus_tag="AHA_RS21655"
                     /old_locus_tag="AHA_0178"
                     /db_xref="GeneID:44157217"
     CDS             complement(195253..195423)
                     /locus_tag="AHA_RS21655"
                     /old_locus_tag="AHA_0178"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005307551.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_162852082.1"
                     /db_xref="GeneID:44157217"
                     /translation="MGNKTLCEWRRSEIPADLKTLRKIVRKPKFVCGKCARSANDKSY
                     LCQPLRLKEKEV"
     gene            complement(195529..195963)
                     /gene="fliL"
                     /locus_tag="AHA_RS00890"
                     /old_locus_tag="AHA_0179"
                     /db_xref="GeneID:4486809"
     CDS             complement(195529..195963)
                     /gene="fliL"
                     /locus_tag="AHA_RS00890"
                     /old_locus_tag="AHA_0179"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005339527.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body-associated protein FliL"
                     /protein_id="WP_011704197.1"
                     /db_xref="GeneID:4486809"
                     /translation="MKLFKFLLVLLLSCGALQAYASEGGEAPAEGEAAAAKPGFFYHL
                     LDPDIITNYLSDGKTLGYVRVTVELMAENEADLKLLEQHDPLIRDAIIRLMGSKSADQ
                     IKSLVSREDLRKECQTRANELLVKETGKKAVRELIFTKFLYQ"
     gene            196109..196645
                     /locus_tag="AHA_RS00895"
                     /old_locus_tag="AHA_0180"
                     /db_xref="GeneID:4486810"
     CDS             196109..196645
                     /locus_tag="AHA_RS00895"
                     /old_locus_tag="AHA_0180"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017786112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chorismate lyase"
                     /protein_id="WP_011704198.1"
                     /db_xref="GeneID:4486810"
                     /translation="MKSELTVPLARLVPWQTPAQCEPPEALLPWLLEADSMTRRLRRH
                     NRHFSVQLFGNRSVALDADEQQLVVAEQPMGLCREVILHGDHGPAVLGWTLFAEAALQ
                     ESGLRELGEQPLGERIFGDEPARRDHLQLACFEIASNPWCPAGTVWGRRSRLFLGQWP
                     LLVHELFLPSLSCNKELE"
     gene            196624..197505
                     /gene="ubiA"
                     /locus_tag="AHA_RS00900"
                     /old_locus_tag="AHA_0181"
                     /db_xref="GeneID:4486811"
     CDS             196624..197505
                     /gene="ubiA"
                     /locus_tag="AHA_RS00900"
                     /old_locus_tag="AHA_0181"
                     /EC_number="2.5.1.39"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011899229.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxybenzoate octaprenyltransferase"
                     /protein_id="WP_043159164.1"
                     /db_xref="GeneID:4486811"
                     /translation="MQQGAGVNLLTKERGLAYVQLARIDKPIGTLLLLWPTLWALWLA
                     ADGLPDLWTLLVFVVGVFLMRSAGCVINDYADRNFDGHVKRTAGRPLPMGKVKPREVL
                     ALFAVLALISFALVLTMNPLTIGLSFAALLLAVCYPFMKRYIPIPQLVLGMAFSWSIP
                     MAYAAQANALPAVAWLVFLANLLWTIAYDTQYAMVDRDDDLKLGLKSSAILFGRHDKR
                     IIGALQLLTLLILLLVGQLSELGSSYYWSLLAAAALFVYQQRLIRERQREACFQAFLN
                     NNYVGALIFAGVVINYL"
     gene            complement(197570..199993)
                     /gene="plsB"
                     /locus_tag="AHA_RS00905"
                     /old_locus_tag="AHA_0182"
                     /db_xref="GeneID:4486812"
     CDS             complement(197570..199993)
                     /gene="plsB"
                     /locus_tag="AHA_RS00905"
                     /old_locus_tag="AHA_0182"
                     /EC_number="2.3.1.15"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017411144.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate 1-O-acyltransferase PlsB"
                     /protein_id="WP_011704200.1"
                     /db_xref="GeneID:4486812"
                     /translation="MSLGQNISRAILQWPVSGLVNHKSLPENPITELKLDPARPIVYA
                     LKTSSITDLMTLQQCCEDLGLPGPFTPLELNGQLLPRYVCLDRPPPLFGKRSKPLPFL
                     QEFHQLLDLHKQDPALDIQVVPVTLFWGRAPGREGEEASGWNIISSLAPNRLKKALIV
                     ILKGRENLVRFSPPLSLRHMADKHGTDEAIAHKLARVARTHFSRQQLAATGPKLPNRN
                     LLFKQLLDSNVIQQAIEEEAQREGISLEKAQKRAHGYMDEIASDFSYRLIRLGESFLG
                     WLWNKLYRGLSVNGAEKVRQLAQEGHEIVYVPCHRSHMDYLLLSYVIYHQGMVPPHIA
                     AGINLNFWPAGPIFRHGGAFFIRRTFKGNPLYSTVFREYLNLLFAKGYSVEFFTEGGR
                     SRTGRLLPPKTGMLAMTLQAMMRGLDRPVTLVPVYLGYEHVMEVNTYHNELKGSRKEK
                     ESFLQVLGILRKLRNYGRGFVNFGEPLTLNNYLNEHVPSWKEHIGEEERPEWMAPTVN
                     QLAELLMTRINGAAAVNGLTLSALALLAAERHALTRDELQAQLNTYLDLLKQVPYSPH
                     STIPDEDAKTLLDQAMELNKFEVSEDKLGQIVSLDRYQAILLTYYRNNILHLFAMPSL
                     VAALIERCEGISRSEIVARCIDIYPLLKTELFLRYEEDELPELVDALLAELQRQQLIE
                     ARDGGFWVNPVNQTRLLLLAESIQETLQRYAIVLTRVLAQPRIEAEQLEADGLMMAER
                     LGTLHGINAPEFFDQKLFSTLIHTLRSEGYLDPGCKPDLGRFQALADNIVPLLSTKIR
                     RTIQAGNRL"
     gene            200198..200821
                     /gene="lexA"
                     /locus_tag="AHA_RS00910"
                     /old_locus_tag="AHA_0183"
                     /db_xref="GeneID:4486813"
     CDS             200198..200821
                     /gene="lexA"
                     /locus_tag="AHA_RS00910"
                     /old_locus_tag="AHA_0183"
                     /EC_number="3.4.21.88"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017788296.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="repressor LexA"
                     /protein_id="WP_011704201.1"
                     /db_xref="GeneID:4486813"
                     /translation="MKPLTPRQAEVLELIKANMNETGMPPTRAEIAQKLGFKSANAAE
                     EHLKALAKKGVIEIMPGTSRGIRLLLEEEEPLEESGLPLIGKVAAGEPILAQEHIESH
                     YQVDPALFHPRADFLLRVQGMSMKNIGILDGDLLAVHKTQEVRNGQVVVARLDEDVTV
                     KRFQRKGSQVWLLPENEELSPIEVDLSCQQLTIEGLAVGVIRNADWM"
     gene            201261..201548
                     /locus_tag="AHA_RS00915"
                     /old_locus_tag="AHA_0184"
                     /db_xref="GeneID:4486814"
     CDS             201261..201548
                     /locus_tag="AHA_RS00915"
                     /old_locus_tag="AHA_0184"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005307567.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011704202.1"
                     /db_xref="GeneID:4486814"
                     /translation="MASSSPWDPGLASPVSSITRFIKGNRMTRFYALWVHHKGACWTI
                     WLGCPKDKIVRLVRLFHSHHDGGLADAPWTAPVIPLRAQSRRPHERRRQQP"
     gene            201770..202396
                     /locus_tag="AHA_RS00920"
                     /old_locus_tag="AHA_0186"
                     /db_xref="GeneID:4486816"
     CDS             201770..202396
                     /locus_tag="AHA_RS00920"
                     /old_locus_tag="AHA_0186"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005321230.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SCO family protein"
                     /protein_id="WP_016349021.1"
                     /db_xref="GeneID:4486816"
                     /translation="MVKPRYPLLFLLLVGGMMAGFYWNQPSLPEHADYYPAGRDINPF
                     AFTDQDGQPFVPASLTGHWTFLFVGYTFCPDICPTTLADLRSVYPELKKIAPNSQVVF
                     ISADPQRDDVARLKTYTAFFNPEFKAATGPHDKLFPFVRNLGLIYSIADQGEKDYLID
                     HSASIVLINPAGKLEAVFRPRLSEGSVPRVVMASMVSDFAKIVRLDDA"
     gene            202419..203804
                     /gene="dinF"
                     /locus_tag="AHA_RS00925"
                     /old_locus_tag="AHA_0187"
                     /db_xref="GeneID:4486817"
     CDS             202419..203804
                     /gene="dinF"
                     /locus_tag="AHA_RS00925"
                     /old_locus_tag="AHA_0187"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017411147.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MATE family efflux transporter DinF"
                     /protein_id="WP_113995914.1"
                     /db_xref="GeneID:4486817"
                     /translation="MLTPVWWRDGRRHRAVFALALPMVFSNVTTPLLGLVDTWVIGHL
                     GQAWFLGGVSVGATLINLLFWLLGFLRMSTTGLTAQAHGASSPAGQLDTLARALGLAV
                     GLGVTLLLLLLPLIPTLIALSGGSAEVQHYAAEYVSVRVWSAPAALCNLVIMGWLLGM
                     QDARSPMLLLIFTNLVNMGLDAWFVLGLGWQVKGVAAASLLADYSALGLGLWLVSRHL
                     RRLAASAWQGAWQRWRQWPALLRLLALNRDIFIRSLCLQLCFAFMTLQGARLGDVAVA
                     ANAVLLNFLMLISYGLDGFAYAVEAMVGRAIGRRDRQGLREAIVLNLGWALLIALTFS
                     LLFAVGGSRLIAHITDLPAVIAAANAQLPWLIAMPLLAVWCFLLDGVFIGATRAREMR
                     NSMLVAALCGFFPVWWLCQGWGVAALWAAMAALMAGRGLTLGWLCWQLERDGRLLHSA
                     HGVGEAQQASS"
     gene            complement(203833..204303)
                     /gene="trmL"
                     /locus_tag="AHA_RS00930"
                     /old_locus_tag="AHA_0188"
                     /db_xref="GeneID:4486818"
     CDS             complement(203833..204303)
                     /gene="trmL"
                     /locus_tag="AHA_RS00930"
                     /old_locus_tag="AHA_0188"
                     /EC_number="2.1.1.207"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349023.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA
                     (uridine(34)/cytosine(34)/5-
                     carboxymethylaminomethyluridine(34)-2'-O)-
                     methyltransferase TrmL"
                     /protein_id="WP_029302634.1"
                     /db_xref="GeneID:4486818"
                     /translation="MLDIVLYQPEIPPNTGNIIRLCANTGYRLHLIEPLGFEWDDKRV
                     KRAGLDYHEFAEVKRWPNFEAFLEAVAPTRVFACTTKGRTAHSAVQFAAGDALLFGPE
                     SRGLPIEIIESLPFEQRLRIPMLPQSRSMNLANAVAVFVYESWRQLGYAGSLQE"
     gene            complement(204372..205727)
                     /locus_tag="AHA_RS00935"
                     /old_locus_tag="AHA_0189"
                     /db_xref="GeneID:4486819"
     CDS             complement(204372..205727)
                     /locus_tag="AHA_RS00935"
                     /old_locus_tag="AHA_0189"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017411700.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAMP domain-containing protein"
                     /protein_id="WP_011704207.1"
                     /db_xref="GeneID:4486819"
                     /translation="MRTARTFNGLSTQIFLWFWFMLLLVVAAVVILPTLDPRNIIPLP
                     AHEITRLNNNLKALQKGADPNQDFDLAQAIDAAGLLPVDNIYLRDAKGQMQSSTRLSK
                     FVIRFMLDSDNPAKPMLGSEHKRAIAGPFQMTHHGQIYHIYFGLNVENSYLFLFIQIL
                     DHPIQILGIAMLVSTPLCLLLAWRLTRPILQLQQSVSQLAEGNLEAQIPNLGRRDEIG
                     QLADHVSHMVDTLKNMIQKQKQLLSDISHELRSPLTRIQLAQALIRRKQGDSNELVRI
                     ESEIGRLDKLIGDLLDLSRVQQHVEAPVVMPLAELLEPILDDAMFEANQSGKQLRLPP
                     LPAESLRMWPDLLARALENPLRNALKYAREFIKVDWYREGLEWVMTIRDDGPGVPVAQ
                     QAQLFLPFFRVDDARNAKTGGTGLGLAIAAEAIARHGGTIRASSNQPAGLTITIRLPI
                     G"
     gene            complement(205724..206419)
                     /locus_tag="AHA_RS00940"
                     /old_locus_tag="AHA_0190"
                     /db_xref="GeneID:4486820"
     CDS             complement(205724..206419)
                     /locus_tag="AHA_RS00940"
                     /old_locus_tag="AHA_0190"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010635506.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="WP_011704208.1"
                     /db_xref="GeneID:4486820"
                     /translation="MHKILLVDDDLELTQLLTEILTLEGFQVTVAEDGEEGLQLLAEQ
                     HFNLVLLDVMMPKLNGFAMLARLRKTHDTPVLMLTARGDSQDRVNGLEAGADDYLAKP
                     FDDRELLARVRAILRRTQSTQPQRGGSSEEVRFMDLVLQPGLQQASCHGELLELTATE
                     FGLLECLLRNPGQIVSKSQLSELVLGKKLEPFDRAIDMHLSNLRKKLPERTDGQPRFK
                     TVRGRGYLWLEQA"
     gene            206506..207417
                     /locus_tag="AHA_RS00945"
                     /old_locus_tag="AHA_0191"
                     /db_xref="GeneID:4486821"
     CDS             206506..207417
                     /locus_tag="AHA_RS00945"
                     /old_locus_tag="AHA_0191"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005321213.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation diffusion facilitator family transporter"
                     /protein_id="WP_011704209.1"
                     /db_xref="GeneID:4486821"
                     /translation="MSHQQYFRWVTLASMAAVTTATLLITGKLIAWLMTDSSSLLASL
                     TDSFMDVSASIINLLAIRYALSPADDEHRFGHGKAESLAGLIQAAFISGSALLLVMHG
                     ISSLLKQAPLERLEAGLWVSGGSIVLTLLLVSFQSLVIRKTNSVAIKADMLHYRSDLL
                     LNGGVLLALVLAGQGWYWADGLFAILIGLFLLWGALHIGYESVQALLDRQLPAEEQAR
                     IMALCCDVEGVHGVHDLRTRQSGPTRFVQLHLELDDQLPLVKAHQIADEAELAVRQAF
                     ERMDVIIHMDPISVVHKEQQGTPSEQQ"
     gene            207426..208205
                     /gene="cysE"
                     /locus_tag="AHA_RS00950"
                     /old_locus_tag="AHA_0192"
                     /db_xref="GeneID:4486822"
     CDS             207426..208205
                     /gene="cysE"
                     /locus_tag="AHA_RS00950"
                     /old_locus_tag="AHA_0192"
                     /EC_number="2.3.1.30"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005907916.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine O-acetyltransferase"
                     /protein_id="WP_011704210.1"
                     /db_xref="GeneID:4486822"
                     /translation="MDDLVARTWQKIQQEAASMATEEPMLASFFHSTILNHKNLRSAL
                     SFQLANKLDSATMPAIALREVIELALRSEPELLAVVAADICAVQERDPAVDLFSTPLL
                     YLKGFHALQGYRVANWLWRQGRRSLALYLQNQISVVFGVDVHPAARIGKGIMFDHATG
                     IVVGETAVIEDDVSILQSVTLGGTGKESGDRHPKIREGVMIGAGAKVLGNIEVGMGAK
                     IGAGSVVINPVPPHTTVAGVPAKIVGRPECDKPSLDMDQCL"
     gene            208227..209507
                     /locus_tag="AHA_RS00955"
                     /old_locus_tag="AHA_0193"
                     /db_xref="GeneID:4486823"
     CDS             208227..209507
                     /locus_tag="AHA_RS00955"
                     /old_locus_tag="AHA_0193"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017411152.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011704211.1"
                     /db_xref="GeneID:4486823"
                     /translation="MAKRWSGYLILGMWLLNLLHLYLGFSPWPAAIAAWGASLLTWPW
                     LVGAARRQALALYGAALALLIFSCWRGASLTAGDWLLPNINMLTMFAAVSTLNLATSG
                     LLTGTTSWQGRKGLWSTMASLNLLGAVINLSVLFIIGDRLERNGTLERRQVLVLSRIF
                     CAAAFWSPFFVAMAVALTYAPGLQLSRILPFGVVATLLAMGLTAWQVERLGVAEFAGY
                     PLRLQTLGLPVALALLVLLIKQIWPDLGILAVIALVAPLLAFAFMPSAGRGPALKRQV
                     VERFPAIGGQLVLFLGAGLLAAGINSALSVFELGGGHGLSFFHHFGWLESSLTLLLIL
                     LVAIVGVHPLISISGLAPLLWPLSPDPSLLGMCFLLGWGLATGTSPLSGSNLALASRY
                     NLSAGAILRGNLLYGLLMYGVACLLLGAYIALHA"
     gene            209742..209951
                     /gene="zapB"
                     /locus_tag="AHA_RS00960"
                     /db_xref="GeneID:44141858"
     CDS             209742..209951
                     /gene="zapB"
                     /locus_tag="AHA_RS00960"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014291171.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein ZapB"
                     /protein_id="WP_016349028.1"
                     /db_xref="GeneID:44141858"
                     /translation="MSLEVLEQLESKVQSAVDNISLLKMELDELKEQNNKLQDENHQL
                     RNEHVAWQERLRALLGKMDQMGESI"
     gene            complement(210025..210675)
                     /gene="elbB"
                     /locus_tag="AHA_RS00965"
                     /old_locus_tag="AHA_0195"
                     /db_xref="GeneID:4486825"
     CDS             complement(210025..210675)
                     /gene="elbB"
                     /locus_tag="AHA_RS00965"
                     /old_locus_tag="AHA_0195"
                     /EC_number="4.2.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005356063.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isoprenoid biosynthesis glyoxalase ElbB"
                     /protein_id="WP_011704213.1"
                     /db_xref="GeneID:4486825"
                     /translation="MKKVAVILSGCGVFDGAEIHEAVISLLALARQGAAVQCFAPNVP
                     QLHVINHLTGEVSEGERRNVLVEAARLCRGQIRDVAELDAADYDALLVPGGFGAAKNL
                     CDFAIKGAECQIQPDVLKACQSFARAGKPAAYICIAPAMIPLIYGAGTLATIGHDEGT
                     ANAIEAMGGSHLNCSVNEFVVDQERKVISTPAYMLANNIVEAADGIEKTVKQLLVL"
     gene            211076..213829
                     /gene="polA"
                     /locus_tag="AHA_RS00970"
                     /old_locus_tag="AHA_0196"
                     /db_xref="GeneID:4489080"
     CDS             211076..213829
                     /gene="polA"
                     /locus_tag="AHA_RS00970"
                     /old_locus_tag="AHA_0196"
                     /EC_number="2.7.7.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005307600.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase I"
                     /protein_id="WP_011704214.1"
                     /db_xref="GeneID:4489080"
                     /translation="MAPSNPLILVDGSSYLYRAFFASQQADLRTSTGLPSGAVRVMAN
                     MMRSLRKQYPDCHVAVVFDAKGKTFRDDIYPEYKANRASMPDDLRSQVAPIHQMIKAM
                     GFPFLMVEGVEADDVIGTLARQATEKQLPVLISTGDKDMAQLVSDHVTLIDTMKDVKT
                     DREGVIEKFGVPPELIIDYLALMGDKVDNIPGMTGVGEKTALALLQGIGSIDEIAANL
                     DKVAALGFRGSKAFADKFREQEEQVRLSYVLATIKTDVALEQSLEELQLGPIDKEALL
                     AVYREYELRNLIKELESGGAEESGAEGDDEGAAPVAAIETDYRCILDEAEFDEWLARL
                     QAAPLFAFDTETTSLDYMEARVVGVSFAIEPGKAAYVPFGHDYLGAPVQLTEAVVLGK
                     LKPLLEDPARLKVGQNLKYDRNVLLNHGIELQGIAYDTMLESYVLNSTASRHDMDSLA
                     RRYLNAETISFEEIAGKGVKQLTFNQIELEQAAPYAAEDADITLRLHQALWGKLSAEP
                     GLAKVFSEIELPLLPVLARMERLGTTIEPKLLHQQSQEIEVRLAELEKQAHELAGQEF
                     NLSSPKQLGEILFTKLGLPIIKKTPKGAPSTAEEVLAELAETYELPQLLMEHRGLAKL
                     KSTYTDKLPLMIKPQTGRVHTSYHQAVAATGRLSSTDPNLQNIPVRNEQGRRIRQAFI
                     PCAGYKLVAADYSQIELRIMAHLSGDKGLLTAFAEGKDIHKATAAEVFGVALEAVTSD
                     MRRSAKAINFGLIYGMSAFGLAKQLGIGRAEAQKYMDLYFERYPGVLEYMERTRQQAD
                     AQGYVETLFGRRLYLPDIKSRNAGLRKAAERAAINAPMQGTAADIIKRAMINVDGWIR
                     GIEDQSIRMLMQVHDELVFEIREEKLEEYIAIIKEKMSAAAELDVPLVVEAGTGDNWD
                     QAH"
     gene            complement(213909..214448)
                     /locus_tag="AHA_RS00975"
                     /old_locus_tag="AHA_0197"
                     /db_xref="GeneID:4489081"
     CDS             complement(213909..214448)
                     /locus_tag="AHA_RS00975"
                     /old_locus_tag="AHA_0197"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005307602.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gamma carbonic anhydrase family protein"
                     /protein_id="WP_011704215.1"
                     /db_xref="GeneID:4489081"
                     /translation="MDLRLRPYKGKRPQLGKRVYVDPCATLVGDIQLGDDASIWPMVA
                     ARGDVNHICIGARSNIQDGTVLHLTRKSASNPGGYPLLIGEDVTVGHKAMLHGCTIGN
                     RVLVGMGAILLDGVIVEDDVMIGAGSLVPPGKRLEAGFLYMGNPVQQARTLKPAEIAF
                     LKTSADNYVLLKDEYLQEA"
     gene            214906..216456
                     /locus_tag="AHA_RS00980"
                     /old_locus_tag="AHA_0198"
                     /db_xref="GeneID:4489082"
     rRNA            214906..216456
                     /locus_tag="AHA_RS00980"
                     /old_locus_tag="AHA_0198"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:4489082"
     gene            216523..216599
                     /locus_tag="AHA_RS00985"
                     /old_locus_tag="AHA_0199"
                     /db_xref="GeneID:4489083"
     tRNA            216523..216599
                     /locus_tag="AHA_RS00985"
                     /old_locus_tag="AHA_0199"
                     /product="tRNA-Ile"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:216557..216559,aa:Ile,seq:gat)
                     /db_xref="GeneID:4489083"
     gene            216610..216685
                     /locus_tag="AHA_RS00990"
                     /old_locus_tag="AHA_0200"
                     /db_xref="GeneID:4489084"
     tRNA            216610..216685
                     /locus_tag="AHA_RS00990"
                     /old_locus_tag="AHA_0200"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:216643..216645,aa:Ala,seq:tgc)
                     /db_xref="GeneID:4489084"
     gene            216918..219835
                     /locus_tag="AHA_RS00995"
                     /old_locus_tag="AHA_0201"
                     /db_xref="GeneID:4489085"
     rRNA            216918..219835
                     /locus_tag="AHA_RS00995"
                     /old_locus_tag="AHA_0201"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:4489085"
     gene            219931..220045
                     /gene="rrf"
                     /locus_tag="AHA_RS01000"
                     /old_locus_tag="AHA_0201a"
                     /db_xref="GeneID:5309692"
     rRNA            219931..220045
                     /gene="rrf"
                     /locus_tag="AHA_RS01000"
                     /old_locus_tag="AHA_0201a"
                     /product="5S ribosomal RNA"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00001"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="RFAM:RF00001"
                     /db_xref="GeneID:5309692"
     gene            220152..220227
                     /locus_tag="AHA_RS01005"
                     /old_locus_tag="AHA_0202"
                     /db_xref="GeneID:4489086"
     tRNA            220152..220227
                     /locus_tag="AHA_RS01005"
                     /old_locus_tag="AHA_0202"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:220185..220187,aa:Thr,seq:ggt)
                     /db_xref="GeneID:4489086"
     gene            220251..220365
                     /gene="rrf"
                     /locus_tag="AHA_RS01010"
                     /old_locus_tag="AHA_0203"
                     /db_xref="GeneID:4489087"
     rRNA            220251..220365
                     /gene="rrf"
                     /locus_tag="AHA_RS01010"
                     /old_locus_tag="AHA_0203"
                     /product="5S ribosomal RNA"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00001"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="RFAM:RF00001"
                     /db_xref="GeneID:4489087"
     gene            220520..221485
                     /gene="ebgR"
                     /locus_tag="AHA_RS01015"
                     /old_locus_tag="AHA_0204"
                     /db_xref="GeneID:4489088"
     CDS             220520..221485
                     /gene="ebgR"
                     /locus_tag="AHA_RS01015"
                     /old_locus_tag="AHA_0204"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012535006.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator EbgR"
                     /protein_id="WP_011704216.1"
                     /db_xref="GeneID:4489088"
                     /translation="MATLKEIALEAGVSQATVSRVLNEDPTLSVKEETKQKIFEIAER
                     LEYKTSGARKGVHKSKLHFLAVYAYPQSTEVNDPYYLAIRYGIETQCARLNIELTHFY
                     NGAEGRDLSAVDGILVIGHLPAERLAALHSLSAQLVFVDCRSQGDFDSIDVDLALISQ
                     QVVDFFIAQGHQRIGYIGGQDDGPDLRELAFLDYGQRLGVVQESDLYRGDFSSASGYK
                     LAKEMLAGDWPRALFVASDSIAIGVLRAIHEKGIAIPQQIELISVNDIPTAKFTFPPL
                     STVRIHSELMGSQGVNLLVERLRDERDVPLRVLVPSKLTLRGTTR"
     gene            221807..224881
                     /gene="ebgA"
                     /locus_tag="AHA_RS01020"
                     /old_locus_tag="AHA_0205"
                     /db_xref="GeneID:4489089"
     CDS             221807..224881
                     /gene="ebgA"
                     /locus_tag="AHA_RS01020"
                     /old_locus_tag="AHA_0205"
                     /EC_number="3.2.1.23"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019841068.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-galactosidase subunit alpha"
                     /protein_id="WP_011704217.1"
                     /db_xref="GeneID:4489089"
                     /translation="MNNWENVQFVGENRLAPRAYFFSYADHALAATMQRELSRRFLSL
                     SGQWQFHYFDHPLQVPEAFYHSPMSEWDQITVPNMWQMEGHGQLQYTDEGFPFPIDVP
                     FVPTNNPTGAYQRSFTLSQAWDGEQVIIKFDGVETYFEVYVNGHYIGFSKGSRLTAEF
                     DISAYAKVGENLLSVRVMQWADSTYIEDQDMWWMAGIFRDVYLVGKPAAHVQDFFIRT
                     ALADDNQSATLSCDIQLENLGAAARDHRLVWSLLDQGSEIASGSLDHLAIDGKCDCRF
                     TLDLANPHLWSAEDPYLYQLQLSLYNGQGELLEVIPQRVGVREIKVKDGLFYVNGHYL
                     KLHGVNRHDNDHLKSRAVGMDRVERDIVLMKQHNLNSVRTAHYPNDPRFYELCDQYGL
                     FVMAETDVETHGFANVGDLSRITDDPFWEPVFVDRIERHVHAQKNHPSIIIWSLGNES
                     GYGCNIRAMYRRCKQMDPTRLVHYEEDRDAEVVDLVSTMYSRVSQMNCFGEFPMPKPR
                     ILCEYAHAMGNGPGGLSEYQQVFDRHPHIQGHYIWEWCDHGILDQDEQGRPVYKYGGD
                     YGDYPNNYNFCMDGLIYPDQTPGPGLREYKQVICPVKVRALDLASGKLEVENRYWFSN
                     LDDIRLLVEVKAEGELLASQQIRLEGVAPGATTELQLELPSLDGRETFVQLRVIKATA
                     TRYSAAEHELGQYQFQLKESTRQLQPFANPNATALQIADERLALTLSGSGFALRFSRL
                     DGKLVSWQQDGNELIERAPRLTFFKPMIDNHKQEYESLWHPNHLQIMQEHFRTLSWRQ
                     LGEVVEVTVESLIAPPVFDFGMRCRYVYTLSPNGQLHVALSGQPYGGYDDIIPKIGFE
                     LGIRQDLDRVHYYGMGPGENYQDSRQSNWIDSFQSTVGEMWEHYPFPQDNGNRQQVRW
                     ATLTNRHGAGLYVRPDAPINLSVWPYSWEHIHAAQHINELEPSGYLTLNLDHKVLGLG
                     SNSWGSEVLDSWRVRFEPFSFGLTLLPIARGNLNPAALAGLDLTINGGRNLA"
     gene            224878..225333
                     /locus_tag="AHA_RS01025"
                     /old_locus_tag="AHA_0206"
                     /db_xref="GeneID:4489090"
     CDS             224878..225333
                     /locus_tag="AHA_RS01025"
                     /old_locus_tag="AHA_0206"
                     /EC_number="3.2.1.23"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005327345.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-galactosidase subunit beta"
                     /protein_id="WP_011704218.1"
                     /db_xref="GeneID:4489090"
                     /translation="MITLDNLTLFKNIYREGKKWGRCVEAINNLANLKPGICHSIGDS
                     LTYRLQEGASPATSLFEGQRRYFDVHYYLEGEETVEWAAKSDLRVEQGYDDTTDREWL
                     VGEVRERQQVGNGQVVIFENDEAYRFVGDAPVRKLIIKVTVEGGYFKNK"
     gene            225436..226881
                     /locus_tag="AHA_RS01030"
                     /old_locus_tag="AHA_0207"
                     /db_xref="GeneID:4489091"
     CDS             225436..226881
                     /locus_tag="AHA_RS01030"
                     /old_locus_tag="AHA_0207"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017788660.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid permease"
                     /protein_id="WP_011704219.1"
                     /db_xref="GeneID:4489091"
                     /translation="MSDSKRNTIGKFGLLSLTFAAVFSFNNVINNNIEIGLASAPMFF
                     LATIFYFIPFCLIIAEFVSLNKNSEAGVYAWVKSSLGGRWAFISAYTYWFVNLFFFTS
                     LLPRVIAYASYAFLGYEYILTPVATTALSMVLFAFATYVSTNGAKMLGPITSVTSSLM
                     LLLTLSYILLAGAALVGGVQPADPITVEAMVPDFSWAFLGITTWIFMAAGGAESVAVY
                     VNDVKGGSKSFVKVIIVAGIFIGVLYSIASLLINVFVHSDTLKYTGGSVQVFEGLAAY
                     FGLPEILMNRFVGLVSFTAMFGSLLMWTATPVKIFFSEIPAGIFGKKTVELNENGVPA
                     RAAWIQYLIVLPLMVIPTLGSNTAQDLMNTVINMTAAASMLPPLFIMLAYLNLRLKLD
                     HLPREFKMGSRTTGIAVVSVLIAIFSVGFLASTFPTGADIMTIVFYNVGGILIFLGFA
                     WWKYNRYEASLSAEARAKEAQPAAQVAMQTP"
     gene            226958..227296
                     /locus_tag="AHA_RS01035"
                     /old_locus_tag="AHA_0208"
                     /db_xref="GeneID:4489092"
     CDS             226958..227296
                     /locus_tag="AHA_RS01035"
                     /old_locus_tag="AHA_0208"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005342042.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA-binding protein"
                     /protein_id="WP_164927506.1"
                     /db_xref="GeneID:4489092"
                     /translation="MSETIEFAEFKRVEMKVGKVLEVVRHPGADKLYIVQIDVGGEQP
                     LQTVTSLVPYYSEEELMGSEVVVLTNLKPTRMRGERSECMLLCAETPDESQSVLLQPR
                     VPMAPGTPIV"
     gene            227463..228899
                     /locus_tag="AHA_RS01040"
                     /old_locus_tag="AHA_0209"
                     /db_xref="GeneID:4489093"
     CDS             227463..228899
                     /locus_tag="AHA_RS01040"
                     /old_locus_tag="AHA_0209"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704221.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid permease"
                     /protein_id="WP_011704221.1"
                     /db_xref="GeneID:4489093"
                     /translation="MSESVRGTIGKFALLSMTFAAVFNVRNIVNNNIELGLSSAPIFL
                     LATLVYFIPFVFIIAEFVSANKNSESGMYDWLKKPLGTRMAYLGSFLYWFVNLFWFVS
                     LLPNVIAYASYAMLGYEYSFSPMVTSVISIVLFAAATHISTKGASWLGKIAEIVAYGV
                     FALFAIYVLGALMALSGDHVPAQPITLEAMTPTVNWATLGIMCWIFQAAGGAETAAAY
                     LNDVKGGQKSFIKVIISAGIVIGAMYAVGSLLVNVFVPRESLTYAGGMVEIFTGMAQY
                     FQLSEALVGRFVGVVLFIAMFGSMMMWTSAPVKIHFSEIPQGVYGEKTTQLNEHGVPV
                     RAAWWQFAFVFVMLVVNGFGSESVQQMMNTAINLTAGTAMLPPIFIMVAYFVFRWKHD
                     DTPREFRMGSRTFGMGVVSVLIAIFVVSMSASAFPSGVDLVRAFFINVFMTAVFSALA
                     YWWISRFEKRQARKQATGTAGGKLAKQS"
     gene            229111..230082
                     /locus_tag="AHA_RS01045"
                     /old_locus_tag="AHA_0210"
                     /db_xref="GeneID:4489094"
     CDS             229111..230082
                     /locus_tag="AHA_RS01045"
                     /old_locus_tag="AHA_0210"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005307625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bile acid:sodium symporter"
                     /protein_id="WP_010635494.1"
                     /db_xref="GeneID:4489094"
                     /translation="MRLDPFTSVLIVVVALASFFPCEGQVAVWFGLLTKLAVALLFFM
                     HGAKLSRQNLLAGLGHWRLHLVVMASTFVLFPLLGLLLTPLVPHWLSPAIYLGFLYLC
                     ALPATVQSAIAFTSMAGGNVSAAVCSASASSILGIFLSPVLVGLMINVQGEGVDTWHS
                     IQAIMVQLMLPFVVGHLSRPLIGRWVDSHRPLIGKLDQSSILLVVYVAFSEAVVQGIW
                     HQVGWYDLASIVLLSCVLLALVLGWNVWISRRLGFNRADEITIVFCGSKKSLANGVPM
                     ANVMFPAASVGVMVLPLMIFHQIQLMVCAVLARRYHEQEAVPQVQQG"
     gene            complement(230140..232290)
                     /gene="ovoA"
                     /locus_tag="AHA_RS01050"
                     /old_locus_tag="AHA_0211"
                     /db_xref="GeneID:4489095"
     CDS             complement(230140..232290)
                     /gene="ovoA"
                     /locus_tag="AHA_RS01050"
                     /old_locus_tag="AHA_0211"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017785271.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-histidylcysteine sulfoxide synthase"
                     /protein_id="WP_011704222.1"
                     /db_xref="GeneID:4489095"
                     /translation="MTQATLLYSTATGLPEPTRTPLLTGSDPDHKRRELLAYFCQTFD
                     LYDSLFDCLADERAWFDKAIPLRHPLIFYYGHTAAFFINKLLAARLIEGRLDARIEAM
                     VAIGVDEMSWDDLDETHYDWPTVAELRDYRGRVRALVCDVIERMPLTLPIDWQSPAWV
                     ILMGIEHERIHLETSSVLIRQLPLAWVRSQPRWPVCPEARRCRDEVPANSLLPVAGGR
                     VRLGKQDATYGWDNEYGERHIELAPFQASRMLVSNAEFFDFVQAGGYQTRAWWDDEGW
                     GWRQYARARMPTFWVGDPLEPEQLQLRLMTEQVTMPWDWPVEVNQLEAAAFCRWQAAQ
                     TGLPVQLPSEAEWMLLREQLAGDQPDWIEAPGNINLARFASSCPVDACPQGSFFDLVG
                     NVWQWTSTAIDGFEGFKVHPLYDDFSTPTFDGKHTLIKGGSWISTGNEALKSSRYAFR
                     RHFFQHAGFRYLVSRYQEPVVVNPYETDTLVAQYLDFQYGPTHFGVANYAQTLAGLAS
                     ELCSRHERALDIGCATGRASFELARRFAHVDGVDYSARFIDVALALASQDSFRYAVPV
                     EGELVEYCEARLSRHELGREQSERVHFSQGDACNLKPRYGDYDLVLASNLIDRLREPA
                     RFLRDIAPRLRSGGLLVLTSPYTWLTDYTPKANWLGGVRENGEALGTYQALQRLLAAE
                     FEEQMPPRDVPFVIRETARKHQHTVAQLTVWRKR"
     gene            232655..233377
                     /locus_tag="AHA_RS01055"
                     /old_locus_tag="AHA_0212"
                     /db_xref="GeneID:4489096"
     CDS             232655..233377
                     /locus_tag="AHA_RS01055"
                     /old_locus_tag="AHA_0212"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019841072.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2807 domain-containing protein"
                     /protein_id="WP_011704223.1"
                     /db_xref="GeneID:4489096"
                     /translation="MKWMMGVVLAVGLSGCSWLDDTRVSGAGAVIEQQHGVGRQVTRV
                     LAGVPASVHLVAGEPRGLRIRGQENLLPYLVLSERGDKLEIEVKDGYRLDPTEPLEIT
                     ITLPALHELALAGVANGELRGFKGEALVLSVAGVGDIVADGLELDRLEGNIAGAGSLD
                     LGNSTARAVELNIAGSGDVLGAELKGREVEVNIAGSGDVEVRAQERLKVGIAGSGSVS
                     YWGDPVLQSEIAGSGEVSRQGS"
     gene            complement(233431..234267)
                     /gene="fghA"
                     /locus_tag="AHA_RS01060"
                     /old_locus_tag="AHA_0213"
                     /db_xref="GeneID:4489097"
     CDS             complement(233431..234267)
                     /gene="fghA"
                     /locus_tag="AHA_RS01060"
                     /old_locus_tag="AHA_0213"
                     /EC_number="3.1.2.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017412535.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-formylglutathione hydrolase"
                     /protein_id="WP_011704224.1"
                     /db_xref="GeneID:4489097"
                     /translation="MNLDIISSNKSFGGWHKRYSHASEVLGCEMRFAIYLPPQALTGQ
                     KVPVLYWLSGLTCTDENFMQKAGAQRIAAELGIALVAPDTSPRGEDVADDPGYDLGMG
                     AGFYVNATQHPWRDHYQMYDYVTRELPELIETHFPVSTKRAISGHSMGGHGALIAALR
                     EPGRYRSVSAFSPISHPSRCPWGQKALGAYLGNNPLLWQEWDACQLLRHHPVTPLPTL
                     VDVGLDDPFLAEQLHIDALADAAAGKEWPLELNRHAGYDHSYYFVASFIEAHLRFHAR
                     HL"
     gene            complement(234317..235444)
                     /locus_tag="AHA_RS01065"
                     /old_locus_tag="AHA_0214"
                     /db_xref="GeneID:4489098"
     CDS             complement(234317..235444)
                     /locus_tag="AHA_RS01065"
                     /old_locus_tag="AHA_0214"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005307638.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-(hydroxymethyl)glutathione dehydrogenase/class
                     III alcohol dehydrogenase"
                     /protein_id="WP_005307638.1"
                     /db_xref="GeneID:4489098"
                     /translation="MAQVQSIKCKAAIAWGPGQPLSIEEVEVMPPQAGEVRVRIVATG
                     VCHTDAFTLSGEDPEGVFPCILGHEGGGIVESVGEGVTSVKVGDHVIPLYTPECGECK
                     FCKSGKTNLCQKIRATQGKGLMPDGTTRFSKDGQPIYHYMGTSTFSEYTVLPEISIAK
                     VDPAAPLEEVCLLGCGVTTGIGAVMNTAKVKEGESVAIFGLGGIGLSAVIGARLAKAG
                     RIIAIDINESKFELARKLGATDCINPNDYDKPIQEVIVELTDGGVDFSFECIGNVKVM
                     RAALECCHKGWGESVIIGVAGAGQEISTRPFQLVTGRVWRGSAFGGVRGRSELPSYVQ
                     RYMQGEFKLDDFITHTMGLEQINEAFDLMHEGKSIRSVIHY"
     gene            235564..236469
                     /locus_tag="AHA_RS01070"
                     /old_locus_tag="AHA_0215"
                     /db_xref="GeneID:4487724"
     CDS             235564..236469
                     /locus_tag="AHA_RS01070"
                     /old_locus_tag="AHA_0215"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010635489.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_005307641.1"
                     /db_xref="GeneID:4487724"
                     /translation="MFGWEGICEFVSVAEQGGFTPAARKLGVSVAQVSRQVAQLEDRL
                     QAKLLLRTTRQVRLTELGEIYYRHCRQLLDNLYEAELAVGRHQAVPQGTLRITAPVSY
                     GESRIAPLVNDFMVRFPQLEVTLNLTNQLLDLVHEGYDLALRLGHLKDSSLVARKLAQ
                     RVPYVCASPAYTARHGMPNSLSELTRHTCLVGNSDEWHFTLDGRPHSVRVHGLLHCNS
                     GHALLDAALKGIGIIQLPDYYVSDHLAQGELIELLPELRAPAEGIWALYPHNRHLSPK
                     VRLLVDYLAERLSDPHQPALVRPVG"
     gene            complement(236526..237491)
                     /locus_tag="AHA_RS01075"
                     /old_locus_tag="AHA_0216"
                     /db_xref="GeneID:4487725"
     CDS             complement(236526..237491)
                     /locus_tag="AHA_RS01075"
                     /old_locus_tag="AHA_0216"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349044.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_011704225.1"
                     /db_xref="GeneID:4487725"
                     /translation="MFEILILMLDATIRTAPPLILAAMAGMFCERSGVVNIALEGKLL
                     AAAFASAAAAAVSGSAWIGLGAGVGVSILFALMHGFATITHRGDQVVSGMAINILAAG
                     LTVTLGRYWFDQGGQTPALSGAARFAPIDLPYAKELYDVPVISQLYSELLSGHSLLEY
                     VAFAAVPLAWWVLFRTRFGLRLRAVGEAPAAVDTAGISVVRMRYTALIIGGLLAGIGG
                     TYLAVAQTAQFIPNMSAGKGFMALAALVFGKWRPWNAMAACLLFGFLDAVAIRLQGVS
                     IGGFPIPVQAIEALPYILTVFLLAGFIGKAVAPKALGTPYVKERE"
     gene            complement(237494..238609)
                     /locus_tag="AHA_RS01080"
                     /old_locus_tag="AHA_0217"
                     /db_xref="GeneID:4487726"
     CDS             complement(237494..238609)
                     /locus_tag="AHA_RS01080"
                     /old_locus_tag="AHA_0217"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005307647.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_005307647.1"
                     /db_xref="GeneID:4487726"
                     /translation="MSQARIPAWISVGVLPAVNILLAFLVSAILFYYLDINPVDAAEI
                     MWYGAFGTGEGVGFTLYYATGFIFTGLSVAVAFHAGLFNIGGEGQAYIGGLGVGLVCL
                     LLGDSLPFALLLPLAIIAGGLFGAAWAFIPAWLQAKRGSHIVITTIMFNFIAASLMAY
                     LLVEVFKPAGSMATESKVFAEASWLPKMSELAGAFGMEMSNSPLNISFFWALLCAALV
                     WVFIWHTRWGYEIRSVGASQSASAYAGISYPKVVILAMVISGMLSGFFALNVLQGELH
                     QIKLNFVEGFGFTGIAVALMGRNHPVGVIIASLLFGFLYQGGAELSFEFGVDRNIVVV
                     LQGLVILFCGALEHMMRPRIEQLYLAFANRSAQVKGA"
     gene            complement(238692..240272)
                     /locus_tag="AHA_RS01085"
                     /old_locus_tag="AHA_0218"
                     /db_xref="GeneID:4487727"
     CDS             complement(238692..240272)
                     /locus_tag="AHA_RS01085"
                     /old_locus_tag="AHA_0218"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349045.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_011704226.1"
                     /db_xref="GeneID:4487727"
                     /translation="MDQTDRYAIELRGIDKRFGEVYANKQIDLKVRKGSIHGIVGENG
                     AGKSTLMSIIYGFYHADKGEMFIDGNPFKPHGSQDAIAAGVGMVHQHFMLVNNFTVLE
                     NVILGAENGWHLGKSLAAAEKLLGELARDYGLEVPLHEKVEDLPVGLQQRVEILKALY
                     RGARILILDEPTGVLTPQEADHLFEVLKKLRDQGATIILITHKLREILAITDQVSIMR
                     RGEMVAHVATKDTDKEQLAELMVGRKVRLKVDKGPTQPGDAKLKVDGLSYVDDARVER
                     VKSISFEVRAGEVVGIAGVSGNGQSELLSLLGGILKPSKGSFTITGGGQAHEVSVSHP
                     ADPERVRNFGLGHVPEDRHKMGLINRFEAKEAFILGYHRRPQYNKGWLQNKEAILQDC
                     QAKMDKWDVRPPHPEHKTANFSGGNQQKLVIAREVEQDPDVLLIGQPTRGVDIGAIEY
                     IHQQIIAMRDKGKAVLLVSVELDEIMSLSDRILVIADGRIVGELDAAKADERTIGLMM
                     ANIVPDEVAASQSQGATS"
     gene            complement(240356..241354)
                     /locus_tag="AHA_RS01090"
                     /old_locus_tag="AHA_0219"
                     /db_xref="GeneID:4487728"
     CDS             complement(240356..241354)
                     /locus_tag="AHA_RS01090"
                     /old_locus_tag="AHA_0219"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005354276.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="BMP family ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_024944638.1"
                     /db_xref="GeneID:4487728"
                     /translation="MTKVLKLATVAALTLAALSAQAASQPAVIYDTAGKFDKSFNEAV
                     FRNGVEVYNKDKGVKVKEFEPQNEAQREQGLRRLASRGNGPIVAVGFNMGSAVEKVAT
                     EFPKTQFTIIDMVVDKPNVQSVIFKEHEGSFLVGALAAIASKTGKVGFVGGMDIPLIR
                     KFECGYEQGAKYVNPKIEVFQNMTGSTPAAFADPAKGAELAKSQFAKGADVVYAAAGG
                     TGIGVYQAAKDEGKLAIGVDSNQNHLQPGTMLTSMVKSVGLAAYQTWDDAAKGTWKPG
                     IKNLGLAEGGVDWALDKDNEKLITPEMKAKVDAIKAEIISGKVKVHDYMSDSTCKY"
     gene            241787..243958
                     /gene="uvrD"
                     /locus_tag="AHA_RS01095"
                     /old_locus_tag="AHA_0220"
                     /gene_synonym="mutU; recL"
                     /db_xref="GeneID:4487729"
     CDS             241787..243958
                     /gene="uvrD"
                     /locus_tag="AHA_RS01095"
                     /old_locus_tag="AHA_0220"
                     /gene_synonym="mutU; recL"
                     /EC_number="3.6.4.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005907476.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA helicase II"
                     /protein_id="WP_011704228.1"
                     /db_xref="GeneID:4487729"
                     /translation="MDVSTLLDGLNDKQRDAVAAPRCNLLVLAGAGSGKTRVLVHRIA
                     WLMQVERCSPFSIIAVTFTNKAAAEMRGRVEKVIGDGVRGMWIGTFHGIAHRLLRAHH
                     LDAGLPQDFQILDSDDQYRLIRRVLKALNLDEKHWAPRAVMGYINGKKDEGLRPGDID
                     LYGDPVTRTYQQIYKTYQETCDRSGLVDFAELLLRAHELWLNKPHILEHYRDRFQNIL
                     VDEFQDTNGIQYAWLRMLAGDTGKVMIVGDDDQSIYGWRGAKIENIQRFLTDYQGAET
                     IRLEQNYRSTANILKAANCVIANNAERLGKELWTEGAEGEPISLYAAFNEVDEARFVV
                     GRLKDWKEKGGLLADCAILYRSNAQSRVLEEALMQDAMPYRIYGGLRFFERQEIKDAM
                     AYLRLINNRGDDASFERVVNTPTRGIGDRTLEILRNNARDQGQNLWQSAKALLGDKVL
                     TGRAGNAVRGFVDLIDALEEQVSLLPLHQQADIAIQHSGLKAMYLAEKGEKSQARVEN
                     LDELVTACRQYQRPDELEDMSDLSAFLAHAALESGENQADEYADAVQLMTLHSAKGLE
                     FPLVLLVGVEEGMFPSQQSTEESGRLEEERRLCYVGMTRAMEKLYICYAESRRIYGRE
                     MFHKPSRFIREMPAECLEEIRLRTQVSRPTQYGRFSQNEVQQSFDASGIKLGQRVLHP
                     KFGEGIVLNFEGVGQQSRVQIQFDDVGAKWLVTAYARLETL"
     gene            complement(244058..245614)
                     /locus_tag="AHA_RS01100"
                     /old_locus_tag="AHA_0221"
                     /db_xref="GeneID:4487730"
     CDS             complement(244058..245614)
                     /locus_tag="AHA_RS01100"
                     /old_locus_tag="AHA_0221"
                     /inference="COORDINATES: protein motif:HMM:NF024573.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AAA family ATPase"
                     /protein_id="WP_011704229.1"
                     /db_xref="GeneID:4487730"
                     /translation="MKFAAIQDCWRSLQRPLHAANGITKIEQHLSKSAITYNPDGVFA
                     VVGLNGAGKSCFFNYLTDQSYSKISFKKHTITLNDGNVLHFPGDKINATVIDISKELR
                     NSTKALLDVKSTWGQQDATSFKEDEISLFNYVLSTCYSDVLFEEVLVSEDESVPLFSV
                     VKNGVELNFEALSLGENLVFYIFWCLTRKYSSPGIFFVDEPESGLSPIAQERLVDLLV
                     YISSKKSKQIFISTHSPFIVSKLGEERVILMTKNVSAEWSHTTSDNCLEELGMKPGIK
                     GIIFFEDNKAKVFAEQLFSLYGSKLIKTHKLIFLKGESDVYEVVSRIPKSSDSFNVFG
                     LLDADQRNDKRYVKGLNSQFFFLPGIYAPEQELINAIKENIDEYSKSLLFNKSELERK
                     IKSCEGLDHHDFFEELSKKLYGNVNTKVYQDAFRVWLFNYGDLKQIHGLMSAIDPNLT
                     KENFDYVDELFNSDHGKQPDGHEEFYDAINLIQPQPQPQPQPQPQPQLIREKELHIKL
                     FDKIMRFLSS"
     gene            complement(245611..246723)
                     /locus_tag="AHA_RS01105"
                     /old_locus_tag="AHA_0222"
                     /db_xref="GeneID:4487731"
     CDS             complement(245611..246723)
                     /locus_tag="AHA_RS01105"
                     /old_locus_tag="AHA_0222"
                     /inference="COORDINATES: protein motif:HMM:NF015210.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF262 domain-containing protein"
                     /protein_id="WP_164927507.1"
                     /db_xref="GeneID:4487731"
                     /translation="MKIKQTDPDIDTIFGRIERKYIDLQPDFQRDLVWNTSKKQSLID
                     TILREWQFPPVFLILVTDGLHEVLDGQQRLNAIHEFMTNKLRVNGNIEPFDDNIARLN
                     GLTYEQLPQDVKRRFGLYSMRVCELYDYKEDEPYELFFRLNQGSVLTPAEKRNTLYGP
                     VREQVRELVHEMDLKGLNIDRIGFNNSRLAYQDVISRFLYALQHRSIEKKITDQMLID
                     FFRYPTGVDKETYLSAKKTIDKLSSLIHEKVKLNKPTLFTWLLFINYEGAIEELFLHM
                     NDLRGKSRSGDIGDPFQLFLIELYQDKSATSVNDAAPVKIRLLVLYLMGIHIGLNFNS
                     ENGLIAHSIYIKIISENNPTESLLLDYMSYSNWGAL"
     gene            complement(246810..247247)
                     /locus_tag="AHA_RS01110"
                     /old_locus_tag="AHA_0223"
                     /db_xref="GeneID:4487732"
     CDS             complement(246810..247247)
                     /locus_tag="AHA_RS01110"
                     /old_locus_tag="AHA_0223"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017788673.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2846 domain-containing protein"
                     /protein_id="WP_011704231.1"
                     /db_xref="GeneID:4487732"
                     /translation="MFRQIMMSAALLSAALLSGCASVPMAEATADAQAKQFVAPKDAA
                     NLYIYRNETFGAAVKMPLLVDGMAVGDTVAHTYILKQVTPGSHTITSKSENDATLTLS
                     TEAGKNYYVWQEVKMGLLMARSKLSQVSEEEGKQGVMESKLVK"
     gene            247452..247934
                     /locus_tag="AHA_RS01115"
                     /old_locus_tag="AHA_0224"
                     /db_xref="GeneID:4487733"
     CDS             247452..247934
                     /locus_tag="AHA_RS01115"
                     /old_locus_tag="AHA_0224"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017783334.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_164927780.1"
                     /db_xref="GeneID:4487733"
                     /translation="MGWWLLRKATLALLTSLLFMISFTLFQYASWWPAMAEDTSLEWS
                     GFSQGWTFAELVPAMLEFSAVLACAFLPLFLLTPRPLLLPLFAGLWLWQTYDIAFMTA
                     TASTWLPHEIIWTFILPHTHWLLLTLLAPLLLIRQLGRRLFVVAPATQPEMSRLADKP
                     "
     gene            complement(248027..249187)
                     /locus_tag="AHA_RS01120"
                     /old_locus_tag="AHA_0225"
                     /db_xref="GeneID:4487734"
     CDS             complement(248027..249187)
                     /locus_tag="AHA_RS01120"
                     /old_locus_tag="AHA_0225"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005307667.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="WP_011704233.1"
                     /db_xref="GeneID:4487734"
                     /translation="MKDQAATVLCFEHVTIARDCMDTLQALGFNVIRIAYSAEVFTKL
                     PFLNFDYLFSINFNPLLSQAAEALRKPYIAWVVDTPCYGMHHDAISNPFSFTFVYDLA
                     VASRLKERSNGNVYYLPVAVNEQRQLSAEPGYDHDISFIANLTPPEYQTHIKPRLAPG
                     PLQTLEELIGHIDLYLEGRPLTAQLTESHIRLVKEVYPLSGLAYLSEYEKLAYLLGRE
                     HSYRERVSCIQALAARFERVAVYGNPEWATHTETYSGYAEHYQAMPRLFQRSRINLNL
                     VRSFVESGLPMRVFDILGAGGFMVTNDKEDLHHLFTPGKDLVIFRDKQDLLEICRYYL
                     SHEEERAAIAAHGQQTVLIHHTYRARLISLFQTVQSTLASMQHPGVKAHSNH"
     gene            complement(249679..249876)
                     /gene="ydfZ"
                     /locus_tag="AHA_RS01125"
                     /old_locus_tag="AHA_0226"
                     /db_xref="GeneID:4487735"
     CDS             complement(249679..249876)
                     /gene="ydfZ"
                     /locus_tag="AHA_RS01125"
                     /old_locus_tag="AHA_0226"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010672483.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="putative selenium delivery protein YdfZ"
                     /protein_id="WP_011704234.1"
                     /db_xref="GeneID:4487735"
                     /translation="MKIYDRNRNALTPGQRVMIAATGAVDFLKEAHTDNLTPYQAEHE
                     KCVLLANSREQYAPIELIRLG"
     gene            250157..250657
                     /locus_tag="AHA_RS01130"
                     /old_locus_tag="AHA_0227"
                     /db_xref="GeneID:4487736"
     CDS             250157..250657
                     /locus_tag="AHA_RS01130"
                     /old_locus_tag="AHA_0227"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005320018.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1993 domain-containing protein"
                     /protein_id="WP_011704235.1"
                     /db_xref="GeneID:4487736"
                     /translation="MNRDIVAQFIKMLTNLDQCLAKAEAHAAAKKFNVENFFGDRLIV
                     DMLPFSKQVLICCDSARAVVATASLSEPPVLGDDPKTMADLRAHVAKTLTYLQSKLDA
                     DFSQYASGHYYPYWAGGKGMDGHTCVHEYGIPNFYFHLTMTYALLRKAGVELGKGDYL
                     GAINLQ"
     gene            complement(250746..251195)
                     /locus_tag="AHA_RS01135"
                     /old_locus_tag="AHA_0228"
                     /db_xref="GeneID:4487737"
     CDS             complement(250746..251195)
                     /locus_tag="AHA_RS01135"
                     /old_locus_tag="AHA_0228"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017410559.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SRPBCC family protein"
                     /protein_id="WP_011704236.1"
                     /db_xref="GeneID:4487737"
                     /translation="MRTGTVRLHRVLKAPPMRIYRAFIEADALAKWLPPYGFTCRVEQ
                     LEAQVGGHFRMAFTHFGNGNSHAFGGEYLELEPGKRIRYTDRFDDPNLPGVMHVTVIL
                     TGVVCGTELAIVQEGIPEVIPVEMCYLGWQESLAQLAALVEPEIPAQ"
     gene            complement(251276..251788)
                     /locus_tag="AHA_RS01140"
                     /old_locus_tag="AHA_0229"
                     /db_xref="GeneID:4487738"
     CDS             complement(251276..251788)
                     /locus_tag="AHA_RS01140"
                     /old_locus_tag="AHA_0229"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005357028.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin domain-containing protein"
                     /protein_id="WP_011704237.1"
                     /db_xref="GeneID:4487738"
                     /translation="MNRHPSIKHWRELQEPEPGRYSGSEEPLSLGSALGRHYGFARLG
                     IHHELLPPGRHTSWPHAEETEDEFVHVLEGTPDVWLDGVLHRLQPGDSVGFKAGDGLA
                     HTFINNTDQPVRLLCVGDTDRADNHIHYAMHPERNRFIGERHWDAVPERELGDHDGLP
                     DQLRERNGPF"
     gene            complement(251886..252542)
                     /locus_tag="AHA_RS01145"
                     /old_locus_tag="AHA_0230"
                     /db_xref="GeneID:4487739"
     CDS             complement(251886..252542)
                     /locus_tag="AHA_RS01145"
                     /old_locus_tag="AHA_0230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349055.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3313 domain-containing protein"
                     /protein_id="WP_011704238.1"
                     /db_xref="GeneID:4487739"
                     /translation="MKRAVIAGMVAILLGGCAVKNQVSHSLQAIPLTAFQQSESNPNQ
                     RIYKEPGVDLRQYHQVLLDPLQFIRQENGQWYLLTANEQNEIGRYYHATFQRELMNHG
                     VKIASAPGPGVMRVQAAITNFDLTRPDPKLRDLLPAKIAINVTREVIGKEPYLLKVGS
                     MAQLLDSQNGKLLVRVMDARESPDTTHKDSPITASEMEKMIDQWAAGRAKQLADNLGR
                     "
     gene            252790..253488
                     /locus_tag="AHA_RS01150"
                     /old_locus_tag="AHA_0231"
                     /db_xref="GeneID:4487740"
     CDS             252790..253488
                     /locus_tag="AHA_RS01150"
                     /old_locus_tag="AHA_0231"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011899219.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_164927508.1"
                     /db_xref="GeneID:4487740"
                     /translation="MKLIRKDSMTSLMAALCGLLLSCLAWAAPTPFVTTPPDSTITAP
                     SASMEPLLSWFTGEFSSREQASYDNRFTSAELRLVEIWPGYKGFRWVYAEQFLTERAV
                     RPFRQRIYRFSLVPDGRILMAELTMPRAIDFAGAWRQPELLDSLTPQQLSLRQGCEIW
                     LTRQPSGEYAGHSKVGSCSTNFGGASTLVQYLWIGPHSVRLLDRAYDTEAHQRWGSPG
                     EGYVYLRRVKQRGE"
     gene            complement(253498..254382)
                     /locus_tag="AHA_RS01155"
                     /old_locus_tag="AHA_0232"
                     /pseudo
                     /db_xref="GeneID:4487741"
     CDS             complement(253498..254382)
                     /locus_tag="AHA_RS01155"
                     /old_locus_tag="AHA_0232"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017411936.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /db_xref="GeneID:4487741"
     gene            254484..255104
                     /locus_tag="AHA_RS01160"
                     /old_locus_tag="AHA_0234"
                     /db_xref="GeneID:4487743"
     CDS             254484..255104
                     /locus_tag="AHA_RS01160"
                     /old_locus_tag="AHA_0234"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005307702.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysE family translocator"
                     /protein_id="WP_011704242.1"
                     /db_xref="GeneID:4487743"
                     /translation="MTLDYYTLYLLLAIGTVLSPGPAVIYTIGNTLTRGTRHAIAGFC
                     GVAVGILLVASLASLAVLWFTRWLAAGQQILTLGGALYLLYLGLNSWRQRAVSPVPGA
                     GPDRDCRRSFIKGALISLLNPKAIIFFTSLFPQFIDFRHGALGQCMLLAVTFSAVVLV
                     VHGGYCLVFHWVGAQGYGERFARGINRLSAVMFTGFALLLLFKGLR"
     gene            255231..256424
                     /locus_tag="AHA_RS01165"
                     /old_locus_tag="AHA_0235"
                     /db_xref="GeneID:4488693"
     CDS             255231..256424
                     /locus_tag="AHA_RS01165"
                     /old_locus_tag="AHA_0235"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017410565.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2920 family protein"
                     /protein_id="WP_164927509.1"
                     /db_xref="GeneID:4488693"
                     /translation="MVEAMPMAWPFNKVGNMSYYEHEVVGHPDVELGLCGERQVRYRI
                     HGAEQAGSGLVVYIPGFGGDLGAYSQVFCEKVAAQHGMAALCVDYFCMRSRPAVGAAI
                     SLLPEERERALALLGLPAKTPDTALLRALDGVQPAAPLRFQGVLVPPDGAYQNFGVMA
                     ALDILNAIEDAMLRYGGNRDNLILVGSSYGGYLAQLVNKFRPGYARALFDNSSWAEPN
                     LAYVVGQDIGAVEYQCSLQGGVELALCVDSPWRMVVGHPHEFDVDAFIIRAFSASQLD
                     QMAAQGGTQTFCLMVHAIHDAIAPADAKLAMARAMLARGFNAELILFDESSVDGEFIR
                     NMEHGMGLSMLQFFAQGLALLAERSPAFTATRAAEVTLHAGHSVYQLNFANPEVRLQR
                     QRIEA"
     gene            complement(256511..257545)
                     /locus_tag="AHA_RS01170"
                     /old_locus_tag="AHA_0236"
                     /db_xref="GeneID:4488694"
     CDS             complement(256511..257545)
                     /locus_tag="AHA_RS01170"
                     /old_locus_tag="AHA_0236"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017778625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YeeE/YedE family protein"
                     /protein_id="WP_011704244.1"
                     /db_xref="GeneID:4488694"
                     /translation="MKWALMALIGFGFGFTLSFSRFGIVFGWREMLTKRNSYYVRVHL
                     LTIAIEILLFTCFLSFSHALFGDAMVGNVMAIGIPFIVGAFLFGIGMQLAGVCATGTL
                     YCCGEGQPRFWLVLLCYGIGTLISNQLRPELEATFSSHVVLAKDLTGNIWSGMLLNLA
                     LVAALFLLFRKSELKRTGELKPLFSGGNLFWRDGRFTVLTGGIIIALLNSSVVALHGS
                     AWTITGAVYDMALRGASLFGLFEGNPKLAQPLFINPMVGMFWLGILGAMLARCISGGG
                     TFAPMRLGNSLASILGGLLMGMGAMYSACNLGGFFDGTASGSLHGWVWMLMALAGSLI
                     GIRLRPLFKL"
     gene            complement(257746..259368)
                     /locus_tag="AHA_RS01175"
                     /old_locus_tag="AHA_0237"
                     /db_xref="GeneID:4488695"
     CDS             complement(257746..259368)
                     /locus_tag="AHA_RS01175"
                     /old_locus_tag="AHA_0237"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005357470.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAMP domain-containing protein"
                     /protein_id="WP_164927510.1"
                     /db_xref="GeneID:4488695"
                     /translation="MFKAIHDRSLLFSQALGILIFIILISISFFGLYSVKSAADKMGE
                     GKDVVADILPPPLYLIEAQLQVYTLLHAAASEREGLLQSLARLEQEFNDRNRFWQEST
                     LDDQLKQSLLGEQRTQAERFWQLLDSQFIPAVQAGRLEQAAAIAAQLRTLYLAHRLGV
                     DTTVSRGSQYAAEQLAQLSLTARMCYWLLLVAALTGCALVFWLGRPTQQRLLAAGRAT
                     AAIAEGALDSPMPPPGDDAIGDLIQRIGRMRDQLSTLVAALQQSAGTLHQQATGLSSL
                     SRQHVDDSLAQVDAARQVEEVIEQLQALIQQSDAQLQQVTGMTSGSEAHANATRLVIQ
                     EVEQVIRAQADGVRRVSGTIGDLAGLSQQISGLAGAIHGIAEQTNLLALNAAIEAARA
                     GEQGRGFAVVADEVRSLASRTGEATTEITSIIGRIQDTSQRAVNEMDTELARVGKTVE
                     HVADAKQSITRIEEGCGEICQRIDQVGALLEQEKSLIHAINSNVGEMSRLAAKVNDSA
                     RHAASEADTVATNSQALTRQTQHFHLAPPPRH"
     gene            260599..263367
                     /gene="mgtA"
                     /locus_tag="AHA_RS01180"
                     /old_locus_tag="AHA_0238"
                     /db_xref="GeneID:4488696"
     CDS             260599..263367
                     /gene="mgtA"
                     /locus_tag="AHA_RS01180"
                     /old_locus_tag="AHA_0238"
                     /EC_number="7.2.2.14"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019840047.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium-translocating P-type ATPase"
                     /protein_id="WP_011704246.1"
                     /db_xref="GeneID:4488696"
                     /translation="MKQQHTASRHKQQGFVAPASAREKLSSRVLDEADKSLEYTLTAV
                     RGNIDGLTATEAANRLIQFGPNEVTHDKPPHALIQLLQAFKNPFVMVLIVLGLVSYVM
                     DVLMAEPGDEDWVKVTILGVMVGLSGLLRFWQEYRSAKAAEALKSLVRNTATVQRRPS
                     PGVAPQRKEVAMTELVAGDIVHLQAGDMIPADIKLIESRDLFISQAVLTGEALPVEKY
                     DTLGAVAGKSADGTGTGAGEAGLLDLPNICFMGTNVVSGTARAVVVATGSDTYFGSLA
                     RNVVSHKRIETSFDRGVNSVTKLLIRFMLVMVPIVFMLSGVSSGDWMSALTFALAVAV
                     GLTPEMLPMIVSANLARGAVAMAKRKVVVKRLNSVQNFGAMDVLCTDKTGTLTQDKII
                     LEHHYDVRGKRDDRILQLAWLNSFHQSGMKNLMDIAVVEHADALGESCKPANYRKVDE
                     LPFDFVRRRLSVIVQDDLGQQLMVSKGAVEEMLAVSSQIADGQEVRELTDADRRALLR
                     QSEEFNADGYRVLIVATREIPATECKQSYRTSDEVKLVVRGFLTFFDPPKDSAAPAIR
                     ALNEYGVAVKVLTGDNPIITSKVCRDVGLEPGVPLLGKDIEVMDDVALCTVVKHTTIF
                     AKLTPLQKSRVVKALQANGNTVGFLGDGINDAPALRDADVGISVDSGADIAKETADII
                     LLEKSLMVLEEGVIKGRETFGNILKYLNMTASSNFGNVFSVLVASAWLPWAPMLAMQM
                     LIQNLVYDVSQMLLPWDKMDPEFLKRPRKWEASNIKRFMLWLGPTSSVFDISTYCLMW
                     FVFGAGALYATANGSMDPLVNGQAIMNSGWFIEGLVSQTLVVHMLRTRKIPFLQSTAT
                     LPVLLSTSIAIAIGCYLPFSPLAEHFGFITLDGPKYFMWLVITMLAYMGLTQTVKSIY
                     IKRHGQWF"
     gene            complement(263467..264114)
                     /locus_tag="AHA_RS01185"
                     /old_locus_tag="AHA_0239"
                     /db_xref="GeneID:4486940"
     CDS             complement(263467..264114)
                     /locus_tag="AHA_RS01185"
                     /old_locus_tag="AHA_0239"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005319980.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysE family transporter"
                     /protein_id="WP_045790883.1"
                     /db_xref="GeneID:4486940"
                     /translation="MFTSLFLTIGLIHLIALASPGPDFALILRTSLHRPTALGAALGI
                     ALAILVHATLSLTGISLLIAEHPWLFITVKVVGALYLGWLGWGALKAAWHSSAELALH
                     AGGEAQGWRKGVQRGIATNLLNPKALLFFMGLLAAMVTPQVDGLTRGLLVLELFLLSL
                     IWFGVLAWSLSTVRAQRLLGRVQRPLNLVTGLLFGAVSLSILTGMAGEAYALVLH"
     gene            complement(264194..265012)
                     /locus_tag="AHA_RS01190"
                     /old_locus_tag="AHA_0240"
                     /db_xref="GeneID:4486941"
     CDS             complement(264194..265012)
                     /locus_tag="AHA_RS01190"
                     /old_locus_tag="AHA_0240"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005307711.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_011704248.1"
                     /db_xref="GeneID:4486941"
                     /translation="MSAPQSRIHYWQSRLLPGVELSHSHHREFSYGRHVHLDYHIGLV
                     QQGGQKFIHKGSSHHLVRGELSTVNPDEMHDGLSLLPEGYEVRVFAIAPEQLARWLPD
                     SPEPFFDQGLQRRPDLYQGFARLHMYLDNPSPDGLLAESELLALLGELLHLAPERHAL
                     ADPQLRYLRDHLLARLDERHSLEDLAALFGLDRFAFLRQFKKKTGMTPYAWLKRLRLE
                     QSKRLLGSGLPVSEVALAVGFFDQSHFHHGFRQAFGLTPADFRQQMLAASGHAD"
     gene            complement(265080..265982)
                     /gene="rarD"
                     /locus_tag="AHA_RS01195"
                     /old_locus_tag="AHA_0241"
                     /db_xref="GeneID:4486942"
     CDS             complement(265080..265982)
                     /gene="rarD"
                     /locus_tag="AHA_RS01195"
                     /old_locus_tag="AHA_0241"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704249.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EamA family transporter RarD"
                     /protein_id="WP_011704249.1"
                     /db_xref="GeneID:4486942"
                     /translation="MQQHVQRQGVIYALCAYTLWGLAPIYFKTIAAVPAAEILTHRMI
                     WSCALLMVLTLLGRQWHKVQAVLRQPKVLLTLAFTSITVGGNWLLFIWAINNGHMLDA
                     SLGYYINPLFNVLLGMLFLSEKLRRLQWWAVGLAAIGVAIQIIAFGSLPWIALVLASS
                     FAIYGLIRKKLALDALTGLLIETLIMLPPAAIYLWGFADSPTSHLTQNDWHLNLLLIA
                     AGAVTTAPLLCFTAAATRLKLSTLGFFQYIGPSLMFILAVTLYGEALALDKMITFAFI
                     WSALVLFSLDGLRSGKRRQAAEQA"
     gene            complement(266108..266398)
                     /locus_tag="AHA_RS21660"
                     /old_locus_tag="AHA_0242"
                     /db_xref="GeneID:44157218"
     CDS             complement(266108..266398)
                     /locus_tag="AHA_RS21660"
                     /old_locus_tag="AHA_0242"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017778621.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011704250.1"
                     /db_xref="GeneID:44157218"
                     /translation="MTLICELGGEIPLFHFCPFIASLNRYNHQIDKPLNIKIKMLFFL
                     GSVLFLVIGLPLLFYMLGHGEAYVTWGPWISAIALMLWLLLDVDKIRRGGGR"
     gene            complement(266407..267903)
                     /locus_tag="AHA_RS01200"
                     /old_locus_tag="AHA_0243"
                     /db_xref="GeneID:4486944"
     CDS             complement(266407..267903)
                     /locus_tag="AHA_RS01200"
                     /old_locus_tag="AHA_0243"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017411932.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase"
                     /protein_id="WP_011704251.1"
                     /db_xref="GeneID:4486944"
                     /translation="MSDLTLAQWQHKASHLTLPSQAFIDGSYRDAINGATLDCINPAN
                     GKLLTKVAACDAADAELAVQAARAAFDDKRWSGLPPKQRKQILQRFAELMRLNKVELA
                     LLESLDMGKPIGDAMGYDAPAAANCIAWNAEAIDKIYDQVAPVEESALALVTREPLGV
                     VAAIVPWNFPLVMACWKLGPALATGNSVILKPSEKSPLTALRIAGLAKEAGIPDGVFN
                     VLPGFGHTVGEALAMHMDVDCITFTGSTKIGKHLVQCSGKSNLKRAFMECGGKSPNII
                     LADAPDLDAAAKSAAGAIFYNQGEVCTAASRLLVQNSIKPQFMDRLLAHAREWISANP
                     LDPATRIGAMVDHIQMEQVLNYIAIGQQEGAKLLLGGKRTNTESGGFYIEPTIFDEVT
                     PEMRIFREEIFGPVLAVTGFDTLEEAIALGNDTDYGLAAAIWTADLNKAVKGSRALRA
                     GTVFVNNWDGGDMTMPFGGFKQSGNGRDKSLHALEKYTELKSTWIQLE"
     gene            complement(268165..268707)
                     /locus_tag="AHA_RS01205"
                     /old_locus_tag="AHA_0244"
                     /db_xref="GeneID:4486945"
     CDS             complement(268165..268707)
                     /locus_tag="AHA_RS01205"
                     /old_locus_tag="AHA_0244"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005307724.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin domain-containing protein"
                     /protein_id="WP_011704252.1"
                     /db_xref="GeneID:4486945"
                     /translation="MDIGHRLKAVRTKAALSQRELAKRSGVTNGFISQIEKNQVSPSV
                     ASLRKVLEGIPMSLATFFTDETEMDSEVIFRAADMPDLGTHPISYRLVGHSRANRAIG
                     MMQEILPPGADTGDDMLSHEGEECGIVIQGQVEVTVGEQVYLLTPGDGYYFDSRTPHR
                     FRNVDEHECVLISANTPASF"
     gene            268893..270224
                     /locus_tag="AHA_RS01210"
                     /old_locus_tag="AHA_0245"
                     /db_xref="GeneID:4486946"
     CDS             268893..270224
                     /locus_tag="AHA_RS01210"
                     /old_locus_tag="AHA_0245"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005307727.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate aminotransferase family protein"
                     /protein_id="WP_011704253.1"
                     /db_xref="GeneID:4486946"
                     /translation="MKPISDINTPSDMSAFWMPFTANQQFKAAPRILKSAEGMYYHSE
                     DGRKILDGTAGLWCCNAGHGRREIAEAVSQQISHLDFAPTFQMGHPLPFELANRLVEI
                     APKGLGHVFYTNSGSESVDTALKIALAWQRARGQGTRTRLIGRERGYHGVGFGGISVG
                     GIPGNRKWFGSLLGGVDHLPHTLNIAKNAFTKGLPEEDVALADELEKIVFLHDASNIA
                     AVIVEPIAGSTGVLMPPKGYLKRLREICTKHGILLIFDEVITGFGRLGAPFAAQEFDV
                     IPDMITCAKGLTNGAIPMGAVLVSNAIYDDMMAAGKGAIELFHGYTYSGHPVAAAAGL
                     ATLEIYRNENLLSRAADLAGYWEEAAHSLKGCKHVKDVRNYGLVAGIELESMPDAPGK
                     RAYEVFVRCFEKGALIRVTGDIIALSPPLIIERSQIDDLFTLLQDALQAQD"
     gene            270323..271819
                     /locus_tag="AHA_RS01215"
                     /old_locus_tag="AHA_0246"
                     /db_xref="GeneID:4486947"
     CDS             270323..271819
                     /locus_tag="AHA_RS01215"
                     /old_locus_tag="AHA_0246"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005319959.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CoA-acylating methylmalonate-semialdehyde
                     dehydrogenase"
                     /protein_id="WP_011704254.1"
                     /db_xref="GeneID:4486947"
                     /translation="MTYRVSNFIDGETTESRSERFGAIFNPATGQQQGQVVLSTAAEC
                     QDAIASAERALADWAQTPPLVRARVLFRFKELMEQHRDDLARLISREHGKVFSDAQGE
                     LTRGLEVVEFACGIPHLLKGEHSLNVGRGVDSHSMMQPVGVCAGITPFNFPAMVPLWM
                     FPVAIACGNTFILKPSEKDPSLSLRMAELLKQAGLPDGVLNVVNGDKEVVDVLLTDPR
                     VGAVSFVGSTPIAQYIYATASAHGKRVQALGGAKNHMLVMPDADLELAVSALMGAAYG
                     AAGERCMAISVAVVVGDETADALVARLSPLVAALRVGPGLGQSPENEMGPLISREHLA
                     KVRGYVDQGVAEGAELVVDGRGLSHGEGYFIGGSLFDRVGPEMRIYREEIFGPVLAIV
                     RAPDYETALRLINEHEYGNGTAIFTCDGDTARDFTARVQVGMVGVNVPIPVPMAFHSF
                     GGWKRSIFGPLNMHGPDGVRFYTRMKTVTARWPQSLRAGAEFSMPTMK"
     gene            271904..272659
                     /locus_tag="AHA_RS01220"
                     /old_locus_tag="AHA_0247"
                     /db_xref="GeneID:4486948"
     CDS             271904..272659
                     /locus_tag="AHA_RS01220"
                     /old_locus_tag="AHA_0247"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017783315.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine amidotransferase"
                     /protein_id="WP_011704255.1"
                     /db_xref="GeneID:4486948"
                     /translation="MRLGILDCDRLDPDLVGDFGPVYSEMFIKGFRALAPGLEFRVWS
                     ALDGELPADLHECDAWLITGSRHDAYSDIPWIRALRDWIRRAHDADVKLAGVCFGHQV
                     IAQALGGEVMKSTKGWGLGVSVHPMLARQPWMEPGLETIRILASHQDQVEQLPPGATR
                     LAGNDFCPNFMFLQGDHIVAIQGHPEFSVEYNRALIERRRDLLPDDRYQRSLSSLEGE
                     VDSATMMQWLLQFLGILPGADTAAGGITAGERA"
     gene            272656..273771
                     /gene="ald"
                     /locus_tag="AHA_RS01225"
                     /old_locus_tag="AHA_0248"
                     /db_xref="GeneID:4486949"
     CDS             272656..273771
                     /gene="ald"
                     /locus_tag="AHA_RS01225"
                     /old_locus_tag="AHA_0248"
                     /EC_number="1.4.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704256.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine dehydrogenase"
                     /protein_id="WP_011704256.1"
                     /db_xref="GeneID:4486949"
                     /translation="MIIGVPKEIKNHEYRVGMTPAGVQELTARGHKVLVQQQGGEAIG
                     LSDAEYQAAGAELVASAAEIFARAEMIVKVKEPQPEECELLRPGQLLFTYLHLAPDPV
                     QTQLLVHSGAVAIAYETVTDDRGGLPLLAPMSEVAGRMAIQAGAHSLEKAQGGNGTLL
                     GGVPAVAPAKVVVLGGGVVGVNSARMALGLGADVTILDRSLPRLRELDSLYGPALKTL
                     YSTRTNIEACIAQADLVIGAVLIPGAAAPKLLTRDMLKLMRKGSVLVDVAIDQGGCFE
                     TSHPTTHEEPTYVVDGIIHYCVANMPGGVARTSTFALTNATLPFVLALADKGYARALQ
                     DDRHLRAGLNVFKGKITQAAVAQALGYEYVSAESVLG"
     gene            273891..274730
                     /locus_tag="AHA_RS01230"
                     /old_locus_tag="AHA_0249"
                     /db_xref="GeneID:4486950"
     CDS             273891..274730
                     /locus_tag="AHA_RS01230"
                     /old_locus_tag="AHA_0249"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017411930.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate kinase"
                     /protein_id="WP_011704257.1"
                     /db_xref="GeneID:4486950"
                     /translation="MSRILLLANLNCDHVLSLSEPLVAGARLQYLDQGRRLGGGAANT
                     GIGLVWAGHEVTIASRIGLDETGDWLLEQAAGYGLDCSHVERFGGETGELLILVDSTG
                     ERTILRRPRRPDLPGDLPSEGVDCLYVNYPGTAIIGYMRQMLGKSFVVAQYPKGGQAR
                     RPCHVLVASRSDLGEVDDPWQHARQIAGEQLAWLVLTEGKAGAVAIHGEEQIRVAARP
                     VSVVDTTGAGDAFAGGLIHGLARGMAIRDALQCAVDWGAFAVASESSIPSSALKNWLR
                     QPH"
     gene            275030..275482
                     /locus_tag="AHA_RS01235"
                     /old_locus_tag="AHA_0250"
                     /db_xref="GeneID:4486951"
     CDS             275030..275482
                     /locus_tag="AHA_RS01235"
                     /old_locus_tag="AHA_0250"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704258.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Rrf2 family transcriptional regulator"
                     /protein_id="WP_011704258.1"
                     /db_xref="GeneID:4486951"
                     /translation="MQLTRFTDYALRTLTFLAVQPGDRLSTITEVADTFAISRNHVVK
                     IVHQLGIKGYIETVRGKHGGIRLGRSAVSINLRDVVMDMEHVLCPVDCKRENCRLSGG
                     CRIQGILRRAMNAFLEVLGEYTLADAVRDPTRLCHLLGIEQDSILAMA"
     gene            complement(275541..276053)
                     /locus_tag="AHA_RS01240"
                     /old_locus_tag="AHA_0251"
                     /db_xref="GeneID:4486952"
     CDS             complement(275541..276053)
                     /locus_tag="AHA_RS01240"
                     /old_locus_tag="AHA_0251"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005319946.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin-type protein NapF"
                     /protein_id="WP_011704259.1"
                     /db_xref="GeneID:4486952"
                     /translation="MTHFFCRWLTQALGGSRKPEVVCHEARPPWAIEESQFLSLCSRC
                     GECFKACPNGLLKPANQPEYDDTPIAGTPVLDLACGQCSYCGSCARACPTGALDLQLG
                     RQVQTRVRIEASCQARQGFYCLLCEDACPQQAIKATADGVSINMAACDGCGACGLACL
                     HGAITLIPQL"
     gene            276192..276407
                     /locus_tag="AHA_RS01245"
                     /old_locus_tag="AHA_0252"
                     /db_xref="GeneID:4486953"
     CDS             276192..276407
                     /locus_tag="AHA_RS01245"
                     /old_locus_tag="AHA_0252"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005319942.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_016349071.1"
                     /db_xref="GeneID:4486953"
                     /translation="MWLFLWRASLLYVFPLLMWGYCRIKGIEFVELDTGVNSHKWVVL
                     AAYLLYVLLWLLLNRYLELFLRQRSRK"
     gene            276404..277744
                     /gene="rmuC"
                     /locus_tag="AHA_RS01250"
                     /old_locus_tag="AHA_0253"
                     /db_xref="GeneID:4486954"
     CDS             276404..277744
                     /gene="rmuC"
                     /locus_tag="AHA_RS01250"
                     /old_locus_tag="AHA_0253"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010635454.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA recombination protein RmuC"
                     /protein_id="WP_011704261.1"
                     /db_xref="GeneID:4486954"
                     /translation="MIEPGLWSLLLAGAVLAVGLGWLVGRRGAAQLAQQVLLSEERQQ
                     ALQDRCDELQDEKLQSQQKLEQQQTLLIKLTARLKDAEATLRSERLAAAEKLQLQQEA
                     EQRLSQQFENLANRIFEQNSGNFRELNQNSLDLLLTPLKEQLEGFRRQVGETHAQETA
                     QRHSLKFELERLAELNARMTEEAAALTRALKGDSKQQGNWGEVVLARILSECGLREGH
                     EYHTQVNIEVDRGKRYQPDVIVHLPQDKDIIIDAKVSLTAYERWYNSDDELEKAVALK
                     EHVASVRNHIRELGRKDYQQLPGVRTLDYVLMFVAVEPAFLTAVEADPSLVRFGLDNN
                     ILLVSPTNLMVALRTIENLWRYERQNQNARQIAERAGRLYEKLRLFVEEMQQLGGSLH
                     RAQESYDKAMGRLVNGRGNLIAQVERFRELGVEVTKTLPEPLVNRALEREDPAE"
     gene            complement(277850..279292)
                     /locus_tag="AHA_RS01255"
                     /old_locus_tag="AHA_0254"
                     /db_xref="GeneID:4486955"
     CDS             complement(277850..279292)
                     /locus_tag="AHA_RS01255"
                     /old_locus_tag="AHA_0254"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005893472.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TrkH family potassium uptake protein"
                     /protein_id="WP_011704262.1"
                     /db_xref="GeneID:4486955"
                     /translation="MIKLRPIIFTLGLVLSKLALFMWLPTLLALLTGSEGFVEFLKSV
                     LITHGAALLCLHYGRKAVFHLGVREMFLLTTSVWVVACIFGALPFFFINHIDFTDAYF
                     ETMSGVTTTGSTVLSGLDGMAHSILLWRSILQWLGGVGFIVMAVAVLPYLNVGGMKLF
                     QTESSDWSDKSAPRAKTVANNIVLVYLVLSMLCFLAYWVSGMTLFEAVNHSMTTLSTG
                     GYSTSDQSMSHFSNSAHWIGTVFMFLGGLPFLLYVQSLSRRDNSLLKDAQVQGFFWLV
                     VWVTVVVTFYLWLRDIYGFMDALRISCFNIVSVLTTTGFGLGDFGTWGPLTSIIFIIL
                     LALGACSGSTAGGLKIFRVQVAFALFKKQMRQLMHPSGVFPQKYNGRPVNDAIIRSMI
                     SFVLAYFAVILLIAALLAAIGLDPLTAISGSITAVANVGPGMGPIIGPSTNFATLPDS
                     AKWILSFGMLLGRLEILTVAVLFFPSFWKQ"
     gene            complement(279389..280765)
                     /gene="trkA"
                     /locus_tag="AHA_RS01260"
                     /old_locus_tag="AHA_0255"
                     /db_xref="GeneID:4486956"
     CDS             complement(279389..280765)
                     /gene="trkA"
                     /locus_tag="AHA_RS01260"
                     /old_locus_tag="AHA_0255"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004406496.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Trk system potassium transporter TrkA"
                     /protein_id="WP_011704263.1"
                     /db_xref="GeneID:4486956"
                     /translation="MKIIILGAGQVGGTLAENLAGENNDITIVDTDSDRLRELQDKFD
                     LRVVNGHGAHPKVLREAGAQDADMLVAVTNSDETNMVACQVAYSLFNTPNKVARIRSP
                     AYLVERDRLFLPESVPVDHLIAPEQLVTDYVRRLIEYPGALQVVDFAGGKVGLVAVKA
                     YYGGPLVGNALSTLRDHMPNIETRVAAIFRQGRSIRPQGTTIIEADDEVFFVAAAGHI
                     RAVMSELQRLESPYRRIMIVGGGNIGAGLARQLEKRYSVKLIERNQKRAEQLSEVLEN
                     TIVFCGDAADQELLAEEHIDQIDVFIAVTNEDEANIMSALLAKKMGAKKTMVLIQRSA
                     YVDLVQGGSIDIAISPQQATISALLTHVRRADIANVYSLRRGAAEAIEAIAHGDENTS
                     KVVGKTVGELKLPPGTTIGAIVRGDEVLIAHDRTQIQQDDHVVMFLVDKKYIPEVERL
                     FQPSPFFL"
     gene            complement(280913..282205)
                     /gene="rsmB"
                     /locus_tag="AHA_RS01265"
                     /old_locus_tag="AHA_0256"
                     /db_xref="GeneID:4486957"
     CDS             complement(280913..282205)
                     /gene="rsmB"
                     /locus_tag="AHA_RS01265"
                     /old_locus_tag="AHA_0256"
                     /EC_number="2.1.1.176"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA (cytosine(967)-C(5))-methyltransferase
                     RsmB"
                     /protein_id="WP_011704264.1"
                     /db_xref="GeneID:4486957"
                     /translation="MKTRAQAALVIQQVLDQGQSLSAVLPAAQEKVAPRDRALLQELC
                     YGTLRWLPRLDAAVGEMMDKPLKNKSRIFHYLILVGLYQLIYTRIPAHAAVAETVNAV
                     KLLKGTSLRGLINGVLRNFQRSAEVILLRIDRVPSIRLGHPEWLTKRLRQAYPDEWEF
                     IMEANNQRPPMWIRNNSQRQSREQMLVRMAEAGINAMAGEEGEDCILLERPCDVTKLP
                     GFEAGDCSVQDGAAQQAAALLDPQPGEWVLDACAAPGGKTAHLLERQPALAGVVAVDA
                     DDNRLKRVQENLDRIGLTAKVIHGDASTPDLWWPEGQFDRILLDAPCSATGVIRRHPD
                     IKWLRRDQDIRELAELQHRILGALWSKLKSGGTLLYATCSVLPEENRDQIRAFLAATP
                     DATLVPLHAQDTPECPGRQFLPGEAEMDGFYYAKLIKR"
     gene            complement(282262..283206)
                     /gene="fmt"
                     /locus_tag="AHA_RS01270"
                     /old_locus_tag="AHA_0257"
                     /db_xref="GeneID:4486958"
     CDS             complement(282262..283206)
                     /gene="fmt"
                     /locus_tag="AHA_RS01270"
                     /old_locus_tag="AHA_0257"
                     /EC_number="2.1.2.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017411928.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionyl-tRNA formyltransferase"
                     /protein_id="WP_011704265.1"
                     /db_xref="GeneID:4486958"
                     /translation="MNKLKLIFAGTPDFAARHLAALLSSDHEVVAVYTQPDKPAGRGQ
                     KLTASPVKELALAHNLPVYQPASLRKEEAQAELAALGADLMVVVAYGLILPKAVLDTP
                     RLGCINVHGSLLPRWRGAAPIQRSIWAGDAETGVTIMQMDVGLDTGAMIRKVSCPIAA
                     DETSASLYDKLAGLGPQALVDTVNAMAAGNTAAEAQDDAQANYAEKLSKEEARIDWSM
                     EAVAIERCTRAFNPWPISWFEVAGQTVKVWQAEVVAQDHGQAAGTLLKADKQGIDIAT
                     GKGVLRLLTLQPPGKKAMSVTDLLNSRRDWFEPGTQLN"
     gene            complement(283219..283731)
                     /gene="def"
                     /locus_tag="AHA_RS01275"
                     /old_locus_tag="AHA_0258"
                     /db_xref="GeneID:4490189"
     CDS             complement(283219..283731)
                     /gene="def"
                     /locus_tag="AHA_RS01275"
                     /old_locus_tag="AHA_0258"
                     /EC_number="3.5.1.88"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010672507.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide deformylase"
                     /protein_id="WP_011704266.1"
                     /db_xref="GeneID:4490189"
                     /translation="MAILDVLRFPDERLRTVAAPVETFTPELQHIVDDMFETMYAEEG
                     IGLAATQVDIHQRIIVIDVSENREDPLVLINPEIIEQAGSTGIEEGCLSVPGSRALVP
                     RAEWVKVRALDRHGKAFELEADDLLAICIQHEMDHLVGKLFVDYLSPLKRQRIRQKLE
                     KMAREDRKVL"
     gene            283840..284928
                     /locus_tag="AHA_RS01280"
                     /old_locus_tag="AHA_0259"
                     /db_xref="GeneID:4490190"
     CDS             283840..284928
                     /locus_tag="AHA_RS01280"
                     /old_locus_tag="AHA_0259"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010635449.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysM peptidoglycan-binding domain-containing
                     protein"
                     /protein_id="WP_011704267.1"
                     /db_xref="GeneID:4490190"
                     /translation="MYLKQTILACLLATLSQGVLADQLKLKAGYPETYVVQKGDTLWD
                     ISGQYLAEPWLWPRLWNINPQIANPHWIYPGDVLHLSWVNGEPRLGKAMQGGKQVVRL
                     SPKSRYENKANPIPTLPLSEIGPFLQTDHILADSQQAKQLPYVLGNDEAHIGMLEGDT
                     LYVQGSLIPGQDYGIYHPGTIYKDKKSGEQLGQEAVFVGTARAEALLPDGRTRVTLSH
                     NQREVYQGDKLMPFPPQESLSAVFTPKAAPIISPGYIVDLPSKARGGGKFDVVLINKG
                     IRDQVAPGDVLEILRPGARLVSKNGKVAYREYSSVYDKAFYSTGKPPLPSEAVARVML
                     FKVYDKLSYGLILQSQDMVSTGYQVSNF"
     gene            284930..286045
                     /gene="dprA"
                     /locus_tag="AHA_RS01285"
                     /old_locus_tag="AHA_0260"
                     /db_xref="GeneID:4490191"
     CDS             284930..286045
                     /gene="dprA"
                     /locus_tag="AHA_RS01285"
                     /old_locus_tag="AHA_0260"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010635448.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-protecting protein DprA"
                     /protein_id="WP_011704268.1"
                     /db_xref="GeneID:4490191"
                     /translation="MPLPSGRLALWLTLDAVTGIGPVTAARLLAHFGGDIVTLFDTDD
                     GALRALGLQSVQVQQMRWPQPVVEQALSWAAEPGNHLLCPDDPAYPALLKEIPAAPLL
                     LYCRGNLAALSVPQLAMVGTRHPTYAGKDNAARLCSELVACGLAITSGLALGIDGVCH
                     QQALAAGGTTLAVLGSGLDCLYPKRHQGLAMEILVRGGLLISELAPDKGPLAEHFPRR
                     NRIISGLSLGTLVVEAAEQSGSLITARYALEQGREVFAVPGAPQNVQALGCNKLIQQG
                     AKLVLSAADIVEELPGFVGLLQQVADLSEHSNNSELPYADLLDNVDYETTSVDTVAER
                     SQLPVEVVLGRLVELELAGAVMAVAGGYVRARRANHV"
     gene            286038..286511
                     /locus_tag="AHA_RS01290"
                     /old_locus_tag="AHA_0261"
                     /db_xref="GeneID:4490192"
     CDS             286038..286511
                     /locus_tag="AHA_RS01290"
                     /old_locus_tag="AHA_0261"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010672510.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF494 domain-containing protein"
                     /protein_id="WP_011704269.1"
                     /db_xref="GeneID:4490192"
                     /translation="MFDVLMYLFETYIHSDADVMVEQNELTDELSRAGFDKDEIEKAL
                     NWLERLANLHDSEREVYVAASAQGSMRIYAPQELARLSTECRGFLLFLEQAQVLNAET
                     REICIERLLELDKPDIELDDLKWVVMMVLFNVPGSENAYQQMEELVFDESDGVIH"
     gene            286567..287124
                     /locus_tag="AHA_RS01295"
                     /old_locus_tag="AHA_0262"
                     /db_xref="GeneID:4490193"
     CDS             286567..287124
                     /locus_tag="AHA_RS01295"
                     /old_locus_tag="AHA_0262"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704270.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011704270.1"
                     /db_xref="GeneID:4490193"
                     /translation="MSKIDHHLFSAHEHAFEREPCPQCGAELVIRQGKHGPFLGCSAY
                     PVCDYIRSLTPSGRDIEKVLEGSACPDCGQPLAIKKGRYGLFVGCTQYPACQHIESLQ
                     ESDDTQILCPECGKGHLISRTSRYGKQFYSCDGYPHCKYVVNDKPVPMPCPQCGWGIM
                     VEKKVRGALRWICPQKKCGHQSEQV"
     gene            287199..287702
                     /gene="purE"
                     /locus_tag="AHA_RS01300"
                     /old_locus_tag="AHA_0263"
                     /db_xref="GeneID:4490194"
     CDS             287199..287702
                     /gene="purE"
                     /locus_tag="AHA_RS01300"
                     /old_locus_tag="AHA_0263"
                     /EC_number="4.1.1.21"
                     /EC_number="5.4.99.18"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005339704.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-(carboxyamino)imidazole ribonucleotide mutase"
                     /protein_id="WP_011704271.1"
                     /db_xref="GeneID:4490194"
                     /translation="MNKPFVAVLMGSDSDFPVMQTTLEVLKSFDIAVEVKVTSAHRTP
                     AATHQYVTDAEARGCKVFICAAGLAAHLAGAVAGITTRPVIGVPIDGGPLKGLDALLS
                     TVQMPGGVPVATVAIGKAGAKNAGYLAAQMLAVADDELAAKVQAERQKNADEVLAKDA
                     ALQALLK"
     gene            287837..288397
                     /locus_tag="AHA_RS01305"
                     /old_locus_tag="AHA_0264"
                     /db_xref="GeneID:4490195"
     CDS             287837..288397
                     /locus_tag="AHA_RS01305"
                     /old_locus_tag="AHA_0264"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005341949.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonylcarbamoyl-AMP synthase"
                     /protein_id="WP_011704272.1"
                     /db_xref="GeneID:4490195"
                     /translation="MPNEFELAVAALQRDGVIAYATEAVFGLGCDPDSESAVHRLLAI
                     KQRPVEKGLILIAADLAQLQDYIDLDQLTSEQLARVEASWPGPFTWIMPARSNTPAWL
                     TGQFTTLAVRVTAHPQVQALCRAFGKPLVSTSANLTGEEPARRVADIGELLASQLAYI
                     LPGEVGGQANPSEIKDARTGAIIRPS"
     gene            288492..289400
                     /gene="hemF"
                     /locus_tag="AHA_RS01310"
                     /old_locus_tag="AHA_0265"
                     /db_xref="GeneID:4490196"
     CDS             288492..289400
                     /gene="hemF"
                     /locus_tag="AHA_RS01310"
                     /old_locus_tag="AHA_0265"
                     /EC_number="1.3.3.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017778611.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxygen-dependent coproporphyrinogen oxidase"
                     /protein_id="WP_011704273.1"
                     /db_xref="GeneID:4490196"
                     /translation="MSKPDVAQVKAFLLQLQDEICRGLELADGAGHFVEDAWRREGGG
                     GGRTRVLRHGAVIEQGGVNFSHVHGDAMPASATAHRPELAGRRFEAMGVSLVIHPHNP
                     YVPTSHANVRFFIAEKEGEEPIWWFGGGFDLTPFYPFEEDVRHWHQLSRDLCQPFGTD
                     IYPEFKSWCDRYFFLKHRDETRGVGGLFFDDLNRWPFADCFAFMQAVGKGYLDAYLPI
                     VERRKALAYGEREREFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLARW
                     EYDWQPSAGSPEALLYSDYLKPREWL"
     gene            289504..290325
                     /gene="aroE"
                     /locus_tag="AHA_RS01315"
                     /old_locus_tag="AHA_0266"
                     /db_xref="GeneID:4490197"
     CDS             289504..290325
                     /gene="aroE"
                     /locus_tag="AHA_RS01315"
                     /old_locus_tag="AHA_0266"
                     /EC_number="1.1.1.25"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349081.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate dehydrogenase"
                     /protein_id="WP_011704274.1"
                     /db_xref="GeneID:4490197"
                     /translation="MDRYLVFGHPVRHSKSPFIHTLFARQTQQELEYGLAEPAVEEFA
                     TSLRAFFAQGGKGCNVTVPFKEQAFALVDRLSPRARRAGAVNTIKLTDDGVLLGDNTD
                     GAGLVADLKAHGVALAGSRILLLGAGGAARGALAPLLAEQPEALVIANRTHARAEQLA
                     AEFRDLGAVSAQTYERLGGHFDLIINSTSASLQGELPPLVPALIHADIAIYDMMYGAT
                     DTPFIAWAKGQGARQTVDGLGMLVEQAAEAFTVWRGIRPGTKQVLRELKRNLGTL"
     gene            290322..290582
                     /locus_tag="AHA_RS01320"
                     /old_locus_tag="AHA_0267"
                     /db_xref="GeneID:4490198"
     CDS             290322..290582
                     /locus_tag="AHA_RS01320"
                     /old_locus_tag="AHA_0267"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017783306.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1488 domain-containing protein"
                     /protein_id="WP_011704275.1"
                     /db_xref="GeneID:4490198"
                     /translation="MNQGILFPELADWQAHEQRIHFPAQQMGALVDCYISRRRLEKMT
                     GLSLAREEDILRAFESVRFDIEDIAEKLIEEQEFAEDGAIYL"
     gene            complement(291373..292023)
                     /locus_tag="AHA_RS01325"
                     /old_locus_tag="AHA_0268"
                     /db_xref="GeneID:4490199"
     CDS             complement(291373..292023)
                     /locus_tag="AHA_RS01325"
                     /old_locus_tag="AHA_0268"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005319896.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YihA family ribosome biogenesis GTP-binding
                     protein"
                     /protein_id="WP_011704276.1"
                     /db_xref="GeneID:4490199"
                     /translation="MDTQTLNFNKVHFVTSAPDIRHLPNDGGVEIAFAGRSNAGKSSA
                     LNTLTKHKNLARTSKTPGRTQLINLFELEPGKRLVDLPGYGYAQVPLEMKLKWQKSLA
                     EYLQRRESLKGLVILMDIRHPLKDTDMNMLEWSSHRKLPVMLLLTKADKLSPGPRNNQ
                     VIKVRQAVAELGPQIQVEAFSSLTQIGVEKLAQTLTGWYLAGADDMTDGEQAPLEE"
     gene            292166..292783
                     /locus_tag="AHA_RS01330"
                     /old_locus_tag="AHA_0269"
                     /db_xref="GeneID:4490200"
     CDS             292166..292783
                     /locus_tag="AHA_RS01330"
                     /old_locus_tag="AHA_0269"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005319894.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c4"
                     /protein_id="WP_016349084.1"
                     /db_xref="GeneID:4490200"
                     /translation="MKNLVITLALMVGVTGMAQAKGDAAAGQTKAAVCAACHGPDGNS
                     LVDMYPKIAGQHASYIKKQLVELKAAASGQTGRVAPIMGPMALPLSEQDMEDLAAYFS
                     SQKVTPLAVPDDAVAAGKALYMGGDMSRGLAACTACHGPRGSGVEQAKYPSLSGQHPA
                     YIKAQLTAFRAAARDNDPNSMMRDVAKKLTDQDIEVLSKYVAGLH"
     gene            293611..294189
                     /locus_tag="AHA_RS01335"
                     /old_locus_tag="AHA_0270"
                     /db_xref="GeneID:4490201"
     CDS             293611..294189
                     /locus_tag="AHA_RS01335"
                     /old_locus_tag="AHA_0270"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349086.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase-activating protein"
                     /protein_id="WP_041217267.1"
                     /db_xref="GeneID:4490201"
                     /translation="MSAKQPNRKPAGKRKESDASAQEGRERKRAAKRKGLKAGSRQQV
                     EQAGKKSGTKQAKDPRIGSRKPVALIVEEKSSKPVAPKQIKEKKLVMTPEQELASIEN
                     DDRLNDLLDRLDAGETLEATEQAWVDQRVDRYQELMDELGIIDTDDDEDEADFDEADF
                     DEPGQPASEEELWDRFTQVDYQPEPKPEPKKK"
     gene            294201..294641
                     /locus_tag="AHA_RS01340"
                     /old_locus_tag="AHA_0271"
                     /db_xref="GeneID:4490202"
     CDS             294201..294641
                     /locus_tag="AHA_RS01340"
                     /old_locus_tag="AHA_0271"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010672520.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2489 domain-containing protein"
                     /protein_id="WP_011704279.1"
                     /db_xref="GeneID:4490202"
                     /translation="MLAALLGGLILLGLAWYAGTLLARLKRQHDSQQQAVAARNERIL
                     ESVRVIAHAVRDGQCDYSEGAIRLTNLLDALQIKGGRAFAGEFPGLYGLYEKVKDMPT
                     HEVRRALKRNEVMKMDLERSGYEAELEAQILEDVARLKDFQLSR"
     gene            294669..296042
                     /gene="hemN"
                     /locus_tag="AHA_RS01345"
                     /old_locus_tag="AHA_0272"
                     /db_xref="GeneID:4490203"
     CDS             294669..296042
                     /gene="hemN"
                     /locus_tag="AHA_RS01345"
                     /old_locus_tag="AHA_0272"
                     /EC_number="1.3.98.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019445786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxygen-independent coproporphyrinogen III
                     oxidase"
                     /protein_id="WP_011704280.1"
                     /db_xref="GeneID:4490203"
                     /translation="MQAEQIVWDQALIEKYNYSGPRYTSYPTALEFNEGFGYPDFVQA
                     ASQYPARNLSLYVHIPFCHKLCYYCGCNKVITRHRHKADQYLDFLEQEIKAQAPLFKQ
                     RLVTQLHWGGGTPTYLDEPQTRRLMAMLREHFHFAEEGEISIEVDPREIELSMLDVLR
                     EIGFNRISLGVQDFNKEVQVAVNREQDNDFIRAMLERARELGFRSTNLDLIYGLPHQN
                     RESFHHTLEEVLKTDPARLSIFNYAHLPSRFAAQHKLKEADMPAPQEKLAMLQDTIAF
                     LTGRGYQFIGMDHFAKPDDELAVAQREGKLHRNFQGYTTQGDCDLLGLGVSSISMIGD
                     AYSQNQKELKAYYGQVETLGHAQWKGCSLNQDDLIRREVIKRLICDFRLNFAAVEQAH
                     GLVFREYFAEDLKLLQTFIDDGLVRMTEEGLEVISTGQLLIRNICMCFDVYLRNKARQ
                     QQFSRVI"
     gene            complement(296111..297112)
                     /gene="add"
                     /locus_tag="AHA_RS01350"
                     /old_locus_tag="AHA_0273"
                     /db_xref="GeneID:4490204"
     CDS             complement(296111..297112)
                     /gene="add"
                     /locus_tag="AHA_RS01350"
                     /old_locus_tag="AHA_0273"
                     /EC_number="3.5.4.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010635442.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenosine deaminase"
                     /protein_id="WP_011704281.1"
                     /db_xref="GeneID:4490204"
                     /translation="MIDRSLPLTDLHRHLDGNIRPQTILELGRQHNIQLPAFELEALR
                     PHVQIVENEPSLVAFLKKLDWGVAVLADYDACRRVAYENVEDLLRAGIDYAELRFSPA
                     YMAMAHKLHPQGVVEAIIDGVAAGSRDFGIKTNLIGIMSRTFGTEQCKQELDACLAHR
                     DRLIAIDLAGDELGFPGELFTDHFRRVRDAGMRVTVHAGEAAGPESMWQAIRELGAER
                     IGHGVKAIQDPALMAYLAEHRIGIESCLTSNIQTTTVASLTEHPIRQFLAAGVLACLN
                     TDDPAVEGIDLPHEYEVAAPAAGMTVSEIRTAQQNGLTLAFLSEAEKAELSARAAQR"
     gene            complement(297254..298672)
                     /gene="glnG"
                     /locus_tag="AHA_RS01355"
                     /old_locus_tag="AHA_0274"
                     /db_xref="GeneID:4490205"
     CDS             complement(297254..298672)
                     /gene="glnG"
                     /locus_tag="AHA_RS01355"
                     /old_locus_tag="AHA_0274"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005339666.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen regulation protein NR(I)"
                     /protein_id="WP_010635441.1"
                     /db_xref="GeneID:4490205"
                     /translation="MTAKVWIVDDDSSIRWVLERTLGSEGFECESFADGEALLSSLEM
                     RSPDVILSDIRMPGIDGLSLLEQIHRRQADLPIIIMTAHSDLDSAVNAYQRGAFEYLP
                     KPFDIDEAVTLVRRAENHLKEQRTKRKARQQDPASSPEIIGEAPAMQEVFRAIGRLSR
                     SSISVLINGQSGTGKELVAHALHKHSPRAHKNFIALNMAAIPKDLIESELFGHEKGAF
                     TGANNIRHGRFEQADGGTLFLDEIGDMPLDVQTRLLRVLADGQFYRVGGHQPVQVDVR
                     IIAATHQNLEKRVADGEFREDLFHRLNVIRIHIPALKERREDIPQLAQHFLLRAAKEL
                     NVEAKSLHPDTQAYISRLPWPGNVRQLENVCRWLTVMASGQEVLVSDLPTELLTPITS
                     TAEPGQPALSGGWQQQLQDWVAAKLALGETDILADALPQFERIMLETALDHTHGHKQE
                     AARLLGWGRNTLTRKLKELDLS"
     gene            complement(298682..299737)
                     /gene="glnL"
                     /locus_tag="AHA_RS01360"
                     /old_locus_tag="AHA_0275"
                     /db_xref="GeneID:4490206"
     CDS             complement(298682..299737)
                     /gene="glnL"
                     /locus_tag="AHA_RS01360"
                     /old_locus_tag="AHA_0275"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017410591.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen regulation protein NR(II)"
                     /protein_id="WP_011704282.1"
                     /db_xref="GeneID:4490206"
                     /translation="MPTRPDQAKILLDNLLTAVILMDERLCIQFVNPAAEQLLSLSQR
                     RLIGIELPHLLEHISLDLQRLKQCLSSGQGFTDSEVTLVVEGEPRLVEMSVSPLADHE
                     QRLMVVELRKIDQQKKISQELQQHAQQQAAKELVRGLAHEIKNPLGGLRGAAQLLQKE
                     LPDPALREYTGIIIEQADRLRVLVDRLLGPQRPGRHQMHNVHSVLEQVRRLVELELPP
                     TVRIERDYDPSIPEFEMEPDQLQQAFLNMVRNAAEAIGEQTGLIRIKTRTAFQITIHG
                     QRYRLAAEIKIIDNGPGIPDAIRDTLFYPMITGKEGGTGLGLSIAQNLIDQHKGRIDC
                     ISWPGHTEFTIFLPLRK"
     gene            complement(299818..300399)
                     /locus_tag="AHA_RS01365"
                     /old_locus_tag="AHA_0276"
                     /db_xref="GeneID:4490207"
     CDS             complement(299818..300399)
                     /locus_tag="AHA_RS01365"
                     /old_locus_tag="AHA_0276"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017412326.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4124 domain-containing protein"
                     /protein_id="WP_011704283.1"
                     /db_xref="GeneID:4490207"
                     /translation="MKNANPVWMLSLLLLVATGAQAAKVYSWTDSQGVVHYTDAPPPG
                     QKAKEVDLRVAPFIGSSPRSVQVDNFNSLTGVDAKKEKEAAKLVIELLSPEQGSTLRD
                     NTGNVVFQGQISPQPPTQYDVRLTLDGKAAPIVKNSLAIRVENLDRGAHEAQLELLAK
                     DGTILAKSKPVTFYLHRASINPAPKVTPLNNKG"
     gene            complement(300492..301901)
                     /gene="glnA"
                     /locus_tag="AHA_RS01370"
                     /old_locus_tag="AHA_0277"
                     /db_xref="GeneID:4490208"
     CDS             complement(300492..301901)
                     /gene="glnA"
                     /locus_tag="AHA_RS01370"
                     /old_locus_tag="AHA_0277"
                     /EC_number="6.3.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017789561.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate--ammonia ligase"
                     /protein_id="WP_011704284.1"
                     /db_xref="GeneID:4490208"
                     /translation="MSAQNVLALIQEHEVKFVDLRFTDTKGKEQHVSIPSHQVDEDFF
                     EDGKMFDGSSIGGWKGINESDMVLMPDAASAKLDPFTEETTLNIVCDVLEPATMQGYD
                     RDPRSIAKRAEDFLKSSGIADTVLFGPEPEFFMFDNITFSNTMGHSFVKIESEEAAWN
                     SGTDYEHGNKGHRPFVKGGYFPVAPVDSSQDIRAAMCLVLEEMGQVVEAHHHEVATAG
                     QNEIATRFNTLTLKADEVQVLKYVIHNVAHAYNKTVTFMPKPMFGDNGSGMHCHQSLA
                     KNGVNLFAGDLYGGLSEMALHYIGGIIKHAKAINAFANPTTNSYKRLVPGYEAPVMLA
                     YSARNRSASIRIPVVPSPKARRIEVRFPDPAANPYLAFAAQLMAGLDGIINKIHPGDA
                     MDKNLYDLPPEEAAEVPTVAGSLDEALAALDADREFLTRGGVFSDDFINSYLELKQQD
                     VDRVRMTPHPLEFELYYSV"
     gene            302253..304064
                     /gene="typA"
                     /locus_tag="AHA_RS01375"
                     /old_locus_tag="AHA_0278"
                     /db_xref="GeneID:4490436"
     CDS             302253..304064
                     /gene="typA"
                     /locus_tag="AHA_RS01375"
                     /old_locus_tag="AHA_0278"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010672527.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translational GTPase TypA"
                     /protein_id="WP_011704285.1"
                     /db_xref="GeneID:4490436"
                     /translation="MLENLRNIAIIAHVDHGKTTLVDKLLQQSGTLDRSTEGQERIMD
                     SNDLERERGITILAKNTAIRWNDYRINIVDTPGHADFGGEVERVLSMVDSVLLLVDAV
                     DGPMPQTRFVTQKAFAQGLKPIVVINKIDRPGARPDWVMDQVFDLFDNLGATDEQLDF
                     KVVYASALNGWATMDQDVESDNMEPLFQAIVDNVEAPKADADGGFQMQISQLDYNSYV
                     GVIGIGRITRGRVKTNQQVTIVGADGKSRTGKVGQVLGYLGLSRTEVADAQAGDIIAI
                     TGLGELKISDTICDNGAVEALPPLSVDEPTVNMTFQVNTSPFAGKEGKFVTSRNILER
                     LNQELVHNVALRVEETDDPDKFRVSGRGELHLSILIENMRREGYELAVSRPEVILRTV
                     DGVLQEPFETVTVDVEEAHQGSVMEQLGLRKGEMTNMTPDGKGRVRLDFMIPSRGLIG
                     FQTEFMTLTSGTGLLYHTFDHYGPHKGGSIGERQNGVLISNATGKALTYALFGLQDRG
                     RLFIGHATEVYEGQVIGIHSRSNDLTVNCLKGKQLTNMRASGTDEAQVLTPPIRMSLE
                     QALEFIDNDELVEVTPKSIRIRKKLLTEMDRKRAGRA"
     gene            304238..305110
                     /locus_tag="AHA_RS01380"
                     /old_locus_tag="AHA_0279"
                     /db_xref="GeneID:4490437"
     CDS             304238..305110
                     /locus_tag="AHA_RS01380"
                     /old_locus_tag="AHA_0279"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005319863.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="virulence factor BrkB family protein"
                     /protein_id="WP_011704286.1"
                     /db_xref="GeneID:4490437"
                     /translation="MQQKFGGRLGHALSFLRHDGGHFAQFVWGRFQQDRLTVTAGYLA
                     YVTLLSLVPMIAVVFGMMSAFPVFQSLKQAMEQFVYHNFVPTAGEMLKEYIDGFVANA
                     TNTTAVGIGALIVVALMLISAIDKNLNYIWRSTQSRPLAQAFAMYWMILTLGPVLIGA
                     SIAISSYIFSLRLFGAESLFGIGYLLLRGLPFLFSVLTFLLVYTVVPNCKVRLMHAFI
                     GALVAATLFELAKRGFAIYITNFPSYQAIYGALATIPILFVWVYLSWLVVLLGAETTA
                     CLGEYERPGADELA"
     gene            305191..305628
                     /gene="dtd"
                     /locus_tag="AHA_RS01385"
                     /old_locus_tag="AHA_0281"
                     /db_xref="GeneID:4490438"
     CDS             305191..305628
                     /gene="dtd"
                     /locus_tag="AHA_RS01385"
                     /old_locus_tag="AHA_0281"
                     /EC_number="3.1.1.96"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014291037.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-tyrosyl-tRNA(Tyr) deacylase"
                     /protein_id="WP_011704287.1"
                     /db_xref="GeneID:4490438"
                     /translation="MIALIQRVSEASVTVEGEMTGAIGQGLLVLLGVEQGDDEAKADK
                     LLHKVSGYRIFSDENGKMNLNVSQAGGGLLVVSQFTLAADTNKGMRPSFSGGAHPVEA
                     ERLYDYFVAQAAASGIPTATGRFAADMKVALVNDGPVTFWLQV"
     gene            complement(305617..306294)
                     /locus_tag="AHA_RS01390"
                     /old_locus_tag="AHA_0280"
                     /db_xref="GeneID:4490439"
     CDS             complement(305617..306294)
                     /locus_tag="AHA_RS01390"
                     /old_locus_tag="AHA_0280"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005356886.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase domain-containing protein"
                     /protein_id="WP_165444122.1"
                     /db_xref="GeneID:4490439"
                     /translation="MDFNLQAYQADHLLHLSAKPQRRLTVQENAHHRWLEIDGVVQSA
                     MSLTEPATLCLPHQQVIACLLPEQAGSILELGLGGGDLTRHLHQRWPDARHECVDLDE
                     EVITLYQLFFQPDQHPQRTPTLHQADALAFLEQSEAQYDLILLDLFSQDGNPPLLFQE
                     RIYQALAPRLNGELIINLLPRTRLELTRVLMLLEQWVGPTTPYPVPGLRNVLLHTAPR
                     YELASDL"
     gene            306468..307376
                     /locus_tag="AHA_RS01395"
                     /old_locus_tag="AHA_0282"
                     /db_xref="GeneID:4490440"
     CDS             306468..307376
                     /locus_tag="AHA_RS01395"
                     /old_locus_tag="AHA_0282"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005355431.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_011704289.1"
                     /db_xref="GeneID:4490440"
                     /translation="MYRVVTPQTAAELDAYYQLRWELLRKPFNLPVGSERDEYDTVAI
                     HRLMLAPDGTPIAVGRLFVGGDEAQIRFMALRPEFRGQGLGARMVEDLEQLARSEKVK
                     RLVMNARQEAVEFYRKCGFLEVGEGPVSFGRIPHRQMIKSLSPLQTIQYRPEWCQDLT
                     TRWSRGIPISEKMGVHITHYDGQTFHLKANLAANLNVHDTMFAGSIYSQCVLAGWGLI
                     WLQLKEAGLVGDTVLAEGNIKYYRPVKEEPEARVAREGMPAVLEPLKAGESAKFSLKI
                     KLFSGDKLAAEFLGHYVVQPVKRPGQ"
     gene            complement(307439..309505)
                     /locus_tag="AHA_RS01400"
                     /old_locus_tag="AHA_0283"
                     /db_xref="GeneID:4490441"
     CDS             complement(307439..309505)
                     /locus_tag="AHA_RS01400"
                     /old_locus_tag="AHA_0283"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349095.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane assembly protein AsmA"
                     /protein_id="WP_011704290.1"
                     /db_xref="GeneID:4490441"
                     /translation="MNSWLRGLLYTLAFLLLFVWVGLGLFDAERAKGPIASWLSQQTG
                     VPVTIGRLVFNPLHPYTLLAEQVSYGNAVTLDKIYLEIESIDWLSRDVRIAHLDLIRP
                     AIKLPLPNQLPSLPVHSLTIADSTIDRLSLESDGLTLRGLNATLSDWQLLNPVRPPQA
                     NLTLNINELATPAWALSRLNLAGRLEGQVLSTDKLTANLFDGLLETGMVLDWPARSLR
                     LNNLKTQGMRIEWGTLAKAESPLRQVSLDLGQIRDLSFNDIERELALNNLNGQLTAFN
                     WQAGSTPSGYFSGTLGDLGRGLFQLEAIQGKVAFSTQQLDAELQGKAYEGEFNLELSL
                     DPLQQKLTLKDMALSGMDISLPEGWWQDWQRWRPQQIDIRKLAFDKLKVLSFDDTLPL
                     SLTGWQFYLTDLSLRGNQPGPLLGRARLESAWFELVWDGLSARNGELDGELTAGSWQL
                     NKLTSSLPDEGSLSLSGQWGREPGQSSRLQLKGEKLDLVQWGKILHSPVSFAGKMDLS
                     ADLQALHGGTPGAWRSSLQGNIALDATEPFWDKVKIDPLLDQWFKQAAAPTLSPAELW
                     QAMQEGDTPFYRIKLQGKVAQGQLKIEQAGASTITHLLGVQGSVDLVNEQWQLDLGVL
                     NGQHCTELLGQWRGKLAEPTLSWSFQQKPDGCGWETGVRYPPQGNSSPLWRPAPKAPA
                     AQAVNG"
     gene            complement(309648..311717)
                     /gene="recG"
                     /locus_tag="AHA_RS01405"
                     /old_locus_tag="AHA_0284"
                     /db_xref="GeneID:4490442"
     CDS             complement(309648..311717)
                     /gene="recG"
                     /locus_tag="AHA_RS01405"
                     /old_locus_tag="AHA_0284"
                     /EC_number="3.6.4.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349096.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase RecG"
                     /protein_id="WP_164927511.1"
                     /db_xref="GeneID:4490442"
                     /translation="MKLDKISLDSLKGVGSKMQEKLERLGLATVQDLLFHLPLRYEDR
                     TQVWPIGDLPPGLHGAVEGEIQDTQLVMGRRRMLVCRISDGTGTLTLRFFNFTAAQKN
                     SLSPGRLMRCFGEVRPGKYGLEMAHPEYKLLGEEQAGQTEEALTPVYPTTEGLRQLTL
                     RSLTDQALAQLDLYGVEELLPAGLYPQQIDLAAALKLLHRPPPSVALALLESGQHPAQ
                     QRLVLEELLAHNLSVLKVRAQAQTQLARALKPAPALVEQLLGALPFTPTGAQNRVVAE
                     IGRDLQQSHPMMRLVQGDVGSGKTLVAALAALQAIGNGCQVGLMAPTELLAEQHAINF
                     AKWLEPLGIGVGWLAGKQKGKAREEALAAIADGSVKMVVGTHAIFQEQVVFQRLALVI
                     IDEQHRFGVHQRLALREKGEREGVHPHQLIMTATPIPRTLAMTAYADLDTSIIDELPP
                     GRTPITTVALPDSRRQDVIERVRLACEEGKQAYWVCTLIEESEVLECQAAEDTAAELQ
                     NLLPGLHIGLVHGRMRPVEKQRVMEEFKAGMLQLLVATTVIEVGVDVPNASLMIIENP
                     ERLGLAQLHQLRGRVGRGSVASHCVLLYHAPLSKTAQSRLGVLRETNDGFLIAQRDLE
                     LRGPGELLGTRQTGLADLKIADLVRDQPLIPQVQKMARFLMDRHPSHVEPLIRRWLGL
                     RDHYSNA"
     gene            complement(311897..313246)
                     /gene="pssA"
                     /locus_tag="AHA_RS01410"
                     /old_locus_tag="AHA_0285"
                     /db_xref="GeneID:4490443"
     CDS             complement(311897..313246)
                     /gene="pssA"
                     /locus_tag="AHA_RS01410"
                     /old_locus_tag="AHA_0285"
                     /EC_number="2.7.8.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017412320.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CDP-diacylglycerol--serine
                     O-phosphatidyltransferase"
                     /protein_id="WP_016349097.1"
                     /db_xref="GeneID:4490443"
                     /translation="MHSSAHYRQLLARLPQIAVAADQFEVLNSAKDFKSRILSLIASA
                     RQRIYLVALYLQDDEAGREILSALYAAKQRNPALDVKVFVDFHRAQRGLIGKGKQGGN
                     HLMYQEMAARHEHQIAIYGVPVKGRELLGVLHLKGFIFDDTLLYSGASLNDIYLHQQD
                     RYRFDRYHQITSPELTRSMVNYVDDLFLRSEAVQRLDRTDIPSAKQLKGPIRRFKHNL
                     RLGQYRFDTMPVNSQEVAITPMSGLGKRGNQLNKMIRTLVRATEREIFICTPYFNPPK
                     ELNKDIEALLKRGCKVTIVVGDKTANDFFIPPEEKFSTIGGLPYLYETNLRKFAERNQ
                     HHIDAGRLNLMLWCCERNSYHLKGIFVDDEWALLTGNNLNPRAWALDLENGLLVYDRR
                     HLLRPQFNAERENILANTKRISHFDQIEQIQDYPDQVRKLLARIHRVKAHILLKRII"
     gene            complement(313393..314733)
                     /gene="gntU"
                     /locus_tag="AHA_RS01415"
                     /old_locus_tag="AHA_0286"
                     /db_xref="GeneID:4490444"
     CDS             complement(313393..314733)
                     /gene="gntU"
                     /locus_tag="AHA_RS01415"
                     /old_locus_tag="AHA_0286"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019840070.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gluconate transporter"
                     /protein_id="WP_011704293.1"
                     /db_xref="GeneID:4490444"
                     /translation="MSDLSLIMTAAGSIVLLLFLVMKARLHAVVSLILVSMVAGLAAG
                     MNPADIAATIQKGMGGTLGFVAVVVALGAMFGKVMEVTGALDRVAHTLLGTFGVKRAN
                     WAMSLTGFICALPLFFDVAVVLLIGVAFAIVRRGGGSVVKIGIALLAGIATCQAFLIP
                     APGPILVASQLGADFGYMILFGLIAAVPALILAGPLFGELISKVVDVPLPADAQSSAH
                     DDGQNLPSFGLAMGLIGLPLLLIGLKTIVGRFVEAGTPLHGWLEFIGHPFTAIMVACL
                     AAFYLLGIRRGMSRDEVMNVCNSAIQPAGVIILVTGAGGVFKQILVDSGVGAALGNML
                     ADSGLPIVALAFILAAAVRVIQGSATVAMLTACGLVLPMLEPLGLNGAQLAAVTIAIG
                     GGAIVLSHVNDSGFWLANRYLGLTEKQTLQTWTVMETIIGTTGGVMAMIIYSFL"
     gene            314979..315488
                     /locus_tag="AHA_RS01420"
                     /old_locus_tag="AHA_0287"
                     /db_xref="GeneID:4490445"
     CDS             314979..315488
                     /locus_tag="AHA_RS01420"
                     /old_locus_tag="AHA_0287"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005340649.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gluconokinase"
                     /protein_id="WP_005307862.1"
                     /db_xref="GeneID:4490445"
                     /translation="MAGKSIIVMGVCGSGKSSVGLKVASVLGAKFIDGDDLHPRANIQ
                     KMAGGNPLNDEDRAPWLERIRDAAYSLEQKNEVGVIVCSALKKQYRDQIREGNESVSF
                     LFLDGSQPLILERMRARKGHFMRESMVQSQFDTLERPDGEAGVFHIDIDGTFEQVVDR
                     AVTALEQAQ"
     gene            315485..317281
                     /locus_tag="AHA_RS01425"
                     /old_locus_tag="AHA_0288"
                     /db_xref="GeneID:4490446"
     CDS             315485..317281
                     /locus_tag="AHA_RS01425"
                     /old_locus_tag="AHA_0288"
                     /EC_number="4.2.1.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349099.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphogluconate dehydratase"
                     /protein_id="WP_011704294.1"
                     /db_xref="GeneID:4490446"
                     /translation="MIHQVISSVTARIRERSAARRQAFLARIQRQADQGKTRAALACG
                     NLAHAVAASSCDEKGRILDMTRANVGIVTAYNDMLSAHQPYQGYPDIIKAALAELGHS
                     AQVAGGVPAMCDGVTQGQPGMDMSLFSRDLIAQATALSLSHNTFDATLLLGICDKIAP
                     GQIMGALSHAHLPTAFVPAGPMASGISNDEKVKVRQQYAAGEVGRDALLQMECGAYHA
                     AGTCTFYGTANTNQLVFEAMGLMLPGSAFVHPHSELRRALTEEAARRISAMIPGSPAY
                     RPLSAVIDERSLVNGLVALLASGGSTNHSIHMVALARAAGLHLTWDDISDLSDVVPLL
                     VRMYPNGPADVNAFEQAGGVPGLMRRLAEEGLIHLDATPVFGEMQDYLSRPALVDGQL
                     VWQPVGESGDASVLSPSGSVFQATGGTKLLAGNLGRAVVKVSAVAPEYRVIEAPARVF
                     SSQHAVEAAYKAGDLNQDAVIVVRHNGPAANGMPELHKLMPVLGNLQKAGYKVALVTD
                     GRLSGASGKIPAAIHVTPEALHGGAIGLLADGDLLRVDAVNGSLDCLTDLSGRTQAEI
                     DLTLEQEGWGRELFSVMRRAVSSAECGATIFD"
     gene            317302..317943
                     /locus_tag="AHA_RS01430"
                     /old_locus_tag="AHA_0289"
                     /db_xref="GeneID:4490447"
     CDS             317302..317943
                     /locus_tag="AHA_RS01430"
                     /old_locus_tag="AHA_0289"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005307866.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional 4-hydroxy-2-oxoglutarate
                     aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase"
                     /protein_id="WP_011704295.1"
                     /db_xref="GeneID:4490447"
                     /translation="MQNWKVTPAEVFAASPLVPVMVINELEQALPMAKALLDGGISVF
                     EITLRTPVALEAIALIAKAMPDAMVGAGTVLNCAQFDAAVAAGARFVISPGMTPALLA
                     HAANSTAPLIPGVATPSEVMQALEAGYDHLKFFPAEANGGTKALAAIAAPLPQVKFCP
                     TGGIGPKNVADYLALKCVATVGGSWMLPAEAVKNGNWEEVTRLSREAVALVAS"
     gene            complement(318041..319048)
                     /locus_tag="AHA_RS01435"
                     /old_locus_tag="AHA_0290"
                     /db_xref="GeneID:4490448"
     CDS             complement(318041..319048)
                     /locus_tag="AHA_RS01435"
                     /old_locus_tag="AHA_0290"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017410603.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family DNA-binding transcriptional
                     regulator"
                     /protein_id="WP_011704296.1"
                     /db_xref="GeneID:4490448"
                     /translation="MNDTRKRRPTLQDIADLTGVTKMTVSRYLRDPQAVAEGTRERIA
                     AAVEELGYIPNRAPDILSNATSKAIGILIPSLSNQVFSAVVHGIESVTRPAGYQTLLA
                     HYGYSPEREEEQVASLLSYHVDGLILSDSQHTERTRKMIATAGIPVVETMDLPQSPID
                     MVVGMDHRAAARAMVTEMLHRGRRKLVYLGARLDVRTQLRMEGYYQAMQDFGLSGQHL
                     LTEQSSSFTLGGQLLEQALVRYPDLDGLFCTNDDLAVGALLQCQAKWIPVPQQIAIAG
                     SNALDIGHAMTPKLASIVTPRKEIGRAAATMLLARLNGQPLADTRLDMGFSLYEGDSL
                     G"
     gene            319139..319789
                     /gene="qnr"
                     /locus_tag="AHA_RS01440"
                     /old_locus_tag="AHA_0291"
                     /db_xref="GeneID:4490449"
     CDS             319139..319789
                     /gene="qnr"
                     /locus_tag="AHA_RS01440"
                     /old_locus_tag="AHA_0291"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017778597.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Qnr family pentapeptide repeat protein"
                     /protein_id="WP_011704297.1"
                     /db_xref="GeneID:4490449"
                     /translation="MIKDKCFEGVRFEQQDLEGEQFQGCRFIGCNFSWLDLAECRFVD
                     CSFYDRESEQSCLLQGCDLREASFLRCDLTMADCSRSQCLGLELRDCQALGINFSRAS
                     FANQITVKSYFCEAHLTGNNFSYANFEGCLLEQCELSGNRWQGANLFGASLAGSDLSG
                     SEFGQIDWASVNLQGCDLRQCDLPGLDLRRVNLDGVQINEDQQQALLEQIGLIVFP"
     gene            complement(319911..321221)
                     /locus_tag="AHA_RS01445"
                     /old_locus_tag="AHA_0292"
                     /db_xref="GeneID:4490450"
     CDS             complement(319911..321221)
                     /locus_tag="AHA_RS01445"
                     /old_locus_tag="AHA_0292"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017766245.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan DD-metalloendopeptidase family
                     protein"
                     /protein_id="WP_011704298.1"
                     /db_xref="GeneID:4490450"
                     /translation="MRGCEVISTKTSRVGLLAGALFFCLSFGPATAWAANQQLGAMQS
                     QIKEQQQTIKLSRQELAKLNTQLKADEQAISAAAAKLEQTKQQLRENQQKLVGLQQDK
                     LDLEQQASHQKQLLAKQAESAFTAGNHDYLKLLLNQQDPAKLSRSLDYYDYLNKARIE
                     AIEALRATRTKLAKNQQATKETESRLQSLLSEQQQHHQSLLASQQSRAKVRNQLQQSV
                     QDDEQKLSKLVKAEKTLKARLEELRRQREEQERRERAERERLAKLKAEQERQRKLAEQ
                     RRAEQQQPTEEVASSKPERGSGISSAGYYSGLKTNGSLRWPVQGPILIAYGSPRTAEL
                     KWKGTLIGASEGTQVKAVAPGQVVYADWLDGFGMLLVIDHGRGYMSLYGHNQSLLRQV
                     GQNVEQGEPVALVGDSGGQDRPGLYFEIRYQGEAINPTKWLAKR"
     gene            complement(321231..322760)
                     /gene="gpmM"
                     /locus_tag="AHA_RS01450"
                     /old_locus_tag="AHA_0293"
                     /gene_synonym="pgmI"
                     /db_xref="GeneID:4490451"
     CDS             complement(321231..322760)
                     /gene="gpmM"
                     /locus_tag="AHA_RS01450"
                     /old_locus_tag="AHA_0293"
                     /gene_synonym="pgmI"
                     /EC_number="5.4.2.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017411918.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,3-bisphosphoglycerate-independent
                     phosphoglycerate mutase"
                     /protein_id="WP_016349104.1"
                     /db_xref="GeneID:4490451"
                     /translation="MSTAKKPLVLVIMDGWGYSTKQEHNAVAAAKTPNLDRLARDYTS
                     TLISGSGLDVGLPDGQMGNSEVGHVNIGAGRIVYQELTRISKDIQDGDFFQNVELAKA
                     VDAAVTKGKAVHIMGLMSPGGVHSHEEHIMGMIEMAAKRGAEQIYFHAFLDGRDVPPR
                     SAQSSIEQFDALFARLGKGRFASMIGRYYAMDRDNRWDRVQQAYDLMTQGKGEFTADS
                     ASEALAAAYARDENDEFVKATRIGAAAPMQDGDALIFMNFRADRAREITRAFVDSDFT
                     GFARTATPALNFVMLTEYAADIKTACAYPPTALVNTLGEWLAKQGKTQLRISETEKYA
                     HVTFFFNGGEEACFTGEDREIVASPKVATYDLQPEMSSEELTDKLVGAIKSGKYDVII
                     CNYPNGDMVGHTGVFDAAVKACEAVDHCIGRVTDALAEVGGECLITADHGNAEKMMDE
                     ETGQAHTAHTNLPVPLIYFGRKAEVAEGGKLSDLAPTMLTLMGLPVPPEMTGKPLMIL
                     K"
     gene            323086..323517
                     /locus_tag="AHA_RS01455"
                     /old_locus_tag="AHA_0294"
                     /db_xref="GeneID:4490452"
     CDS             323086..323517
                     /locus_tag="AHA_RS01455"
                     /old_locus_tag="AHA_0294"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017411919.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rhodanese-like domain-containing protein"
                     /protein_id="WP_005307875.1"
                     /db_xref="GeneID:4490452"
                     /translation="MQEYLDFAARNPLLTAAWFGLAGTLVYTTVRARFSPVKSVNNHT
                     ATLLINRENATVVDIRSQEEFAKGHLAGAQHLPLSQIQSNNLGPVEKHKDAPIIVVCE
                     SGMTAGGAGRQLSKAGFKQVYVLSGGMAQWRAENLPVTKKR"
     gene            323565..324035
                     /gene="secB"
                     /locus_tag="AHA_RS01460"
                     /old_locus_tag="AHA_0295"
                     /db_xref="GeneID:4490453"
     CDS             323565..324035
                     /gene="secB"
                     /locus_tag="AHA_RS01460"
                     /old_locus_tag="AHA_0295"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005319808.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein-export chaperone SecB"
                     /protein_id="WP_011704300.1"
                     /db_xref="GeneID:4490453"
                     /translation="MAEEINNQEVQPEFHIQRVYTKDVSFEAPNTPHIFQKEWQPDVK
                     LDMDTKTNILADSVYEVVLTLTVTCKLETETAFLCEVQQAGIFTIGNLPEPQLAHCLA
                     AFCPNILFPYAREAVSNLVSKGSFPQLNLAPVNFDALFAQHMAQAQAQQATAEA"
     gene            324038..325042
                     /gene="gpsA"
                     /locus_tag="AHA_RS01465"
                     /old_locus_tag="AHA_0296"
                     /db_xref="GeneID:4490454"
     CDS             324038..325042
                     /gene="gpsA"
                     /locus_tag="AHA_RS01465"
                     /old_locus_tag="AHA_0296"
                     /EC_number="1.1.1.94"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005319805.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H-dependent glycerol-3-phosphate
                     dehydrogenase"
                     /protein_id="WP_011704301.1"
                     /db_xref="GeneID:4490454"
                     /translation="MADQIAISVLGAGSYGSALAISLARNGHPTLLWGHDPAHVAELE
                     QDRCNKAFLPDVPFPADLQLTADLQQAVQAAPVLLLVVPSHVFGQVLAQVKPFLRPDT
                     RIAWATKGLEPDSGRLLQDVAREVLGDEMPLAVISGPTFAKELAAGLPTAISVASTHD
                     DFADDLSLLLHCGRSFRVYTNPDFIGLQLGGAVKNVIAIGAGLSDGLGFGANARTALI
                     TRGLVEMQRLGAALGADAKTFMGMAGLGDLVLTCTDNQSRNRRFGLALGAGKDVNTAM
                     AEIGQVVEGYRNTKEVHLLAARCGVEMPICEQIFKVLYEGKNPKEAAIALLSRDKKDE
                     "
     gene            complement(325126..325704)
                     /gene="nfuA"
                     /locus_tag="AHA_RS01470"
                     /old_locus_tag="AHA_0297"
                     /db_xref="GeneID:4488756"
     CDS             complement(325126..325704)
                     /gene="nfuA"
                     /locus_tag="AHA_RS01470"
                     /old_locus_tag="AHA_0297"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016942932.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe-S biogenesis protein NfuA"
                     /protein_id="WP_011704302.1"
                     /db_xref="GeneID:4488756"
                     /translation="MISISDTAQAHFRKLLEKQPDGTNIRVFVVNPGTQNAECGVSYC
                     PPDAVDPEDQHLPFSGFDCLVDPLSAPFLVDATIDFVTDQMGSQLTLKAPNAKMRKVA
                     DDAPLIDRIEYVLMSEVNPMLAGHGGKVTLVELTEDKLAILQFGGGCNGCSMVDYTLK
                     EGIEKQLLEKFPGELNGVKDATEHQRGDHSYY"
     gene            complement(325785..326513)
                     /locus_tag="AHA_RS01475"
                     /old_locus_tag="AHA_0298"
                     /db_xref="GeneID:4488757"
     CDS             complement(325785..326513)
                     /locus_tag="AHA_RS01475"
                     /old_locus_tag="AHA_0298"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017410608.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ComF family protein"
                     /protein_id="WP_011704303.1"
                     /db_xref="GeneID:4488757"
                     /translation="MLKRLLAKASPILGRHADWQGNCLLCQQPCDVDPLLCSWCRQAL
                     QQADHTCRLCAAPLPAMHEERLPICGRCQRRPPPWERLQVIGDYRPPYPMLIPRLKYS
                     GQILLAPLLARLLADHLDLSDPPEAIIPVPLHWWRQWWRGFNQAEEIALTLSELTAIP
                     CNNRLLRRVRATAQQTKLSAGQRRRNLRGAFQIRPHAYQHVALLDDVVTTGATAGHLT
                     RLLHESGVTKVEVWAVCRTLKHLK"
     gene            326550..327314
                     /gene="bioH"
                     /locus_tag="AHA_RS01480"
                     /old_locus_tag="AHA_0299"
                     /db_xref="GeneID:4488758"
     CDS             326550..327314
                     /gene="bioH"
                     /locus_tag="AHA_RS01480"
                     /old_locus_tag="AHA_0299"
                     /EC_number="3.1.1.85"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005319797.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pimeloyl-ACP methyl ester esterase BioH"
                     /protein_id="WP_011704304.1"
                     /db_xref="GeneID:4488758"
                     /translation="MSVSVERFGQGPDLVLLHGWGMNGAVWHGIVPALASRYRVHLVD
                     LPGFGNSPLAGEVEYSLPWLAEEVAAILPEQCHLLGWSLGGLVASQLALSHPERLHSL
                     ITVASSPCFMARDEWPGIAPKVLAGFNQMLAGDFKQTIERFLAIQAMGSEHARDDIRQ
                     LRHWLAERPAPQLAALEAGLGLLAEVDLRDELTPLSLPWLRVYGRLDSLVPKASIPLL
                     DERYPSSRSVVLEKASHAPFISHPQQFIEIIEHFVG"
     gene            327386..327619
                     /locus_tag="AHA_RS01485"
                     /old_locus_tag="AHA_0300"
                     /db_xref="GeneID:4488759"
     CDS             327386..327619
                     /locus_tag="AHA_RS01485"
                     /old_locus_tag="AHA_0300"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005319796.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook protein FlgE"
                     /protein_id="WP_011704305.1"
                     /db_xref="GeneID:4488759"
                     /translation="MRIDSALNSGVQGFQRAEQIADKASSQIARLNTPSGDKVQLPEE
                     LVNLKSAEVQAGASAKVIQTASDMMGTLIDIRV"
     gene            327621..328418
                     /locus_tag="AHA_RS01490"
                     /old_locus_tag="AHA_0301"
                     /db_xref="GeneID:4488760"
     CDS             327621..328418
                     /locus_tag="AHA_RS01490"
                     /old_locus_tag="AHA_0301"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017766248.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011704306.1"
                     /db_xref="GeneID:4488760"
                     /translation="MNINVSLPTIIPNQLQPQTESARTDNRRAALIPQSRQSEAFNAE
                     SEVGSQKEKSRASQANPNQTSQQARDGAQTSNPQAAIDNRFVEAAGEDGQRNKQQDPK
                     QQEQQQKQELQVKELADRDQEVRTHEQAHQSTGGQYAGSPTYEFAMGPDGKRYATGGG
                     VSIDIGTIPGDPRATIAKMQQVRAAALAPAEPSSQDLSVARSAAAKEAQARKALLSSD
                     PDTALAADGSAKTGVLNGYMEQRNQVIAQRYQQAVKPAAQQNLNLSV"
     gene            328514..328792
                     /locus_tag="AHA_RS01495"
                     /old_locus_tag="AHA_0302"
                     /db_xref="GeneID:4488761"
     CDS             328514..328792
                     /locus_tag="AHA_RS01495"
                     /old_locus_tag="AHA_0302"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005319791.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011704307.1"
                     /db_xref="GeneID:4488761"
                     /translation="MHFDEVKPEDFATFSRVPPPHLQMEQFLMQLGGGGTEGTHFKKK
                     VMLAAGWSHTGVVSYGKYPQEACKAFNRLREVLAAHREADAILAALAQ"
     gene            complement(328848..331154)
                     /locus_tag="AHA_RS01500"
                     /old_locus_tag="AHA_0303"
                     /db_xref="GeneID:4488762"
     CDS             complement(328848..331154)
                     /locus_tag="AHA_RS01500"
                     /old_locus_tag="AHA_0303"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017411922.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding transcriptional accessory protein"
                     /protein_id="WP_164927512.1"
                     /db_xref="GeneID:4488762"
                     /translation="MQSHVIEHQIAGELNARPEQVQAAVRLLDEGATVPFIARYRKEV
                     TGGLDDSQLRTLESRLGYLRELADRRQVILRSIEEQGKLTPELARELNDADSKTRLED
                     LYLPYKPKRRTKGQMAIEAGLEPLADLLLSDPLKDPEQEAVRFLNAEQGITDGKAALD
                     GARYILMERFAEQADLLEKLRDYLWHNATLRARVVTGKEQEGAKFKDYFEHDEPLHKA
                     PSHRVLAMLRGRNEGVLNLALVAGDDEGASPCEGIIAHHLKLNLQNRPADKWLQGVVS
                     WTWKIKLSLQMETELIGRIRESAEDEAIKVFAMNLKDLLMAAPAGMRCTMGLDPGIRT
                     GVKVAVVDATGKLVDHATIYPFEPKRQVDQSLKTLSELCQKHRVELISIGNGTASRET
                     DRLVSDLFERYPAAKAQKIVVSEAGASVYSASELASQEFPDLDVSIRGAVSIARRLQD
                     PLAELVKIDPKSIGVGQYQHDVGQSQLARRLDAVVEDCVNAVGVDVNTASVALLNRVS
                     GLSQTLAQNIVAYRDENGAFQHRQQLLKVSRLGPKAFEQCAGFLRIRGGSNPLDGSAV
                     HPESYPVVERILAKLEQTVDSLLGNSSLLRTLKPTDYTDEQFGVPTVTDIIGELDKPG
                     RDPRPEFKTATFKEGVEKISDLVPEMVLEGVVTNVTNFGAFVDIGVHQDGLVHISSLT
                     DRFVKDPREVVKAGDIVRVKVLEVDVPRKRISLTMRLDEKAGQPARKPAEPRHTGNAK
                     PKQAPRQSPPADGAMGNAFAAALSKLKK"
     gene            complement(331424..331897)
                     /gene="greB"
                     /locus_tag="AHA_RS01505"
                     /old_locus_tag="AHA_0304"
                     /db_xref="GeneID:4488763"
     CDS             complement(331424..331897)
                     /gene="greB"
                     /locus_tag="AHA_RS01505"
                     /old_locus_tag="AHA_0304"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229228.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription elongation factor GreB"
                     /protein_id="WP_011704309.1"
                     /db_xref="GeneID:4488763"
                     /translation="MKTKLITREGYNKLKQELDFLWREERPETTRKVAWAASLGDRSE
                     NADYQYNKKRLREIDRRVRYLRKCLEELGIVDYSPAQEGKVFFGAWVEVENEEGETKR
                     FRIVGYDEIFERKDYISIDSPMARALLKKEVGDEAIVRTPVGDACWYINEISYPK"
     gene            332134..332853
                     /gene="ompR"
                     /locus_tag="AHA_RS01510"
                     /old_locus_tag="AHA_0305"
                     /db_xref="GeneID:4488764"
     CDS             332134..332853
                     /gene="ompR"
                     /locus_tag="AHA_RS01510"
                     /old_locus_tag="AHA_0305"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009204837.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="two-component system response regulator OmpR"
                     /protein_id="WP_011704310.1"
                     /db_xref="GeneID:4488764"
                     /translation="MSQQYKVLVVDDDLKLRSLLERYLTEQGFVVRGVANGEQADRLL
                     TRENFSLMVLDLMLPGEDGLSICRRLREAGNQIPVLMLTAKGDEVDRIVGLEMGADDY
                     LPKPFNPRELLARIRAVLRRHTVELPGAPSTAEKVVSFGSYQLNLATRELSRDGDPVA
                     LTSGEFAVLKVLVSHPREPLSRDKLMNLARGREYTATERSIDVQVSRLRRLLEQDPAQ
                     PRYLQTVWGLGYVFVPDGDCE"
     gene            332850..334160
                     /gene="envZ"
                     /locus_tag="AHA_RS01515"
                     /old_locus_tag="AHA_0306"
                     /db_xref="GeneID:4488765"
     CDS             332850..334160
                     /gene="envZ"
                     /locus_tag="AHA_RS01515"
                     /old_locus_tag="AHA_0306"
                     /EC_number="2.7.13.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005319760.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="two-component system sensor histidine kinase
                     EnvZ"
                     /protein_id="WP_017410611.1"
                     /db_xref="GeneID:4488765"
                     /translation="MKKVSSMFSRMLWFLAAVLVVYQFVSYATFYNYLLAPTVKQISH
                     LLANQVKLIFPVESNQLALSEDAEALVYVATGSDIYTQTEAEQHGLNESKPYTYLEES
                     ISRELGGKTKVRVEIQDHYIIWIQPPQANKVWVRIPLTEIEDDDIEPLILYMSVLLVV
                     TLFAAWRFARQLVRPLEDLEAGAVAVARGNFPDALGEQGSREVRRLTRTFNHMSSSIK
                     GLIEERNLMMAGVSHDLRTPLTRIRLATEMMSSGDEYLKESINADIDESNGIIDQFID
                     YIRPDEGLDTQQIDLTQLIHDSLLVQTDQGLEVELELPAEAVRVACNPISIRRILNNL
                     SGNSLRYGASRLQAELKDDGHWVRLRLSDDGPGIPEQDYYRVLKPFTQGNEARTGSGS
                     GLGLAIVAKIVSQHHGTIRLGRSELGGLLVEIRLPKNQPLEWID"
     gene            complement(334196..335110)
                     /locus_tag="AHA_RS01520"
                     /old_locus_tag="AHA_0307"
                     /db_xref="GeneID:4488766"
     CDS             complement(334196..335110)
                     /locus_tag="AHA_RS01520"
                     /old_locus_tag="AHA_0307"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704312.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DMT family transporter"
                     /protein_id="WP_011704312.1"
                     /db_xref="GeneID:4488766"
                     /translation="MLKDQKKAYQYGLCAVALWSTVASAFKISLAYFEPVQLLLVAAC
                     TSTLTLGVIVACQGKLPLLLGYIKSRPLYYLALGVLNPFFYYLLLFKAYDLLPAQQAQ
                     TLNYTWAITLSLLAVPFLGQKLRRRDGVAIVLGYFGALVIATRGDVFGLQFDSPLGVT
                     LALVSTLIWAGYWILNTRNQGDPIVSLLLGFLISLPFIVAATWLLSDFSMTAWQGWAG
                     AIYVGLFEMGFGFVLWLMALRHATNTAPISNLIFISPFASLVLLNLLIGETIHPATPI
                     GLALIVAALLIQQLKYGRRYRKTSEPQA"
     gene            335467..335778
                     /gene="rpsJ"
                     /locus_tag="AHA_RS01525"
                     /old_locus_tag="AHA_0308"
                     /db_xref="GeneID:4488767"
     CDS             335467..335778
                     /gene="rpsJ"
                     /locus_tag="AHA_RS01525"
                     /old_locus_tag="AHA_0308"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014268624.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S10"
                     /protein_id="WP_005307944.1"
                     /db_xref="GeneID:4488767"
                     /translation="MQNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPT
                     RKERFTVLISPHVNKDARDQYEIRTHKRLVDIVEPTDKTVDALMRLDLAAGVDVQISL
                     G"
     gene            335801..336433
                     /gene="rplC"
                     /locus_tag="AHA_RS01530"
                     /old_locus_tag="AHA_0309"
                     /db_xref="GeneID:4488768"
     CDS             335801..336433
                     /gene="rplC"
                     /locus_tag="AHA_RS01530"
                     /old_locus_tag="AHA_0309"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005350169.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L3"
                     /protein_id="WP_010672559.1"
                     /db_xref="GeneID:4488768"
                     /translation="MTIGLVGRKVGMTRIFTEDGVSIPVTVIEVEANRVTQVKSVETD
                     GYNAIQVTTGAKKASRVTKPEAGHFAKAGVEAGRGLWEFRLNNGETFTVGSELKVDLL
                     ADVKLVDVTGTSKGKGFAGTVKRWNFRTQDMTHGNSLSHRVPGSIGQNQTPGRVFKGK
                     KMAGHMGAERVTTQNLELVRVDAERNLLLIKGAVPGATNGNVIVKPAVKA"
     gene            336451..337056
                     /gene="rplD"
                     /locus_tag="AHA_RS01535"
                     /old_locus_tag="AHA_0310"
                     /db_xref="GeneID:4488769"
     CDS             336451..337056
                     /gene="rplD"
                     /locus_tag="AHA_RS01535"
                     /old_locus_tag="AHA_0310"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010304939.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L4"
                     /protein_id="WP_005340616.1"
                     /db_xref="GeneID:4488769"
                     /translation="MELVMKDAKSALEVSETTFGREFNEALVHQVVVAYAAGARQGTR
                     AQLTRSEVSGGGKKPWRQKGTGRARAGSIRSPIWRSGGVTFAAKPQDHSQKVNKKMYR
                     GAIRSILSELVRQERLIVVEKFGIEAPKTKELIAKLKEMELTDVLIVTAEVDENLFLA
                     ARNLYKVDVRDVAGIDPVSLIAFDKVLMTADAVKQIEEMLA"
     gene            337053..337355
                     /gene="rplW"
                     /locus_tag="AHA_RS01540"
                     /old_locus_tag="AHA_0311"
                     /db_xref="GeneID:4488770"
     CDS             337053..337355
                     /gene="rplW"
                     /locus_tag="AHA_RS01540"
                     /old_locus_tag="AHA_0311"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008108343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L23"
                     /protein_id="WP_005307955.1"
                     /db_xref="GeneID:4488770"
                     /translation="MIREERLLKVLKAPHISEKSTMVAEKQNTIVFKVAVDATKAEVK
                     AAVAKLFEVEVETVRTLNMKGKTKRAGARVGRRSDWKKAYVTLKAGQDIDFMGAAE"
     gene            337371..338192
                     /gene="rplB"
                     /locus_tag="AHA_RS01545"
                     /old_locus_tag="AHA_0312"
                     /db_xref="GeneID:4488771"
     CDS             337371..338192
                     /gene="rplB"
                     /locus_tag="AHA_RS01545"
                     /old_locus_tag="AHA_0312"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002213425.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L2"
                     /protein_id="WP_005307957.1"
                     /db_xref="GeneID:4488771"
                     /translation="MAIVKCKPTSPGRRHVVKIVNQDLYKGKPFAALLDKKDKSGGRN
                     NNGRITTRHIGGGHKQHYRIVDFKRDKDGIPAKVERLEYDPNRTANIALVLYADGERR
                     YILAPKGLKAGDAIASGADAAIKVGNTLPMRNIPVGSTVHAVEMKPGKGAQLARSAGT
                     FIQILAREGNYVTLRLRSGEVRKVLAECRATIGEVGNSEHMLRQLGKAGANRWRGIRP
                     TVRGMAMNPVDHPHGGGEGRNKGMQPVSPWGQKAKGFKTRKNKRTDKYIVRRRNK"
     gene            338215..338493
                     /gene="rpsS"
                     /locus_tag="AHA_RS01550"
                     /old_locus_tag="AHA_0313"
                     /db_xref="GeneID:4488772"
     CDS             338215..338493
                     /gene="rpsS"
                     /locus_tag="AHA_RS01550"
                     /old_locus_tag="AHA_0313"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011148791.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S19"
                     /protein_id="WP_005307960.1"
                     /db_xref="GeneID:4488772"
                     /translation="MPRSLKKGPFIDLHLLKKVEKAVESGDKKPVKTWSRRSMIIPNM
                     IGLTIAVHNGRQHVPVFVTEEMIGHKLGEFAPTRTYRGHAADKKAKKR"
     gene            338504..338848
                     /gene="rplV"
                     /locus_tag="AHA_RS01555"
                     /old_locus_tag="AHA_0314"
                     /db_xref="GeneID:4488773"
     CDS             338504..338848
                     /gene="rplV"
                     /locus_tag="AHA_RS01555"
                     /old_locus_tag="AHA_0314"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005319741.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L22"
                     /protein_id="WP_011704314.1"
                     /db_xref="GeneID:4488773"
                     /translation="MEAIAKHRYARTSAQKARLVADQVRGLSVDKALNILTFSPKKAA
                     ALVKKVLESAIANAEHNEGADIDALRVATIMVDEGPSMKRIRPRAKGRADRILKRTAH
                     ITVVVSDAKAGR"
     gene            338852..339565
                     /gene="rpsC"
                     /locus_tag="AHA_RS01560"
                     /old_locus_tag="AHA_0315"
                     /db_xref="GeneID:4488774"
     CDS             338852..339565
                     /gene="rpsC"
                     /locus_tag="AHA_RS01560"
                     /old_locus_tag="AHA_0315"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229162.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S3"
                     /protein_id="WP_005331168.1"
                     /db_xref="GeneID:4488774"
                     /translation="MGQKVHPNGIRLGITKPWNSTWFANTKDFADNLYSDFQVRQFLT
                     KELKNASLSKITIERPAKSIRVTIHTARPGVVIGKKGEDVEKLRKAVAAIAGVPAQIN
                     ISEVRKPELDGKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGA
                     EIARTEWYREGRVPLHTLRADIDYATSEAHTTYGVIGVKVWIFKGEVLGGLAAVNAAA
                     AQEQAPAKPKRDNKRRAAK"
     gene            339579..339992
                     /gene="rplP"
                     /locus_tag="AHA_RS01565"
                     /old_locus_tag="AHA_0316"
                     /db_xref="GeneID:4488775"
     CDS             339579..339992
                     /gene="rplP"
                     /locus_tag="AHA_RS01565"
                     /old_locus_tag="AHA_0316"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229161.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L16"
                     /protein_id="WP_005307963.1"
                     /db_xref="GeneID:4488775"
                     /translation="MLQPKRTKFRKTHKGRNRGLANSGNEVSFGTFGLKATSRGQLTA
                     RQIEAARRAMTRHVKRQGKIWIRVFPDKPITEKPLEVRMGKGKGNVEYWVCPIQPGKV
                     LYEMDGVPEALAREAFALAAAKLSVQTTFVIKTVM"
     gene            339992..340183
                     /gene="rpmC"
                     /locus_tag="AHA_RS01570"
                     /old_locus_tag="AHA_0317"
                     /db_xref="GeneID:4489522"
     CDS             339992..340183
                     /gene="rpmC"
                     /locus_tag="AHA_RS01570"
                     /old_locus_tag="AHA_0317"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000647192.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L29"
                     /protein_id="WP_005307965.1"
                     /db_xref="GeneID:4489522"
                     /translation="MKAQDLRQKSVEELNQELLGLLREQFNMRMQASTGQLAQTHTLK
                     QVRRDVARIKTVLTEKAGA"
     gene            340183..340431
                     /gene="rpsQ"
                     /locus_tag="AHA_RS01575"
                     /old_locus_tag="AHA_0318"
                     /db_xref="GeneID:4489523"
     CDS             340183..340431
                     /gene="rpsQ"
                     /locus_tag="AHA_RS01575"
                     /old_locus_tag="AHA_0318"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006817275.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S17"
                     /protein_id="WP_005307966.1"
                     /db_xref="GeneID:4489523"
                     /translation="MTDKIRTLQGRVISDKMDKSITVAIERKVKHPIYGKIIKRTTKL
                     HVHDENNECKAGDLVEIRECRPLSKTKSWTLVAVVEKA"
     gene            340579..340947
                     /gene="rplN"
                     /locus_tag="AHA_RS01580"
                     /old_locus_tag="AHA_0319"
                     /db_xref="GeneID:4489524"
     CDS             340579..340947
                     /gene="rplN"
                     /locus_tag="AHA_RS01580"
                     /old_locus_tag="AHA_0319"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012728338.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L14"
                     /protein_id="WP_005307975.1"
                     /db_xref="GeneID:4489524"
                     /translation="MIQMQSMLGVADNSGARSVMCIKVLGGSHRRYAGIGDIIKVSIK
                     EAIPRGKVKKGDVYNAVVVRTRKGVRRPDGSVIRFDNNAAVLLNNNQQPIGTRIFGPV
                     TRELRNEKFMKIVSLAPEVL"
     gene            340959..341276
                     /gene="rplX"
                     /locus_tag="AHA_RS01585"
                     /old_locus_tag="AHA_0320"
                     /db_xref="GeneID:4489525"
     CDS             340959..341276
                     /gene="rplX"
                     /locus_tag="AHA_RS01585"
                     /old_locus_tag="AHA_0320"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000729185.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L24"
                     /protein_id="WP_005307977.1"
                     /db_xref="GeneID:4489525"
                     /translation="MAAKIRREDEVIVLTGKDKGKRGKVTQVLIAKGKVIVEGINQVK
                     KHQKPVPALGQAGGIVTKEAPIDVSNVALFNSATGKADRVGFRIEDGKKVRFFKSTGE
                     LVK"
     gene            341290..341829
                     /gene="rplE"
                     /locus_tag="AHA_RS01590"
                     /old_locus_tag="AHA_0321"
                     /db_xref="GeneID:4489526"
     CDS             341290..341829
                     /gene="rplE"
                     /locus_tag="AHA_RS01590"
                     /old_locus_tag="AHA_0321"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001096198.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L5"
                     /protein_id="WP_005331162.1"
                     /db_xref="GeneID:4489526"
                     /translation="MAKLHDYYKSDVVNELSKQFGYKTIMQVPRIEKITLNMGVGEAI
                     SDKKLLENAAADMAAISGQKPLITKARKSVAGFKIREGYPIGCKVTLRGERMWEFLER
                     LICISVPRIRDFRGLNAKAFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTSA
                     NTDEEGRALLAAFNFPFRK"
     gene            341840..342145
                     /gene="rpsN"
                     /locus_tag="AHA_RS01595"
                     /old_locus_tag="AHA_0322"
                     /db_xref="GeneID:4489527"
     CDS             341840..342145
                     /gene="rpsN"
                     /locus_tag="AHA_RS01595"
                     /old_locus_tag="AHA_0322"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005597110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S14"
                     /protein_id="WP_011704315.1"
                     /db_xref="GeneID:4489527"
                     /translation="MAKTSMKAREAKRAKLVAKFASKRTELKAIIVDMNASEEARWDA
                     VLQLQQLPRDSSPSRQRNRCNITGRPHGFLRKFGLSRIKVREHAMKGEIPGLKKASW"
     gene            342167..342559
                     /gene="rpsH"
                     /locus_tag="AHA_RS01600"
                     /old_locus_tag="AHA_0323"
                     /db_xref="GeneID:4489528"
     CDS             342167..342559
                     /gene="rpsH"
                     /locus_tag="AHA_RS01600"
                     /old_locus_tag="AHA_0323"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011148781.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S8"
                     /protein_id="WP_011704316.1"
                     /db_xref="GeneID:4489528"
                     /translation="MSMQDPIADMLTRIRNGQAASKVAVSMPSSKLKVAIAKVLKEEG
                     YITGYSVAGDVKPELEIELKYFQGKPVVELIQRVSRPGLRIYKRTTDLPKVMGGLGVA
                     IVSTSKGVMTDRAARKASMGGEIICYVA"
     gene            342573..343106
                     /gene="rplF"
                     /locus_tag="AHA_RS01605"
                     /old_locus_tag="AHA_0324"
                     /db_xref="GeneID:4489529"
     CDS             342573..343106
                     /gene="rplF"
                     /locus_tag="AHA_RS01605"
                     /old_locus_tag="AHA_0324"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004926436.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L6"
                     /protein_id="WP_005307981.1"
                     /db_xref="GeneID:4489529"
                     /translation="MSRVAKAPVTIPAGVEVTLNGQELSIKGGKGSLVRSIHAGVEVT
                     KEDNVLKFAPRDGIAGADAQAGTARALVNNMVIGVTQGFERKLQLVGVGYKASIKGNA
                     VALALGFSHPVEHALPAGVTAECPTATEIVLRGVDKQLVGQVAADIRAYRAPEPYKGK
                     GVRYANEQVRTKEAKKK"
     gene            343116..343469
                     /gene="rplR"
                     /locus_tag="AHA_RS01610"
                     /old_locus_tag="AHA_0325"
                     /db_xref="GeneID:4489530"
     CDS             343116..343469
                     /gene="rplR"
                     /locus_tag="AHA_RS01610"
                     /old_locus_tag="AHA_0325"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005970258.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L18"
                     /protein_id="WP_011704317.1"
                     /db_xref="GeneID:4489530"
                     /translation="MDKKAARLRRATRARKKMQELGATRLVVHRTPRHIYAQVIAANG
                     SEVLASASTVEKAISEAIKYTGNADAATAVGKAIAERAIAKGVQNVSFDRSGFKYHGR
                     IAALAAAARDAGLQF"
     gene            343484..343984
                     /gene="rpsE"
                     /locus_tag="AHA_RS01615"
                     /old_locus_tag="AHA_0326"
                     /db_xref="GeneID:4489531"
     CDS             343484..343984
                     /gene="rpsE"
                     /locus_tag="AHA_RS01615"
                     /old_locus_tag="AHA_0326"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020322763.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S5"
                     /protein_id="WP_011704318.1"
                     /db_xref="GeneID:4489531"
                     /translation="MAKVESQAGELQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNG
                     RVGYGYGKAREVPAAIQKAMEQAKRNLNKVELNNGTLHHPVRGVHSGSTVFMKPASQG
                     TGIIAGGAMRAVLEVAGIHNVLAKTYGSTNPINVVRATVDALVQGQSPAQIAAKRGLR
                     VEEILG"
     gene            343991..344170
                     /gene="rpmD"
                     /locus_tag="AHA_RS01620"
                     /old_locus_tag="AHA_0327"
                     /db_xref="GeneID:4489532"
     CDS             343991..344170
                     /gene="rpmD"
                     /locus_tag="AHA_RS01620"
                     /old_locus_tag="AHA_0327"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005350132.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L30"
                     /protein_id="WP_005307985.1"
                     /db_xref="GeneID:4489532"
                     /translation="MANTVKVTQTRSSIGRLPKHKATLRGLGLRRIGHTVELEDTPCV
                     RGMINQVYYMVKVEG"
     gene            344173..344610
                     /gene="rplO"
                     /locus_tag="AHA_RS01625"
                     /old_locus_tag="AHA_0328"
                     /db_xref="GeneID:4489533"
     CDS             344173..344610
                     /gene="rplO"
                     /locus_tag="AHA_RS01625"
                     /old_locus_tag="AHA_0328"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011078814.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L15"
                     /protein_id="WP_005307987.1"
                     /db_xref="GeneID:4489533"
                     /translation="MRLNTLSPAAGSKRVKHRPGRGIGSGLGKTGGRGVKGQTSRSGG
                     GKVRNGFEGGQMPLKIRLPKFGFFSRKSLVSAEVRLNEIALVEGDVVDVSTLKQAGVI
                     TKNIVFAKVVLSGNIDRAVTVRGLSVTKGARAAIEAAGGKIEE"
     gene            344619..345947
                     /gene="secY"
                     /locus_tag="AHA_RS01630"
                     /old_locus_tag="AHA_0329"
                     /db_xref="GeneID:4489534"
     CDS             344619..345947
                     /gene="secY"
                     /locus_tag="AHA_RS01630"
                     /old_locus_tag="AHA_0329"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005340602.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecY"
                     /protein_id="WP_010672567.1"
                     /db_xref="GeneID:4489534"
                     /translation="MAKKPGLDVKAQGGLSELKSRLLFVLGAIIVFRAGSYVPIPGID
                     AAVLAELFQQQKGTIIEMFNMFSGGALSRASILALGIMPYISASIIIQLLTVVHPALA
                     ELKKEGESGRRKISQYTRWGTLVLGTFQAIGIATGLPNMMQGLVTHPGLGFYFTAVVS
                     LVTGTMFLMWLGEQITERGIGNGISLIIFTGIVAGLPHAIGATAEQARQGELHILLLL
                     LLGLIVFAVTYFVVFVERGQRRIVVNYAKRQQGRQVFAAQSTHLPLKVNMAGVIPAIF
                     ASSIILFPGTITSWFGQGEGKIADILQQVSMVLQPGQPLYEMLYAAAIIFFCFFYTAL
                     VFNPRETADNLKKSGAFIPGIRPGEQTARYIDKVMTRLTLAGALYITFICLVPQFLMT
                     AWNVQFYFGGTSLLIIVVVIMDFMAQVQTHMMSHQYGDVLRKANLKGYGR"
     gene            345975..346088
                     /gene="rpmJ"
                     /locus_tag="AHA_RS01635"
                     /db_xref="GeneID:44141859"
     CDS             345975..346088
                     /gene="rpmJ"
                     /locus_tag="AHA_RS01635"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006232360.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L36"
                     /protein_id="WP_005319705.1"
                     /db_xref="GeneID:44141859"
                     /translation="MKVRASVKAICRNCKIIKRHGVVRVICSEPKHKQRQG"
     gene            346228..346584
                     /gene="rpsM"
                     /locus_tag="AHA_RS01640"
                     /old_locus_tag="AHA_0330"
                     /db_xref="GeneID:4489535"
     CDS             346228..346584
                     /gene="rpsM"
                     /locus_tag="AHA_RS01640"
                     /old_locus_tag="AHA_0330"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018356918.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S13"
                     /protein_id="WP_005307991.1"
                     /db_xref="GeneID:4489535"
                     /translation="MARIAGINIPDHKHAVIALTAIYGVGRTRSKAICAAAGIAENVK
                     IKDLDEAQIESLREQVGKFTVEGDLRRQISMNIKRLMDLGCYRGLRHRRSLPVRGQRT
                     KTNARTRKGPRKAIKK"
     gene            346599..346988
                     /gene="rpsK"
                     /locus_tag="AHA_RS01645"
                     /old_locus_tag="AHA_0331"
                     /db_xref="GeneID:4489536"
     CDS             346599..346988
                     /gene="rpsK"
                     /locus_tag="AHA_RS01645"
                     /old_locus_tag="AHA_0331"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001029758.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S11"
                     /protein_id="WP_005319702.1"
                     /db_xref="GeneID:4489536"
                     /translation="MAKTPTRARKRVKKQVSDGIAHVHASFNNTIVTITDRQGNALSW
                     ATSGGSGFRGSRKSTPFAAQVAAERAGEIAKEYGVKNLEVMVKGPGPGRESSIRALNA
                     AGFRITNITDVTPIPHNGCRPPKKRRV"
     gene            347028..347648
                     /gene="rpsD"
                     /locus_tag="AHA_RS01650"
                     /old_locus_tag="AHA_0332"
                     /db_xref="GeneID:4489537"
     CDS             347028..347648
                     /gene="rpsD"
                     /locus_tag="AHA_RS01650"
                     /old_locus_tag="AHA_0332"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004410410.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S4"
                     /protein_id="WP_011704319.1"
                     /db_xref="GeneID:4489537"
                     /translation="MARYIGPKLKLSRREGTDLFLKSGVRAIDSKCKIDTVPGQHGAR
                     KARLSDYGVQLREKQKVRRIYGVLEKQFRNYYRDAARQKGNTGENLLQLLEGRLDNVV
                     YRMGFGATRAESRQLVSHKAIMVNGRVVNIPSFQVSPEDVICVREKAKKQARIKASLE
                     VAGQREKPTWVEVDAAKMEGAFKRLPERSDLSADINEQLIVELYSK"
     gene            347674..348663
                     /gene="rpoA"
                     /locus_tag="AHA_RS01655"
                     /old_locus_tag="AHA_0333"
                     /db_xref="GeneID:4489538"
     CDS             347674..348663
                     /gene="rpoA"
                     /locus_tag="AHA_RS01655"
                     /old_locus_tag="AHA_0333"
                     /EC_number="2.7.7.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011217146.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit alpha"
                     /protein_id="WP_005307997.1"
                     /db_xref="GeneID:4489538"
                     /translation="MLGSVTDFLKPRLVDIEQVSPTHAKVTLEPLERGFGHTLGNALR
                     RILLSSMPGCAVTEVEIDGVLHEYSSKEGVQEDILEILLNLKGIAVKLEGKDEVTLSL
                     TKSGTGPVTAGDITHGDEVEIVNPEHVICHLTGANAEISMRLKVQRGRGYVPASARVH
                     NDDEERPIGRLLLDSAFSPIVRIAYNVEAARVEQRTDLDKLVIDMETNGTLDPEEAIR
                     RSATILAEQLEAFVDLRDVSVPEKKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIH
                     YIGDLVQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASIADE"
     gene            348707..349090
                     /gene="rplQ"
                     /locus_tag="AHA_RS01660"
                     /old_locus_tag="AHA_0334"
                     /db_xref="GeneID:4489539"
     CDS             348707..349090
                     /gene="rplQ"
                     /locus_tag="AHA_RS01660"
                     /old_locus_tag="AHA_0334"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_312186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L17"
                     /protein_id="WP_005307999.1"
                     /db_xref="GeneID:4489539"
                     /translation="MRHRLSGRQLNRNSSHRQAMFRNMASSLVRHEIIKTTLPKAKEL
                     RRVVEPLITLAKTDSVANRRLAFARTRDNAIVAKLFNELGPRYLERAGGYTRILKCGF
                     RAGDNAPMAYIELVDRPAAAEAAAE"
     gene            349945..351495
                     /locus_tag="AHA_RS01665"
                     /old_locus_tag="AHA_0335"
                     /db_xref="GeneID:4489540"
     rRNA            349945..351495
                     /locus_tag="AHA_RS01665"
                     /old_locus_tag="AHA_0335"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:4489540"
     gene            351690..351765
                     /locus_tag="AHA_RS01670"
                     /old_locus_tag="AHA_0336"
                     /db_xref="GeneID:4489464"
     tRNA            351690..351765
                     /locus_tag="AHA_RS01670"
                     /old_locus_tag="AHA_0336"
                     /product="tRNA-Glu"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:351724..351726,aa:Glu,seq:ttc)
                     /db_xref="GeneID:4489464"
     gene            351994..354908
                     /locus_tag="AHA_RS01675"
                     /old_locus_tag="AHA_0337"
                     /db_xref="GeneID:4489465"
     rRNA            351994..354908
                     /locus_tag="AHA_RS01675"
                     /old_locus_tag="AHA_0337"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:4489465"
     gene            354968..355082
                     /gene="rrf"
                     /locus_tag="AHA_RS01680"
                     /old_locus_tag="AHA_0338"
                     /db_xref="GeneID:4489466"
     rRNA            354968..355082
                     /gene="rrf"
                     /locus_tag="AHA_RS01680"
                     /old_locus_tag="AHA_0338"
                     /product="5S ribosomal RNA"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00001"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="RFAM:RF00001"
                     /db_xref="GeneID:4489466"
     gene            355180..355256
                     /locus_tag="AHA_RS01685"
                     /old_locus_tag="AHA_0339"
                     /db_xref="GeneID:4489467"
     tRNA            355180..355256
                     /locus_tag="AHA_RS01685"
                     /old_locus_tag="AHA_0339"
                     /product="tRNA-Asp"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:355214..355216,aa:Asp,seq:gtc)
                     /db_xref="GeneID:4489467"
     gene            complement(355349..>355417)
                     /locus_tag="AHA_RS01690"
                     /pseudo
                     /db_xref="GeneID:44141860"
     CDS             complement(355349..>355417)
                     /locus_tag="AHA_RS01690"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005306245.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylaminoimidazole carboxylase"
                     /db_xref="GeneID:44141860"
     gene            complement(356544..357530)
                     /locus_tag="AHA_RS01695"
                     /old_locus_tag="AHA_0340"
                     /db_xref="GeneID:4489468"
     CDS             complement(356544..357530)
                     /locus_tag="AHA_RS01695"
                     /old_locus_tag="AHA_0340"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005316508.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="WYL domain-containing transcriptional regulator"
                     /protein_id="WP_005308002.1"
                     /db_xref="GeneID:4489468"
                     /translation="MSKKLLRQLTLARCIPHRPYKLTASQLQVKLEEEGIHVSLRTVQ
                     RDLEEMSGMGLFDLTSDERSKPHGWCFERHGLNDFANIMPLSLAVALKTWSDQASQLL
                     PASVLTELNPLVDKASQVIRDSQSELAERWLESVHQSPRPFAGNPEIRRSTLIRDALW
                     RGRKFSAEIQRVIKERTVWLCYDRINPLGILNQAEGPTLLCTLSELDPKVYGIPFDHI
                     KNVELTNFSATQPKDFNIQKLIRDQGYQDVSGPIRFVGRIDANCPTLVDGQIPGHNPR
                     MTRYDKRSVVVETEVQDTPEFRTWLNNMSGNLEVLAPESLRKAYPTPGSRVS"
     gene            complement(357834..358220)
                     /locus_tag="AHA_RS01700"
                     /old_locus_tag="AHA_0341"
                     /db_xref="GeneID:4489469"
     CDS             complement(357834..358220)
                     /locus_tag="AHA_RS01700"
                     /old_locus_tag="AHA_0341"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017785733.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SirB2 family protein"
                     /protein_id="WP_011704321.1"
                     /db_xref="GeneID:4489469"
                     /translation="MIAYYPMLKHLHMTLALVSVLLFLYRWLLALGGSPRLQQKWLKI
                     LPHVNDTFLLLFGVLLAVTLQMSPGQQPWLMAKLIALVVYIGLGVMALKRPARSQKLV
                     AGLAALAVFGYMVGAAITKSALSWLA"
     gene            complement(358217..360073)
                     /locus_tag="AHA_RS01705"
                     /old_locus_tag="AHA_0342"
                     /db_xref="GeneID:4489470"
     CDS             complement(358217..360073)
                     /locus_tag="AHA_RS01705"
                     /old_locus_tag="AHA_0342"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017778464.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transporter"
                     /protein_id="WP_011704322.1"
                     /db_xref="GeneID:4489470"
                     /translation="MGHGLLFDAFIYLSAAVIAVPLAKRWGLGSVLGYLLAGIIIGPF
                     LLGLVGEQKDVMHFAEFGVVLMLFLVGLELRPALLWQLKGPILGTGGLQVLLTTAALT
                     GVAHLIGLPWQQGLAIGLILALSSTAIVLQSLQERKLMQSESGRSAFAVLLFQDIAVI
                     PILAILPLLAIAPVASSGSSELAGWQHGLLVVAAISGIVLGGHYLMRPVFRAIAQSHM
                     REIFVAAALLLVIAIAVLMESVGLSPALGSFLAGVVLADSEYRHELEADIEPFKGLLL
                     GLFFMSVGAGINFGLFAEHPLLIPTLVVGLMVLKWLVLMALGFAIRISPSQRWTFGLA
                     LAQGGEFAFVLFSFAAQNKVLPGDTIALLTLVVALSMALTPLLLILNDRVIQPWFDYR
                     NQSELPQHEQPELVEHPVIIAGFGRFGQIVGRLLHGHGIGTTILEQDASQIEMLRKYG
                     YQVFYGDASRLDLLHAAGAHKAKLLVLSINDPATSLEVIEMVKKHFPHLKILARAQDR
                     PHAHEILRQGVGSVYRETLGSAVDLGVEALTQLGFRANQAWRAGQTFKQHDNWLLREQ
                     VNYLDDEHTYINKSLQYRDILSDLLQDDQEGQERIHAHNWNSGLPDNDKEAI"
     gene            complement(360144..360743)
                     /locus_tag="AHA_RS01710"
                     /old_locus_tag="AHA_0343"
                     /db_xref="GeneID:4489471"
     CDS             complement(360144..360743)
                     /locus_tag="AHA_RS01710"
                     /old_locus_tag="AHA_0343"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005316502.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="modulator of glutathione-dependent potassium
                     efflux system"
                     /protein_id="WP_016349118.1"
                     /db_xref="GeneID:4489471"
                     /translation="MKRILVIFSHPALQSSRANKQLLQAIDGLEGVTLHDLYQHYPNM
                     FINVKREQALLSEHDIIVFQHPFYWYSCPAIMKEWMDLVLEYGYAYGPEAHALNGKQW
                     LSAITTGGAPESYCSEGYNQRPLLDFLLPFRQTAQLCGMSWLPPFVLHSFHKIRDQEA
                     LRRCGQDYRQLLCALRDEQLTPAQLAGSPYLRDLLEVLS"
     gene            complement(360821..361663)
                     /locus_tag="AHA_RS01715"
                     /old_locus_tag="AHA_0344"
                     /db_xref="GeneID:4489472"
     CDS             complement(360821..361663)
                     /locus_tag="AHA_RS01715"
                     /old_locus_tag="AHA_0344"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005357655.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_042066814.1"
                     /db_xref="GeneID:4489472"
                     /translation="MLDLRLLRFFIAIYEEKNITAAAERCHVSQPSLSAGLRQLEETL
                     GDSLFIRGKKGVAARDQAHYLYPHAVKLVEEARRLPALFRQKATRARLNMAIMPDLSR
                     RRVAGLLQQVQAVLPELDLTLSDYGTPADCRLTLDALRREDEIFLPLWEEDYVLCVRR
                     DHPLASRQQLELAELQHYDFIECPPCEAHQQTIGLLACDRLTLNLVAKAESKGLVMAL
                     VLAGVGISFLPDGLVEDEAGLCTVPVRGPRMFRRIGLCYPAHQTLNPALRELIPELAS
                     HGAS"
     gene            361807..362529
                     /locus_tag="AHA_RS01720"
                     /old_locus_tag="AHA_0345"
                     /db_xref="GeneID:4489473"
     CDS             361807..362529
                     /locus_tag="AHA_RS01720"
                     /old_locus_tag="AHA_0345"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008988230.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family oxidoreductase"
                     /protein_id="WP_164927513.1"
                     /db_xref="GeneID:4489473"
                     /translation="MSKPLVVITGASAGIGAAIARAFSAAGHPLLLLARRVEPMQALA
                     LPDTLCIGVDVTDTAAMKAAIKQAEAQFGPVGCLVNNAGVMLLGQADVQDPAEWQQML
                     NINVMGVLNGVHAVLAGMKARRSGTIINISSIAGRKTFPNHAAYCATKFAVHALTENI
                     REEVADVGVRMVTIAPGAVETELLSHTTDESIKAGYHDWKDQMGGVIAPEVIADAVLY
                     AWSQPANVCVREIMLAATRQQP"
     gene            362617..362940
                     /locus_tag="AHA_RS01725"
                     /old_locus_tag="AHA_0346"
                     /db_xref="GeneID:4489474"
     CDS             362617..362940
                     /locus_tag="AHA_RS01725"
                     /old_locus_tag="AHA_0346"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704326.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011704326.1"
                     /db_xref="GeneID:4489474"
                     /translation="MVLTRRQLARARRWLPLWSLLMVLMSFGSRAATDLCTLTPHCSQ
                     SERTLEKAMPCGSFTSALAMTVLTGDSLTVAMLEPDTPDFISPSQFMPDVPTDRLERP
                     PRHLG"
     gene            362990..363421
                     /locus_tag="AHA_RS01730"
                     /old_locus_tag="AHA_0347"
                     /db_xref="GeneID:4489475"
     CDS             362990..363421
                     /locus_tag="AHA_RS01730"
                     /old_locus_tag="AHA_0347"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017783152.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF411 domain-containing protein"
                     /protein_id="WP_011704327.1"
                     /db_xref="GeneID:4489475"
                     /translation="MYKSLLLAVLAGTVSFSALATEQMTVYKSQYCGCCKTWIKHMEE
                     NGFEVKVVETEQLEPVKQQYGITPQLASCHTGVVNGYVVEGHVPAADVQKLLKEKPAI
                     RGLTIPGMPQSAPGMDIPGQPYQVLSISNEGATKVWSSYPG"
     gene            363646..365799
                     /locus_tag="AHA_RS01735"
                     /old_locus_tag="AHA_0348"
                     /db_xref="GeneID:4489476"
     CDS             363646..365799
                     /locus_tag="AHA_RS01735"
                     /old_locus_tag="AHA_0348"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005316493.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S9 family peptidase"
                     /protein_id="WP_164927514.1"
                     /db_xref="GeneID:4489476"
                     /translation="MFTFSRGLLLLACLAAVPCSYANDESAMPTSDTLIQPPVAAKHP
                     HAIKKHGDTRVDNYYWLRDDERQKPEVLAYLEAENAYTDAMLKPIKPLRDQLYQEMVA
                     RIPQQDESVPYVKNGYRYQTRYEPGKEYAIYSRSKLGEEAASLLLDGNQRAEGHEFYA
                     LGALEVSRNNRWLAVAEDFLSRRQYQIQFLDLESGKWAAELLPNTSGNLVWANDSKTV
                     FYVRKHPKTLLPYQVYRHELGTEPAKDQLVYEEKDDSFYVSLYATTSEDFIVIALSST
                     TSGEARLIDANVPTQAPRLFLPRQVDHEYSLDHYRGRFYVRSNKDGKNFGLYETKESP
                     VDRWKAVIAPNPDVLLESYALFKEWLVLEERSQGLTRLRQVNWQSGEQKEIAFDDPAY
                     VTWLAYNPEPDTSALRYGYSSMTTPSSTYELDLNSGKRTLLKQQPVAGFKAEQYASER
                     LWITARDGVAVPVSLVYRKDKFKQEGAGTHTNPLLVYGYGSYGASMDPDFSSARLSLL
                     DRGFVYAIAHIRGGEELGRHWYEDGKLLKKQNTFNDFIDVTEALVAQGYGAKDQVYAM
                     GGSAGGLLMGAVINQAPQLYRGVVAQVPFVDVVTTMLDESIPLTTGEYDEWGNPNQKR
                     YYDYMKAYSPYDQVKAQAYPNLLVTTGLHDSQVQYWEPAKWVAKLRELKTDDNKLLLS
                     TDMDAGHGGKSGRFKAYEDIALEFAFILDLAKPQA"
     gene            366215..367186
                     /locus_tag="AHA_RS01740"
                     /old_locus_tag="AHA_0349"
                     /db_xref="GeneID:4489477"
     CDS             366215..367186
                     /locus_tag="AHA_RS01740"
                     /old_locus_tag="AHA_0349"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005339950.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TAXI family TRAP transporter solute-binding
                     subunit"
                     /protein_id="WP_016349123.1"
                     /db_xref="GeneID:4489477"
                     /translation="MKGLSLACALSAVLAGVSFGGPVQAQERFVTIGTGGQTGVYYVA
                     GQSICRFLNRGAADHQIKCNAPASGGGVANVNGIRSGEFNFGIMQSDHQYKAMKGLPP
                     FQAEGAMDDMRAVFSLQSEVFTILARKDAKIAGFDDLKGKRVNIGNPGSGQRDTFEEI
                     MAVKGWKKGDFGLVSELKPAEQASALGDNNIDAMSYFVGHPNGAIQEASTTTDAVLVP
                     VTGADIDKLLAEKSYYSKAEIPGGIYKGSDQPTPSIGGKAVLSTSAKADPEVVYQLVK
                     SVFDNLDRFKRLHPAFADLKEADMIKVGLSAPLHEGAARYYKERGWL"
     gene            367289..369841
                     /locus_tag="AHA_RS01745"
                     /old_locus_tag="AHA_0350"
                     /db_xref="GeneID:4489478"
     CDS             367289..369841
                     /locus_tag="AHA_RS01745"
                     /old_locus_tag="AHA_0350"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019444684.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TRAP transporter permease"
                     /protein_id="WP_011704330.1"
                     /db_xref="GeneID:4489478"
                     /translation="MQDKQLSTEELIAQDVGARLPLGIMGGCITTLALAWSLFQLWIA
                     SPLPFMLGFGVLNDTETRAIHLTFALLLAYLVFPAFRRSPRDRVPLGDLALGLVAAGA
                     ASYLFVMYEALAQRPGNLTTADLVTACIGIPLLLEAARRALGPALAVIALVFLAYSLA
                     GPWMPGLLAHRGVSFTALANHQWITTEGVFGIALGVSTSFVFLFVLFGALLERAGAGH
                     YFIQLAFSLLGHLRGGPAKAAVVASGLTGLISGSSIANVVTTGTFTIPMMKKVGFSAE
                     KAGAVEVASSVNGQIMPPVMGAAAFLMVEYVGIPYVEIIKHAFLPATISYIALLYIVH
                     LEALKLGMQPIGDHQPKPWLRRLTGFAFGAALISGLSMAVYYGLGWLKPALGDYALPG
                     IALLLAATYLGLLKIAASNEPLAAEDPDKPLTELPNTRTVLLSGLHFLLPVVVLVWCL
                     MVERLSPGLSAFWGTVMLVIILLTQRPLLNWLRSDGRHDYGSLQDGLIDLREGLVAGA
                     RNMIGIGIATATAGIIVGAVSQTGVGLVLADLVEMLSMGNLLLMLLLTALLSLILGMG
                     LPTTANYIVVSSLLAPVVVTLGQQNGLIVPLIAVHLFVFYFGIMADVTPPVGLASFAA
                     AAVSKGDPIKTGITAFYYSLRTAALPFLFIFNTDLLLIDVDFAHGVLIFMVATVAMLI
                     FAAATQGHFLVKSRWYESVLLLLVAFTLFRPGFWMDMVHDPYRETPPAQLAQTLGEVE
                     AESTLRLRIQGEDAVGKLRQSTVLLAVPAGEDGEARLASLGLALYEQDGKTLIDSVTF
                     GSPAAAAGMEFDQEIMMVKAPTERWRKELMWLPGFLLFALIVWLQRRRVVRA"
     gene            complement(370032..370172)
                     /locus_tag="AHA_RS01750"
                     /old_locus_tag="AHA_0352"
                     /db_xref="GeneID:4489480"
     CDS             complement(370032..370172)
                     /locus_tag="AHA_RS01750"
                     /old_locus_tag="AHA_0352"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_016349126.1"
                     /db_xref="GeneID:4489480"
                     /translation="MKNYLPAIDIMMCHLGISFEQACEQLGLSQVEQQTLSLLQEQDP
                     QE"
     gene            370361..370987
                     /locus_tag="AHA_RS01755"
                     /old_locus_tag="AHA_0353"
                     /db_xref="GeneID:4489481"
     CDS             370361..370987
                     /locus_tag="AHA_RS01755"
                     /old_locus_tag="AHA_0353"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005339927.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysoplasmalogenase"
                     /protein_id="WP_011704333.1"
                     /db_xref="GeneID:4489481"
                     /translation="MLLSFLIIASGWWHIRAAYGSDSRQFYISKPLTMLLIIALAFGY
                     QSYDHDGSHAWILLGLCLSLAGDVLLMLPSDRFIQGLAAFFVAHLCYIVGFAQGPLVL
                     NLVDGLLLLLVAGMVFGLLWGKLGEMKVPVFCYMLVIIGMAWVAAGAWHASLTAGSAA
                     ALVGALMFLFSDSMLALDRFRRPFPHATAWVMTSYFAAQFLIAASLAG"
     gene            complement(371078..372631)
                     /locus_tag="AHA_RS01760"
                     /old_locus_tag="AHA_0354"
                     /db_xref="GeneID:4489482"
     CDS             complement(371078..372631)
                     /locus_tag="AHA_RS01760"
                     /old_locus_tag="AHA_0354"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704334.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DHA2 family efflux MFS transporter permease
                     subunit"
                     /protein_id="WP_011704334.1"
                     /db_xref="GeneID:4489482"
                     /translation="MEPIPRRNWIAVMGGLIGAFMAILDIQITNASLKDIQGALSATL
                     SESSWISTSYLVAEMIAIPLSGWLSRGLSVRRYLLWTTGAFIVASVLCSFSWNLTSMI
                     VFRALQGFTGGALIPMAFSLIVSLLPLHKRATGMALFGLCATFAPAIGPTLGGWLTEQ
                     MSWHYIFYMNVPPGLLVMAMLAHGLDKKPVDWEVIKRVDLIGIVTMAVGLGLLEVVLE
                     EGNREDWFGSSFIVRLTVISVVALVFFVISQLLRRHPLVNLRLLHNPRFALACFAYLV
                     LGMALMGSIYVLPLYMTQIHNYNALEIGEVLMWMGLPQLLVLPLVPRLTHKIDPRYLV
                     SFGFLVFAVSCFMNMNMSADYAGPQLIQSLIVRALGQPFIMVPLSLVATASLTHDEIP
                     SSSTLLNVLRNLGGAFGIAIIATLIDNDTRIHVSQISSTLAASSIEGQSYLLQLAQTM
                     MAQGSGPELARQQAQAMLSNTISREAAIMAYNQVFFVMGIFLLLASGLMLLLKQPAPR
                     AADAEPLEA"
     gene            complement(372631..373683)
                     /locus_tag="AHA_RS01765"
                     /old_locus_tag="AHA_0355"
                     /db_xref="GeneID:4489483"
     CDS             complement(372631..373683)
                     /locus_tag="AHA_RS01765"
                     /old_locus_tag="AHA_0355"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010635404.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HlyD family secretion protein"
                     /protein_id="WP_011704335.1"
                     /db_xref="GeneID:4489483"
                     /translation="MSQHKKIPLLAAMILALLGLLFAGYWYLHGRYFESTDNAYLQSE
                     VTGIGSKLSGYISEVLVTDNQPVKAGQLIARLDDREYKTKVAEAEADLRLNQATAENL
                     AATRTQQLSLIRQAEAKVSSANAEQVRAQQQVRRVSQLNQRHYSSQDSLDEVRAGLQV
                     NQAQEQEAKAALQAARERLLVLDAEAKQNQAKLALSAAQLEQAKLELAYTELRAPADG
                     IIGKRSLRAGLYVQSGMQVASLVPLQQVWVEANFKETQLLHMQPGQKVEVILDAYPDQ
                     PVEGIIDSLAPATGAKFALLPPENATGNFTKIVQRVPVKIRIPEPGPLAGKLLPGLST
                     EVIVDTRSPDPVVAAH"
     gene            373780..374682
                     /locus_tag="AHA_RS01770"
                     /old_locus_tag="AHA_0356"
                     /db_xref="GeneID:4490802"
     CDS             373780..374682
                     /locus_tag="AHA_RS01770"
                     /old_locus_tag="AHA_0356"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017785722.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_011704336.1"
                     /db_xref="GeneID:4490802"
                     /translation="MDLNAALILVRIVDKGSFTAAAQELGMTKATVSRRIAELEQRLG
                     VRLLYRSTRQLTLTEAGEQYYLRCSKAVDELAQAELMVSASQQEVTGTLKLAVPIEAG
                     QLVVGRLVAEFLQAYPGLQVELELTNRIVDPINEGLDAIVRIGDMSDSNLAARRLWSN
                     ARLICASPAYLARSPAITHPEDLVHHERVAVTSGFLASHWCFERDDKEVLVDPPSRFR
                     VNNITCAREAAKAGLGLASLPAMLCHEELASGTLVSVLPEWQQPRVPIYLLFPERRLM
                     PRKLRVFIDFIVAKGADYGIDTLL"
     gene            374739..375053
                     /locus_tag="AHA_RS01775"
                     /old_locus_tag="AHA_0357"
                     /db_xref="GeneID:4490803"
     CDS             374739..375053
                     /locus_tag="AHA_RS01775"
                     /old_locus_tag="AHA_0357"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308027.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2007 domain-containing protein"
                     /protein_id="WP_011704337.1"
                     /db_xref="GeneID:4490803"
                     /translation="MDHWINLYRASHSLEAHALKGALEVEGVPVRLNGEALSGALGEL
                     PVDLLQVTLMVREQDRSKAGRVIERYQQRQGNGWLCGQCGEENGANFDVCWRCHHDPH
                     EN"
     gene            complement(375068..376351)
                     /locus_tag="AHA_RS01780"
                     /old_locus_tag="AHA_0358"
                     /db_xref="GeneID:4490804"
     CDS             complement(375068..376351)
                     /locus_tag="AHA_RS01780"
                     /old_locus_tag="AHA_0358"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005348522.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dicarboxylate/amino acid:cation symporter"
                     /protein_id="WP_026080178.1"
                     /db_xref="GeneID:4490804"
                     /translation="MLFHGLAFKPWRIWTRRPLWLKTLLGMLTGIGLGAGFSEQALLL
                     KPIGVLFVNTIQMLMVPLIFCSVIAGLTSLLKGKTLDRIAGKAIGLYLCSTAVAICIG
                     LMMGWLLEPGMGANMGPYERVGMAESPTLASVLSHLVPRNPVQAMVDGKILQVIVFAV
                     ALALALNATGRRGRPAILFFTSLAEGMFKLTQMVMALAPYGVCALMAWMTGKYGMSLL
                     LPLLKVIGAVYLGCLLHVLGVYSSLLILLARLNPLHYFKSIVDAQAVAFTSSSSNSTL
                     PISLACAERRLGVSPAITAKVLPIGATINMDGTALYQGVTALFVAQAFGVDLHMVDYL
                     TIISIATLASIGTAGTPGTGLMLLTLTLTAVGLPLEGVALIAGIDRILDMARTTVNVS
                     GDILVSVLIARSERELDLATYHDASAGEDIDFTLR"
     gene            376560..376805
                     /locus_tag="AHA_RS01785"
                     /db_xref="GeneID:44141861"
     CDS             376560..376805
                     /locus_tag="AHA_RS01785"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349130.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YecH family protein"
                     /protein_id="WP_019839960.1"
                     /db_xref="GeneID:44141861"
                     /translation="MTQSVHGHEVMEMMLAHGGQFTRASLKQAIDERFGAEARFHTCS
                     ASEMDAEALIDFLAKRGKFIESEQGFQTHADKICNHG"
     gene            376908..377507
                     /locus_tag="AHA_RS01790"
                     /old_locus_tag="AHA_0360"
                     /db_xref="GeneID:4490806"
     CDS             376908..377507
                     /locus_tag="AHA_RS01790"
                     /old_locus_tag="AHA_0360"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010635400.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YhgN family NAAT transporter"
                     /protein_id="WP_010635400.1"
                     /db_xref="GeneID:4490806"
                     /translation="MDTFSAAVMLFLIMDPLGNLPVFLSILRHIDPKRRRKVMMRELL
                     FSLVIMMAFLFVGQQILNFLNLRQEAVSIAGGIILFLIAIKMIFPSEGGVTGLAAGEE
                     PFLVPMAIPMIAGPSILASLLLLANQEPTRMADWSLALLMAWGASAVILMFYEVFNKL
                     LGERGLTAVERLMGMLLVMISVQMLLDGVHHYLAVTGQN"
     gene            complement(377612..378580)
                     /locus_tag="AHA_RS01795"
                     /old_locus_tag="AHA_0361"
                     /db_xref="GeneID:4490807"
     CDS             complement(377612..378580)
                     /locus_tag="AHA_RS01795"
                     /old_locus_tag="AHA_0361"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005316464.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_011704340.1"
                     /db_xref="GeneID:4490807"
                     /translation="MLLEQLGRIDLNLLIILQVLLEERNGSRAARRLHLSQSAVSKAL
                     GRLRETFDDPLFVRSAYGLEPTARALSLQQQLQPILLSLDNLIQPPDFDPTTTEREFV
                     IASMDSAFTLFAPLYLSELKRQAPGIRLRYEEWTENSLTEMSQGQVDIAFTVRENCIN
                     SDFRLDTLPNAICQRLLAIDDLTCLVQHDHPALHEPEWDLTRYLAYPHVQTYCEGRDR
                     WMLDHKLAEQDLYRRIEATVPSFEAALRMGMHSDMIVTLSRLYARHATQVYPLVPLPL
                     PIALDSISHLLIWHQRHEEDPGHRWLRETLLTLIMGKLEPTAAEPS"
     gene            378854..379015
                     /gene="tatA"
                     /locus_tag="AHA_RS01800"
                     /old_locus_tag="AHA_0362"
                     /db_xref="GeneID:4490808"
     CDS             378854..379015
                     /gene="tatA"
                     /locus_tag="AHA_RS01800"
                     /old_locus_tag="AHA_0362"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005339944.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="twin-arginine translocase TatA/TatE family
                     subunit"
                     /protein_id="WP_005308036.1"
                     /db_xref="GeneID:4490808"
                     /translation="MGLGGIHIWHLLILLVVVVVVFGSKRLAGAGEDLGTAIRDFRKA
                     LRDDESQPK"
     gene            379030..379332
                     /locus_tag="AHA_RS01805"
                     /old_locus_tag="AHA_0363"
                     /db_xref="GeneID:4490809"
     CDS             379030..379332
                     /locus_tag="AHA_RS01805"
                     /old_locus_tag="AHA_0363"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010635398.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YfcZ/YiiS family protein"
                     /protein_id="WP_011704341.1"
                     /db_xref="GeneID:4490809"
                     /translation="MSVEEKVELNETCDSCGCFAEIGTIIGEGDDVMELVIEAAAEAD
                     ARAKLAAYEALAKQVTAEATSSSELSQGANGVILKARLQFTCTAEKLIFEMRARSI"
     gene            379558..380982
                     /locus_tag="AHA_RS01810"
                     /old_locus_tag="AHA_0364"
                     /db_xref="GeneID:4490810"
     CDS             379558..380982
                     /locus_tag="AHA_RS01810"
                     /old_locus_tag="AHA_0364"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017412343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lytic transglycosylase F"
                     /protein_id="WP_045528755.1"
                     /db_xref="GeneID:4490810"
                     /translation="MRRRWLWGLLALCALPLLAADLKPQRLPQPGDLASILQKKELRA
                     LVVYERGFFFFDKGAQHGILVNQLQGFERWLNQTYLAKEKIKLKIIYIPVRQDKLLDY
                     LTEGRGDLVAANMTVTPTRREQVTFSNPVIAPIEEWVVSQHSLPTFNRITQLSGRRVW
                     VRASSSYYESLRQLNWLFRELGLPPIYIETVPEYLQDGDLLEMVAAGIIPLTVTDSFK
                     GRIWLGMISGLRAHKLIPLRDNGRSAWALRNNSPELLKAVNDYLADAGKRTLYSDMAL
                     RRLLARNDQMSNILAPDPLGRLSTIRKVLEQQADKYRLDWLMLAALAYKESGLNANIR
                     SERGAVGIMQLLPSTGGEVGIRGARLASLEGNVEAACRYMRLILDTYFNDPKLDVLNR
                     HLFALAAYNAGPNRVQALRAKAEAAGLDPNVWFGNVEQLVANEVGQGPINYVSTIYKY
                     YVAYRFSLPQLEGKAAAIEAVAQP"
     gene            complement(380990..381136)
                     /locus_tag="AHA_RS21665"
                     /db_xref="GeneID:44157219"
     CDS             complement(380990..381136)
                     /locus_tag="AHA_RS21665"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005316451.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_165444123.1"
                     /db_xref="GeneID:44157219"
                     /translation="MELTDRPAISHRPQASEPDPSPSGQLTPWYLQHKDQAWQPFAPP
                     TQPH"
     gene            381214..382467
                     /locus_tag="AHA_RS01815"
                     /old_locus_tag="AHA_0365"
                     /db_xref="GeneID:4490811"
     CDS             381214..382467
                     /locus_tag="AHA_RS01815"
                     /old_locus_tag="AHA_0365"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipase D family protein"
                     /protein_id="WP_011704343.1"
                     /db_xref="GeneID:4490811"
                     /translation="MIPAEFALIDQPELALKLRCQLIRGARSRIQAQYYSWEEDSSGK
                     LLLAELLHAARRGVRVQLLIDDLYAGDNRFLEMVAHQPGIEVRLFNPFWLRGWRPLTL
                     LLEGLLSFRRINHRMHNKLLLVDGSQAVIGGRNIGDRYFGLGGAPQFVDLDLACRGPL
                     CQQAEQGFDQFWRSRWSHPIRRLLRRPLQRAEVQVVNDFLLTMNEPQVAAVYDLPASL
                     FDPEPVPLRWHAGQAEVWFDRPGKGLVSRPTTARLLWRKLADNQGTLSLVTPYLILTR
                     GLRRRLRQQRQAGVNIDILTNSLASTDVPLVYGAYRRHRPWLIRQGIALSELEGESLS
                     LHAKLILVGEEEALLGSFNLDPRSLLLNTELVLHLACPALCAELQQWLATWQQRSSHS
                     VAAPPSTLRRLLARVSDWLPLQRWL"
     gene            complement(382947..384065)
                     /locus_tag="AHA_RS01820"
                     /old_locus_tag="AHA_0366"
                     /db_xref="GeneID:4490812"
     CDS             complement(382947..384065)
                     /locus_tag="AHA_RS01820"
                     /old_locus_tag="AHA_0366"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017412341.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA desaturase"
                     /protein_id="WP_011704344.1"
                     /db_xref="GeneID:4490812"
                     /translation="MERPPIIMTNTLLFALSGLTALIAVPWYGMTHGYDLWQWGSFLL
                     LFCYCGISITAGYHRLWSHKAYKAHPILQWIFAIGGALALQNSALHWSSDHRRHHRHV
                     DDNQQDPYSAGRGFWYSHIGWMLREYQGETYHDYSNVRDLQNNPIVVFQHKHYLALTL
                     ATNIGIPLLLGLVHGDLLGMLLLAGVLRMVMTHHTTFFINSLAHIWGSQPFTDRNSAR
                     DNGILAFFTFGEGYHNFHHLFENDYRNGIHWWQFDPTKWLIRSASWCGLTRDLRACPE
                     ERIEQARLEMQLKRAQAKLRKQDDRDLWQALLQEEYDKLNQQLQHYYASRKRLLEQRK
                     RKALARYDQLKLQLEYRNLHDAFIAAKRNWSRLLAGIA"
     gene            384214..384834
                     /gene="fabR"
                     /locus_tag="AHA_RS01825"
                     /old_locus_tag="AHA_0367"
                     /db_xref="GeneID:4490813"
     CDS             384214..384834
                     /gene="fabR"
                     /locus_tag="AHA_RS01825"
                     /old_locus_tag="AHA_0367"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005316443.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HTH-type transcriptional repressor FabR"
                     /protein_id="WP_005308043.1"
                     /db_xref="GeneID:4490813"
                     /translation="MGIRAQQKEKTRRTLIEAAFSQLCANRSFSNLSLREVAREAGIA
                     PTSFYRHFRDMEELGLTLVDEGGLTLRQLMRQARQRIAGGGSVISTSVQTFMEFVENN
                     PNIFRLLLRERSGTSAAFRQAVAREIQHFIAELTDYLEATTGAPREEAYIQAEAMVTI
                     VFSAGADALDMTSEECRALSDRTIRQLRMIAMGAEVQNQKRREPLS"
     gene            384855..385220
                     /locus_tag="AHA_RS01830"
                     /old_locus_tag="AHA_0368"
                     /db_xref="GeneID:4490814"
     CDS             384855..385220
                     /locus_tag="AHA_RS01830"
                     /old_locus_tag="AHA_0368"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308044.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YijD family membrane protein"
                     /protein_id="WP_113995426.1"
                     /db_xref="GeneID:4490814"
                     /translation="MHDQNPIPKKPLLLALLIGICGDASLTVLSESVVPFSFFPMIAL
                     VLAAYQLYQHYRHVSLEGNTPVCMLLCFFIGVFGHSALVKVQYPELGSNFFSLIMMLL
                     LLAVLSIKLGISVGKKEKE"
     gene            complement(385259..385570)
                     /locus_tag="AHA_RS01835"
                     /old_locus_tag="AHA_0369"
                     /db_xref="GeneID:4490815"
     CDS             complement(385259..385570)
                     /locus_tag="AHA_RS01835"
                     /old_locus_tag="AHA_0369"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308045.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1145 domain-containing protein"
                     /protein_id="WP_011704346.1"
                     /db_xref="GeneID:4490815"
                     /translation="MKRVFNLLAMGLILFFWFGVLVSLIAPLPGKLNGFLPVCGVIVA
                     LMHWVQASMVKAACKPYFAVSRLEFTQVLVFGVFGMVEIRTRLQAIVDAKQRGTDNKA
                     G"
     gene            complement(385681..386310)
                     /gene="rsmD"
                     /locus_tag="AHA_RS01840"
                     /old_locus_tag="AHA_0370"
                     /db_xref="GeneID:4490816"
     CDS             complement(385681..386310)
                     /gene="rsmD"
                     /locus_tag="AHA_RS01840"
                     /old_locus_tag="AHA_0370"
                     /EC_number="2.1.1.171"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005316434.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA (guanine(966)-N(2))-methyltransferase
                     RsmD"
                     /protein_id="WP_011704347.1"
                     /db_xref="GeneID:4490816"
                     /translation="MPRVKSSRNGPSKSPAPQGKSGFVRIISGQWRGRKLPVRDVEGL
                     RPTTDRVKETIFNWLAPHVRGTRCLDLFAGSGGLGLEALSRYAEQVTLIEMDKGAADQ
                     IKKNLTTLGSSQGQVIQSDAVSWLQGPATPFDLVFLDPPFRRELLPQVCELLEQRGWL
                     APDALIYLEREKEMADLPLPASWQLLKDKQAGQVCYQLYLRDTKHDAAV"
     gene            386421..388322
                     /gene="ftsY"
                     /locus_tag="AHA_RS01845"
                     /old_locus_tag="AHA_0371"
                     /db_xref="GeneID:4490817"
     CDS             386421..388322
                     /gene="ftsY"
                     /locus_tag="AHA_RS01845"
                     /old_locus_tag="AHA_0371"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017408793.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal recognition particle-docking protein
                     FtsY"
                     /protein_id="WP_011704348.1"
                     /db_xref="GeneID:4490817"
                     /translation="MAKGLFSWLGFGRKKEEAEAVQPQTPQATPITAEPEVAAAPAPV
                     SDPTPAVAAEVPASAQNSVLHDDCCPPAELDDHGPLVVEECASDLEPVIVNEALLAEE
                     ERAAAQAQAQEAARVAAELKAAQEVRIAAEARAAEEARIAAEARTAEEARLAAEARAA
                     EEARIAAEARAAEEARLAAEARAAEEARVAAEARAVKEARIAAEASAAEETRIAAEAR
                     AAEEARIAAEARAAEEARLAAEARAAEEARIAAEARAAEEARLAAEARAAEEARLAAE
                     AQAAEEARLAKEAQRVEDLRLVAEMEAEAAALAALPLAAKVDDDTQEKPQREGFFARL
                     KRSLVRTRENIGSGFFGLFRGKKIDDELFEELETQLLTADLGVDTTSRIIEGLVQHAD
                     RKQLKDAEALYGLLKQDMGEMLAKVEQPLVIDTSKKPYVILMVGVNGVGKTTTIGKLA
                     KQFQAEGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIYDAIEAAR
                     SRGADVLIADTAGRLQNKSNLMEELKKVVRVMKKLDDAAPHEIMLTLDAGTGQNALSQ
                     AKLFSEAVGLTGITLTKLDGTAKGGVIFAVADKFQIPIRYIGVGEGIDDLRPFVANDF
                     IEALFSREE"
     gene            388413..389081
                     /gene="ftsE"
                     /locus_tag="AHA_RS01850"
                     /old_locus_tag="AHA_0372"
                     /db_xref="GeneID:4490818"
     CDS             388413..389081
                     /gene="ftsE"
                     /locus_tag="AHA_RS01850"
                     /old_locus_tag="AHA_0372"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017412338.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division ATP-binding protein FtsE"
                     /protein_id="WP_011704349.1"
                     /db_xref="GeneID:4490818"
                     /translation="MIRFDKVSKVYSGGHQALQKVSFHLRKGEMAFLTGHSGAGKSTL
                     LKLISVMERPTDGRVFFHGDDVSHIKRGEIPYVRRQIGMIFQDHRLLMDRTVFDNVAL
                     PLVIDGYSHADINKRVAAALDKVGLLGKERYQPRMLSGGEQQRVGIARAIVNKPPLLL
                     ADEPTGNLDPQLSMDIMRLFEEFNRFGVSVLIATHDLGLIARMRYRTLTLKAGRMYSA
                     GEEL"
     gene            389081..390034
                     /gene="ftsX"
                     /locus_tag="AHA_RS01855"
                     /old_locus_tag="AHA_0373"
                     /db_xref="GeneID:4490819"
     CDS             389081..390034
                     /gene="ftsX"
                     /locus_tag="AHA_RS01855"
                     /old_locus_tag="AHA_0373"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005348569.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsX"
                     /protein_id="WP_011704350.1"
                     /db_xref="GeneID:4490819"
                     /translation="MAIVRHKQPPLRRFMMYWVDHARQAFSSLGELWRNPLASLMTLA
                     VLGVSLALPSCFHVLLKNAEVVEGSWQTSSQISLYLRKDLPEQNILDMKQRILLYPEV
                     ESVTYMSRDEALKEFREISGFGDALDYLDSNPLPPVLSVIPDPRWQNPEGAAELLNKL
                     NNEDGVEQGKLDLQWLTRLQGIMNLLRHTITGIAVLLLSAVLLIVGNTLRLNILNQRS
                     EIEVLKLVGATDAFIHRPFLYTGIWFGVIGGMLAWWLTEVMVIWSEGVVKELAGLYNS
                     NFRLVGMGAVDGINLILLGALLGLIASWFSVHRHIRDIEPS"
     gene            390490..391344
                     /gene="rpoH"
                     /locus_tag="AHA_RS01860"
                     /old_locus_tag="AHA_0374"
                     /db_xref="GeneID:4490820"
     CDS             390490..391344
                     /gene="rpoH"
                     /locus_tag="AHA_RS01860"
                     /old_locus_tag="AHA_0374"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019934563.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor RpoH"
                     /protein_id="WP_011704351.1"
                     /db_xref="GeneID:4490820"
                     /translation="MGTSLQRTMALIPQGSLEGYIQAVNSIPVLSAEEERELAERLQQ
                     GGDLEAARQLVMSHLRFVVHVAKSYAGYGLPQADLVQEGNIGLMKAVKRFDPSVGVRL
                     VSFAVHWIKAEIHEYVLRNWRMVKVATTKAQRKLFFNLRKSKKRLGWLNHEEVQAVAA
                     DLGVSAADVTEMEARMSNYDQAFDLVGDDEEEGGFAPVHYLEDKSSDLAATIENDNWD
                     DHATRRLSSALATLDERSQHIIRARWLDDESKTTLQELADTYGVSAERVRQLEKNALK
                     KLKDAMEA"
     gene            391471..392130
                     /gene="can"
                     /locus_tag="AHA_RS01865"
                     /old_locus_tag="AHA_0375"
                     /db_xref="GeneID:4486959"
     CDS             391471..392130
                     /gene="can"
                     /locus_tag="AHA_RS01865"
                     /old_locus_tag="AHA_0375"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010672606.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbonate dehydratase"
                     /protein_id="WP_005308055.1"
                     /db_xref="GeneID:4486959"
                     /translation="MKLLNDLFTNNREWAERIKAEDPEFFATLSAQQAPEYLWIGCSD
                     SRVPANQLMGLLPGDVFVHRNVANLVVHTDFNCLSVLQYAVEVLKVKHIIVCGHYGCG
                     GVKAAMQNQELGLIDNWLRNIKDVYFKYREQLDAIEDEHERFDYLCELNVAEQVANVC
                     HTTIIQNAWRKGQELAVHGWIYGIKDGLLHDLDLCISGPEQIPDVYRAWPDMRPPHRR
                     R"
     gene            392142..392846
                     /gene="hutC"
                     /locus_tag="AHA_RS01870"
                     /old_locus_tag="AHA_0376"
                     /db_xref="GeneID:4486960"
     CDS             392142..392846
                     /gene="hutC"
                     /locus_tag="AHA_RS01870"
                     /old_locus_tag="AHA_0376"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308057.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine utilization repressor"
                     /protein_id="WP_011704352.1"
                     /db_xref="GeneID:4486960"
                     /translation="MAPALYLQIKQHILDGIRERHYQAGDRIPTEAALCEQFAVSRMT
                     VNKALRELVAEGWLVRTAGSGSFVADRRTESPLLAIRNIADEIAERGSEYSGRVIRLQ
                     RQAADEKVAVQLGLRVGAPIFHSLIVHQADGEPLQLEERFVDAERLPQYGEQDFASQT
                     PNRYLMEVCPLSEMEHVVEAVLPSAGEAGLLQVRVDTPCLLLHRRTWSDGYLVSYARL
                     LSPGSRYKLSSKTSLS"
     gene            393002..394237
                     /locus_tag="AHA_RS01875"
                     /old_locus_tag="AHA_0377"
                     /db_xref="GeneID:4486961"
     CDS             393002..394237
                     /locus_tag="AHA_RS01875"
                     /old_locus_tag="AHA_0377"
                     /EC_number="3.5.2.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349144.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="imidazolonepropionase"
                     /protein_id="WP_164927515.1"
                     /db_xref="GeneID:4486961"
                     /translation="MNKELLNCERVWLNVTPATLRSDLADYGLLEPHALGVHEGRIHA
                     LVPMQDLKGPYPAHWQDMKGKLVTPGLIDCHTHLIFAGSRAEEFELRQKGVPYAEIAR
                     KGGGIISTVRATRAACEEQLFELALPRVKSLIREGVTTVEIKSGYGLTLEDELKMLRV
                     ARRLGEALPIRVKTTLLAAHAVPPEYRDDPDSWVETICQEIIPAAAEAGLADAVDVFC
                     EHIGFSLAQTEQVYLAADQYGLAVKGHMDQLSNLGGSTLAANFGALSVDHLEYLDPEG
                     IQALAHRGVVATLLPTAFYFLKETKLPPVAALRKAGVPMAVSSDINPGTAPIVSLRMA
                     MNMACTLFGLTPVEAMAGVTRHAARALGEQEQLGQLRVGMLADFLVWNCGHPAELSYL
                     IGVDQLVSRVINGEETLHG"
     gene            394230..395174
                     /locus_tag="AHA_RS01880"
                     /old_locus_tag="AHA_0378"
                     /db_xref="GeneID:4486962"
     CDS             394230..395174
                     /locus_tag="AHA_RS01880"
                     /old_locus_tag="AHA_0378"
                     /EC_number="3.5.3.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005342870.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formimidoylglutamase"
                     /protein_id="WP_011704354.1"
                     /db_xref="GeneID:4486962"
                     /translation="MDKFNPVDMSVWQGRQDPEDGELALRWHDKVQPWPQAGRAAPGV
                     ALVGFACDEGVRRNKGRVGAAGAPLAVRKLLANSAWHLGRPVYDRGDVNCEDGDLDAA
                     HGRLAERVARLLDEGHFPLVLGGGHEVAFGSWSGLNRHLAGRGRVGIINFDAHFDLRM
                     KLEQASSGTPFFQIAEQCAIQGTPFTYACLGVAETANTQALFARAEALGVWHVLDEAM
                     TPAELPALLSGLDAFIARCDHLYLTIDLDVLPAAVMPGVSAPAARGVELAVIEPLIAH
                     IRASGKLRLADLAEYNPSLDQDNRSARVAARLVHQLIK"
     gene            395229..396938
                     /locus_tag="AHA_RS01885"
                     /old_locus_tag="AHA_0379"
                     /db_xref="GeneID:4486963"
     CDS             395229..396938
                     /locus_tag="AHA_RS01885"
                     /old_locus_tag="AHA_0379"
                     /EC_number="4.2.1.49"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005357685.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="urocanate hydratase"
                     /protein_id="WP_011704355.1"
                     /db_xref="GeneID:4486963"
                     /translation="MSQQHQDPRHDPNRVIRAPRGTTLTAKSWLTEAPLRMLMNNLDP
                     EVAEHPQSLVVYGGIGRAARNWACFDKIVEVLTRLEEDQTLLVQSGKPVGVFQTHKDA
                     PRVLIANSNLVPHWANWEHFNELDKKGLMMYGQMTAGSWIYIGTQGIVQGTYETFFAV
                     ANQHFNGEPKGRWILTGGLGGMGGAQPLAATMAGFSMIAVECDETRIDFRLRTRYVDK
                     KAHSLDEALAMIEEAKQSGSAVSVGLLGNAADVFAELVARGITPDVVTDQTSAHDPVH
                     GYLPQGWSVAQWRALQKSAPQEVNVAARHSMARQVEAMLTLQSRGAATLDYGNNIRQM
                     ALEEGVKNAFDFPGFVPAYIRPLFCEGIGPFRWVALSGDPEDIYKTDQKVKELIPDDP
                     HLHNWLDMARDRIAFQGLPARICWVGVKDRVRLGLAFNEMVKNGELKAPIVIGRDHLD
                     SGSVASPNRETESMMDGSDAVSDWPLLNALLNTAGGATWVSLHHGGGVGMGFSQHSGV
                     VIVCDGSDDAAKRVGRVLRNDPATGVMRHADAGYEIAINCAHEAKLDLPMIDGANGVK
                     GKV"
     gene            396943..398475
                     /gene="hutH"
                     /locus_tag="AHA_RS01890"
                     /old_locus_tag="AHA_0380"
                     /db_xref="GeneID:4486964"
     CDS             396943..398475
                     /gene="hutH"
                     /locus_tag="AHA_RS01890"
                     /old_locus_tag="AHA_0380"
                     /EC_number="4.3.1.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017413010.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine ammonia-lyase"
                     /protein_id="WP_011704356.1"
                     /db_xref="GeneID:4486964"
                     /translation="MFELTITPGELDLATLRRVSREPVHVSLDPAALAGIHASAAVVT
                     KVIEQNRVVYGINTGFGLLANTRIPVEQLDELQRSIVLSHAAGIGEYMDDATVRLMMV
                     LKLNSLARGFSGIRLVVLEALMRLINAEVYPVVPKKGSVGASGDLAPLAHMSCLLIGE
                     GKARHAGELIDAATALKIAGLEPIALAPKEGLALLNGTQASTAFALEGLFHAEDLYAG
                     AITIGAMSVEAALGSRRPFDARIHAVRGQRGQIDAAACYRHLLVDGSEIGMSHHNCEK
                     VQDPYSLRCQPQVMGACLTQIRQAAEVLVCEANAVSDNPLVFAEDEDILSGGNFHAEP
                     VAFAADNLALAIAEIGSLSERRMALLIDSRMSGLPAFLVNNGGVNSGFMIAQVTSAAL
                     ASENKTLAHPASVDSLPTSANQEDHVSMATFAGRRLADMAENTRGILAVELLAAAQGL
                     DFRAPLRSTELIELAKGRLREEVSFYDKDRYFAPDIEAAAALLGRASYNDLLPAGVLP
                     SL"
     gene            complement(398545..399642)
                     /locus_tag="AHA_RS01895"
                     /old_locus_tag="AHA_0381"
                     /db_xref="GeneID:4486965"
     CDS             complement(398545..399642)
                     /locus_tag="AHA_RS01895"
                     /old_locus_tag="AHA_0381"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308064.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="calcium:proton antiporter"
                     /protein_id="WP_011704357.1"
                     /db_xref="GeneID:4486965"
                     /translation="MKSFIRQEIALPVGLLTLLFFKTLGSDLLTEATPLGIYLPVSAM
                     LLAIVTWAIFSVVRHSDALAIKLGEPFGTLILTLSVISLEVVMISSVMLTGEPNPVMA
                     RDTMFAVVMLVTNGLVGFTLLFGGWRYHTQSFNLDGVKSYLVAIIPLALLCLVLPNFT
                     EGGNIGSMSSAMSWMLIIISVLLYGVFLLIQTRSHSHFFIDSDHEDYEEHHGPLQSNV
                     YHTLLLLAYLVVVILLAKTLAIPINHGVKVLAAPPALGGFIVACIVLAPEAVGAIKAA
                     FNNQLQRAMNLYFGSVLATIALTVPAVLFIGAMLGQEVRLGLSAADMVLLFTTLMVCK
                     VTFSSGRTNVLHGATHLVLFVVYLFLMFEHE"
     gene            complement(399804..401333)
                     /locus_tag="AHA_RS01900"
                     /old_locus_tag="AHA_0382"
                     /db_xref="GeneID:4486966"
     CDS             complement(399804..401333)
                     /locus_tag="AHA_RS01900"
                     /old_locus_tag="AHA_0382"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010635386.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EAL domain-containing protein"
                     /protein_id="WP_164927516.1"
                     /db_xref="GeneID:4486966"
                     /translation="MRPISPLWLTLLLFCLPLLASLPLSQLLSKQLAHQLLQEKKEEI
                     EAALVERHRDLDESIRAQLAQFTFDCGQKDMALLRDPRFYSRHIRIQGLKLASGTGCS
                     SLGVDLPFTAADLPPYPSQELFGLAATQARFNTEQELVAYFHVGNNTAYWVLNNSWSH
                     ALLQYPCTDCFYLEFHQQTPDEAMPVFPRGNKSIKEEGGSQSLSFFDPNNHIKQTLWA
                     GKALEHYAQQQARHYGFWGGAAVGALLVAAYWGLRNYRRSLKGLLQAGLARREFVPFY
                     QPVVDSRSLQVVGFEALLRWQRGGDLIPPGAFIDYAEEQQLILPMTSQLLEKVIADLP
                     RLAPGQWVSVNIVAAHLEHPHLRNLLLQHGWPSPAQLTFELTERKPITDIKTAVIEIT
                     ALQQQGYHFKLDDFGTGYGGFAYLQRLGIRQIKIDKMFVDTIGTDDLKRSVLDATIAF
                     GRESGMEMIAEGVERQDQVDYLQQHGVHLIQGYVYAQPMALTKLKIWLLAWYQNHTGE
                     R"
     gene            401880..403808
                     /gene="csrD"
                     /locus_tag="AHA_RS01905"
                     /old_locus_tag="AHA_0383"
                     /db_xref="GeneID:4486967"
     CDS             401880..403808
                     /gene="csrD"
                     /locus_tag="AHA_RS01905"
                     /old_locus_tag="AHA_0383"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010635385.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNase E specificity factor CsrD"
                     /protein_id="WP_039212856.1"
                     /db_xref="GeneID:4486967"
                     /translation="MKLTTQLVSFITLCVIAAMAMVLLGGVFSFRELGMEMQQKKVNS
                     LVEIIDKQLEVADDHQDLTRWLPTLLRSAHVVELEIRQDKQRIYWFRDVQQPTDESLL
                     IPYHQPMPHQPGMQADFKLERPFKEFEYSIKAMSGISLGVFIVVFGLWYSIRWLRLQL
                     RGAELLAERAQLILDNKLTKLAHDPADEWPQPASQALDYLLAELADARKERSRFDNFI
                     RSNAFVDKMTGIGNRLFFDNRLESAIMEASVMSGGVLLIELAGLEELDPELNGRQSQD
                     LLMEASASIAAFVRKHNGALQARYAGQVFAVLLPNMSESEMVDGAGQLHKSLQRLHWP
                     EAVNPDTAVYLGAVCYQAEDSLLKVQEEAELALKSARLQGHTGWFLYEKQLDEEQSSK
                     GTVRWRTLIGRRIEEHGIDFYVQPVQQERDQVVLQQDLLIRIHDEQGRELQAGVFMPM
                     AEKAGLLLPLDRLVAEQTLGLLRQRSEQSCPISLTLCAQSLLHREFQRWLFFDLFQLP
                     RSTNERLILQLSEAQVTRHYEALKRPLRALRMLGCQLAIDHAGQDVVSTQYIKEFEIN
                     FLKLHPSLVREIHTRQVNQMAVRSLVGGCANTRTRVIAVGVESGDEWKMLRHLGVHAG
                     QGPWFAEPERLVLEPAGA"
     gene            complement(403909..404820)
                     /locus_tag="AHA_RS01910"
                     /old_locus_tag="AHA_0384"
                     /db_xref="GeneID:4486968"
     CDS             complement(403909..404820)
                     /locus_tag="AHA_RS01910"
                     /old_locus_tag="AHA_0384"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017764691.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-aminocyclopropane-1-carboxylate
                     deaminase/D-cysteine desulfhydrase"
                     /protein_id="WP_164927781.1"
                     /db_xref="GeneID:4486968"
                     /translation="MALPPLPPALVPSPLQAVSHPLLIAYGVQLWCKRDDLIHPAISG
                     NKWRKLKYHLLHAREQGKRHLLSFGGAYSNHIHALAAAGCQSGLRTTGIIRGEPQAVS
                     NCTLSAAKGWGMDLVFVDRQSYRRRQDPAWLAQFENEETLIVPEGGSSPLAIPGVAEL
                     VDEVPFSPDLWVLPCASGGTLAGLIAGKRAPQQILAIAVLKGGSFIADEVRRLHPAAA
                     DTPGWRIALDHHDGGYAKFSPALWQWVQAFSAETGLPLEPIYSGKAMWGLFRELAAGR
                     IPRGSKIVFIHTGGMQGLAGLREQGRL"
     gene            404926..405789
                     /locus_tag="AHA_RS01915"
                     /old_locus_tag="AHA_0385"
                     /db_xref="GeneID:4486969"
     CDS             404926..405789
                     /locus_tag="AHA_RS01915"
                     /old_locus_tag="AHA_0385"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017408803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MSHA biogenesis protein MshI"
                     /protein_id="WP_011704361.1"
                     /db_xref="GeneID:4486969"
                     /translation="MKQLFRRSTPSRQVGLLLASDRIMLASLGNPPIFATRAINGPQE
                     WPQAMAELFSRHGLAKSKVRVALAASLYQQVQIDKPAVPDAEMAGALPWAIKDYVSES
                     VLQLAMDYVDLPTPPAGRPRINVICVPKARVQQLADAVNGIASLDAIVSDELAMTALY
                     EPDQTVRMLLWQPKGQDLQLLVFHQGGLCFSRQLRGFGALTGEHEPDAMLLDSLALEI
                     QRSLDYLVGQLKLPELGQMQLAIASPFIGTLVRHMEQTFGFAVSAMANKAILSGVEYL
                     SAYAAALGGEQ"
     gene            405890..406483
                     /locus_tag="AHA_RS01920"
                     /old_locus_tag="AHA_0387"
                     /db_xref="GeneID:4486971"
     CDS             405890..406483
                     /locus_tag="AHA_RS01920"
                     /old_locus_tag="AHA_0387"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019839975.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011704363.1"
                     /db_xref="GeneID:4486971"
                     /translation="MKRQINLYGAEFRPRRQWASLNQMALVWGGSVLLLLCAAGVIAW
                     QQHAVERELVQVRAALEIKRGEAQRLDAELARHQADGLLQQQLATKQEELTAKQGLMR
                     QLGSLALQKSQGYAGLMADLSRIRDPQLSLQRIEIADGYVNLSGFAGRSQDVPAWVNR
                     FKQTPSLVGKQFGELTLSRDKEGRLAFQLSGIEREKP"
     gene            406483..407130
                     /locus_tag="AHA_RS01925"
                     /old_locus_tag="AHA_0388"
                     /db_xref="GeneID:4486972"
     CDS             406483..407130
                     /locus_tag="AHA_RS01925"
                     /old_locus_tag="AHA_0388"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005316380.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MSHA biogenesis protein MshJ"
                     /protein_id="WP_011704364.1"
                     /db_xref="GeneID:4486972"
                     /translation="MSLKEQWQAWADKIAALSQRERVLILLTGVVVVGAVAIYGWLDG
                     AAVRLEQERLALSTAQRDLEIMDLENQGKQAKLARDPDLHVRTQLAQLDGELGKLDAE
                     LKAQTVDLIQAHEMPAVLEALLSRSANLHMVALTSLTPEPLMAGEQRINLFKHGIRLK
                     LEGGYFDVYQYLKALEGLPRHFYWKQFDYQVQEYPKAVVEMEIYTLSTSKEFIRG"
     gene            407123..407449
                     /locus_tag="AHA_RS01930"
                     /db_xref="GeneID:44141862"
     CDS             407123..407449
                     /locus_tag="AHA_RS01930"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308073.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MSHA biogenesis protein MshK"
                     /protein_id="WP_016349155.1"
                     /db_xref="GeneID:44141862"
                     /translation="MARWFPLWACLFSLLAQAQPELLQDPTAPLSGATSGASATGQRE
                     AGLPRLQSIMLGNGPALAVLNGSSYRVGQQVDGYRVVAIGADAVVLEKGGKRQSLTLF
                     ASKVRI"
     gene            407520..409193
                     /gene="mshL"
                     /locus_tag="AHA_RS01935"
                     /old_locus_tag="AHA_0389"
                     /db_xref="GeneID:4486973"
     CDS             407520..409193
                     /gene="mshL"
                     /locus_tag="AHA_RS01935"
                     /old_locus_tag="AHA_0389"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005316372.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus (MSHA type) biogenesis protein MshL"
                     /protein_id="WP_011704365.1"
                     /db_xref="GeneID:4486973"
                     /translation="MKKHHLCLISAAVLTAGCTSYRHPEPVQAKDALRHAMTEQNKGG
                     ALTSVPKSVQSELLQLNRPPQAISMPEPRLRIAAHDVDAVEFFGSLFKGSRYSVAVHP
                     GVAGQISVELKDVTLTEVLAVVGDMYGFDVQRKGNVFHVYPAGLRTETIPVNYLMMSR
                     RGLSRTSVSTGGVASNDNNSSNNNNFDNANNSTNNSTSNRSSNGSSNSDSNGTRIETD
                     TSSDYWTDLRDTLQTLIGSGDGRAVITSPQAGLVTIRAYPKELKAVREFLNQSESHLK
                     RQVVLEARILEVALNEGYEQGVDWSGLSASWDGNKGITGGGSLTPSTIANTPNQIFSA
                     LGGGAGFKISDGNFNVAVNLLKTQGDVNTLSSPRVTATNNQKAVIKVGTDEYFVTNAS
                     TTTTTSGTSAPIVTPNVELTPFFSGIALDVTPQIDEEGKVLLHIHPSVIDTEEQKKTI
                     DVGTADPLILPLAKSSIRESDTVVQANNGDIIVIGGLMKTDKQEIVSKVPLLGDIPWV
                     GEAFTNRRESTKKVELVILLKPTVVEKDTWQNELQRSSELLDKWYPPKG"
     gene            409271..410161
                     /locus_tag="AHA_RS01940"
                     /old_locus_tag="AHA_0390"
                     /db_xref="GeneID:4486974"
     CDS             409271..410161
                     /locus_tag="AHA_RS01940"
                     /old_locus_tag="AHA_0390"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308075.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AAA family ATPase"
                     /protein_id="WP_011704366.1"
                     /db_xref="GeneID:4486974"
                     /translation="MYLNHFGLQEAPFGLTPNTGFYYGLPPHEEALQVLNWALAQGEG
                     FIKVTGEVGTGKTLLCRKLLSELGSEERPVRLAWLPNPHLNPAELRIALALELGLAVR
                     DQSELDLTDRIHRHLIALHQQGSRVVVLIDEAQALPDETLEAIRLFGNLETESSKLLQ
                     IVLFGQPELDARLAKPYLRQLRQRIGFSYCLRPLRFDETRAYLEHRLQISGYRGAPLF
                     GGRALRQLWRASRGIPRLINILAQKCLMLAYGQGARQIDSRLVRLAVRDTDDARRFVP
                     RRWWPLVLLLGCALAYGVWQ"
     gene            410158..411255
                     /locus_tag="AHA_RS01945"
                     /old_locus_tag="AHA_0391"
                     /db_xref="GeneID:4486975"
     CDS             410158..411255
                     /locus_tag="AHA_RS01945"
                     /old_locus_tag="AHA_0391"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017787333.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tetratricopeptide repeat protein"
                     /protein_id="WP_043125776.1"
                     /db_xref="GeneID:4486975"
                     /translation="MSVINQMLKDLEQRQQGGEGAVYVPPVRQQGWWMLLLTLICGLA
                     LGILGWRTWIYWQQSQRVVEARQLQAAGEPTPDAIARAVPAAVPASAEQEPVDQVVAL
                     PTPRHLATSPTAEPQQAEERTADDADVAAIDEEGPSDEELQPDLYAELAAEQEAPAAA
                     PRKPGVLKIETVNLSEAELATLAERKATTAMAKGQLRDAQDNYYQVLAHDPRNQGARE
                     QLAGLLYGEGRLSEASQLLEEGLRFDPEQADFRLLLARLAISGGDQLKALGWLTGHRP
                     DLASNLDYYATWAGLSQELGQHAEAADLYVKLLRQQPDQGRWWLGLGVAEDGQGHSQR
                     ALDAYRNAQLHGNLGEASTSWLEQRIAQLAP"
     gene            411288..412997
                     /locus_tag="AHA_RS01950"
                     /old_locus_tag="AHA_0392"
                     /db_xref="GeneID:4486976"
     CDS             411288..412997
                     /locus_tag="AHA_RS01950"
                     /old_locus_tag="AHA_0392"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005348611.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II/IV secretion system protein"
                     /protein_id="WP_011704368.1"
                     /db_xref="GeneID:4486976"
                     /translation="MAQPRLKMRLGDLLVQEQIISDDQLQLALQQQRQTGRKLGTTLI
                     DLGFISEVQLLQFLARQLDVPFFDLNNLTIDASAVPLLPEVQARRYRALAVNLTDNKV
                     TVAMSDPADLSALDAIAALLRPREMGLAVAREGQLLEYFDRLYRRTREIESFAEQLHE
                     EYQDAGFELGSSNLGAGDEGEATVAKLLRSLFEDAVQVGASDIHIEPDEKVLRIRQRI
                     DGILHENILSEVRIAQALVLRLKLVAGLDISEKRLPQDGRFNMKVRGRDVDVRMSTMP
                     VQYGESVVMRLLDQSSGILSLTETGMPPEILTRFRRQLKRPHGMILVTGPTGSGKTTT
                     LYGALSELNQASQKIITVEDPVEYRLPRVNQVQVNPKIGLTFSHVLRSTLRQDPDILL
                     VGEMRDNETVEIGLRGAITGHLVLTTLHTNDAVTSALRLIDMGAPGYLVASALRAVVA
                     QRLVRRVCEHCVEEKAPDEGQATWLTVLSGEAPGQHVYHKGRGCQSCNFTGYAGRIGV
                     YELLELDQPMMDSLRRNDAEGFAKAARQHPHYRPLALTALDYARQGITSVDEVLRLAE
                     DLG"
     gene            413051..414271
                     /locus_tag="AHA_RS01955"
                     /old_locus_tag="AHA_0393"
                     /db_xref="GeneID:4486977"
     CDS             413051..414271
                     /locus_tag="AHA_RS01955"
                     /old_locus_tag="AHA_0393"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017787334.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system F family protein"
                     /protein_id="WP_011704369.1"
                     /db_xref="GeneID:4486977"
                     /translation="MSSFAYKGRDSQGNAVSGVVDAANEMAAAEQLMRRGVMPTELKP
                     GKAKAAALDWSLLLERGVRLDELVVFSRQMYALTRAGIPILRAIAGLEESAHSKPLKR
                     ALHALGEDLGNGRPLSSSMQAHPRVFSSLFVAIIHVGENTGQLEEAFLQLANYFELEL
                     ETRKRIKTAMRYPSFVLIAIGIAMVILNIMVIPVFAGMFAKFGVELPLATRILLATSH
                     FFVHYWWVMLGVLLAMVFGWRRWVSTVKGKLTWHRWQLKLPIVGTIIERSLLARFARS
                     FSMMLKAGVPLNTALSLVADAVDNAWMAGRIRDMRAGIERGESLLRTAGSSGLFTPLV
                     MQMIAVGEETGQVDDLLHEAAEYYEREVDYDLKSLTARIEPILIGIVAVMVLILALGI
                     FTPMWDMMRAVRGK"
     gene            414449..414913
                     /locus_tag="AHA_RS01960"
                     /old_locus_tag="AHA_0394"
                     /db_xref="GeneID:4486978"
     CDS             414449..414913
                     /locus_tag="AHA_RS01960"
                     /old_locus_tag="AHA_0394"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017778495.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011704370.1"
                     /db_xref="GeneID:4486978"
                     /translation="MSRQSQQDEHWLGSYRRLAVGILLLIMVATLARSYLVHREEALA
                     VSLTLLGEQFAERAQRLHGLWLDQRRPAVLHVDGMAWQFDERGWPLGAGTVMTPSENC
                     RWLWEQLIGKAASTQPPVQALASLDGEGCQFGWENNWLIYQFSDGRVQQSPE"
     gene            414987..415658
                     /locus_tag="AHA_RS01965"
                     /old_locus_tag="AHA_0395"
                     /db_xref="GeneID:4487193"
     CDS             414987..415658
                     /locus_tag="AHA_RS01965"
                     /old_locus_tag="AHA_0395"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017408812.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system protein"
                     /protein_id="WP_011704371.1"
                     /db_xref="GeneID:4487193"
                     /translation="MTTTRLVPRYSGVVSPHRAAGFSLIELVIVIVILGILAVTALPR
                     FLDVTDEAKKASVEGVSGGFATGVSLVRAQWEAEGRAKQDSLNTVLYDGSRFYLTTPT
                     DTQVSNGELSPGYPMDTSAGGGIDVDPANLTAPRCLKIWEGLLQNPPKATASFSEVRG
                     SGNDLKYYVSVTNNGLDSVCRYYLVNSLSKGSDGKYQDPQGSTDAFMSFSYRPASGQV
                     TTNIN"
     gene            415673..416110
                     /locus_tag="AHA_RS01970"
                     /db_xref="GeneID:44141863"
     CDS             415673..416110
                     /locus_tag="AHA_RS01970"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005900213.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin-type N-terminal cleavage/methylation
                     domain-containing protein"
                     /protein_id="WP_024945635.1"
                     /db_xref="GeneID:44141863"
                     /translation="MKKQAGFTLIELVIVIIILGILAVTAAPKFLNLQDDAKKSAAQG
                     VQAAVSSSAQLVYSKSALEGKERASSAVVTGSDGTEIKTVYGYPEATDDGIKNAVTID
                     GSWSGKASANNSYVFSTSSSKCTVNYTAASETSAAATTLNGCD"
     gene            416158..416649
                     /locus_tag="AHA_RS01975"
                     /old_locus_tag="AHA_0396"
                     /db_xref="GeneID:4487194"
     CDS             416158..416649
                     /locus_tag="AHA_RS01975"
                     /old_locus_tag="AHA_0396"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017408814.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin-type N-terminal cleavage/methylation
                     domain-containing protein"
                     /protein_id="WP_011704372.1"
                     /db_xref="GeneID:4487194"
                     /translation="MRRGFTLIELVIVILLLGILAAFAVPKLLGKGGFETQTLRDELL
                     TRLRLVQTINMHEPADRCTQLVVEASRFAHITLAVAGGACPDPGPMTDWSDNQRTRGR
                     LVTPSAGMAVSLNNASSFVIRFDQMGRPFGSCATGCTLLVSDGRETGRLKIESEGYIH
                     ESP"
     gene            416636..417199
                     /locus_tag="AHA_RS01980"
                     /old_locus_tag="AHA_0397"
                     /db_xref="GeneID:4487195"
     CDS             416636..417199
                     /locus_tag="AHA_RS01980"
                     /old_locus_tag="AHA_0397"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017787337.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin-type N-terminal cleavage/methylation
                     domain-containing protein"
                     /protein_id="WP_011704373.1"
                     /db_xref="GeneID:4487195"
                     /translation="MRAPERGFTLIELIVGIVLLAVALTGILGLLINQAPQAVDPVQQ
                     VRAAQLAQRLAGEIQQTSFDEQSDHNGGRYRCGEVVAGVTIQACSTHYGPDGEPAPYM
                     FNDVDDFDTAGSWKDASFYTQTGGIIASDEYRNYQVRIAVSPVDFSDGTFKNTCTAPC
                     SVGKRIDLQVRLPDESVLDFSFYRGNY"
     gene            417199..418020
                     /locus_tag="AHA_RS01985"
                     /old_locus_tag="AHA_0398"
                     /db_xref="GeneID:4487196"
     CDS             417199..418020
                     /locus_tag="AHA_RS01985"
                     /old_locus_tag="AHA_0398"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017787338.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system protein"
                     /protein_id="WP_011704374.1"
                     /db_xref="GeneID:4487196"
                     /translation="MRTASGFTLIELVMVILLLGIMATFASQFIGIGTQIYGDASSRE
                     QLMSDARFAMERLNREVRDALPGSERIEALDGSWDDSGPCLRFWPISTSSRYLALNRA
                     QSGSTSTLELVMAIPASAANPLNQDANAVKVGDLMVVFPMPTSAAGSLVNGCEYGRCV
                     ARVTEVLAPVSGAQTVRYISGETLAGISPGSRVYFANQQVRYCVEGSTMTRSSAAIDA
                     PVAAGVLMAESLRAGNFYREVSAFNAEGAFGVRLVFERQGEAVTFNHKLGVFNVP"
     gene            418010..418480
                     /locus_tag="AHA_RS01990"
                     /db_xref="GeneID:44141864"
     CDS             418010..418480
                     /locus_tag="AHA_RS01990"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308098.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041216134.1"
                     /db_xref="GeneID:44141864"
                     /translation="MFPERRQSKKMGGSALMIALFVIVVMAMLAAAMGRFLLDSSEKN
                     TVEVRSVRALLAAQSGLEVALYRLFPNRTAAQPQPPAVCESSRTISFTGNPGLIDCQA
                     VVQCRSVSATYNGVTSTGYRLQSVGTCGLRNDLTSASPDFRVSRTLMVEAYDGG"
     gene            418480..422166
                     /locus_tag="AHA_RS01995"
                     /old_locus_tag="AHA_0399"
                     /db_xref="GeneID:4487197"
     CDS             418480..422166
                     /locus_tag="AHA_RS01995"
                     /old_locus_tag="AHA_0399"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017785697.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MSHA biogenesis protein MshQ"
                     /protein_id="WP_165444124.1"
                     /db_xref="GeneID:4487197"
                     /translation="MMKWLWALALFTSQVWAFDPIDTGSLFPAVVQGHHGNNNDACHQ
                     INGYQLIQLNNAKINGSGGLPLNFCSIQPDQNNTRRCDDGAGGYKVCTVTGSDIRGLA
                     LNGNNAFPSNNANTTQTCSSGSQSASSAAYDTMTVESCTMTFPSRSTYQFKTLTVRNN
                     ATLVLGEGDYFIDRLNLDNGTIRLSGSGTTRIFVNQDVKLVNTVSINANNQGSLIWVN
                     YNNMVIDNSTTFYGYLYTDGLLNMNNNATVYGKVTAGYLKMDAQSSINTAVLPPMLTC
                     FADGFDSAQINPDSWVVAQRNNSTLPSVQNGRLRLTQNITDQATSATFQRLFPGAGNL
                     VTVEFDQYAYKTSGTSGADGMAVVLSDATLTPQPGAFGGPLGYGYKTGISGFAGGWLG
                     VGLDEYGNYANEGGSTNLGSRPQAVSIRGSGSGTSGYRYLTGTASNLNPPVDSGTNGN
                     RPHRYRITVDSRVAGSSLATVERDTGAGYSSLIGPINMTSQTGQAAVPANFLLSLTGS
                     TGSVTNFHEIDNVRICALRSNPVGVQIDHFQLDHSGQALTCNPETVTVKACADAACTT
                     LITDPVTATLSLEPVSSSNGWVGGNTVTFSGGSTTVQLRNNTATSVTIGVSGSVPATK
                     PFSTTLCKAGAGTPSAAACTLNFADSGFFFDVPDTYSNQPQTVAIKAVKKSDVTKQCV
                     PGFANQSKSVKFWSSYVSPASNNYNSRMSVNNSVIGTSQGNATALSLSFDAQGQSSMT
                     VKYPDAGKVQLDARYDGTGSEAGLVMLGSDQFVARPVGLCITPPQGVCAAGDSSCPVF
                     KKAGDTFQVDIKAMAWESVNDGDICAGNQTTPNFVLSNIALGSTLVAPNPGTNAAVGT
                     ATYNHVPASNSLNSVTQTVSEVGVFRMTATPQANAYFTYTIPPASSVPVGRFVPWDFN
                     LFSGTVTPACGGFSYMSQPFGVKMRLQARNKQGGVTLNYRDAFARGLLYLVAADNKDG
                     IDRTDRIGSLATNWQAGEVIFDGSSRFARLAERTPSLTTPEEPFFKLRFGLRVIDGEN
                     PSITTLTGMNMNTGVSGDCQVGVTCNAKQLSIPAVIDDTMVAYYGRVLAGTDRGAASE
                     PLSLSLLMQYYQNGAWSRNEADVCSTLSLANDGVLFTDDTQHYDVASGDLVLGTTARI
                     RVGLGAPSPGAVVGKADKGELLFHFGAPQFAVRVPYSIVLEKQPQQPRWLADPGNLNS
                     LLGEAIFGSSRGNDRIIYRREVMH"
     gene            422371..423411
                     /locus_tag="AHA_RS02000"
                     /old_locus_tag="AHA_0400"
                     /db_xref="GeneID:4487198"
     CDS             422371..423411
                     /locus_tag="AHA_RS02000"
                     /old_locus_tag="AHA_0400"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006002206.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rod shape-determining protein"
                     /protein_id="WP_005308111.1"
                     /db_xref="GeneID:4487198"
                     /translation="MFKKLRGVFSNDLSIDLGTANTLIYVKDQGIVLNEPSVVAIRQE
                     RGNAKSVAAVGHAAKQMLGRTPGNISAIRPMKDGVIADFYVTEKMLQHFIKQVHDNNY
                     FRPSPRVLVCVPCGSTQVERRAIKESALGAGAREVYLIDEPMAAAIGAGLPVSEATGS
                     MVVDIGGGTTEVAIISLNGVVYSQSVRIGGDKFDEAIISYVRRNYGSLIGEATAERIK
                     HEIGSAYPGEEVREIEVRGRNLAEGVPRSFTLNSNEILEALQEPLSGIVSAVMVALEQ
                     SPPELASDISERGMVLTGGGALLKDIDRLLMEETGIPVVVAEDPLTCVARGGGKALEL
                     IDMHGGDLFHYE"
     gene            423454..424359
                     /gene="mreC"
                     /locus_tag="AHA_RS02005"
                     /old_locus_tag="AHA_0401"
                     /db_xref="GeneID:4487199"
     CDS             423454..424359
                     /gene="mreC"
                     /locus_tag="AHA_RS02005"
                     /old_locus_tag="AHA_0401"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017412500.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rod shape-determining protein MreC"
                     /protein_id="WP_011704376.1"
                     /db_xref="GeneID:4487199"
                     /translation="MKPIFGRGPSLQLRLFLAVIISIAAIVADSRFGVFSHVRVYLSS
                     LVSPLQYMANAPGIMLDTMSTQVQTRAGLIEQTKQQEQQLFTLRSRLLKMDHLEHENQ
                     RLRELLGSPVHKESRKMVAELLSVDSDPFSHQVLINKGALDGVYNGQPVINDQGVIGQ
                     VLHVGSTTSRVLLITDSSHGIPVRVLRNDLRAIASGSGELDKLELRNLPRNTDVQVGD
                     LLVTSGLGGRFPEGYPVATVTRSDYVEGKPFAQVEAKPLVALDRLRYLLLLWTDKKPE
                     VHDDEEAPTPAAAPAAAPSAAGATR"
     gene            424359..424844
                     /gene="mreD"
                     /locus_tag="AHA_RS02010"
                     /old_locus_tag="AHA_0402"
                     /db_xref="GeneID:4487200"
     CDS             424359..424844
                     /gene="mreD"
                     /locus_tag="AHA_RS02010"
                     /old_locus_tag="AHA_0402"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005316354.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rod shape-determining protein MreD"
                     /protein_id="WP_005308115.1"
                     /db_xref="GeneID:4487200"
                     /translation="MLQPASGRIWIWISILLALSLSILPLPFQLEPFRPDWLAMVLIY
                     WALALPHRTNVGTAWVAGLLLDVLLGSTLGVRAMAMAITTYLAAFQFQKIRNFSLWQQ
                     ALIIGCLSLVGKVTIFWAEHLFSRASLNFAYFWSTLSTMLIWPWVFLVLRKVRRRFNI
                     K"
     gene            424896..425483
                     /locus_tag="AHA_RS02015"
                     /old_locus_tag="AHA_0403"
                     /db_xref="GeneID:4487201"
     CDS             424896..425483
                     /locus_tag="AHA_RS02015"
                     /old_locus_tag="AHA_0403"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005316352.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="septum formation inhibitor Maf"
                     /protein_id="WP_011704377.1"
                     /db_xref="GeneID:4487201"
                     /translation="MNKHNELQLYLASGSPRRHELLTQLGYRFEVLKLDVPEQREEGE
                     KPQDYVCRLARDKATAGVAAAPTALPVLGADTIVVLGDRVLEKPSDLLDAKDMLEALS
                     GKVHQVMTAVALATPERCDVRLVTTNVAFRKLDEAEIEAYWRTGEPCDKAGAYAIQGI
                     AGKFVSRIEGSYSAVVGLPLLETDLLIKHHLEQSR"
     gene            425670..427139
                     /gene="rng"
                     /locus_tag="AHA_RS02020"
                     /old_locus_tag="AHA_0404"
                     /db_xref="GeneID:4487202"
     CDS             425670..427139
                     /gene="rng"
                     /locus_tag="AHA_RS02020"
                     /old_locus_tag="AHA_0404"
                     /EC_number="3.1.26.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020332236.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease G"
                     /protein_id="WP_011704378.1"
                     /db_xref="GeneID:4487202"
                     /translation="MSVELLVNVTPSETRVALVENGLLQEVHVERQAKRGIVGNIYKG
                     KISRVLPGMQAAFVDIGMDKAAFLHASDIVPHTECVAVKEKEQFQAGNIAELVRQGQD
                     IMVQVVKDPLGTKGARLTTDITLPSRYLVFMPGSAHVGVSQRIESEAERERLKRTVAG
                     YVDELGGYIIRTAAEGVGEQELEQDAAFLKRLWRKILERKQKYPPCKILYEDPSLAFR
                     VVRDFVGAELDKIRVDSRQSFDQLKRFTEEYVPELANKLEYYSGESPIFDLYDVENEI
                     QRALERKVELKSGGYLIIDQTEAMTTVDINTGAFVGHRNLEETIFNTNVEATAAIARH
                     LRLRNLGGIIIIDFIDMQSEDHRRRVLHSLEQALSKDRAKTNVNGFSQLGLVEMTRKR
                     TRESLEHVLCSECPECKGRGRVKTVESVCFEILREIIRVNRAYDADQFTVYAAPAVAD
                     YLRGEESHSLAELEVFIGKQVRVVSEPLCGQEQFDVVMM"
     gene            427140..431039
                     /locus_tag="AHA_RS02025"
                     /old_locus_tag="AHA_0405"
                     /db_xref="GeneID:4487203"
     CDS             427140..431039
                     /locus_tag="AHA_RS02025"
                     /old_locus_tag="AHA_0405"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017785695.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TIGR02099 family protein"
                     /protein_id="WP_164927517.1"
                     /db_xref="GeneID:4487203"
                     /translation="MVYRWLSRGWLALGVFFVLLAILVSLVRFGGPLLNQHRQALLNT
                     LLADSKLEASVDRIGLDWTQLGPALELQQLVIAPNSGRFALRLGKVWAHLDFWRSLNE
                     LKPVFGQLILSDGDIALDLGQPAEPETGNGSDQQQALLRFLLTQLSTFDIHDTRLSLT
                     TALGEVRALDIAQLRWQNRGKRHQGVGKAYLINGVGESTLDLIVDVDAPQVRLDRLKG
                     QLYLGARQLDISPMLARTHSGEPKVSGQLDFQLWSEFKAGQLGDSLLAFGDNYLIWQD
                     EKQGDLHRLGLQGGKIQLRRDGKEWQFASHDVTFKLDGKPWLHSRLQLERVGDRIQGY
                     VPAIDLDQIANLSQLVSGIYPELTETLKRTRPTGKIQDLILQADAGWQGLSVSGQLSH
                     IRVNAWHDVPGVRDLNGEFWLTPTGGSARLQLANDAIDPARHFKEPIPIDRFSARLDW
                     WQVPQGWVLYGQDLVLDNPDLSLASRFRLDLFEHPFLALTGRIDVKNAANADRYYPLQ
                     VMDKSLVDYLSGAIKGGKAKGADLLWYGEFRDFPYRKGEGIFQVAVPLQQASYEFFPG
                     WQPLTDLQIDLLFQNASLDMNSRATQLGKASSDSVHAWIPDLYPGAHLYVDAKVEGEG
                     KAISDYLQDSPLGGSVGQALREVEIRGPMKGSVKLDIPLDGESEVKASGDALFSNNKV
                     RVTSLDLPLEQVQGRLEYDNEQTRFSNLKASLWNQPLTLDYQGRQQPNRYQVDLKFKG
                     QWDSRRQRQDIPALDILKGRGNWAGSLGLTLPGDQPFSFQLALDSNLQGMGLDLPAPL
                     AKAAGSRLPLKVTARGRDGSADIRAVLGADVDMQSRLVYGDGVPYLSRVRVDVGQPGA
                     RVLRDRPMLLAINQQQADVAGWLARLKQWLPASTAPSGNAVVGPSFLPQEWWVDGRLA
                     RADIGSANLKAVHFTVGPVNQATEVMIDSPDVMGVVRLPVSERQPIDAKFARIHWSGK
                     SSDLSPDPDARQDRAIMDAIPWLTFSCVDCRFGELPLGEVKGELIPGADKLSLKGLEM
                     RLAGSQLNGSAEWLAGADGMQTRARAHISSNNSELLLKRLGYTSPIGDAPGKMALDLS
                     WRDVPYRPNVPTLSGTADYQLEGGTLREVNDKGARLLSLLSLDSLLRKLRLDFRDVFD
                     KGFYFESMSASAKIKQGVVDNRDFYMKGAAGNLRGEGIADLVRWRLDYELSFSPNLGG
                     TLPVVAAFSLTPITGLYVLALSKLLEPVVDVVTRIDFRVSGPLDDPKLIEAGRDRARI
                     KLNQQQKEAVDAVAPNLPTQEVTPFLLTPKHAGPAQR"
     gene            431074..431394
                     /locus_tag="AHA_RS02030"
                     /old_locus_tag="AHA_0406"
                     /db_xref="GeneID:4487204"
     CDS             431074..431394
                     /locus_tag="AHA_RS02030"
                     /old_locus_tag="AHA_0406"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308123.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Dabb family protein"
                     /protein_id="WP_011704380.1"
                     /db_xref="GeneID:4487204"
                     /translation="MIRHILLIAFKPGTQPAQIDAVRAAFLAIPHQVSGVLAVEWGRD
                     DSPEGRAEGFTHSVLMTFADEAARQRYLPHPDHDALKAIFRPVLERIIVLDYTLQAGD
                     AVSI"
     gene            431423..432229
                     /locus_tag="AHA_RS02035"
                     /old_locus_tag="AHA_0407"
                     /db_xref="GeneID:4487205"
     CDS             431423..432229
                     /locus_tag="AHA_RS02035"
                     /old_locus_tag="AHA_0407"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005316344.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbon-nitrogen hydrolase family protein"
                     /protein_id="WP_011704381.1"
                     /db_xref="GeneID:4487205"
                     /translation="MWLAAIQLVSGRRWQDNREQIAAELALLPSERPLLVLLPENFAL
                     FGERQGYLDGAEAIGAGPIQAQLAEWARDYGIWLVAGAMPTTIAGSDHIHTSTLVFDP
                     SGERKGHYHKIHLFDVDVADNHGRYRESETFSPGEEPVLVDSPFGPLGLSICYDLRFP
                     ELYRRLARAGARVLLVPAAFTAVTGEAHWEPLLRARAIENQCYLVAANQGGTHETGRQ
                     TWGHSMVIDPWGRVLASLDSGRGTVLAPLDPGLVDELQRTMPVLGHARLL"
     gene            432380..433828
                     /gene="tldD"
                     /locus_tag="AHA_RS02040"
                     /old_locus_tag="AHA_0408"
                     /db_xref="GeneID:4487206"
     CDS             432380..433828
                     /gene="tldD"
                     /locus_tag="AHA_RS02040"
                     /old_locus_tag="AHA_0408"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011899168.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metalloprotease TldD"
                     /protein_id="WP_016349174.1"
                     /db_xref="GeneID:4487206"
                     /translation="MSLLSQVSASLLAPHDLDEGRLQQLLGSLMSHQVEFGDLYFQRS
                     WHESWMLEDGIVKDGSYNIDQGVGVRAVSGEKTGFAYSDELSLLALQQSVTAARGIAA
                     AGAQGKVKAWARTEANLLYPALDPLQTLDKQQKIALLEQMDKFARSLDPAINQVMASI
                     SGVYEEVLVAATDGTLAADVRPLVRLSVTVIAEKGDRRERGSAGGGGRFGYDYFLELD
                     GLESRAFGYVREAVRQALVNLDAIDAPAGTMPVVLGAGWPGVLLHEAVGHGLEGDFNR
                     KGSSAFAGRIGEQVASKHCTIVDDGTLPGRRGSVSIDDEGTPGGYNVLIENGILKGYL
                     QDKQNARLMGVPLTGNGRRESYAALPMPRMTNTYMLAGQYDPAEIIASVKKGIYAPNF
                     GGGQVDITSGKFVFSASEAYLIEDGKITAPIKGATLIGNGPEAMSQVSMVGKDLALDR
                     GVGVCGKEGQSVPVGVGQPTLKLDQLTVGGTQ"
     gene            433861..434721
                     /locus_tag="AHA_RS02045"
                     /old_locus_tag="AHA_0409"
                     /db_xref="GeneID:4487207"
     CDS             433861..434721
                     /locus_tag="AHA_RS02045"
                     /old_locus_tag="AHA_0409"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017787345.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SIS domain-containing protein"
                     /protein_id="WP_011704383.1"
                     /db_xref="GeneID:4487207"
                     /translation="MLTLSKISNIRSQLSPSELKIADYILACPEQVTHFSSQELAQQA
                     DVSQSSIVKFTQKIGFKGFTAFKLAVSEDLGRKHAIKTDNVGDLYNGIGRDDDLETMA
                     KKLAQEKINSIVETTQALDNATLARVLDVINQAGRVQLVGIGGSALTAKDLWYKLLKI
                     GVTTLFAQDSHVQISIAQTLGPGDVQLVVSYSGASRDVLAAAELAKRNGATLIAVTSF
                     RNTPLRQMADMVLDTVADENELRISSISSRTAQNTITDILFLGLVQRRDEAWALIDGT
                     RGAIDRLNKE"
     gene            complement(434809..435414)
                     /locus_tag="AHA_RS02050"
                     /old_locus_tag="AHA_0410"
                     /db_xref="GeneID:4487208"
     CDS             complement(434809..435414)
                     /locus_tag="AHA_RS02050"
                     /old_locus_tag="AHA_0410"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017778507.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2057 domain-containing protein"
                     /protein_id="WP_011704384.1"
                     /db_xref="GeneID:4487208"
                     /translation="MIHLPLLTTLLLLLALPTQAARLELADNLTLLASSRGKASPFER
                     ALTLPAGETRLLVRFDSPLDPGSTNESQGRVRSAPLLLTLTLPASGTLRLVTPPLPTP
                     QAIRRFAASPALQLATADGTRPLLTTALPRSQDSLLTDYQALLARYDGSASAATALPA
                     VTPVLPAATPGAVPVDPELQRRYLAADEAQRKAFLRWALAL"
     gene            complement(435464..436537)
                     /locus_tag="AHA_RS02055"
                     /old_locus_tag="AHA_0411"
                     /db_xref="GeneID:4487209"
     CDS             complement(435464..436537)
                     /locus_tag="AHA_RS02055"
                     /old_locus_tag="AHA_0411"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010672643.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="WP_011704385.1"
                     /db_xref="GeneID:4487209"
                     /translation="MKQSMLALAIPALLAVGTAQAAVIYQADDGSNVDLYGRLGFNIS
                     DKKSGNDQGDFDGRIGFTARQTVNEQVAVIGMAQYQVNAAEYANNVQKNSSDLTARYV
                     WAGLDGGQWGKLTGGRVSSGLIMFTDIGDVFAASDVSMARQASKVDSTAVQVFRQDGT
                     LQYQNTLGNLDLSLAYILGNGTSDLDYGYNGALRYTFDLGAAGKLAPVIAYQQSKAAQ
                     TGASKVDPNADEYRFSGIGTRYTLGPLMLGALYAKDQVSYRNGQADSEDKVWELTAVY
                     DINQKWAARAGYRHLDNDGGDGMSLRDTTLELQYKLTPRSSLYSAYVFRGGEDGLAGS
                     TVTSFGGSSNSEDFYHLGLRYEF"
     gene            complement(436639..438093)
                     /gene="murP"
                     /locus_tag="AHA_RS02060"
                     /old_locus_tag="AHA_0412"
                     /db_xref="GeneID:4487210"
     CDS             complement(436639..438093)
                     /gene="murP"
                     /locus_tag="AHA_RS02060"
                     /old_locus_tag="AHA_0412"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017778509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS N-acetylmuramic acid transporter subunit
                     IIBC"
                     /protein_id="WP_011704386.1"
                     /db_xref="GeneID:4487210"
                     /translation="MAKITDTMVGQLIQAIGGRDNITHCGHCMTRLRLSLADSLHADR
                     DTIKRIAGVMGVIESDDQFQIVLGPGKAQTACELMNGMLSAGLGALEAPTAQSADLGE
                     IAAAKKQALKQKQTSAAHRFLAKFATIFTPLIPGFIAAGLLLGFATLIEQTLLLEGQQ
                     AGGMLAEFVGYMKLFSKGLFSFLSILIGYNAQKAFGGSGVNGAILASLFVMGYDPQAT
                     SGIYAGVSDFFGHQIDPRGNIIGVLIACIIGASVERQVRRFIPDSLDMILTSGITLLI
                     MGAVTFVLIMPLGVQLYNGMSWLFIHLNGNPFGTAILAGLFLISVMFGIHQGFVPVYF
                     ALMDAQGFNSLFPILALAGAGQVGAALALYSRAGKDSLLRTQVKGTIIPGILGVGEPL
                     IYGVTLPRVKPFITACCGGALGGFLVGLISWLGLPVGLNTVFGPSGIVALPLMTSAQG
                     IFPGMLVYAAGLAVAYLGGYLITLMFGCKNVDLS"
     gene            complement(438193..439089)
                     /gene="murQ"
                     /locus_tag="AHA_RS02065"
                     /old_locus_tag="AHA_0413"
                     /db_xref="GeneID:4487211"
     CDS             complement(438193..439089)
                     /gene="murQ"
                     /locus_tag="AHA_RS02065"
                     /old_locus_tag="AHA_0413"
                     /EC_number="4.2.1.126"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704387.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmuramic acid 6-phosphate etherase"
                     /protein_id="WP_011704387.1"
                     /db_xref="GeneID:4487211"
                     /translation="MTIDLSSMITETRNPASVEIDQLPTLEMLRVINQEDQQVALAVS
                     QLLPEITRAVDAIAAAFGKGGRLVYIGAGTSGRLGILDASECPPTYGVSAEQVVGLIA
                     GGHKAILQAVENAEDDAELGAQDLKNIQFCANDVLVGIAASGRTPYVLGAMAHARAVG
                     ATVCSISCNPGSPLAQAADISMVAVVGPEIVTGSSRMKAGTAQKLILNMLSTGAMIRT
                     GKVYGNLMVDVEATNAKLVERQKRIVMEATDCERAVAERALAQADNHCKTAIVMILAG
                     LTADEARTRLQSSNGFISQCTH"
     gene            complement(439353..439556)
                     /locus_tag="AHA_RS02070"
                     /old_locus_tag="AHA_0414"
                     /db_xref="GeneID:4488384"
     CDS             complement(439353..439556)
                     /locus_tag="AHA_RS02070"
                     /old_locus_tag="AHA_0414"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010672646.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005308127.1"
                     /db_xref="GeneID:4488384"
                     /translation="MEKMLTEIGSYSLFHEYLNVVGAASPALTRIKSRWEYKQSDRLV
                     AQIRVDQQGNARFFIDARAISVN"
     gene            complement(439717..440433)
                     /locus_tag="AHA_RS02075"
                     /old_locus_tag="AHA_0415"
                     /db_xref="GeneID:4488385"
     CDS             complement(439717..440433)
                     /locus_tag="AHA_RS02075"
                     /old_locus_tag="AHA_0415"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349179.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarC family NAAT transporter"
                     /protein_id="WP_016349179.1"
                     /db_xref="GeneID:4488385"
                     /translation="MFFQVVFLALLALLPMVNPPTTATLLLGLSKGMSREHVRRQINL
                     AAIYLFCTLCVSFFIGSSILDLFGISIPGLRLAGGLIIAFIGFRMLFPAPSQAAGVDI
                     NQSIAFVPLTMPSMCGPGTMALVISGAAQIAELPDEYNRFTIYAAMVTAFALMSLLSW
                     GVLKLADPVCKILGATGIDAMTRIMGFLLVCMGMQFCINGIKEVAQDPVFHGAPAAQT
                     APALPHVSGALDQLPDPRQP"
     gene            complement(440568..441884)
                     /locus_tag="AHA_RS02080"
                     /old_locus_tag="AHA_0416"
                     /db_xref="GeneID:4488386"
     CDS             complement(440568..441884)
                     /locus_tag="AHA_RS02080"
                     /old_locus_tag="AHA_0416"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017408828.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_011704390.1"
                     /db_xref="GeneID:4488386"
                     /translation="MTTVTPAYDHSRPLNRQDYKTLSLAALGGALEFYDFIIFVFFAV
                     VIGELFFPADIPEWLRQFQTFGIFAAGYLARPLGGIIMAHFGDLIGRKRMFTLSILLM
                     ALPTLLIGLLPTYATLGIAAPLLLLLLRILQGAAIGGEVPGAWVFVAEHVPARRVGVA
                     CGTLTAGLTAGILLGSLVATAINRGMSPSEVSDWGWRLAFVLGGAFGIVAMYLRRWLH
                     ETPVFAEMQANKALAEELPLKTVLRSHKGSVVVSMLLTWLLSAGIVVVILMTPTYLQK
                     VHGISPADALTANSLAILALTFGCIVYGRLIDALGSGPTFMLGSLLLAGASYAFYHGL
                     ATDTSQLVPLYALAGFSVGIVGAVPYVMVNAFPAVVRFSGLSFSYNVAYAIFGGLTPM
                     LVTLWMKEDVLAPSHYVVSLAALGFVLGLLLWLQQRSQRQSAPQAA"
     gene            442132..442803
                     /locus_tag="AHA_RS02085"
                     /old_locus_tag="AHA_0418"
                     /db_xref="GeneID:4488387"
     CDS             442132..442803
                     /locus_tag="AHA_RS02085"
                     /old_locus_tag="AHA_0418"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017408829.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_011704391.1"
                     /db_xref="GeneID:4488387"
                     /translation="MKTKVLLSWSSGKDSAWALHALRQDPAIEVVGLFTTLNQAFERV
                     AMHGVRKQLLLAQAECVGLPLTTIDLPWPCSNEDYARIMTDFIADVVAQGIRHMAFGD
                     LFLEDVRAYRERQLAGTGITPLFPLWGSKTDELAGEMMAAGLRARISTLDPRKLPATL
                     GGHEFDGALLAALPAGVDPCGENGEFHTLAWDGPMFQRPLAIRVGETVERDGFVFTDL
                     LPATI"
     gene            complement(442800..443930)
                     /locus_tag="AHA_RS02090"
                     /old_locus_tag="AHA_0417"
                     /db_xref="GeneID:4488388"
     CDS             complement(442800..443930)
                     /locus_tag="AHA_RS02090"
                     /old_locus_tag="AHA_0417"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005316329.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="two-component system response regulator"
                     /protein_id="WP_016349182.1"
                     /db_xref="GeneID:4488388"
                     /translation="MLNLLDPDTKPTLLVVDDTPENLSLLSALLSPHYRVKVAISGQR
                     ALEILSAGTRVDLILLDVVMPQMDGYQVMQALQEMPQAREIPVIFLTAKVEESAEAHG
                     LALGAVDYIHKPITPAIVLARVRNHLELKAARDLLHDQNAFLEQEVERRTRENELIQN
                     ITIHSLASLAETRDNETGNHILRTQHYVRLLAETLCEHPRFRAELTPKTIDLLFKSAP
                     LHDIGKVGVPDRILLKPGKLDADEFAQMKHHSILGKEAIVHAEEALGVEVEFLRLAKE
                     IACYHHEKWDGTGYPYGLIGDEIPLSARLMALADVYDALISKRCYKAAMSHQEVVPII
                     LAGRGNHFDPDITDAFARIHQQFHEIALRYNDDKGERESNRD"
     gene            complement(443941..446607)
                     /locus_tag="AHA_RS02095"
                     /old_locus_tag="AHA_0419"
                     /db_xref="GeneID:4488389"
     CDS             complement(443941..446607)
                     /locus_tag="AHA_RS02095"
                     /old_locus_tag="AHA_0419"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005316326.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="WP_011704393.1"
                     /db_xref="GeneID:4488389"
                     /translation="MRQLIGETLLSGPAAALTARRKVIQVLTCLDRSPTFVAPLAGAT
                     SELVRQLVANAEPLQLQVWLEPHAQELWLSLSANAPISPEPDGRHSRGIRLVAHADNA
                     IALVYRLPRWPDEPLLQQMQRQFAEPTRDELFAVMQAKNQELEVAYELAEGATRAKSD
                     FLANMSHEIRTPMNAILGMSHLALQTRLDPQQFDYVSKIQRSAQHLLGIINDILDFSK
                     IEAGKLDLERIEFDLDHVLENLATLVGEKAEAKGIELLFEVDHQLDTLLYGDPLRLGQ
                     ILINYANNAVKFTEQGEILVKVSCLEKQPQEVLLHCSVQDTGIGMSQEQQQRLFQSFQ
                     QADSSTTRKYGGTGLGLAISRKLAELMGGEVGVQSEPGRGSTFWFTARLGRGRRRSRY
                     LPSLDLRGRRMLVADDSASARTIMAALLRSMSFVVDTAESGQQALQMIAGAEQEGQPY
                     EVVLLDWHMPGLDGIETGRRLIARGMGQRPYRVMVTGYGREEVFRQADTAGFDRVLVK
                     PVCASVLFDTVIGLFGQQASPLTFKPPQATHHYRFDGLRILLAEDNELNQQVALELLR
                     AVGADVSIAGNGAIALEMVAQTHYDLILMDMQMPVMDGLAATRLLREREDVGQHTPIL
                     AMTANVMAGDRERCLAAGMDDHIAKPIDPDRLYAALQRWATSFSREVSSRLTASRASP
                     ATALLPQLRALGLNAETALQRLMHNWEWYRDLLQRFARQGSQPMETLLAALQANDREE
                     AHRQAHTLKGIAATLGAGSLQELSARLESALARGDDAASLLPLAELGLQQQQQLAAGL
                     LTLLPAPAAAGLPEATPAELAPLLHQLTGLLLEDDAEAFILFQRNQARLAPLLGEAAP
                     AMHDAMTRFRFADALAHLQQVRALRPDLFNQE"
     gene            complement(446608..447678)
                     /locus_tag="AHA_RS02100"
                     /old_locus_tag="AHA_0420"
                     /db_xref="GeneID:4488390"
     CDS             complement(446608..447678)
                     /locus_tag="AHA_RS02100"
                     /old_locus_tag="AHA_0420"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349184.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SpoIIE family protein phosphatase"
                     /protein_id="WP_011704394.1"
                     /db_xref="GeneID:4488390"
                     /translation="MQLEQSVLEASYPLRHDIDLHLTVMAVRRLPFIANLSEVDRAML
                     STVVSELGSNILKYAERGEITLTLHHPRGRPCIDIVARDQGPGIGDVHQAMQDHYSTS
                     GTLGLGLPGVRRMMSELTISTPPEGGTLVQARKWLGAAPLVSRPIAPLASAGQLHAGL
                     QLAWASENRPCYPERVSGDLAFIRPGPEGVSLILIDVSGHGASANKLVQVLEAALQQT
                     HEQEPARLLQLLHQHCIGTRGAAAGVALVNGERGELSYAGIGNTRICLRGREPWRGIS
                     RDGVLGERFPTPLLQRQPLVAGDVVMLYSDGISESLNLRDGALDLAAEPAQLARQVIA
                     HSGRSTDDASCIVLRVLAGEED"
     gene            complement(447685..448059)
                     /locus_tag="AHA_RS02105"
                     /old_locus_tag="AHA_0421"
                     /db_xref="GeneID:4488391"
     CDS             complement(447685..448059)
                     /locus_tag="AHA_RS02105"
                     /old_locus_tag="AHA_0421"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010635354.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-B regulator RsbS"
                     /protein_id="WP_011704395.1"
                     /db_xref="GeneID:4488391"
                     /translation="MLLNNDLGIADVADCIVVSMRPDLGDEGMQQLMQALSQRLMLGR
                     QHAVLLDFSGVMLLDHHEFRQVRKLAEVCRLLGAVCLLVGLNAGIAAFLALADAEPGP
                     LRCFLDMDDAFAHVRTTLKDEE"
     gene            complement(448069..449289)
                     /locus_tag="AHA_RS02110"
                     /old_locus_tag="AHA_0422"
                     /db_xref="GeneID:4488392"
     CDS             complement(448069..449289)
                     /locus_tag="AHA_RS02110"
                     /old_locus_tag="AHA_0422"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005316318.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PAS domain-containing protein"
                     /protein_id="WP_164927518.1"
                     /db_xref="GeneID:4488392"
                     /translation="MDVHTAAAHSNTVTPASPQARLEAIDQLMARLELAPDGLILDAN
                     PRFLAIMGYQLAELKGQHYSMLLPAEAEESAEEVARWQALRTGQVQEGEFHRLDRQGR
                     DIWLRGSCSPQLDEQGALIQVIEYSMDLTEQKQLNANFEGQLNALSRVMGKVEFSLDG
                     IILDANARFLETVGYQLEELKGQHHRLLVDPDYAQSADYRSFWETLRRGEFLAGEFCR
                     LGKQGEEIWIQGSYNPVLDLTGKPSKIVKFATDITAQVAQHRQLKRAMEEAEEAARVR
                     EELHKSLQEMSTPVTPIWDGILLLPLVGIIDSMRTADVMNKSLTKIAETRARVFVLDI
                     AGVATVDTGVANQLIKITKATQFMGCEAIISGVSPAIARTMVELGVSVGDIRTTATLR
                     DAFEIALKRVGSTL"
     gene            449431..450123
                     /locus_tag="AHA_RS02115"
                     /old_locus_tag="AHA_0424"
                     /db_xref="GeneID:4488393"
     CDS             449431..450123
                     /locus_tag="AHA_RS02115"
                     /old_locus_tag="AHA_0424"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308144.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="WP_011704397.1"
                     /db_xref="GeneID:4488393"
                     /translation="MNLWYRDYPQGALTALHCHGGSQFCYLHRGGGVISSQAAGVLLV
                     AGQLCLIPAGLAHEFRVLRHSRLSLIYLDDLDGGSELTTRQVSPLLAGLFERLADMAE
                     PGLRDAYLTVLAAELRQAPVAAGFMLSAALDVRLLRVLERVCRHPSIEYGLAELAADS
                     GASVRTLNRLFSQQLGCSFRQWRQQVVMGRARQLQQQGQPLSRIALELGYGDFSAFSH
                     AFNRFLREPAGP"
     gene            complement(450089..450508)
                     /locus_tag="AHA_RS02120"
                     /old_locus_tag="AHA_0423"
                     /db_xref="GeneID:4488394"
     CDS             complement(450089..450508)
                     /locus_tag="AHA_RS02120"
                     /old_locus_tag="AHA_0423"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017783194.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011704398.1"
                     /db_xref="GeneID:4488394"
                     /translation="MDYKQRLQDCLNRVICDPDFTPAELDHWFCPDYVQLVDDQRLDR
                     AAFEQHLLVLRQSLARCEIHFVSLLAEGNRVHSQHRVRAWRHDGAQIECKVSALFTFQ
                     GERLSHTDELTCLLAGEPADRDLGSRLTAPPAPARSD"
     gene            450724..451434
                     /gene="aphA"
                     /locus_tag="AHA_RS02125"
                     /old_locus_tag="AHA_0425"
                     /db_xref="GeneID:4488395"
     CDS             450724..451434
                     /gene="aphA"
                     /locus_tag="AHA_RS02125"
                     /old_locus_tag="AHA_0425"
                     /EC_number="3.1.3.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349188.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acid phosphatase AphA"
                     /protein_id="WP_043168835.1"
                     /db_xref="GeneID:4488395"
                     /translation="MSLSPRFALLASLVAASLTLPAVAVEAPASPAGVTAVTLAQQAP
                     IHWVSVTQIAKSLDGLPPMAVGFDIDDTLLFSSPGFYRGKQEFSPNDESYLKNPAFWE
                     KMNNGWDAFSVPKEVGKALIAMHLERGDHIYFVTGRSATKTETVSQTLQQTMNIPADQ
                     LNPVIFAGDQPGQNTKVQWLKEKQMKIFYGDADGDIKAAQELGIRGIRLLRSANSTYR
                     PLPLAGALGEEVIVNSQY"
     gene            complement(451497..452342)
                     /locus_tag="AHA_RS02130"
                     /old_locus_tag="AHA_0426"
                     /db_xref="GeneID:4488396"
     CDS             complement(451497..452342)
                     /locus_tag="AHA_RS02130"
                     /old_locus_tag="AHA_0426"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017787358.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc metallopeptidase"
                     /protein_id="WP_011704400.1"
                     /db_xref="GeneID:4488396"
                     /translation="MRWQDRRESNNVEDRRQQGSGGGIPIGGKGRLILLVVVMVAGYY
                     GVDLSPLLSEPTTQSQPQRQEMSQPAKDPLARFTSVMLASTEDAWGEIFQQSGSRYQA
                     PKLVLYRGATRTGCGQGQSVMGPFYCPADRTVYIDLSFYQEMRDKLGADGDFAQGYVV
                     AHEVGHHVQNLLGIERKIREQQQGLSRAEQNKLSVKLELQADCFAGVWGHYMQQEQVL
                     EHGDLEEALNAAQAIGDDRLQQQSQGRVIPDSFTHGSSAQRYAWFKRGFDSGKPASCN
                     TFAAR"
     gene            complement(452450..452713)
                     /locus_tag="AHA_RS02135"
                     /old_locus_tag="AHA_0427"
                     /db_xref="GeneID:4488397"
     CDS             complement(452450..452713)
                     /locus_tag="AHA_RS02135"
                     /old_locus_tag="AHA_0427"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005316314.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011704401.1"
                     /db_xref="GeneID:4488397"
                     /translation="MSEPTEFFDEQTLLEMVDNQLSDGHPLQVKATLMRLVMKGTPRE
                     ETLQYIACALGAELMAMEADQGPFNLERYGQFLDSLPEMPWAE"
     gene            452887..453708
                     /locus_tag="AHA_RS02140"
                     /old_locus_tag="AHA_0428"
                     /db_xref="GeneID:4488398"
     CDS             452887..453708
                     /locus_tag="AHA_RS02140"
                     /old_locus_tag="AHA_0428"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349190.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HDOD domain-containing protein"
                     /protein_id="WP_024945656.1"
                     /db_xref="GeneID:4488398"
                     /translation="MPTIDSLLSKPQNLPNVPEVMRELVQTFNEKEPDILLIAKKINK
                     DPVISAKLLRLANSAKFGGSRQVATVNEAVVRLGVDVVRNMVLACGLTGSINAVPGID
                     LKHFWGKVFDVAELARRLAKLKGMKGEEVFTCALLYDMGRLIMHVGLPENMVNHIKDL
                     EPSKGRAKAEELVVGFNYAQTGAEMARRWQFPLSICHAVEYHYNPLLAKEFSVEAALI
                     HLAIALAAQSDVGDEAPPEWPAQVAERLGLSWSDCAAVFVALREQGNGYAGLLAA"
     gene            453826..454347
                     /locus_tag="AHA_RS02145"
                     /old_locus_tag="AHA_0429"
                     /db_xref="GeneID:4488399"
     CDS             453826..454347
                     /locus_tag="AHA_RS02145"
                     /old_locus_tag="AHA_0429"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308158.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_011704403.1"
                     /db_xref="GeneID:4488399"
                     /translation="MILSERLELRELTIADAPFIVELLNDPDFHRYIGDRGIRTLQDA
                     ENYIQQGPAVSYARHGHGLYLVARRSDGAKLGICGLIKRDTLPCEDIGYAFLPAYRGQ
                     GYGIEAAQAALQDGRERLGIERVVAIVTPGNERSVALLAKLGLVQSRLVKLAEDADEC
                     LLLEVQGAQACRV"
     gene            complement(454474..454650)
                     /locus_tag="AHA_RS21670"
                     /old_locus_tag="AHA_0430"
                     /db_xref="GeneID:44157220"
     CDS             complement(454474..454650)
                     /locus_tag="AHA_RS21670"
                     /old_locus_tag="AHA_0430"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704404.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011704404.1"
                     /db_xref="GeneID:44157220"
                     /translation="MMKVVQTHKPLRRSKPINLPVQEHDDDGFLIQFSTRFSGGFAIS
                     CDGIAGEFSIEDLN"
     gene            complement(455122..456399)
                     /locus_tag="AHA_RS02150"
                     /old_locus_tag="AHA_0431"
                     /db_xref="GeneID:4488401"
     CDS             complement(455122..456399)
                     /locus_tag="AHA_RS02150"
                     /old_locus_tag="AHA_0431"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017408839.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:proton antiporter"
                     /protein_id="WP_011704405.1"
                     /db_xref="GeneID:4488401"
                     /translation="MSVYYTLCFLAALAIFIAFANQYVVKIQTTIAITAGSMLISALL
                     VLFGKLGWFNLEPLAVKTMESIDFQNFLLKGILGFLLFAGGLGINLKALRSQKWEITI
                     LSIVATLLSTFMVGYGFWFIAKLLGWELPLVYCMLFGALISPTDPIAVLAIVKKMKAP
                     PQIAIQIEGESLFNDGVGLVIFATVFAVAFGGVEPTFGSVAGLFLHEALGGILFGAVL
                     GLITHVMISATDDGSLELLLTLCIPTAGFAFANMIGVSGALAMVVTGIMIGNWTRHSG
                     FSEQSSHHLDHFWELMDQFLNALLFLLIGLALVLLDLAWRDWILLVIAVPLCLAARFI
                     SVSLPYMAFRRYRSYNKFSVRILTWGGLRGGLAMAMALALPSGVMMLPEHGVDLREVI
                     LVMTYSVVMFSIVVQGMTITPMITAAKKASGHY"
     gene            456603..460286
                     /gene="metH"
                     /locus_tag="AHA_RS02155"
                     /old_locus_tag="AHA_0432"
                     /db_xref="GeneID:4488402"
     CDS             456603..460286
                     /gene="metH"
                     /locus_tag="AHA_RS02155"
                     /old_locus_tag="AHA_0432"
                     /EC_number="2.1.1.13"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017778525.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine synthase"
                     /protein_id="WP_011704406.1"
                     /db_xref="GeneID:4488402"
                     /translation="MSNKKSDVTNKLEACLKERILIIDGAMGTMIQGYKLGEADYRGA
                     RFADWHTDIKGNNDLLVLTRPAVIREIHEQYCAAGADILETNTFNATRIAMADYEMEE
                     FSAEINCEAARLARAVADEWTAKEPHKPRFVAGVLGPTNRTASISPDVNDPGKRNVTY
                     DQLVAAYTESTHALIEGGADIILIETIFDTLNAKAAAFAVEGVFEALGYSLPVMISGT
                     ITDASGRTLSGQTTEAFYHSLRHVKPVSFGLNCALGPDELRQYVEELSRISETHVSAH
                     PNAGLPNAFGEYDLDAVEMAEHIREWAASGFLNLVGGCCGTTPTHIRAMADAVAGIKP
                     RALPELPVACRLSGLEPLIITPESMFVNVGERTNVTGSAKFKRLIKEGLYDEALDVAK
                     QQVESGAQIIDINMDEGMLDAEAAMVRFLNLIAGEPDIARVPVMIDSSKWEVLEAGLK
                     CVQGKPVVNSISMKEGEEKFIQQARLLRRYGAAVIVMAFDEVGQADTRARKFEICQRA
                     YRILVDRVGFPPEDIIFDPNIFAVATGIDEHNNYAVDFIDAVKDIKQNLPHAMISGGV
                     SNVSFSFRGNEPVREAIHAVFLYHAIQNGMDMGIVNAGQLAIYEDIPSDLKEKVEAVV
                     LNLNPDATEALLAIAERYRGGGAQTEDPRDQAWRSWPVGKRLEHALVKGITDFIEEDT
                     EEARSKAEKPLHVIEGPLMDGMNVVGDLFGAGKMFLPQVVKSARVMKRAVAYLQPYIE
                     AEKSGGSSNGKIVMATVKGDVHDIGKNIVGVVLQCNNYEIVDLGVMVSCETILKTARE
                     VNADIIGLSGLITPSLDEMVHVAKEMERQGFKLPLLIGGATTSKAHTAVKIEQNYSEP
                     VVYVSNASRAVGVAQSLLSPELKPAFVARIDKEYEIAREQHARKQPRSKPVSLAHARA
                     NRHQLDWVGYQPPKPREPGVQTFEDVPVSVLRPYIDWTPFFLSWELAGKFPRILEDEV
                     VGEEATRLYADANAMLDQLEQDRSVRCAGIIGLFPANAVGDSIEVYTDESRREVRKVL
                     HHLRQQSEKQGFPNYCLADYVAPKESGKPDWIGAFAVTGGIGEEAIAKAYKAEHDDYN
                     AILIQAVCDRLAEAFAEYLHEQVRKVHWGYAPNEALSNEELIRENYRGIRPAPGYPAC
                     PEHTEKGSIWELLGVEQAIGMKLTESYAMWPGAAVSGWYFSHPDSKYFAVAQIQQDQV
                     EDYAQRKGMTLAEAERWLGPNLH"
     gene            460526..461422
                     /gene="rimK"
                     /locus_tag="AHA_RS02160"
                     /old_locus_tag="AHA_0433"
                     /db_xref="GeneID:4488403"
     CDS             460526..461422
                     /gene="rimK"
                     /locus_tag="AHA_RS02160"
                     /old_locus_tag="AHA_0433"
                     /EC_number="6.3.2.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308166.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S6--L-glutamate ligase"
                     /protein_id="WP_016349212.1"
                     /db_xref="GeneID:4488403"
                     /translation="MKIAILSREPNNYSTRRLVEVAQARGHQVEVLDTLRCYMNIASH
                     NPSIHYEGRELESYDAVIPRIGASITFYGTAVLRQFEMMNTMALNSSVAISRSRDKLR
                     AMQLLSRHGIGLPVTGYAHSTHDVPDLITMVGGAPLVVKLLEGTQGIGVVLCETQKAA
                     ESVIEAFIQTNNNILVQEYIREANGADIRCLVVNGKVVAAMRRQAQPGEFRSNLHRGG
                     TAEAIKISPEERATAVQAAKIMGLDVAGVDILRSARGPLVLEVNSSPGLQGVEAASGK
                     DVAGKIIEFLELKASRKHKPAE"
     gene            461811..463145
                     /gene="brnQ"
                     /locus_tag="AHA_RS02165"
                     /old_locus_tag="AHA_0434"
                     /db_xref="GeneID:4490397"
     CDS             461811..463145
                     /gene="brnQ"
                     /locus_tag="AHA_RS02165"
                     /old_locus_tag="AHA_0434"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012770774.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid transport system II
                     carrier protein"
                     /protein_id="WP_011704408.1"
                     /db_xref="GeneID:4490397"
                     /translation="MNNQKLTSRDIVALGFMTFALFVGAGNIIFPPMVGLQAGEQVWG
                     AAAGFLLTAVGLPVLTVVALAKVGGGVDALSAPIGRKAGLLLATVCYLAVGPLFATPR
                     TATVSYEVGLAPLFGDDGSALLIYSLVYFSLVIGISLYPGRLLDTVGHVLAPIKILAL
                     AALGLAVLLWPAGSAIPAVESYQHQPFSNGFVNGYLTMDTLGAMVFGIVIVNAARSRG
                     VSSAKLLTRYTVLAGLIAGMGLTLVYLSLFRLGSVSGELVPHAQNGAEILHAYVQHTF
                     GNMGSGFLALLIFIACLVTAVGLTCACAEFFAQYLPLSYRTLVLLLGGFSMLVSNLGL
                     SHLIQLSVPVLTAIYPPCIVLVVLSFTLRWWGNGTRVVGPVMLISLLFGLIDGLKASA
                     LAGLLPAWSLALPLNEQGLAWLPPSLCALLLAALWDRLQGRPQVASVSKSAA"
     gene            complement(463220..464431)
                     /locus_tag="AHA_RS02170"
                     /old_locus_tag="AHA_0435"
                     /db_xref="GeneID:4490398"
     CDS             complement(463220..464431)
                     /locus_tag="AHA_RS02170"
                     /old_locus_tag="AHA_0435"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349214.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAMP domain-containing histidine kinase"
                     /protein_id="WP_011704409.1"
                     /db_xref="GeneID:4490398"
                     /translation="MSLPSLRRRLILTLSGAGLLLLVIISLLMVVAEDKMEELSLRHW
                     LEAEVTRYSDDWLRLGMAAPAPSPRQFSSYWTEAGRLPVWLKPYQSPGFYEHVLGDED
                     KHFLVRPHPSGEGLLYLVFNDDADDYLDPYEDQLHLATRLIGLVLLLGCIGFGIWLVR
                     HITRPLQRLQQRVAHLTPDQADFVPDAPWQELRDIELALLAGKQEVAAVFAREQEFSR
                     FASHELRTPNMVIQGSAALLGKVSDLPAPAARATTRIRAAADEMALLTETFLLLGRKE
                     PVERPPQQVAPLIRQELARLAPLLQREELDIRLQLDDESEALAPLSLLAIALGNLLKN
                     ALSYAEGHIDIELAGPVLTISNPTAAAPDQILGYGCGLTIIQRICEKLGWQIETRLEG
                     GIFSARLAMRE"
     gene            complement(464475..465143)
                     /locus_tag="AHA_RS02175"
                     /db_xref="GeneID:44141865"
     CDS             complement(464475..465143)
                     /locus_tag="AHA_RS02175"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010672659.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator transcription factor"
                     /protein_id="WP_016349215.1"
                     /db_xref="GeneID:44141865"
                     /translation="MKILVVEDNPQVAETIMDYLELAGHRLDCAYHGQAALQLLAEQR
                     FDVIIMDVMMPRLDGLSTVARLREQGIPTPVLFLTARDSLDDKLAGFKAGGDDYLVKP
                     FAMEELEVRLQALALRGPRSDMGALCVGELTLDPASGRATRAGVELKLGKIPFQILTL
                     LARRAPALVTRQEVLDTVWGDEEPDSDALRSHIYALRNALDKPFPTPMLETLHGQGYR
                     LVTP"
     gene            465234..465650
                     /locus_tag="AHA_RS02180"
                     /db_xref="GeneID:44141866"
     CDS             465234..465650
                     /locus_tag="AHA_RS02180"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308172.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_044798981.1"
                     /db_xref="GeneID:44141866"
                     /translation="MKKSLCTLLLLILLPLGAAQSAEFKLTGRTTWQLGQLMVNGIPF
                     VLDEQTRFKDGLREDDLGGTWVDLEGVVEGELRLIREVEKLEEDDEMDLEGPVEQGRI
                     WGYVTSDDSLAPFEGRWLELECKFDGMRLSRCREDD"
     gene            465736..466215
                     /locus_tag="AHA_RS02185"
                     /old_locus_tag="AHA_0437"
                     /db_xref="GeneID:4490400"
     CDS             465736..466215
                     /locus_tag="AHA_RS02185"
                     /old_locus_tag="AHA_0437"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005316289.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011704411.1"
                     /db_xref="GeneID:4490400"
                     /translation="MTRTSLLLLTLPLCALAADGELWLVELEHNDGLRLQFQGAELEL
                     GNAALSGVAGNDELRPGMRLAILSRDGVAERIGMADAIAGFLPTSQWRRAEASLLAVT
                     GRALRLQGLGVLAFDDDTRWLNGSPADLQPGRKLVLSRNEQGCLTEILIANPEDEPE"
     gene            466510..467991
                     /gene="aerA"
                     /locus_tag="AHA_RS02190"
                     /old_locus_tag="AHA_0438"
                     /db_xref="GeneID:4490401"
     CDS             466510..467991
                     /gene="aerA"
                     /locus_tag="AHA_RS02190"
                     /old_locus_tag="AHA_0438"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704412.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-barrel pore-forming toxin aerolysin"
                     /protein_id="WP_011704412.1"
                     /db_xref="GeneID:4490401"
                     /translation="MQKLKITGLSLIISGLLMAQAHAAEPVYPDQLRLFSLGQEVCGD
                     KYRPITREEAQSVKSNIVNMMGQWQISGLANGWVIMGPGYNGEIKPGTASNTWCYPTN
                     PVTGEIPTLSALDIPDGDEVDVQWRLVHDSANFIKPTSYLAHYLGYAWVGGNHSQYVG
                     EDMDVTRDGDGWVIRGNNDGGCEGYRCGEKTAIKVSNFAYNLDPDSFKHGDVTQSDRQ
                     LVKTVVGWAINDSDTPQSGYDVTLRYDTATNWSKTNTYGLSEKVTTKNKFKWPLVGET
                     ELSIEIAANQSWASQNGGSTTTSLSQSVRPTVPARSKIPVKIELYKADISYPYEFKAD
                     VSYDLTLSGFLRWGGNAWYTHPDNRPNWNHTFVIGPYKDKASSIRYQWDKRYIPGEVK
                     WWDWNWTIQQNGLSTMQNNLARVLRPVRAGITGDFSAESQFAGNIEIGAPVPLAADSK
                     VRRTRSVDGAGQGLRLEIPLDAQELSGLGFSNVSLSVTPAANQ"
     regulatory      468097..468210
                     /regulatory_class="riboswitch"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00059"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="TPP riboswitch; Derived by automated computational
                     analysis using gene prediction method: cmsearch."
                     /bound_moiety="thiamine pyrophosphate"
                     /db_xref="RFAM:RF00059"
     gene            468494..470485
                     /gene="thiC"
                     /locus_tag="AHA_RS02195"
                     /old_locus_tag="AHA_0439"
                     /db_xref="GeneID:4490402"
     CDS             468494..470485
                     /gene="thiC"
                     /locus_tag="AHA_RS02195"
                     /old_locus_tag="AHA_0439"
                     /EC_number="4.1.99.17"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019840135.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphomethylpyrimidine synthase ThiC"
                     /protein_id="WP_011704413.1"
                     /db_xref="GeneID:4490402"
                     /translation="MSTNVSDTAKSSRREQRSSAQTFIDNLKGMAHPNSRRIFIEGSR
                     ADIRVPLREIQLADTFVGGTKEAPQFEPNEPVPVYDTSGRYGEEGVAIDVRRGLPRLR
                     EDWVLERADTEALEGLSSTFTQERLADEGLDHLRFEHLPSARRAKPGRRVTQLHYART
                     GIVTPEMEFIALRENMGRERVRSELLRTQHPGQGFGARLPQNITPEFVRDEVAAGRAI
                     IPSNINHPEAEPMIIGRNFLVKINANIGNSAVTSSIEEEVEKLVWSTRWGADTVMDLS
                     TGRYIHETREWILRNSPVPIGTVPIYQALEKTNGIAEDLTWELFRDTLLEQAEQGVDY
                     FTIHAGVLLRFVPMTAKRLTGIVSRGGSIMAKWCLSHHKENFLYQHFREICEICAAYD
                     VALSLGDGLRPGSVYDANDEAQFAELHTLGELTKIAWEYDVQVMIEGPGHVPMHMIER
                     NMTEQLEHCHEAPFYTLGPLTTDIAPGYDHFTSGIGAAMIGWYGCAMLCYVTPKEHLG
                     LPNKEDVKQGLITYKIAAHAADLAKGHPGAQIRDNAMSKARFEFRWEDQFNLALDPDT
                     ARAYHDETLPQESGKVAHFCSMCGPKFCSMKITQDVRDYAAKLEAVEIKMVGMDGQQE
                     RVVAEVESGMARMAETFKETGGEIYHQAAALKQAAGEEA"
     gene            470482..472098
                     /gene="thiE"
                     /locus_tag="AHA_RS02200"
                     /old_locus_tag="AHA_0440"
                     /db_xref="GeneID:4490403"
     CDS             470482..472098
                     /gene="thiE"
                     /locus_tag="AHA_RS02200"
                     /old_locus_tag="AHA_0440"
                     /EC_number="2.5.1.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010672664.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine phosphate synthase"
                     /protein_id="WP_011704414.1"
                     /db_xref="GeneID:4490403"
                     /translation="MSSASGAVSPADLSPVTDSRPVVWTIAGSDSGGGAGIQADLHTL
                     HDLGVHGCSVISAITAQNSVAVKMVDPVLMQTFTAQIDALGLDLPPAAIKVGLLPTRL
                     HVEVLARRLPTVDAPFVVYDPVAIASTGTPMAEPNMLEAVREQLLPRLSLITPNGPEL
                     EALTGLPATSPELVRLAARRLRELGARAVLVKGGHLAWSGDLCLDYYQDETREFWLTA
                     PRLDTRHGHGTGCCYASAIAAVVAQDYPVEDAITLARAYLQQGLAAAQGVGAGPGPIA
                     HLGWPADLAHFPRAVLAGSALDRRFGLYETSSARLPQGPFAPTEHNLGLYPVVDSVKW
                     LKRLLGAGVKTIQLRIKDLPAAQVAPAIRDAVALGRRHGARLFINDYWQQAIEAGAWG
                     VHLGQEDMETADLAAIQAAGLRLGISTHGYFELMRARELAPSYIALGHIFPTNTKAMP
                     SRPQGLKRLHRYRALMCDWPTVAIGGISEERVAAVKESGVGSIALVSAITASDDWQGA
                     TERLLAAVGAGDEPRSALLMTDMQEAAHAL"
     gene            472161..472919
                     /locus_tag="AHA_RS02205"
                     /old_locus_tag="AHA_0441"
                     /db_xref="GeneID:4490404"
     CDS             472161..472919
                     /locus_tag="AHA_RS02205"
                     /old_locus_tag="AHA_0441"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017787368.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HesA/MoeB/ThiF family protein"
                     /protein_id="WP_011704415.1"
                     /db_xref="GeneID:4490404"
                     /translation="MLADAEYLRYGRQLMLAEVGEEGQARLKDKSVLIVGLGGLGSPL
                     ALYLAGAGVGTLWLADGDTVDSSNLPRQILFDSEAVNHSKAELARERLAAHNPLVELI
                     AINQRLDAASLPEFVAEVDLVIDCCDNLATRQAINAACVAQGKPWVCAAAVGWQGQLM
                     VRTSSEHACYACLYPLDTEIKESCETSGVTGPLVGVMGSLQALEALKLLFGMQSPVAG
                     TLRRFDALAHQWQTLTLAPDPDCPVCGPHKEITP"
     gene            472916..473122
                     /gene="thiS"
                     /locus_tag="AHA_RS02210"
                     /old_locus_tag="AHA_0442"
                     /db_xref="GeneID:4490405"
     CDS             472916..473122
                     /gene="thiS"
                     /locus_tag="AHA_RS02210"
                     /old_locus_tag="AHA_0442"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308183.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfur carrier protein ThiS"
                     /protein_id="WP_164927519.1"
                     /db_xref="GeneID:4490405"
                     /translation="MTLTIQLNDKAQPLAAGQSVADLLAAQDVNPQGVAVALNGAVLP
                     RSRWAETRLNDGDELHLFTAIAGG"
     gene            473124..473891
                     /locus_tag="AHA_RS02215"
                     /old_locus_tag="AHA_0443"
                     /db_xref="GeneID:4490406"
     CDS             473124..473891
                     /locus_tag="AHA_RS02215"
                     /old_locus_tag="AHA_0443"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349221.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiazole synthase"
                     /protein_id="WP_011704417.1"
                     /db_xref="GeneID:4490406"
                     /translation="MLKIADHTFSSRLFTGTGKFARPALMAAAIEASGSQLVTMAIKR
                     LEPGKAHDDILSPLLQLGVKLLPNTSGAKTAAEAVFAAHLAREALGTNWLKLEIHPDP
                     RYLLPDPIETLKAAEQLVKEGFVVLPYCGADPVLCKRLEEVGCAAVMPLGAPIGSNQG
                     LVTREFLSIIVEQANVPVVVDAGIGAPSHAAAAFELGADAVLVNTAIAVSGDPIAMGR
                     AFALACTAGRSAYEAGLGARAQQAQASSPLTDFLGAL"
     gene            473927..475198
                     /gene="thiH"
                     /locus_tag="AHA_RS02220"
                     /old_locus_tag="AHA_0444"
                     /db_xref="GeneID:4490407"
     CDS             473927..475198
                     /gene="thiH"
                     /locus_tag="AHA_RS02220"
                     /old_locus_tag="AHA_0444"
                     /EC_number="4.1.99.19"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017778537.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-iminoacetate synthase ThiH"
                     /protein_id="WP_011704418.1"
                     /db_xref="GeneID:4490407"
                     /translation="MSSFSVSPEADVFSPPLPLGEGLGVRAEADSVLEGGEPCTPPPP
                     KGEAGRGLDFANRWQELEWDDIGMQIRAKTAADVARALSAPRRTLADFMALISPAAEA
                     YLPQMAAEAERLTRQRFGNTIGFYVPLYLSNLCANDCTYCGFSMSNRLKRKTLNAEEI
                     ERECLAIKARGFDSVLLVTGEHEHKVGLAYFREVMPIIRRHFSTVGMEVQPLSQDEYA
                     ELKSLGLDSVMVYQETYHAPTYARHHLRGNKREIAWRLATPDRLGRAGIDKIGLGALI
                     GLSSDWRADSYFVAEHLAWLERHHWQSRYSLSFPRLRPCTGGLEPAVVMSDRQLAQLI
                     CAWRLFSPTLDLSLSTRESATFRNGAVRLGITQMSAESRTQPGGYAEGDAEELEQFAI
                     HDDRPVGEVAAAVRQAGLQPVFKDWEPFLGR"
     gene            complement(475373..475672)
                     /locus_tag="AHA_RS02225"
                     /db_xref="GeneID:44141867"
     CDS             complement(475373..475672)
                     /locus_tag="AHA_RS02225"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_026457977.1"
                     /db_xref="GeneID:44141867"
                     /translation="MSDKTKDIREALAEALIHAEEKGDLVITTSVIDGITVPMAEAIK
                     TVYAGMFTTHELSALSNLAFHATQDANFYDWEMPTLIGLSREEMQSLGEKLRDLT"
     gene            <475780..475983
                     /gene="thiH"
                     /locus_tag="AHA_RS02230"
                     /pseudo
                     /db_xref="GeneID:44141868"
     CDS             <475780..475983
                     /gene="thiH"
                     /locus_tag="AHA_RS02230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017783212.1"
                     /note="in Escherichia coli this enzyme functions in
                     thiamine biosynthesis along with thiFSGI and iscS; with
                     ThiFSG catalyzes the formation of thiazole phosphate from
                     tyrosine, cysteine and 1-deoxy-D-xylulose-5-phosphate;
                     forms a complex with ThiG; contains an iron-sulfur center;
                     incomplete; partial in the middle of a contig; missing
                     N-terminus; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="2-iminoacetate synthase ThiH"
                     /db_xref="GeneID:44141868"
     gene            476321..478207
                     /locus_tag="AHA_RS02235"
                     /old_locus_tag="AHA_0445"
                     /db_xref="GeneID:4490408"
     CDS             476321..478207
                     /locus_tag="AHA_RS02235"
                     /old_locus_tag="AHA_0445"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012127956.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_164927520.1"
                     /db_xref="GeneID:4490408"
                     /translation="MIRQITITNFRSIRKETISTEEITTFVGKNDAGKSNLLRALNLF
                     FNGKTDADTDYNFQSDFNINAIVQQRKAKEIKVELVLKLPRSYRKPDQPDTVYWSKIW
                     RADGFHDEVQQHCEVKGGAVVNKRNFPKRSKIPSLLKSINYIYIPAIKDANFFRDLQG
                     KLYDVLAISSEQGLHASANSFEQEINEHISELMGEIDTVFASSNNEIKLPQNLRNIFG
                     ALEFKADNIPLSRRGDGIKIRHIPMMLSFIALKQQSIGAKITIRPQIWGFEEPENNVE
                     FSTCFELNNQLIEAAKKHTQMFITTHSPAIYSLSFNASLPSGLKSISYYVDKKGHDTK
                     LQSCSEQDLHGNTGFLNLVTPLIEEHRKVWQERESEYKKTLGVLSSQLAASSKPRVFL
                     EGMSDSVVINRILQFLNKADEIFIDVPDNAHNSANAASDRAKAFYLLQKHEKTKVLGL
                     LLLDDDPAGKEAKNQFTEFFKGQQSTVSAATYPPHDAPKKLKLKGYIWRVELEHLYPE
                     CIWQHALEQSWIEEVTDEEQKFTDNKRKELFNTGVSPITYKADLTDYQRFIVDYAFTH
                     QGKRDVSQYIDNMTDDELFEKGLVAAFEPVIEMILKKLKLSPIASEISASEDSETSPI
                     WTGT"
     gene            complement(478359..478901)
                     /locus_tag="AHA_RS02240"
                     /old_locus_tag="AHA_0446"
                     /db_xref="GeneID:4490409"
     CDS             complement(478359..478901)
                     /locus_tag="AHA_RS02240"
                     /old_locus_tag="AHA_0446"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_164927521.1"
                     /db_xref="GeneID:4490409"
                     /translation="MTFQPLANTTLVIRPFEPGDADEFVCAAHESIETVGSWMSWCTP
                     SFNREQALAWFATCDQDRAAGRAFDMGLFCATTGQLLGGAGINQLAPHHRYGNIGYWV
                     RQSRQGCGIARQAVALLRAFGFQQLGLFRLEIVMGVGNTASEAVAIAAGATFECLARN
                     RIFLHDQPLDAHIYSLGPTE"
     gene            479239..479820
                     /locus_tag="AHA_RS02245"
                     /old_locus_tag="AHA_0447"
                     /db_xref="GeneID:4490410"
     CDS             479239..479820
                     /locus_tag="AHA_RS02245"
                     /old_locus_tag="AHA_0447"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017779801.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010635332.1"
                     /db_xref="GeneID:4490410"
                     /translation="MKLRSLLMVGALLLGGCAVNPYGGTQAPVSEPDQPVSQPDKPVT
                     KPDAGAPLPKPVAPTGLALAMADAFVQAPEVRELAQTGQPVLLLTPPQNGTGEPVDTR
                     AMAAAMSKRIQSKSGFRFVDPGQVAAITGQLEYQQGRMNPASLVRLGRQTGAGYMLYG
                     DLVAEGSRYRLSMTLMELRSGELLWSGSRSASH"
     gene            complement(479899..480315)
                     /locus_tag="AHA_RS02250"
                     /old_locus_tag="AHA_0448"
                     /db_xref="GeneID:4490411"
     CDS             complement(479899..480315)
                     /locus_tag="AHA_RS02250"
                     /old_locus_tag="AHA_0448"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349225.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_011704421.1"
                     /db_xref="GeneID:4490411"
                     /translation="MHLTPPQPPAEQDVDALRIGLSGYNIGQAGTHLREHIASFIKDE
                     AGKVHGGITADLKWGWLHVDWLWIDERIRQDGWGGRLLATMEQYARSKGISNFHLETT
                     SFQALPFYQKQGYQVFGELPDMPPGHTTYFLRKMES"
     gene            complement(480428..480745)
                     /locus_tag="AHA_RS02255"
                     /old_locus_tag="AHA_0449"
                     /db_xref="GeneID:4490412"
     CDS             complement(480428..480745)
                     /locus_tag="AHA_RS02255"
                     /old_locus_tag="AHA_0449"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704422.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011704422.1"
                     /db_xref="GeneID:4490412"
                     /translation="MKRAIVKARFDAISIEGEQLTVKIAIRAPEPDPKSAGGDWRCKV
                     KLDGLGNKTFIYGVDALQALSLALKFVESELRAFTDAGWHFYLPGCPDHPVDMAACYF
                     PQL"
     gene            481080..481985
                     /locus_tag="AHA_RS02260"
                     /old_locus_tag="AHA_0450"
                     /db_xref="GeneID:4490413"
     CDS             481080..481985
                     /locus_tag="AHA_RS02260"
                     /old_locus_tag="AHA_0450"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704423.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor domain-containing diguanylate cyclase"
                     /protein_id="WP_011704423.1"
                     /db_xref="GeneID:4490413"
                     /translation="MALSVKQLYEVMAQLPDPVFILSEDGYYIEYIGGVEQQSYQDGN
                     PLAGKRLADVLPAAMTRWVMEQVTLALDSGQVQVVEYELAAVEVEGIDASVGPQGMQH
                     FEGKIAPLPSRYDGKRAVAWVTRNITRQYELQQRLKLQSETDQLTGLYNRRYFFEHCR
                     QRRAGEAPCALVMLDIDHFKQINDRFGHQQGDRALQRFCACVAAQLRADDMFVRSGGE
                     EFLILLPGMSEPDLLALAERIRAAVAALPADPAAFTVSLGTTLVRPGEEINQALARAD
                     EWLYRAKRAGRNRVAHCPVATGAQG"
     gene            482444..483718
                     /locus_tag="AHA_RS02265"
                     /old_locus_tag="AHA_0451"
                     /db_xref="GeneID:4490414"
     CDS             482444..483718
                     /locus_tag="AHA_RS02265"
                     /old_locus_tag="AHA_0451"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017787377.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine transporter"
                     /protein_id="WP_011704424.1"
                     /db_xref="GeneID:4490414"
                     /translation="MSVAIAEKSNPASKLKWEKSDSVWTMGLYATAVGAGTLFLPITV
                     GSNSPVILLFILLMAFPLSYYSHRALSRFVLSSSHREGDITHVVEEHFGARAGKLLML
                     VYLMAFYPIILVYSISITNAIQSFVVHQLGNAEIPRGLLVLGVMLGLHLVLLAGKQIV
                     VSAISVLALPMVAFLIGLSIYLLPQWSLSYFSESQGVDWRDPAFWKSLWLIVPVMVFS
                     FSHAPIISSFSAAQKKRCQASADQRAKRIIKCSSLLICGSVLFFVVSCVMSLSQAEMA
                     QARIDNISVLSALANKFSNPLIAYVGPLIAILAMSKSFLGTSMGVSEGTVSMVNGACQ
                     GLGLSLREATIARVSSVILFVVTGVITYLNPNVLEIIEKVSGPLIAVILFLLPACSIY
                     RLPVLKRYRGASTLFVLVIGLLAISALIYDLL"
     gene            complement(483782..484420)
                     /locus_tag="AHA_RS02270"
                     /old_locus_tag="AHA_0452"
                     /db_xref="GeneID:4490415"
     CDS             complement(483782..484420)
                     /locus_tag="AHA_RS02270"
                     /old_locus_tag="AHA_0452"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349228.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exopolysaccharide biosynthesis protein"
                     /protein_id="WP_164927522.1"
                     /db_xref="GeneID:4490415"
                     /translation="MVAAQLNDPQNKLSDTLRATAHAIEESHISLRQMLALVGEQGML
                     LFCVLLTVPFLLPVSIPGVSTPFGLLILFIGIGITLNRVPWLPAILMERRFAAEQLKP
                     TLHKGADLLARIDRFIRPRLLLLTGSSTINRCNGLLIMLAALLLMLPLGAIPFTNAMP
                     AWAILLLAIGMLQRDGLFVASGYLLVSATLIWFSALAIGLLMAGQSVSTLLG"
     gene            484671..485291
                     /locus_tag="AHA_RS02275"
                     /old_locus_tag="AHA_0453"
                     /db_xref="GeneID:4488851"
     CDS             484671..485291
                     /locus_tag="AHA_RS02275"
                     /old_locus_tag="AHA_0453"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017779795.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porin family protein"
                     /protein_id="WP_011704426.1"
                     /db_xref="GeneID:4488851"
                     /translation="MKRAGIMMMGLLLPLGQAWSAEGEAALGWQVTPFFGYSSAIDFE
                     ANDDPKPTPVSTRLESLQGERSGSWGLFISKEVDDPGMIELLYSHQSTRLSPDQPDRL
                     TVDTLHFAGALTLSDNLMAPYIGAGIGATRFAAYDSEVAPSMSLALGVQPRLTEHLAL
                     RAEVRGYGSLVNDNSQFLCNPDQCVFKVRGELVTQWQANIGLTLRF"
     gene            485297..485839
                     /locus_tag="AHA_RS02280"
                     /old_locus_tag="AHA_0455"
                     /db_xref="GeneID:4488852"
     CDS             485297..485839
                     /locus_tag="AHA_RS02280"
                     /old_locus_tag="AHA_0455"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017787380.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_164927782.1"
                     /db_xref="GeneID:4488852"
                     /translation="MHRGALPPLPRTLPSLSTPRLLLRAFDARDSADLFAIYGDPLVM
                     RFVGEPPFPSLATVAQMLASVARLLAAGESLEWGLVARDSGRLIGTCGLHSFAGEAGL
                     RQAEVGCMLARSHWGEGWMAEALTALIVYARQLGIATLLADIEPDNLPSQRLFRRLGF
                     VWQQASCYRLSLEGVTPDHG"
     gene            complement(485820..486125)
                     /locus_tag="AHA_RS02285"
                     /old_locus_tag="AHA_0454"
                     /db_xref="GeneID:4488853"
     CDS             complement(485820..486125)
                     /locus_tag="AHA_RS02285"
                     /old_locus_tag="AHA_0454"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308216.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="monooxygenase"
                     /protein_id="WP_011704428.1"
                     /db_xref="GeneID:4488853"
                     /translation="MPSLLQIHFNFPAEMMGPALTAAAMPLAESITKEPGFISKIWTE
                     NPRTGEAGGIYLFEDETSALAYATMHEQRVLAMGASAVQFKLFDVNEPLSRLTRGLV"
     gene            486247..486612
                     /locus_tag="AHA_RS02290"
                     /old_locus_tag="AHA_0457"
                     /db_xref="GeneID:4488854"
     CDS             486247..486612
                     /locus_tag="AHA_RS02290"
                     /old_locus_tag="AHA_0457"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017764630.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="WP_011704429.1"
                     /db_xref="GeneID:4488854"
                     /translation="MSPLPCPAYRVLRLLAGKWKPAILFHLRAQILRFGDLRRSLPEV
                     SQKVLTAQLKELESDGVIIRTLYPDVPPRVEYSLSPLGIALLPLLQQMHDFALSHGSL
                     LAQSEAGAAREEPHLGEPG"
     gene            complement(486609..487043)
                     /locus_tag="AHA_RS02295"
                     /old_locus_tag="AHA_0456"
                     /db_xref="GeneID:4488855"
     CDS             complement(486609..487043)
                     /locus_tag="AHA_RS02295"
                     /old_locus_tag="AHA_0456"
                     /EC_number="2.3.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017764629.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase"
                     /protein_id="WP_011704430.1"
                     /db_xref="GeneID:4488855"
                     /translation="MQIRPFTPADTEAVLAIWLEASLQAHHFIEPAYWHANLAPMREI
                     YLPAADSQLLCLGEQVLGFYSLHEGTLAALFVAPARQGQGLGKALLEHAKQRLPTLRL
                     QVYQQNRTACDFYRAQGFQVAAGGVDPHTGCAEWVMIWPARD"
     gene            complement(487169..487741)
                     /locus_tag="AHA_RS02300"
                     /old_locus_tag="AHA_0458"
                     /db_xref="GeneID:4488856"
     CDS             complement(487169..487741)
                     /locus_tag="AHA_RS02300"
                     /old_locus_tag="AHA_0458"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349234.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_164927523.1"
                     /db_xref="GeneID:4488856"
                     /translation="MKLLTKTLFTKQSGLVLVLLAASGSLSAAQIANNNITEAEIKAA
                     QDAWGKALIQISDDYRSGGIDKARATATAVLDGAYGYHHGPVLFKPTLAGGEQTFRIN
                     QAGALAYFVGNNQAYPADTGFALKNWQSYNYDNAAVYINGDMALTMGKVHLTDRDNKQ
                     TTVDKTWGFKKGDDGKVRIVLHHSSLPYAG"
     gene            complement(487871..488908)
                     /locus_tag="AHA_RS02305"
                     /old_locus_tag="AHA_0459"
                     /db_xref="GeneID:4488857"
     CDS             complement(487871..488908)
                     /locus_tag="AHA_RS02305"
                     /old_locus_tag="AHA_0459"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017408862.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase family protein"
                     /protein_id="WP_011704432.1"
                     /db_xref="GeneID:4488857"
                     /translation="MRISSIECGRVVAIMAVMAIHLSPFSNPFDPTLWDGTLYFWLGG
                     VINQLCRFAVPLFFLCAGYFLQPALAAGHPLTVALRYCRPLLGLWLAWSLLYVLIPFN
                     PLAAVSEGYLPAMASQWQMQLGDPLNAWWVGGMIHLWFLPALMLAVLILALCQQARLP
                     RLALLLGVLLYGLALLGGSYGPPLLGDEWALLTRNGPFFSLLFVALGAELRLRAWQPD
                     ARRCALLMAAGMGLYALEAAGLLHFAAVPLNRHDFLLGSLPWALGLFGLLLANPGWGR
                     GSWLERQAPKVLGLYCLHMMLVVWLMIFGPQGKQVWWELLKVPALLALSLLGYRLLAL
                     GTASRWLLRAR"
     gene            complement(489085..489705)
                     /locus_tag="AHA_RS02310"
                     /old_locus_tag="AHA_0460"
                     /db_xref="GeneID:4488858"
     CDS             complement(489085..489705)
                     /locus_tag="AHA_RS02310"
                     /old_locus_tag="AHA_0460"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349236.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_164927524.1"
                     /db_xref="GeneID:4488858"
                     /translation="MKRRKLPLHNNKWVRRIHAWAGFATLTLMLLYGLTGLWLQHRAV
                     LPLPGPHTEKSSEEIVLSAPLSSPDELKSLLQQRYPAGFEEGRVQLTPPQTLPTPDSP
                     LTLPARWEMRGVTLSQSVAASYVAGTLLVRTELQQANFASSLNRLHRGMGTGLPWQLV
                     GDLAALAMLLLALTSLLMWNKLHGPAARGIALLLLGALVTVLVALL"
     gene            complement(489771..491813)
                     /locus_tag="AHA_RS02315"
                     /old_locus_tag="AHA_0461"
                     /db_xref="GeneID:4488859"
     CDS             complement(489771..491813)
                     /locus_tag="AHA_RS02315"
                     /old_locus_tag="AHA_0461"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308229.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent siderophore receptor"
                     /protein_id="WP_011704434.1"
                     /db_xref="GeneID:4488859"
                     /translation="MHTPHHPRTLLSVALLALSAGAHAEDETMTVVGKRSQHEEVATA
                     TRTNTPAKLVPQAIDSVKASELTAFGQPTLSEALTGIPGVNASGDTRFDGVNIRGFSA
                     SNDFYLDGFRDDMQYTRDLGNTERVEVLKGPAAVLYGRGSTGGIVNRVSKKPQKGLES
                     SVSAQVGSFDSRRLAADLNGEAGEQVQVRLNLAQEDKDSFRNGVTSKRTLLAPSVNWE
                     ISDKLNWLVQYERNEHDRTPDRGIPGVNGRPADVPKEYVYSDTRRDFIDDVAQSTRSR
                     LTWDINDQWQLRQQLGYTSLDSQFDNTYVTSVKGDQVTRSRWQQDLKANSLISNTEAE
                     GQLQTGPVEHRLLVGFEQNWQERTPKLYQNATAIPAGNLYDPGSLPTYDGAMKLSSDA
                     NHKVRGYGLYVQDQLSLGDWHLLAGLRRDDFTVTSRRNDLNKEETVSVTSLSPRLGLV
                     WNPIEEHAFYASYSKTFTPVGGELIGITPGDKNNNLDPQHTRLYEGGVKSDWLDGRLA
                     TTLSLYRLEMYNKRSKDPLDPTKVILTGLQRTEGIELSARAQLTDELYLRGGIAIQDA
                     EQVKADADLQGKRPMNVSRQNGELFAGYQSGKQGWFGETGVTAVGDRFADNANTTTLP
                     GYARFDARAGYRWQQWETQLSVENLTDHDYFVSATSASQIMPGTPRQLHLSAAYRF"
     gene            complement(492040..492951)
                     /locus_tag="AHA_RS02320"
                     /old_locus_tag="AHA_0462"
                     /db_xref="GeneID:4488860"
     CDS             complement(492040..492951)
                     /locus_tag="AHA_RS02320"
                     /old_locus_tag="AHA_0462"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017764625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011704435.1"
                     /db_xref="GeneID:4488860"
                     /translation="MPLRLLICCCLLCALPVQALTIAMVLWRGETDAERGFRDELNRL
                     GHHPTFVTFNANQDRTVLATLLRQQLLPSLADYDYIYCFGTTATAMVKSLVGNRKPLI
                     FSIVSDPVGAGFLSDDKTENQMVAGTSNMVPMALQLANARRYLPAGKGMLLPFNPREQ
                     NTLLTGELLLREARRYQWELTTWRIAPDKRRLASELKRLQHDAKESIVFLAADSYLLS
                     IAPELLAALNEAGIPTICSAELYVEHGCTVGTISSYRALGQMAANIIHRNLQGTPLQD
                     IPLQTDPAPRLVLGKQLAEIAPSTADH"
     gene            complement(493069..494133)
                     /locus_tag="AHA_RS02325"
                     /old_locus_tag="AHA_0463"
                     /db_xref="GeneID:4488861"
     CDS             complement(493069..494133)
                     /locus_tag="AHA_RS02325"
                     /old_locus_tag="AHA_0463"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005342806.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="WP_016349239.1"
                     /db_xref="GeneID:4488861"
                     /translation="MKKLTVVALALTAAFQAHAVEVYKNDTTTLDLYGRIYAGQFFGD
                     KKEGVDSTHPNGTQEYSDKQGANQFVRFGAKVDSQINSQLKALAQYEVQMYINDSEKT
                     ISENSDNLRTRLAFAGVGADWGNITFGRQKGAPGFLADWTDVSLSDGYGNDALGAKTD
                     TFATNRAGSVLKYSGLFNGFQVDTSYKFDGGDTEETTSKDSDAAYGAAVAYTFPFNLA
                     LGTAYNVGIRDKNGEEDAKLWLLSAKYDNKAVYAALSYADGTDFLATGKDHTGWEGAL
                     GYNFENGFGLMALWNKQKVEQDGKADYDSIDYYTLGAQYKFNKNLRVIGEYRINNLDS
                     KESGKLNVKDDFQLAARYDF"
     gene            494354..495364
                     /gene="glpX"
                     /locus_tag="AHA_RS02330"
                     /old_locus_tag="AHA_0464"
                     /db_xref="GeneID:4488862"
     CDS             494354..495364
                     /gene="glpX"
                     /locus_tag="AHA_RS02330"
                     /old_locus_tag="AHA_0464"
                     /EC_number="3.1.3.11"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349240.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class II fructose-bisphosphatase"
                     /protein_id="WP_011704437.1"
                     /db_xref="GeneID:4488862"
                     /translation="MRRELAIEFSRVTEAAALAGYKWLGRGDKNIADGAAVAAMRHIL
                     NQIQIDGEIVIGEGEIDEAPMLYIGEKVGTGLGDAVDIAVDPIEGTRMTAMGQANALA
                     VLAVGDKGSFLKAPDMYMEKLIVGPKAKGAIDLDEALELNLKAVAKALGKPLSRLTVI
                     TLAKPRHDKAIKEMQGLGVRVFAIPDGDVAASILTCLPDSEVDMLYGIGGAPEGVISA
                     AVIRALDGDMQARLVPRHQVKGDSPEVRALGEQEIARCEALGIDVSKVLKLEDLAKND
                     NVIFSATGITKGDLLDGITSDGVMATTETLLIRGKSRTIRRIKSIHFLDRKDSVVRDI
                     IL"
     gene            495522..495773
                     /locus_tag="AHA_RS02335"
                     /old_locus_tag="AHA_0465"
                     /db_xref="GeneID:4488863"
     CDS             495522..495773
                     /locus_tag="AHA_RS02335"
                     /old_locus_tag="AHA_0465"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017412954.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="proteinase inhibitor"
                     /protein_id="WP_011704438.1"
                     /db_xref="GeneID:4488863"
                     /translation="MECRQGCGACCIAPSISSAIPGMPDGKPAGVPCVQLDARLGCKI
                     FGQPERPAVCGGFRPMQDVCGYHREEAIWLIGELERMTS"
     gene            complement(495930..497093)
                     /locus_tag="AHA_RS02340"
                     /old_locus_tag="AHA_0466"
                     /db_xref="GeneID:4488864"
     CDS             complement(495930..497093)
                     /locus_tag="AHA_RS02340"
                     /old_locus_tag="AHA_0466"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017412953.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011704439.1"
                     /db_xref="GeneID:4488864"
                     /translation="MIRLIVLVAAMVAGLIFGPQASGNKGYVLISLGNYTVESSVTSA
                     VILAVLFYGALLIVEWLLGRVFGLRRKTLGWYGSRRRRKANQQTVAATLAMAEGHYSQ
                     AEKLMLKGASNSDTPLLNYLSAAKAAQARGDDVRRDQYLQKAQEENPKAELALTLTQT
                     QLQIEQGQYDTALAMLESVYALNPRHPMVLDQLRQVHLAREDWAALIDLIPVLHKVGK
                     LTPKQEEDLLQQAWRGRLDAASGALETLRPIWQELPRKLRQDPDLLAAYGDRLRQLGA
                     DNEAAELWLDALRKQVSPQLLARLPKLKLDSYQPMLTLLQKIQDQPGVDAALAQVYLL
                     AGQLDDAQRLLEQEVAKAPNAAVYHALGQVMDKRRLTNKANEYYRQALQLADV"
     gene            complement(497104..498180)
                     /locus_tag="AHA_RS02345"
                     /old_locus_tag="AHA_0467"
                     /db_xref="GeneID:4488885"
     CDS             complement(497104..498180)
                     /locus_tag="AHA_RS02345"
                     /old_locus_tag="AHA_0467"
                     /EC_number="2.1.1.107"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005316199.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heme biosynthesis operon protein HemX"
                     /protein_id="WP_011704440.1"
                     /db_xref="GeneID:4488885"
                     /translation="MTEQQEVQPSAAASVADNKQPGQKVANNKKGSSGAVVGGIAILL
                     ALGLTGGLYLHGHKSAVAQQGELNQLKLQLAEAMNKLDQSNSKDGEQLAALGKQQQLL
                     QDELKGLQTRVLDLNDKRPNDWMLAESEYLVRMAGRKLWLEHDLVSAITLLGNADERI
                     KALNDPSLMPIRKALAEDIAQLKGMPRIDREGLTLKLAALSDQIELLPLSTVSMPEAK
                     SEPDQAVSTNPDEWESNLKKNWVKFTENFITIRRRDGAVEALLSPQQEIFLRENLKTK
                     LLQAQLAVYREQQALYDDSLDKAQRWLTQYFDTDNSATHYMQSELDKLKGEQIQFNYP
                     DRFKTQAMLEEVLTERLQRILASN"
     gene            complement(498177..498911)
                     /locus_tag="AHA_RS02350"
                     /old_locus_tag="AHA_0468"
                     /db_xref="GeneID:4488886"
     CDS             complement(498177..498911)
                     /locus_tag="AHA_RS02350"
                     /old_locus_tag="AHA_0468"
                     /EC_number="4.2.1.75"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005342818.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen-III synthase"
                     /protein_id="WP_011704441.1"
                     /db_xref="GeneID:4488886"
                     /translation="MIPLVVRPAAQAAELAALLRQHGHAPLCCPLLETVAGSELHRLP
                     ELLPQADIVIAVSVHAVNFTHHFLLQTGQTWPNIDYFAVGQASADAFSEVGIQALSPD
                     DPRSEGLLALPSLQQVNGKQVLILRGNGGRDLIARTLASRGALVHYCAAYERHYPALD
                     GDALTCHWQAAGLDSLLVTSGELLQRLLELVPDQQLPWLHDRLLVVPSPRVAEMAAAA
                     GFTHITIAQGASNQALTAALELRKME"
     gene            complement(498908..499837)
                     /gene="hemC"
                     /locus_tag="AHA_RS02355"
                     /old_locus_tag="AHA_0469"
                     /db_xref="GeneID:4488887"
     CDS             complement(498908..499837)
                     /gene="hemC"
                     /locus_tag="AHA_RS02355"
                     /old_locus_tag="AHA_0469"
                     /EC_number="2.5.1.61"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010672695.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxymethylbilane synthase"
                     /protein_id="WP_016349245.1"
                     /db_xref="GeneID:4488887"
                     /translation="MAARTLKIATRKSPLALWQANFVKDRLEALYPELQVELVPMSTQ
                     GDKILDTPLAKVGGKGLFVKELETAMLEGRADIAVHSMKDVPVEFPEGLGLHTICERE
                     DPRDAFVSNRFGQIDELPQGAVVGTSSLRRQCQLRAARPDLVIRDLRGNVNTRLAKLD
                     AGEYDAIILAAAGLKRLEMAHRITAFIEPEQSLPANGQGAVGIECRLDDHELHALLAP
                     LEHPETRIRVLTERAMNRALQGGCQVPIGAYALVQGEEVWLRGLVGSPDGSRVIRDEI
                     RGPLADGEALGHTLAQRLLADGADVILAEVYRA"
     gene            500161..502695
                     /locus_tag="AHA_RS02360"
                     /old_locus_tag="AHA_0470"
                     /db_xref="GeneID:4488888"
     CDS             500161..502695
                     /locus_tag="AHA_RS02360"
                     /old_locus_tag="AHA_0470"
                     /EC_number="4.6.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017408871.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class I adenylate cyclase"
                     /protein_id="WP_011704443.1"
                     /db_xref="GeneID:4488888"
                     /translation="MLVKLDTLVARYDELNRLKTQRALGLMSRYGQQVFQLLPVMLHF
                     NHPLLPGYVAGDVPHGIWSFTANDAQQAFIEDLCQNANCLNGLTTHDKSIQGLYSMGS
                     TSSIGQCCHSDLDIWVCHVAGLSQERLELLDLKCQQLSKWAEQRGVDLNFFLIPEDKF
                     RQRNDAQMQGESCGSAQHLLLLDEFYRSAMLIAGKRLLWYLVPSEYDDHYDDYVNGLF
                     AHGKLSQDDWLDLGGFNRIPAEEYFGSALWQLYKGIDSPYKAVLKSVLMEAYSHEYPN
                     TRLLSVTSRDWFQHNEGMHYRLDNYCLMLDKVTNYLKSIGDMQRLDLVRRCFYLKVCD
                     GLSHPKEEHSPAWRREQMTQLVSYWGWSQERLHHLDHRQEWKVEDVKVAHAELLEALM
                     QSYRNLIQFARRNNISESINPEDIGILSRKLYAAFESLPGKVQRINLKIAPDLSEPDL
                     SFVQVPHGRLNRAGWYLYKHSLEPADIIGRAPLEYNGYISKLVSWAYFNGLLTPQSRV
                     HLFNQGSDLHIDNLHQFCRDLSGTFPVKYPRATNLALSRPCEIRQLSIFLNLETDPTS
                     HWVGQVIEFDANAADVFSFGRNQECLVGSVDLVYRNSWSEIRTLHFQGDEAVVDALTT
                     ILGKMHQDAAAPEMIEVFCYSQHFRSLVRTRFQQLVAECIELRLARDKQQLVKTLALG
                     KEKYGIFFERRGVSVKKLENAVDFYRHISHNKLDHLPLRLDKTHSQHLPGIVDAYASE
                     GLVQFFFDTRDAGTNIYILDEANRVEIYQHFAGNKDELVQGVNRFYTSSHERFSDAGQ
                     FSNFNLPQYYEIVQINGELEVIPYRSQGQLRDGGQGRELGSAAGAG"
     gene            complement(502819..503472)
                     /locus_tag="AHA_RS02365"
                     /old_locus_tag="AHA_0471"
                     /db_xref="GeneID:4488889"
     CDS             complement(502819..503472)
                     /locus_tag="AHA_RS02365"
                     /old_locus_tag="AHA_0471"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017408872.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta fold hydrolase"
                     /protein_id="WP_164927783.1"
                     /db_xref="GeneID:4488889"
                     /translation="MIDLHPEGARHAVIWLHGLGDSGAGLAPLVDALALPADLPVRHL
                     LPDAPERAITINMGYKMRGWYDIKSFDNPADRAVESHVRESAAHIAALIEQLVAEGFA
                     PERIVLAGFSQGGVIASFTALRLPQQLAGLLCMSTYLAAPDALLGEMSEAARSLPICY
                     MHGIYDDVVSLSMGWDAKNRLEAAGLSPEWHEYPMRHEICRPQLDDIRQWLLARLAG"
     gene            complement(503487..503801)
                     /gene="cyaY"
                     /locus_tag="AHA_RS02370"
                     /old_locus_tag="AHA_0472"
                     /db_xref="GeneID:4488890"
     CDS             complement(503487..503801)
                     /gene="cyaY"
                     /locus_tag="AHA_RS02370"
                     /old_locus_tag="AHA_0472"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019444859.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron donor protein CyaY"
                     /protein_id="WP_011704445.1"
                     /db_xref="GeneID:4488890"
                     /translation="MKDHEYHALTDAFFQYVEDTVDAGYPDIDCERAGGVLTLSFENK
                     TKVIINKQEPLHQIWVATRENGFHFELQGESWIDNRFGHELKTLLSKACTTQAGEPVQ
                     FP"
     gene            503875..504051
                     /locus_tag="AHA_RS02375"
                     /db_xref="GeneID:44141869"
     CDS             503875..504051
                     /locus_tag="AHA_RS02375"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017408874.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="WP_115586400.1"
                     /db_xref="GeneID:44141869"
                     /translation="MITQLTKCLLATLLSIGLAACGLTGPLYMPPPEQPQTQSTPQAQ
                     TPATAEAAPEAAPQ"
     gene            504072..505322
                     /gene="lysA"
                     /locus_tag="AHA_RS02380"
                     /old_locus_tag="AHA_0473"
                     /db_xref="GeneID:4488891"
     CDS             504072..505322
                     /gene="lysA"
                     /locus_tag="AHA_RS02380"
                     /old_locus_tag="AHA_0473"
                     /EC_number="4.1.1.20"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017412137.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diaminopimelate decarboxylase"
                     /protein_id="WP_011704446.1"
                     /db_xref="GeneID:4488891"
                     /translation="MDHFNYDADGQLQAEHTSLQQLAEQYGTPLYVYSRATLERHWHA
                     FDKAAGDIPHLICYAVKANSNLALLNLLARLGSGFDIVSGGELSRVLAAGGDPAKVVF
                     SGVAKSEAEMRLALDKEILCFNLESEAELERLNRVAGGMGKKARVSVRVNPDIDAGTH
                     PYISTGLKQNKFGIPIEQAPAIYRKAAAMANIEIVGVDCHIGSQLTELNPFMEAADKL
                     LRLIDGLAVEGIHIHHLDVGGGLGVNYGAEQPPHPSEYAEALKQKLAGRDLTLLFEPG
                     RAIVANAGVLLTRVEYLKPGETRNFALIDAGMNDLLRPSLYGAWMNIIEVDSRTAHEP
                     ALYDVVGPVCETGDFLGKERTLAIAEGSLLAVRSAGAYGFTMSSNYNTRPRAAEVLVD
                     GAQSFLIREREQLADLWRGEHLLP"
     gene            505388..506218
                     /gene="dapF"
                     /locus_tag="AHA_RS02385"
                     /old_locus_tag="AHA_0474"
                     /db_xref="GeneID:4488892"
     CDS             505388..506218
                     /gene="dapF"
                     /locus_tag="AHA_RS02385"
                     /old_locus_tag="AHA_0474"
                     /EC_number="5.1.1.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017412136.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diaminopimelate epimerase"
                     /protein_id="WP_011704447.1"
                     /db_xref="GeneID:4488892"
                     /translation="MLIDFSKMHGLGNDFMVVDGVTQKVFFSNEVIKKLADRHFGIGF
                     DQLLLVEPPYDPELDFHYRIFNADGSEVEQCGNGARCFARFVRLKGLINRDRIAVSTA
                     RGRIVLQLEGENQVTVNMGVPQFEPGKIPFRAQKAEKTYLLRAQEHTVMCGAVSMGNP
                     HCVIEVPSVADAPVATLGPIMERHERFPERVNVGFMEMVNASEIKLRVFERGVGETLA
                     CGTGACAAVVVGISQGKLKERVTVTLPGGKLTIAWKGPGQPVYMTGPAEHVFDGQIEL
                     "
     gene            506299..506979
                     /locus_tag="AHA_RS02390"
                     /old_locus_tag="AHA_0475"
                     /db_xref="GeneID:4488893"
     CDS             506299..506979
                     /locus_tag="AHA_RS02390"
                     /old_locus_tag="AHA_0475"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005316158.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF484 family protein"
                     /protein_id="WP_016349251.1"
                     /db_xref="GeneID:4488893"
                     /translation="MSELKRQEPLVDEATVLEYLARYPEFFQRHAAMLDRIRIPHERK
                     GTVSLVERQLDRQRERIEQLEQEITELMGIASENERIFRVYADLYGELYGCQSLFEVS
                     AVMGKAFVQRLRLTGLRLWLSPKKFQLSGPEQKFMAEGRQLEQLLGQRLPGQDYYFGR
                     LNQSEKQALFGHDVLVNSVALMRLGDLGVLAFASSDPSHFTPHNDTLLLGQLGRLLQL
                     RLPELARG"
     gene            506972..507949
                     /gene="xerC"
                     /locus_tag="AHA_RS02395"
                     /old_locus_tag="AHA_0476"
                     /db_xref="GeneID:4488894"
     CDS             506972..507949
                     /gene="xerC"
                     /locus_tag="AHA_RS02395"
                     /old_locus_tag="AHA_0476"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017787393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine recombinase XerC"
                     /protein_id="WP_011704449.1"
                     /db_xref="GeneID:4488894"
                     /translation="MAKTPARSPAKAPPAAEPLPAALADELAGFIEYLRVERQLSPHT
                     RSNYQAHLEAMTAELVKLGVDDWARLEASQVRSLVTRMHKAGLAPRSLATKVSALRSF
                     CDWQVRQGRLVANPARGIVTPKQGRPLPKNLDVDEMYQLLNITDEQDPLAVRDRAIME
                     LMYSSGLRLAELVGLNLADVKLDERQLRVTGKGSRERVLPVGRMAVEWLHKWLKLRPL
                     LAGDELEALFVSKRKQRLSARSVQERLDGWGNKQALNAHVHPHKLRHSFATHMLESSG
                     DLRAVQELLGHADLSTTQIYTHLDFQHLAKVYDSAHPRAKRDPATPDDE"
     gene            507990..508700
                     /locus_tag="AHA_RS02400"
                     /old_locus_tag="AHA_0477"
                     /db_xref="GeneID:4488895"
     CDS             507990..508700
                     /locus_tag="AHA_RS02400"
                     /old_locus_tag="AHA_0477"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308262.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAD-IA family hydrolase"
                     /protein_id="WP_011704450.1"
                     /db_xref="GeneID:4488895"
                     /translation="MQFYRRWQPVAAISFDLDDTLYDNGPAIERAEQWMLSHLRSEYL
                     ATAMLDKPRWQALKHNLLLEQPALRHDVSLARRHGIQAALMAGGMAQGLAEREAASVF
                     AGFLAERSKIEVSDETHALLARLAERYPLVVITNGNLDLTRAGLADYFTLVCKAGLGS
                     RMKPAPDMFVEAQRALKLAPGQILHVGDHPQTDVLGARLHGFKAAWLNERGQPWRELQ
                     LLPDVELTALGELAELLL"
     gene            complement(508799..509200)
                     /locus_tag="AHA_RS02405"
                     /old_locus_tag="AHA_0478"
                     /db_xref="GeneID:4488896"
     CDS             complement(508799..509200)
                     /locus_tag="AHA_RS02405"
                     /old_locus_tag="AHA_0478"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017787395.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_164927525.1"
                     /db_xref="GeneID:4488896"
                     /translation="MLLTALALSATLQFDCPATIETRQQLLGASPGWQAVTRNDMGEQ
                     HQPLSHRLDNLALFDGDPDERAQLKPDNGDSDALHYWSLDRRNPRPFYLVCHYRETAI
                     TLQQALPTGISYCRVNQPDPYQLRGLICRNE"
     gene            complement(509242..510768)
                     /locus_tag="AHA_RS02410"
                     /old_locus_tag="AHA_0479"
                     /db_xref="GeneID:4488897"
     CDS             complement(509242..510768)
                     /locus_tag="AHA_RS02410"
                     /old_locus_tag="AHA_0479"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010635303.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mechanosensitive ion channel"
                     /protein_id="WP_011704452.1"
                     /db_xref="GeneID:4488897"
                     /translation="MFSDNLVALPTLLWIGEHPFWTLLTLFLLFTHFLRSPGRRRELV
                     SELGFVMISLVVILLIQFEGGWFRLPLPHRWLVEISSLLAGLVLVKIWGILLFQFLLP
                     LCQIRIPRIIADIVITVGYIGWCLFRLYASGMALGEIVTTSAVITAVIAFSMQDTLGN
                     LLAGVSIQLDNSIAIGDWLQVETTQGRVVEINWRATTIETRNWETVVIPNSHLLKQRF
                     TVLGRRQNAPLQWRRWVWFDITLDTLPTQIIALVEQSLRETRIRHVSASPQPDCLLMN
                     VENGIARYAVRYWLTDLAVDDPTDSAVRTLIDAALRRNDRRLTPPIFNVFMTTDQDHK
                     DQRHKRHTAERTDTLRRLPLFAMLQEEELLRLADQVKFAPFVNGDRMLSQGEVSGWLF
                     VLVKGDAQMLVEVEGRELPLGTLNAGDFFGELSLLTGEPSPFTVRALGTVETYRINQA
                     MFQELVAQRGSLLEPLYKVLSARQQEQQELLAREAEAMKQITPPRDLLDKLMALFGGR
                     "
     gene            510902..511297
                     /locus_tag="AHA_RS02415"
                     /old_locus_tag="AHA_0480"
                     /db_xref="GeneID:4488898"
     CDS             510902..511297
                     /locus_tag="AHA_RS02415"
                     /old_locus_tag="AHA_0480"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005342835.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_161772480.1"
                     /db_xref="GeneID:4488898"
                     /translation="MVWIAGAWLLTGCDQLADKYRVEFRDGSWREIAITPFADEARWR
                     EGCATGEVLSDMMLPLKRGKTVNGREQLLIGGELFELDDSALYRSNGMVFGHTPDHIQ
                     RGLKGLEVCRTLRPDRGALPKLKARGFGD"
     gene            complement(511307..512077)
                     /locus_tag="AHA_RS02420"
                     /old_locus_tag="AHA_0481"
                     /db_xref="GeneID:4488899"
     CDS             complement(511307..512077)
                     /locus_tag="AHA_RS02420"
                     /old_locus_tag="AHA_0481"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017783689.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gamma-glutamyl-gamma-aminobutyrate hydrolase
                     family protein"
                     /protein_id="WP_011704454.1"
                     /db_xref="GeneID:4488899"
                     /translation="MTRSPHTPRKPVVLMTTGAQPRNGHAYQVMTHKYIKPLVEISGC
                     VPLLVPTCCGTEDLAQYLDLADGVYLSGAGSNIDPALYGQENLTPEKQQDRDRDLFDI
                     PLVRAALDRGLPILGICRGMQEINVALGGDIHQKVYSEPGYDDHREDADDPVDDQYGE
                     SHQVELVPGSWLAELMGQPSIPVNSLHGQGIKTLAKGLEPLAHAEDGLIEAIHAPTLS
                     PFLLAVQWHPEWKASENPHSIKIFEAFGDACRARLSGL"
     gene            complement(512439..513248)
                     /gene="yidA"
                     /locus_tag="AHA_RS02425"
                     /old_locus_tag="AHA_0482"
                     /db_xref="GeneID:4488900"
     CDS             complement(512439..513248)
                     /gene="yidA"
                     /locus_tag="AHA_RS02425"
                     /old_locus_tag="AHA_0482"
                     /EC_number="3.1.3.23"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005316137.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar-phosphatase"
                     /protein_id="WP_011704455.1"
                     /db_xref="GeneID:4488900"
                     /translation="MYKLIALDMDGTLLNSQGQISPRTHAAIAAARAKGVTVVLASGR
                     PLEGMSRYLVELGLTGQDDYVICYNGALVQQVADQRIIRSQLLTGSDASAIAALADEL
                     GVNVHGFSVSRGLISPRVSPYTEHESRLIDMPIKLLDFATLPADEQILKVMMIDPEPL
                     LSPAIAKLPAELYQRYTVVRSAPYFLEFMNKQSNKGTGVAALAEHLGLDASQVIAVGD
                     AGNDHHMIEYAGLGVAMGNATDDIKALAQHTTGRNDEDGVAQVIERFILNA"
     gene            complement(513353..514987)
                     /locus_tag="AHA_RS02430"
                     /old_locus_tag="AHA_0483"
                     /db_xref="GeneID:4488901"
     CDS             complement(513353..514987)
                     /locus_tag="AHA_RS02430"
                     /old_locus_tag="AHA_0483"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF342 domain-containing protein"
                     /protein_id="WP_016349258.1"
                     /db_xref="GeneID:4488901"
                     /translation="MEYACLRIVPGLTNPISESDIQTLLLASNCRRYQPLTEGIKQAI
                     SLLNTLLSNPTAPLPGNPVPIAQRHDASVLLVVEKDRMSATAQITADWGGKYLTSEQL
                     EQAIQSSEISQGVQAPLIAAAVLAAKEATPGTLLRLPVAQGKAAVNGQDTRFERLVET
                     PAERILKPQELDHGRVDMRDLGTILTVKAGAQLMRRHPATQGVPGFTVTGQELPAKHG
                     KDSPMVAGEGTFLSPDDPDLLLASRPGLPRQEKNGMKVDDVLSVKQVDIRHGHVIFEG
                     ALIVAGDVTPGMKIKTSGDVVIGGFVEGGYIESSGTITVRNGIIGRKSEQSDEFLCHL
                     NAQGEIHASYAQYAKLEAGGDIHILTQLSHCYSRSGQDLKVGDSGMRKGHLLGGISIA
                     NRLIMAPILGASAHNQTRLQILGGYFTHKEQEQALRQRKQECREQLDKLQDLLLKLLQ
                     LPSDKRNPQTLQKIKLIRTQRLEESKLLDEQLEAAQEELQKLMAEMDIIATQHAFPGV
                     EVEMAHHHYRVDIEHGPIHFAIREDQLQLTPYEPHK"
     gene            515318..516283
                     /locus_tag="AHA_RS02435"
                     /old_locus_tag="AHA_0484"
                     /db_xref="GeneID:4488902"
     CDS             515318..516283
                     /locus_tag="AHA_RS02435"
                     /old_locus_tag="AHA_0484"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349259.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HlyD family efflux transporter periplasmic
                     adaptor subunit"
                     /protein_id="WP_164927526.1"
                     /db_xref="GeneID:4488902"
                     /translation="MRHCLLPLALTGLLSACQPQASTTALGTLERDRVLLTATAGEII
                     RALPVAEGSRVEEGTLLARLDDRRQQAVLARARAQQAQARAVLARLTNGERPEDIAAA
                     RASLDKAQANVRESERNFERIDRLVRRKLVSPADLDKARAQRDSALAEQDGARQQLDK
                     LARGVRREDIDEAQAALLAATAEVALAERELADLSIVATRSGRLDSLPYHLGERVAVG
                     AVLAAIQADEAPYARVYVPEPSLAGYRVGQPVRVQVDGVAEPFTGRLRWISKEPAFTP
                     YYALNEQDRARLVYLAEIDLPAGAQDLPSGLPLQAEPAAQGEGHE"
     gene            516276..517205
                     /locus_tag="AHA_RS02440"
                     /old_locus_tag="AHA_0485"
                     /db_xref="GeneID:4488903"
     CDS             516276..517205
                     /locus_tag="AHA_RS02440"
                     /old_locus_tag="AHA_0485"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017786035.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_011704458.1"
                     /db_xref="GeneID:4488903"
                     /translation="MSELAIRALGVSRRFGDFLAVDGLDLCVPKGQIHGFLGPNGCGK
                     STTLRMLTGLLTPSAGEVEVLGLHIPREAETLRRRIGYMTQKFSLYDELTAWENLEFM
                     GRIHGMGGTVLAARLHELLATYELAPLARQRAGAMSGGQKQRLALAAAVIHRPALLLL
                     DEPTSAVDPQNRRDFWEKLFDLSEGGTTILVTTHYMDEAERCHQLAIMEAGRVRAQGA
                     PQALMDAMSTRVVEVLAADLRLLKQQLVQLAPVRSAAQLGQRLRVLVDKELAEPVAWL
                     QQACPALAGASLALVRPSLEDVFVSCTGQEPRA"
     gene            517312..518406
                     /locus_tag="AHA_RS02445"
                     /old_locus_tag="AHA_0486"
                     /db_xref="GeneID:4490068"
     CDS             517312..518406
                     /locus_tag="AHA_RS02445"
                     /old_locus_tag="AHA_0486"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349262.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_011704459.1"
                     /db_xref="GeneID:4490068"
                     /translation="MNSLRRLWAITQKELRQLARDRLTFGMVVMIPLIQLLLFGYAIN
                     TDVRQIPVGLVEMSQSVPGRLLVEAVKASQVVHIKQQYVGVQQAEAALTRGEVRAVLV
                     LPADLSRRLSAGETAGQWLVDGSDTMIAGALLGLRNMPLSDLKPDLKTAPPTFETVLY
                     FNPARRSAVNIVPGLLGVILTMTMIMFTSAAIVRERERGNLELLITTPVGSMELMLGK
                     ILPYIGVGLIQVAIILGLGHFIFDVPINGALSQVLLATLLFIAASLTLGLLISTLAQT
                     QLQAMQMTVFILLPSILLSGFMFPYEGMPLPAQWIAEVLPATHFMRLIRGIVLRGGEL
                     SELLPDVLWLAGFTLLVLTLAAHRFKKSLD"
     gene            complement(518484..519641)
                     /locus_tag="AHA_RS02450"
                     /old_locus_tag="AHA_0487"
                     /db_xref="GeneID:4490069"
     CDS             complement(518484..519641)
                     /locus_tag="AHA_RS02450"
                     /old_locus_tag="AHA_0487"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010635296.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CinA family nicotinamide mononucleotide
                     deamidase-related protein"
                     /protein_id="WP_011704460.1"
                     /db_xref="GeneID:4490069"
                     /translation="MRIEIISTGDEIVTGLVVDTNAAWLSALLLEQGWQVRRRVTVGD
                     NLKDLKTVLAESASRAEVVLVCGGLGPTADDLTAQAAAEAFDQPLTLFPDWLATIEAR
                     YASRGRPMPASNAKQAWLPQGGEILDNPVGTACGFVVTHTGHQGPSLLFFTPGVPFEF
                     KQMVREQIMPRLKALAGAQTDTELRRFYTFGVSESALSDMLDAAPWPAGIELGYRSSM
                     PLIELKLIGHGASAADMDAAEARLLAAIEPWLVGRGDKEPAQQILDLLGDKPLTLLEG
                     ESRGALLAMCHPHPALTASFSHALASELAQLAAPAAPLSLTIGRAGPDGVPLLLCVDG
                     QLYGQTLKVSHPDPDSGRRIIAFAALDMLRRQLQGLPVLGDYRTLARTASR"
     gene            complement(519702..520940)
                     /locus_tag="AHA_RS02455"
                     /old_locus_tag="AHA_0488"
                     /db_xref="GeneID:4490070"
     CDS             complement(519702..520940)
                     /locus_tag="AHA_RS02455"
                     /old_locus_tag="AHA_0488"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005316119.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3391 domain-containing protein"
                     /protein_id="WP_016349264.1"
                     /db_xref="GeneID:4490070"
                     /translation="MTGIKISVDRLQVGNYVSLPLGWREHPFLFSSFKLKNEEEIELI
                     RRLGLKLVTIIPDKSDAPPKPLNQIQAQPVEAPDTSQRQAEMQLEKERRIEQLQQYRR
                     DLQQCEKQFQQSLAQVRNVMSKIQSRPLNAIGEAQELINAMTEQLLSVDEMVLHLVSD
                     SEDGNNLYFHSLNVSVLSMLLAKECNMSADEIRQVGMGALFHDIGKLKIPSQILRKTE
                     PLTKPEQNLMAQHPRYGLDLLNLAKDFPAEAKGIVLHHHEYLDGSGPEGLKKGQLDPL
                     TQIVSLINEYDNLCHMQAKVPYSALSGLYKQRKAQFNPEYLSMLIRLMGIYPPGSVVQ
                     LSNGQVGLVMSVNASRLLYPSVLVYDPRIPRQEAAIIDLQQAELSIAKVIHPKRLPPA
                     VFEYLNPRTRISYYFEHTKP"
     gene            521085..522038
                     /gene="metA"
                     /locus_tag="AHA_RS02460"
                     /old_locus_tag="AHA_0489"
                     /db_xref="GeneID:4490071"
     CDS             521085..522038
                     /gene="metA"
                     /locus_tag="AHA_RS02460"
                     /old_locus_tag="AHA_0489"
                     /EC_number="2.3.1.46"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704462.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine O-succinyltransferase"
                     /protein_id="WP_011704462.1"
                     /db_xref="GeneID:4490071"
                     /translation="MPIKIPDQLPAAEVLGQENIFVMTESRAVTQNIRPLRVLILNLM
                     PKKIETEIQLMRMLSNSPLQVDVDLLRIDDRESKNTPQAHLENFYHDFEQVRGNNYDG
                     MIITGAPLGLVEFEEVVYWPRIVEIIEWSHQHVTSTLFLCWAVQAALKALYGMEKQTH
                     GEKLSGVYRHHRLDEHEPLLRGFDDEFVAPHSRYAAFDGDLIRAHTDLQIFAESAEAG
                     VYLAATKDCRQVFVTGHPEYDALTLDGEYQRDLAAGLEPVIPVNYYPDNDPTRTPRAS
                     WRSHGHLLFSNWLNYYVYQLTSYRVEDIGKVFTYQQNSPSR"
     gene            complement(522047..522553)
                     /locus_tag="AHA_RS02465"
                     /old_locus_tag="AHA_0490"
                     /db_xref="GeneID:4490072"
     CDS             complement(522047..522553)
                     /locus_tag="AHA_RS02465"
                     /old_locus_tag="AHA_0490"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005336003.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein tyrosine phosphatase"
                     /protein_id="WP_164927527.1"
                     /db_xref="GeneID:4490072"
                     /translation="MHPSHPFWSQEVPRVDGQLLLTPCPGTQQVALPLALGQLKLAGA
                     HGVLTLMTDAELARLELGRLGQQIEAAGMRWFQLPIEDDQAPDAAFEAAWQQTLPDLI
                     GLLRDGKHLVIHCKGGSGRTGLVAAALLMSLGQPQQEAMAAIRAHRPKAFTLACHRQW
                     LDGLAEGD"
     gene            522713..523183
                     /locus_tag="AHA_RS02470"
                     /old_locus_tag="AHA_0491"
                     /db_xref="GeneID:4490073"
     CDS             522713..523183
                     /locus_tag="AHA_RS02470"
                     /old_locus_tag="AHA_0491"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308292.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Lrp/AsnC family transcriptional regulator"
                     /protein_id="WP_011704464.1"
                     /db_xref="GeneID:4490073"
                     /translation="MRNLDQLDLDILAHLFRDAGMTNKDLAALVGVAPSTCLERVRKL
                     QQDGVLKGAHCEVDYQALGGHIQAMVSLQLARHSRQIIDAFRDAILALPEVISLFHMG
                     GKDDFLVHLCVADTEHLRNFVFDHFTSREEVVHLETSLVFEHKFSRSLPCFLNT"
     gene            complement(523241..525205)
                     /locus_tag="AHA_RS02475"
                     /old_locus_tag="AHA_0492"
                     /db_xref="GeneID:4490074"
     CDS             complement(523241..525205)
                     /locus_tag="AHA_RS02475"
                     /old_locus_tag="AHA_0492"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005316107.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LTA synthase family protein"
                     /protein_id="WP_011704465.1"
                     /db_xref="GeneID:4490074"
                     /translation="MTTIRRWLGPFWPIAVFSLIALVSLSISRLALGLWQLERVDAVA
                     GWQEMLLQGLRVDFATLCWLWGVPAVFTLLLAGPHAVGRAWLQFIRVWLTLGLWLLLF
                     LEISTPSFVTEYGVRPNRLYIEYLIYPKEVFAMLWAGRKGELLLALLFSGAVLAGGWW
                     LSGRLLRGISFPRWYWRPAFALLILAIGFLGARSSLGHRALNPAMVAFASDPLVNALT
                     VNSSYSLFFAIKQMRAEEDASQFYGELPRQRILDLVRQESGRESHEFSSDTLPSQTFN
                     EASYGGKPKNLVILLQESLGAQFVGSLGGLPLTPNIDALSKEGWAFEQLYATGTRSVR
                     GIEAVLTGFTPTPAQAVVKLGRSQTNFFTIADLLKQRGYDTSFIYGGESHFDNMRSFF
                     LGNGFTTIVEQKDFKNPVFEGSWGASDEDLMAKADETFQALSKQGKPFFSLVFSSSNH
                     DPFEFPDDRIALYEQPKQTRNNAAKYADYAIGEFFKKAKQSDYWKDTLFLVIADHDSR
                     VSGASLVPIPRFHIPGVIVGDGIAPRQDPRIVSQIDMAPTLLSLMGISADYPMLGKDL
                     TRMPADWPGRAIMQYDKNFALMRGKDVVILQPERAPEGFIYEDATETLTPAPQPATMK
                     DAALGLALWGSLAYQQGLYRTAPDTRTVLN"
     gene            525465..525722
                     /locus_tag="AHA_RS02480"
                     /old_locus_tag="AHA_0493"
                     /db_xref="GeneID:4490075"
     CDS             525465..525722
                     /locus_tag="AHA_RS02480"
                     /old_locus_tag="AHA_0493"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005316103.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2442 domain-containing protein"
                     /protein_id="WP_011704466.1"
                     /db_xref="GeneID:4490075"
                     /translation="MPVFIDVEYLQGWSLFVVLSDGTTGALDLTPWRTQPLFAALDSE
                     RRCARVFINRHHQLEWPAGCILSAHEVYHLIKPIDEREAFS"
     gene            525968..527935
                     /locus_tag="AHA_RS02485"
                     /old_locus_tag="AHA_0494"
                     /db_xref="GeneID:4490076"
     CDS             525968..527935
                     /locus_tag="AHA_RS02485"
                     /old_locus_tag="AHA_0494"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308298.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent copper receptor"
                     /protein_id="WP_011704467.1"
                     /db_xref="GeneID:4490076"
                     /translation="MACHMRTPLALLVGGFACHGAAGQEPVQQLEPMVVVASRPASTL
                     EVTLDPKKPGSPMPAADGAGYLKNVTGMSMVRKGGLGGDPVLRGMGMSRLNVQMDGGM
                     LAGGCGGRMDPPTAYVFPQSFDRIRVLKGPQSLEQGATLAGTVLFERDRPEFTAPGVK
                     AEASALYGSFGRDDQMLDATVGAPQGYLRGQFTHSDSDDYRDGHGDKVRSFYRRENGT
                     AQLGWTPSEHTWLELTAERSNARAAYADRTMDGPMFDRESFGLKLRQEQISRHWQRSE
                     LTLWDNDIDHIMDNFSLRPNSGMKMLSNPDRRNTGGRWANDIALPADWLLTAGFDANR
                     DQHRARSGVDYASQPRQRTLRFEQQGGFAELGRQQGAHSYKGGYRQDRVETTRYGAGD
                     QTLYSDTLTLDSGFGRYEYQWSPAWSSYLAWGQAKRAPDYWERSKDSVPFTLNPERSR
                     QWDAGLALRSRELDLTLSLFSADIQDYLLYNNKSNKVRNIDAQTRGGELEGRWQFAEQ
                     WRLDGGLAVVYGENRSDHQPLAQMPPLDGKLALGWQPAEAWNLTLLGRAVAAQERVDV
                     GSGTVAGQDQGETPGFFTMNLSAAWQFQPGWQLSAGVDNLFDTFYYEHLSKSVHASQA
                     GLGYEQVGRIPEPGRAYWLSVSYRFASAGVL"
     gene            528059..529678
                     /locus_tag="AHA_RS02490"
                     /old_locus_tag="AHA_0495"
                     /db_xref="GeneID:4490077"
     CDS             528059..529678
                     /locus_tag="AHA_RS02490"
                     /old_locus_tag="AHA_0495"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005316097.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosidase"
                     /protein_id="WP_162517796.1"
                     /db_xref="GeneID:4490077"
                     /translation="MKQGTLRHGGLIGAALLLTACGSGGGSGSSEPQQPPVTNPPPAT
                     ASRACYGNDQPACNLRTYQVMVESFVDGDGSANYGVGYGPSQHNGDLQGIIDSLDHIK
                     SLNVNAIWLTPVFDSCAGQGGDDKLDATGYFACDFFNVDPNFGSNVQLKQLVDGAHQR
                     GLYVFLDGVFGHVNKVGVSKPSPEGRLPALKSGGAGYPGQLVDYSQPQSLAYFKEVAR
                     YWVEQYGIDGWRLDQAYQLGLDDWRAIRSEVERASAARKTAGQQWGTLGYMVGEVWKG
                     ADEIRAQAYGPSDNPALSSAFDFPLRYGLVQALAVEESGKGGQGASVLDASWNKVENY
                     PNHAMPNLMLGNHDLVRFGDLLERGNFNPADYWQRHKAAFSFLAARSGPITLYYGEEF
                     GDEVPGFAKQVGGDCAAQGLCDDHVARSDGKVPGATGFVPSSEQSELKQWLSQLLALR
                     AAHPALYQGERVKLVAEGSVYGDIKQTAAEQVVYLLNVSSTPQSYAVPVGKLRSASAL
                     VDLQSGESLAIGGSSVTVDLPPLSGRFLLVR"
     gene            complement(529733..530266)
                     /locus_tag="AHA_RS02495"
                     /old_locus_tag="AHA_0496"
                     /db_xref="GeneID:4490078"
     CDS             complement(529733..530266)
                     /locus_tag="AHA_RS02495"
                     /old_locus_tag="AHA_0496"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005316094.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MgtC/SapB family protein"
                     /protein_id="WP_162516945.1"
                     /db_xref="GeneID:4490078"
                     /translation="MMTTDWWDIAPLGWENILVCLVCGTLVGLERQLRGKPVGIRTSS
                     LIILGTYCFLAIGAAVSPQSADQARVLGQLITGIGFLGAGVMMTRDGQVLGVTSAATV
                     WMLAALGALIGMQMLHQALLLTGVTLSILVGVDYLETSFKSLRRGVHNRLESWRHGNG
                     NVQAAPHQDELGSGIEK"
     gene            complement(530291..531733)
                     /locus_tag="AHA_RS02500"
                     /old_locus_tag="AHA_0497"
                     /db_xref="GeneID:4490079"
     CDS             complement(530291..531733)
                     /locus_tag="AHA_RS02500"
                     /old_locus_tag="AHA_0497"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308306.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RimK family alpha-L-glutamate ligase"
                     /protein_id="WP_011704470.1"
                     /db_xref="GeneID:4490079"
                     /translation="MSTYVIVEEPGDWPCHADYLLTARTYLQHGVPTTGGRPRIINLC
                     RNLEHLSAGYYCSLLAQARGHHCLPGLQAISQLQPQQPPAKLWRKLQGWLAQQSEDRI
                     RVRAIFGQCEQSELAGLARYYYGLSQLPLQELTLKRGRHGWSVRQQQSLSPLELSTSE
                     KELMLHHAQALVGTGDEEQAAPLYQLAILVDPNDGRASSDALALERFIQAAAAQGIRA
                     EILAPSAIERLPEFDTLWLRSETAVGHYTFEFARRAEQLKMPVIDSSRAILACSNKLY
                     LYELMVRSGVPMPPTMVVTRRGRHHVDELVQRLGLPLMVKVPDGAQGRDLAMASDEQQ
                     LARLLDEGLARSALLLVQSRIPAEFDWRIGFLDGSPLFACRRFRPEPGNRIRRRKHPL
                     DMSRIEALPLNEVPERVLQTARRAVHQLGNGLFGVDLRQQGRDCVLLEIIDNPWIRGD
                     IEDREAKDLYERLARAFRQRLENRGQSAAG"
     gene            531920..532378
                     /locus_tag="AHA_RS02505"
                     /old_locus_tag="AHA_0498"
                     /db_xref="GeneID:4490080"
     CDS             531920..532378
                     /locus_tag="AHA_RS02505"
                     /old_locus_tag="AHA_0498"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017408893.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_011704471.1"
                     /db_xref="GeneID:4490080"
                     /translation="MLTVRAARTDDLGAIVKLERYCFPPEVAFGRSRWHYLLTHAKGR
                     TLLVLDQQEQLMGYLCLLEHRGWDRLIIQTLAIRWTIRRQGWARRLLEQVIQEGKEAG
                     WGAIRLEVGDANEEAQALYRELGFRPRQKLLDYYGHGQHAHRLVLALKQA"
     gene            532393..532638
                     /locus_tag="AHA_RS02510"
                     /old_locus_tag="AHA_0499"
                     /db_xref="GeneID:4490081"
     CDS             532393..532638
                     /locus_tag="AHA_RS02510"
                     /old_locus_tag="AHA_0499"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005335980.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3624 domain-containing protein"
                     /protein_id="WP_011704472.1"
                     /db_xref="GeneID:4490081"
                     /translation="MSCDNCLATAIKAKLGRCPVCAGQTFVIGLVGWLVWWWCGADTS
                     VNALTGLLFALGGSGLLLLHLLVFVWRRATGRELSDE"
     gene            532695..533441
                     /locus_tag="AHA_RS02515"
                     /old_locus_tag="AHA_0500"
                     /db_xref="GeneID:4490082"
     CDS             532695..533441
                     /locus_tag="AHA_RS02515"
                     /old_locus_tag="AHA_0500"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family oxidoreductase"
                     /protein_id="WP_011704473.1"
                     /db_xref="GeneID:4490082"
                     /translation="MIAMVTGASSGFGESISRQLVQAGYRVIGTGRRGERLAALADEL
                     GAQFLPLVFDVQDKAATRAAIDGLPAEWREVDLLVNNAGLALGLEPAHKADLEDWEQM
                     IATNISGLTLLTRLLLPGMVARNRGHVINIGSIAGTYPYPGGNVYGATKAFVKQFSLN
                     LRADLAGTAIRVTNVEPGLCGGTEFSNVRFHGDDAKAATVYQGVQAIQPEDIANTVLW
                     ISQQPAHVNINSIEIMPVAQTFGPLNISRR"
     gene            complement(533503..534975)
                     /locus_tag="AHA_RS02520"
                     /old_locus_tag="AHA_0501"
                     /db_xref="GeneID:4490083"
     CDS             complement(533503..534975)
                     /locus_tag="AHA_RS02520"
                     /old_locus_tag="AHA_0501"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017783633.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C69 family dipeptidase"
                     /protein_id="WP_139348841.1"
                     /db_xref="GeneID:4490083"
                     /translation="MKKHTLSLLSATLLTLLGTSADACTGLIVGKGASADGSVMIARN
                     EDFGVNNWNKYLAFRSAQQNEGKVWKLGNGLEVPMPKAFFAYSAIRDWDATSSDPAGK
                     YYEERGINEFNVAISATTSAEVNDKAQKADPLIEKGVIEAIIPTLILPQAKTAKEGVA
                     LLGRYVEQYGAGEGNSLYLADVNEAWLMEIGSGHHWIAVRVPDDSYAMVANGLRIHGV
                     NLDSADVLHSPKLLEFVREHKLLDNADPKEFNFAKAFGVIADPYNVDREWLGQKMLTA
                     SHPQPTRQAQYPLFMKPDAPIAVPDVARLLSATYEGTPLAGKAERPIRIDRQLESHVI
                     QLRKEMPKELQGLIWQSYGVLAESVMVPLYNTLESYPLPYRTGSDSYSDDSAYWQFRS
                     LTALASADPDKYLPLLRGVWSKESSKLYQEVALLDQSLKQAYASDKATAIGLAADYSY
                     GQLEQTYQMAKELRYKLMTDLTKRTEQKYSPEEFKKIMSL"
     gene            535441..535893
                     /locus_tag="AHA_RS02525"
                     /old_locus_tag="AHA_0502"
                     /db_xref="GeneID:4490084"
     CDS             535441..535893
                     /locus_tag="AHA_RS02525"
                     /old_locus_tag="AHA_0502"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308316.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011704475.1"
                     /db_xref="GeneID:4490084"
                     /translation="MDIKPYSQQLAQSASNNRALATLSSADSGQGGGWEDLVNLSSQR
                     ITGQAQQALTYEHLAKNSKLPPALDIGSDKGGVMQQLVDKALGFDRKKFNEIEEKLKT
                     IADNKQLSAEERAEQSKPLNEQRDAMLQDAMDRLTGKKSSAKEETKSA"
     gene            complement(536092..536673)
                     /locus_tag="AHA_RS02530"
                     /old_locus_tag="AHA_0503"
                     /db_xref="GeneID:4490085"
     CDS             complement(536092..536673)
                     /locus_tag="AHA_RS02530"
                     /old_locus_tag="AHA_0503"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005316069.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011704476.1"
                     /db_xref="GeneID:4490085"
                     /translation="MKLKHAWIAGLLSLSTCLAQAAEVATEVATAPGKANLVEAVSAQ
                     ATVTAIDMASRKVSLKNAAGEAFDIVAGEQVTNLANLKVGDVVALRYLQMLDLELLKG
                     TAGVRKRIVEVAAGKAEAGEKPGAGIGKKVTLYGDVIAVDKGQQTITVKGVDHTLVLK
                     VHNPAQFALIAKGDQIKAVQTQAVGIGILPEKK"
     gene            536885..538060
                     /locus_tag="AHA_RS02535"
                     /old_locus_tag="AHA_0504"
                     /db_xref="GeneID:4490086"
     CDS             536885..538060
                     /locus_tag="AHA_RS02535"
                     /old_locus_tag="AHA_0504"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017787408.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-containing alcohol dehydrogenase"
                     /protein_id="WP_011704477.1"
                     /db_xref="GeneID:4490086"
                     /translation="MHSTEGSAVYNFQYANPTRVCFGEGQIAKLPELIPAGSRLLVLY
                     GGGSIKQNGVYEQLTQALAGREWLEFPGIGANPQYDQLMEAVALVKRERIDFLLAVGG
                     GSVVDGSKFVAAAACFEGADPWEILLHKAPIKAALPLGCVLTLPATGSESNPAAVVSR
                     GEAKLSFMNPLVQPVFAVLDPTTTYSLPPRQVGNGVVDAFVHIIEQYLTFPVGGEVQD
                     RLAEGLLQVLVDNGPRALAEPTNYQVRANLMWAASLALNGLIGRGVPQDWSTHAIGHQ
                     LTALHGLDHAQSLAVVLPSLLREQSGQKQEKLAQFAERVWHSSREDKALRIEEAIIRT
                     EQFFQQMGVGTRLADYGLSESCIPGICSNLKRFGLTALGEQQDIDPDKVARILSHAL"
     gene            complement(538265..538894)
                     /locus_tag="AHA_RS02540"
                     /old_locus_tag="AHA_0505"
                     /db_xref="GeneID:4490087"
     CDS             complement(538265..538894)
                     /locus_tag="AHA_RS02540"
                     /old_locus_tag="AHA_0505"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017781005.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase family protein"
                     /protein_id="WP_162516645.1"
                     /db_xref="GeneID:4490087"
                     /translation="MIVLHHLNKSRSQRIIWLLEELGLPYEIKAYQRDAATFLAPPEL
                     KAIHPLGKSPVIEFDGRVLAESGAITEYLIARHAPERLAPAQDSPDYAEYLQWLHFAE
                     SSGILPLLLDMFVRKDGSPMRFLPDYAKAECAKVLGYLNDVLATRQYLVGGRLTGADI
                     LNSFLVDLLAQSGQLAQFPHLQAYWQRLNTHPARQKAAARERELDRSAG"
     gene            complement(539003..540271)
                     /locus_tag="AHA_RS02545"
                     /old_locus_tag="AHA_0506"
                     /db_xref="GeneID:4486998"
     CDS             complement(539003..540271)
                     /locus_tag="AHA_RS02545"
                     /old_locus_tag="AHA_0506"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704479.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="O-acetylhomoserine
                     aminocarboxypropyltransferase/cysteine synthase"
                     /protein_id="WP_011704479.1"
                     /db_xref="GeneID:4486998"
                     /translation="MKDATLALHHGFTSDPTTKAVAVPIYQTVAYEFESAQHGADLFN
                     LAVPGNIYTRIMNPTNDVLEQRMAALEGGIAGLVVSAGSAAITYAIQALTAAGDNIVS
                     TPQLYGGTYTLFAHMLPSFGVEVRFAKDDSAEAIAALIDDKTKAVYCESIGNPAGNIV
                     DLAAFAKVAHARGVPLIVDNTVATPVLCKPIEHGADIVVHSLTKYVGGHGNSLGGVIV
                     DSGKFPWADHAERFPQLTKPEPSYHGVVYTEAFGPAAFIGRVRTVPLRNTGAALAPMN
                     AFLLLQGLETLSLRMERHVDNALRVAHHLKHHPKVAWVSYAGLPGHPHYLLAEKYMAG
                     RPSAILSFGLKDGYEAGVRFYDALKIFKRLVNIGDAKSLACHPASTTHRQLSEAEQAK
                     AGVKPEMIRLSVGIEAIEDILADLDQALEA"
     gene            complement(540428..540604)
                     /locus_tag="AHA_RS21675"
                     /old_locus_tag="AHA_0507"
                     /db_xref="GeneID:44157221"
     CDS             complement(540428..540604)
                     /locus_tag="AHA_RS21675"
                     /old_locus_tag="AHA_0507"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005336463.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011704480.1"
                     /db_xref="GeneID:44157221"
                     /translation="MSHANPIKPNRIQQILRRYFKRILPRPLTLIEDPMSQLNRLMQW
                     DMNQIDDREYRRRL"
     gene            540705..542438
                     /gene="sgrR"
                     /locus_tag="AHA_RS02550"
                     /old_locus_tag="AHA_0508"
                     /db_xref="GeneID:4487000"
     CDS             540705..542438
                     /gene="sgrR"
                     /locus_tag="AHA_RS02550"
                     /old_locus_tag="AHA_0508"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010635279.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HTH-type transcriptional regulator SgrR"
                     /protein_id="WP_164927528.1"
                     /db_xref="GeneID:4487000"
                     /translation="MPTSRLYQQFQRLAQQLGCDEREISLAEVADLLCCTPRNARLLL
                     RRMQDQGWLSWAAEAGRGRRSRLTLLDNQESLTRRRLRDLLSQGQLAQAVRLAEDRLD
                     LLTPLLIEQLGQATREGRQILRVPYYRPLPRLLPTGPLRRSEIHLSRQIFNGLTRRNE
                     ENGEIEGDLAHHWECLGPCHWRFYLRPAVRFHHGRELVVEDVVESLLALRDRPLFAHL
                     ARLESPWPRTLDLHLDSPDPLLPQLLAEPVAAILPRELKEEAGFALQPVGTGPYRVTA
                     NDPLQLCLEAFDDYFGLRALLDEIDIWMLPELAERLESHLQLGRDSPELGTMRGESEL
                     ESGCYFLLQDDRSASLQDPALRQWLAGLLNPIALMARVAPELQRGWTSALGLLPHWRE
                     AQPAPLPMPEQLPRQLVLACFNQHLEFNECANAMSSLLAEQGIRLEVRTLDYGRWVSG
                     VDEDVDLWLGTLNLEHEHAFAPYAWLQGTPLLRKVWGSQQRLWQGLTQWRASGEEPGP
                     RALLASVQQQGWFVPLFHHWLELESRVGVHGVRMTALGWFDFRSAWLRPELAVGGGDT
                     TGELESKGGPR"
     gene            542474..542869
                     /locus_tag="AHA_RS02555"
                     /old_locus_tag="AHA_0509"
                     /db_xref="GeneID:4487001"
     CDS             542474..542869
                     /locus_tag="AHA_RS02555"
                     /old_locus_tag="AHA_0509"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308329.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA thioesterase"
                     /protein_id="WP_011704482.1"
                     /db_xref="GeneID:4487001"
                     /translation="MLEMQIQPRFQETDALGHINNTVPAVWFESARDPLFRIFSPELD
                     VHNWHLIIAGYTVQFKRELFYGQQVLIKTGVRRIGSSSFTLWQEAWQGDELAVTAETT
                     LIHFDYQSRQSIPLSDRHREGLRAWLIES"
     gene            542901..543614
                     /locus_tag="AHA_RS02560"
                     /old_locus_tag="AHA_0510"
                     /db_xref="GeneID:4487002"
     CDS             542901..543614
                     /locus_tag="AHA_RS02560"
                     /old_locus_tag="AHA_0510"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704483.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011704483.1"
                     /db_xref="GeneID:4487002"
                     /translation="MRNTVIALSLGLGLGLCSLPSVAASLAEQFSLMEKGAESALDTR
                     LFSHDGVDIKAWVDGAPVIIAVPIMNEQGKLEGESRYYFKGGKLFGVKEPAAQFAFDD
                     GGKLTQWLDEKGQPAEFVSKMSMQQREVWLTKRAAELGKLFAQSPAEQKAAKGGVKLK
                     GAELAHWLCNGKLMALAGGDKVTFEQAKLKTRAEGIEGEVSLRQEKGWQDLSLKCEVQ
                     GSQVTRLTWQPLPGANKPQ"
     gene            complement(543679..544422)
                     /locus_tag="AHA_RS02565"
                     /old_locus_tag="AHA_0511"
                     /db_xref="GeneID:4487003"
     CDS             complement(543679..544422)
                     /locus_tag="AHA_RS02565"
                     /old_locus_tag="AHA_0511"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019841004.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipase chaperone"
                     /protein_id="WP_011704484.1"
                     /db_xref="GeneID:4487003"
                     /translation="MNKAWLMAAPLGAALLLGGWQLWPAPNSTPATPPVDEAGPSSPL
                     ARQAASSPDESSLQARYEAFLAAEGSLTVPTDPGLASLQVLFDEREQLRQQSFTPAEQ
                     EQLFAEDRLMEQWTLRRKALAEAGDADKPLLASELELWLAEQPQWFREAEANSRLLGD
                     LQSLERLPAAERDAVLREQLGPEAADRLHQLAESQQGFEQQLAGYLAESKPLPAERRA
                     EQQPEILARWFEPDQWRRVEALTRLRLGE"
     gene            complement(544419..545330)
                     /locus_tag="AHA_RS02570"
                     /old_locus_tag="AHA_0512"
                     /db_xref="GeneID:4487004"
     CDS             complement(544419..545330)
                     /locus_tag="AHA_RS02570"
                     /old_locus_tag="AHA_0512"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005316049.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="triacylglycerol lipase"
                     /protein_id="WP_164927529.1"
                     /db_xref="GeneID:4487004"
                     /translation="MKKWLLVLLCALPMLGQAAGYTQTRYPIVLVHGLFGFDKLLGVD
                     YFYGIPQALTRDGARVYVAQVSATQSSELRGEQLLKQVQQVLAITGAEKVNLIGHSHG
                     GPTIRYVASVAPELVASATSVGGVNYGSEIADLVRANVAPGSVAEKLAVAAASALSGV
                     ISLLSGGSQLPQDPLAALDALTSAGAQRFNQRYPEGLPNQYCGEGPMQAANGVYYFSW
                     SGRGTMTNILDPVDPALALTGSFFKEPNDGLVGVCSSHLGKVIGTDYRMNHLDEVNQS
                     FGIRHLFETDPISLYRQHANRLQRLGL"
     gene            545621..546046
                     /locus_tag="AHA_RS02575"
                     /old_locus_tag="AHA_0514"
                     /db_xref="GeneID:4487006"
     CDS             545621..546046
                     /locus_tag="AHA_RS02575"
                     /old_locus_tag="AHA_0514"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017786052.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011704487.1"
                     /db_xref="GeneID:4487006"
                     /translation="MVHWKVQTMSGNRHFDAGEHGKALSCYQQALWLARQQFTGWHDV
                     DEAVAALVVAHHNLADLLVAMARPERAADLLCHIHDCLLATSQSPASPDPLRDAALRH
                     TRSTHAELLAFLRKHGNHDGIRRCLGQCLCQTESARQLH"
     gene            546068..546682
                     /locus_tag="AHA_RS02580"
                     /old_locus_tag="AHA_0515"
                     /db_xref="GeneID:4487007"
     CDS             546068..546682
                     /locus_tag="AHA_RS02580"
                     /old_locus_tag="AHA_0515"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349287.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="superoxide dismutase"
                     /protein_id="WP_011704488.1"
                     /db_xref="GeneID:4487007"
                     /translation="MSHTLPALAYAYDALEPHIDALTMEIHHSRHHQTYINNLNAALA
                     DLPELAALPVEELLARFDSLPGKVQGAVRNHGGGHANHSLFWQVMSPQGGGEPGGELA
                     AAILRDLGGLEAFKQAFTQAALSRFGSGWAWLVVDRSGKLQVVSSANQDSPLQDGQVP
                     ILGLDVWEHAYYLKYQNKRPDYIAAFYNVIDWSEVARRYVAALA"
     gene            complement(546736..547761)
                     /locus_tag="AHA_RS02585"
                     /old_locus_tag="AHA_0516"
                     /db_xref="GeneID:4487008"
     CDS             complement(546736..547761)
                     /locus_tag="AHA_RS02585"
                     /old_locus_tag="AHA_0516"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017783625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF218 domain-containing protein"
                     /protein_id="WP_011704489.1"
                     /db_xref="GeneID:4487008"
                     /translation="MTLCHLLLQTRTAPRMKKFAKILLACLCLLLASVATLLGYSEWT
                     VSDARHYTYDDVNAVPYNRVALVLGTSKYLIGGSPNHYFKYRIKAAAELYNNGKVDYI
                     LVSGDNATVQYNEPRQMRRALIQAGIPANAIYSDYAGFRTLDSIVRAKEVFGQAHFTV
                     VSQAFHNERAIFIARHFGIEAVGFNAVDPSAYQGIKTRVREVFARLMGLLDLYVLDKG
                     PKFLGEPIVIGGPVPCQALSTIGASQPCLPIAPPPHKPKAKPAAAVSAATATSAAAAT
                     SGAVATSAAVPNEAAPVDNPAAASAATPAGNIPATNTAVPSEVTPVDNPAAASAAPPT
                     SSALTPQ"
     gene            complement(547928..550675)
                     /locus_tag="AHA_RS02590"
                     /old_locus_tag="AHA_0517"
                     /db_xref="GeneID:4487009"
     CDS             complement(547928..550675)
                     /locus_tag="AHA_RS02590"
                     /old_locus_tag="AHA_0517"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010635271.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="collagenase"
                     /protein_id="WP_011704490.1"
                     /db_xref="GeneID:4487009"
                     /translation="MNNLGTRLLLLAAPGLFATSALANYSPSDWQQYQLKGESSRQLG
                     DRLTEVTYELSARSGGAPYQQLRVYRRFDWSDANLAALAEQQCGEPQLKIELGWQIRY
                     LSCEEVVPAGKAVPASSYDYGYGMKQGRWEPLAGTPTAPRQDRLPLAERVILGHSEQE
                     LDRCELNAEGRCAEQAWQYQPQNWQQLKVLEETPNERDGRLEQIFFRLQPIVGSQAAK
                     QVSELHVWRQYTWLLEQAKTQQECDEPQTRQEGDKTISYRVCRQTLPAGSEVQVVLKD
                     TGYQYPVGGSEWQTLPETTEWQESRVLNHPIVLASKEEQLDCRRADGRACSEPDLPGT
                     ELLDAEAAKIVQDASGQPAPVWQENYGHDDTKLLAVSRGIQSLLAANQPAHPAMKLLL
                     EYVRAHNYHNYGKHKEDGPAAAEALAEALTALGAHPLLFPEQASDEVGAVMGAWSIAL
                     HGQFKSPAVQSRFGTLLGEFNQMLAYSTRHASEINGQHAWATGLFDLLNFLDFASDYS
                     DPFANDFRQQDGELRKQLHALGMSELALWKGRDGADLFLLNNVLDAYTRLYRVARYTR
                     PDELDGYRKLLDDSVIALVRHHNLIPGGQQSQDLLEDMSLTLSTYYLTYTDRTSEACI
                     SGDFAGLCTPVRVEDVLPFEHTCSPTLRLRAQDLTMDQAEGICRELGAEEQQFHQQME
                     TGWQPVADDHNEALELVVFNSSADWKRYGSALFGGVSTDNGGIYLEGDPARPGNQARF
                     FAYEAEWKRPAFQVWNLRHEYVHYLDGRFNQYGSFGHYPLNRTTWWSEGLAEFIAHGQ
                     CFARGLDNVAGRPASDRPALADILHLDYDKGGEMVYSWSYTVHRFLNETGRGASWLAM
                     AQALRNPDQQQAMSTFEAELDQLIANDSEAYQQWLGRELLPWWEANKDSDECKANDSS
                     H"
     gene            complement(551179..551502)
                     /locus_tag="AHA_RS02595"
                     /old_locus_tag="AHA_0518"
                     /db_xref="GeneID:4487010"
     CDS             complement(551179..551502)
                     /locus_tag="AHA_RS02595"
                     /old_locus_tag="AHA_0518"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005316030.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein"
                     /protein_id="WP_065479870.1"
                     /db_xref="GeneID:4487010"
                     /translation="MNTSTASVRNSAIRFASSAAAAMLLGAALLPATASAADGTITFT
                     GTIYEAPCDFADNSVTCYSGTQRQTLDLASLQQAGSLNTISSTMQYKLSAGSSNMAIV
                     TVSYL"
     regulatory      complement(551596..551681)
                     /regulatory_class="riboswitch"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF01051"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="cyclic di-GMP riboswitch class I; Derived by
                     automated computational analysis using gene prediction
                     method: cmsearch."
                     /bound_moiety="cyclic di-GMP"
                     /db_xref="RFAM:RF01051"
     gene            552789..553331
                     /locus_tag="AHA_RS02600"
                     /old_locus_tag="AHA_0519"
                     /db_xref="GeneID:4487011"
     CDS             552789..553331
                     /locus_tag="AHA_RS02600"
                     /old_locus_tag="AHA_0519"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704492.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 1 fimbrial protein"
                     /protein_id="WP_011704492.1"
                     /db_xref="GeneID:4487011"
                     /translation="MKANKILVAMGVGSMLLCGSAVAAGGAGSGKVTFNGEIINAPCS
                     VAPESVDQVVEMGQISTKELASGGESNSKPFSIKLLNCEISDKEDAVKVTFSGAKDPV
                     DSSLLVIGGGDAAGAGIKMTAPGGAPIVLGTPTAAFGLVNGDNELPFSAVLKGYADQT
                     ANPLKAGAFTAVTNFTLSYE"
     gene            553431..553820
                     /locus_tag="AHA_RS02605"
                     /old_locus_tag="AHA_0520"
                     /db_xref="GeneID:4487012"
     CDS             553431..553820
                     /locus_tag="AHA_RS02605"
                     /old_locus_tag="AHA_0520"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005354943.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_029304496.1"
                     /db_xref="GeneID:4487012"
                     /translation="MMAAMVLQLVMMAGSVHANELTDGLAESGCTLEVLRSIPLQARQ
                     PGTLKISGCQVEGATEASLPFISMSVRGAMSDELGILNNGQYHKVSGERFIVSDIVNS
                     DLEFNLGLTSSQLFFQDSTTLFELNYM"
     gene            553888..556422
                     /locus_tag="AHA_RS02610"
                     /old_locus_tag="AHA_0521"
                     /db_xref="GeneID:4487013"
     CDS             553888..556422
                     /locus_tag="AHA_RS02610"
                     /old_locus_tag="AHA_0521"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017408910.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbria/pilus outer membrane usher protein"
                     /protein_id="WP_011704494.1"
                     /db_xref="GeneID:4487013"
                     /translation="MSVSTSDSVRKKHYSKMVFMLCVPGLMAVANHAWAETEFNIDAL
                     DLDERTKIDLSQFADEGYILPGDYYLEIEVNKNKLPLQKIPFYETDTGKGKGGVACLP
                     QEVIPKLALTDEAIAKIDTWHDGQCANLLALDGVVIANDIGNGLLRIAVPQAWMKYSD
                     PNWIPPEQWDEGIPGMMLDYNINAQVNEGDGYSNRNISSYGTLGFNYGAWRLRGDYQA
                     NAYWGDNERTTSELNRIYAYRPLPDMAAKLTVGEQQLNSQLIDGFRYTGVNLANDERM
                     LPPSLQGYAPEVSGIAKTNAKVTISQSGRILYETNVPAGPFRIQGLDSSVRGRLDVRV
                     EEQDGSVNSFQVDTATVPYLTRPGYVRYNLAVGAPSEQTDSVHDVHGPAFVTGDFSWG
                     VANSWSLYGGSLVAGEYNSMGLGIGRDLYAFGAISADLTQSIAKLPGLSTKIGQSVRV
                     NYAKQFDEYNSSITFAGYRFSQHNFMTMSQFLSNKERLEKNETTSSDDYNTWGDKELY
                     TITANKTFWAEDAAKALTVYLDYTHRTYWEHDAEDRYGLTINKNVNIGSFKDVSVYVS
                     AYKTKTENYEDDKSVMLTLSMPIGDRKSAGYSVQSSNGKVTHLATYQDYSRPDDTYQL
                     GAGVQSNGHAVARGYYNHNSDIGAVSLNAYSVQSEYTSVGASLRGGLTATQHGAALHQ
                     ATRRGGTRMMVDTDKTSGVSFNNGRAVTNRFGVAVISDMTDYRKSDTRVDVDQLSDDI
                     DAMNAIKQGTLTEGAIGYNAFEMAEGFKLLANVKLPDGSVPPFGATVVKDSGRVLSVV
                     DEDGLVYLTGVKPNEAFELSWGGARQCKIVAPQQVTDLSMKTLTCK"
     gene            556433..557164
                     /locus_tag="AHA_RS02615"
                     /old_locus_tag="AHA_0522"
                     /db_xref="GeneID:4487014"
     CDS             556433..557164
                     /locus_tag="AHA_RS02615"
                     /old_locus_tag="AHA_0522"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005316022.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone"
                     /protein_id="WP_011704495.1"
                     /db_xref="GeneID:4487014"
                     /translation="MKKLLSYTCLAVLGMTSLNVSAAIVLDRTRVVYPGGAKSISLNI
                     KNENQKLPYLAQSWIEDAQGQKIASPFAVLPPVQRVDANQKSIVRIASVPAIDSLPKD
                     RESIYYFNLREIPPKSEKSNVMQIAVQSKIKLFYRPEAILPERGAIWQDQVLITKLGK
                     ALKVNNPTPYYITYVGLGHPQGKGRTAMKGFSAFMVAPKSEQTVTIPEALGNEFVISY
                     VNDYGGYMDIKYQCKGDRCESVKEK"
     gene            557169..558203
                     /locus_tag="AHA_RS02620"
                     /old_locus_tag="AHA_0523"
                     /db_xref="GeneID:4487015"
     CDS             557169..558203
                     /locus_tag="AHA_RS02620"
                     /old_locus_tag="AHA_0523"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005354940.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein"
                     /protein_id="WP_011704496.1"
                     /db_xref="GeneID:4487015"
                     /translation="MLRKASIAGLLLSLLYPALSYGNGYVYPDGGTYEYDIDLGNSSI
                     KNEKGYETKPPLEWDLKRQYNASIDCSNGRIKGPTYFKAIMNESIPPVGGGFMKLNEF
                     LDMKVEIWFEGNRRTYVTAPFTEESNRLEWTCYSPSDRFSYRSGSKGKVTFRVRKPII
                     NGVQIEDRKVVEMFGRLGGSAANGYGPMAMSRIIIKSALLYVPEECTINGGQTIEVEF
                     GDLPGNGLDGNNFEKTVPLTFQCKGGEFEGNALKINLGISGKAASFSDEYLRTTKDGY
                     QGGAVIPDLGIKFKQLDGSQMSINKFYPVSMQGNIGDWGFIAAPVSPAGADVAAGDFY
                     ATATIVAEFQ"
     gene            558215..558766
                     /locus_tag="AHA_RS02625"
                     /old_locus_tag="AHA_0524"
                     /db_xref="GeneID:4487016"
     CDS             558215..558766
                     /locus_tag="AHA_RS02625"
                     /old_locus_tag="AHA_0524"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005354939.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 1 fimbrial protein"
                     /protein_id="WP_011704497.1"
                     /db_xref="GeneID:4487016"
                     /translation="MLRTLLISLMLSPLIAVAAIPRAGDGLELRGDKLNLHGRIIDQP
                     CVVAPESLEQEVEMGVVDVKQLYANGAGEQVPFSIRLTNCKPGIFRMAKVTFTGSKDA
                     QLSGGLAFTAGIAKGAGIRLYDVTQTPLDLGTPSRGYLLGGSADNELQFFARVEGHPD
                     ALAAKNIQPGDYSAVANFIVAYE"
     gene            complement(558769..560009)
                     /locus_tag="AHA_RS02630"
                     /pseudo
                     /db_xref="GeneID:44141870"
     CDS             complement(558769..560009)
                     /locus_tag="AHA_RS02630"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349297.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="winged helix-turn-helix transcriptional
                     regulator"
                     /db_xref="GeneID:44141870"
     gene            complement(560311..561717)
                     /locus_tag="AHA_RS02635"
                     /old_locus_tag="AHA_0527"
                     /db_xref="GeneID:4488867"
     CDS             complement(560311..561717)
                     /locus_tag="AHA_RS02635"
                     /old_locus_tag="AHA_0527"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017783616.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-succinylbenzoate--CoA ligase"
                     /protein_id="WP_011704500.1"
                     /db_xref="GeneID:4488867"
                     /translation="MPPLSDHHHPLQPCPVRHWARSASDRIAIHAADPLTYQQLDIRL
                     NGLCRQLGQAGLQAGDRLAAVVRGALPDLLLAWACVRSGIVFCPLNPAFPLARQAELA
                     ALLAVRACWSAGEIPTGNWQPLRLDFTHELVADEGDCMLDPARLNNMILTSGSSGTPK
                     AVVHRLANHLASARGSAAVIPLDAECGWLLSLPLFHVGGYAILFRVFLAGAALVLDDR
                     RRPLRERLEQQPITHLSLVPTQLWRLLAEGFDPARTRLRELLLGGAAIPQPLVNRLSA
                     MGLVPKVSYGLSEMGSQVCTGQPSTAGVVGKALPGREVCIQQGEICVRGDTLFAGYFK
                     QGGLERPLDEAGWFHTRDKGHFTVDGELVVEGRLDNLFISGGENIQPETIEQRLVDHP
                     AVAQALVVPVPSDEWGQRPAAFIEWHGEPVPPAELAAWIRQTLPGFMVPDQWHPWPDL
                     GGHLKPQRRQYQNILKAQ"
     gene            complement(561728..562657)
                     /gene="menC"
                     /locus_tag="AHA_RS02640"
                     /old_locus_tag="AHA_0528"
                     /db_xref="GeneID:4488868"
     CDS             complement(561728..562657)
                     /gene="menC"
                     /locus_tag="AHA_RS02640"
                     /old_locus_tag="AHA_0528"
                     /EC_number="4.2.1.113"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005316010.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="o-succinylbenzoate synthase"
                     /protein_id="WP_011704501.1"
                     /db_xref="GeneID:4488868"
                     /translation="MTLALYRYQLPFTQPLTFHGKVEVAREGLLVRVDDGWGEIAPLP
                     GFSRESLAEAQAEAIASLEQLAAGQEIAPQLPSVQFGLDCARRCWPAQTTPLPEPYPL
                     IQGSPQELLKHWKNWLHTTPSKAKLKVARYPMRDELALIRLLCDRIPTLKLVLDANQG
                     WTREEAWAFCGHLDPNRIEYLEDPCANFADIAFVANRTGMPVAIDELLAQGKPWEPIP
                     QLRALVLKPTLLGSLAHCEALVARARELRLKVIVSSCFESGLGLNQLFHLAGEWAPDQ
                     APGLDTRRWLAADLLDATGKPDLSLLEPLFHRD"
     gene            complement(562657..563517)
                     /gene="menB"
                     /locus_tag="AHA_RS02645"
                     /old_locus_tag="AHA_0529"
                     /db_xref="GeneID:4488869"
     CDS             complement(562657..563517)
                     /gene="menB"
                     /locus_tag="AHA_RS02645"
                     /old_locus_tag="AHA_0529"
                     /EC_number="4.1.3.36"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005350818.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1,4-dihydroxy-2-naphthoyl-CoA synthase"
                     /protein_id="WP_011704502.1"
                     /db_xref="GeneID:4488869"
                     /translation="MIEAMTEAELYAPVEWRDCSAGYEDILYHKSDDGIAKITINRPQ
                     VRNAFRPRTVKEMLQALADARYDDQIGTIILTGFGEKAFCAGGDQKIRGDYGGYRDDE
                     GTHHLNVLDFQRDIRTCPKPVVAMVAGYAVGGGHVLHMMCDLTIAADNAQFGQTGPKV
                     GSFDGGWGASYMARIVGQKKAREIWFLCRMYDAKQALDMGLVNTVVPLAELERETVRW
                     CREMLQNSPMALRCLKAALNADCDGQAGLQELAGNATMLFYMTEEGQEGRNAFNEKRR
                     PDFSKYKRNP"
     gene            complement(563510..564280)
                     /gene="menH"
                     /locus_tag="AHA_RS02650"
                     /old_locus_tag="AHA_0530"
                     /db_xref="GeneID:4488870"
     CDS             complement(563510..564280)
                     /gene="menH"
                     /locus_tag="AHA_RS02650"
                     /old_locus_tag="AHA_0530"
                     /EC_number="4.2.99.20"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308378.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-succinyl-6-hydroxy-2,
                     4-cyclohexadiene-1-carboxylate synthase"
                     /protein_id="WP_011704503.1"
                     /db_xref="GeneID:4488870"
                     /translation="MAASADQPTLVLLHGLLGDAHDWQPVQAALAGLPSLALDLPGHG
                     SNRAVRVAGFEQAHRWLCDELAARDIDRYQLVGYSLGGRLALYHASQSLVGLQALLLE
                     NCHPGLPPAERPARLAHDEGWARRFEQEPLAAVLADWYRQGVFADLGEDARARQIARR
                     LGNDGEAVAAMLRATSLGQQPNLGPWLAQGALPVTWVSGKRDHKFHQLACLMASQHRK
                     INHLELDGGHNLHAHQPETFARLLAEWVNQQQEEKRHD"
     gene            complement(564270..566000)
                     /locus_tag="AHA_RS02655"
                     /old_locus_tag="AHA_0531"
                     /db_xref="GeneID:4488871"
     CDS             complement(564270..566000)
                     /locus_tag="AHA_RS02655"
                     /old_locus_tag="AHA_0531"
                     /EC_number="2.2.1.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017780369.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-succinyl-5-enolpyruvyl-6-hydroxy-3-
                     cyclohexene-1-carboxylic-acid synthase"
                     /protein_id="WP_011704504.1"
                     /db_xref="GeneID:4488871"
                     /translation="MSARQEFASHHATFNHVWSSLLLEELFRLGVRDIALASGSRSAP
                     LTMAAAAHPGFRRHLHFDERGLGFMALGLAKGSGRPVAVIMTSGTAVANLWPAVAEAQ
                     LTGVPLIILSADRPPELIDNGANQAIDQQGIFGRYPVYQQNLPSPTATIPAAFVLSSV
                     DQALAQQARTPGPVHFNCMYPEPLYPGDAYLDFSAYLAPLGDWLRSSEPWSPWQLTQA
                     PCPCQPDWDELQGKRGLIVAGRIQDPVQAKAVAALAERLGWPLLADLQSQLRFDGRNL
                     VHADLALQHSGFVAELARAEVLLQFGARLISKRLGQFIKQQPWQAYWLIDPQPARLDP
                     DYRLRRRLLCDPAAFAAAHPVAHPHLPWHRLAERQQAVSQQVRSACERFSELGVCHRL
                     NQLIRGQLFVGNSMPARLMDMLGEAGKGPSRVMTNRGASGIDGLIATAYGFAQSVQPG
                     SNEPTTLLLGDLSALHDLNSLALLGKSSRPLVVILLNNDGGSIFRMLPVPTQDALLET
                     YYCLPHGLHFEHAAAMFGLHYRTPASLADFERDYTTALEKGVTLIEIKVPSSEVAEDL
                     KALGSAIRGS"
     gene            complement(566035..567381)
                     /locus_tag="AHA_RS02660"
                     /old_locus_tag="AHA_0532"
                     /db_xref="GeneID:4488872"
     CDS             complement(566035..567381)
                     /locus_tag="AHA_RS02660"
                     /old_locus_tag="AHA_0532"
                     /EC_number="5.4.4.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017787428.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isochorismate synthase"
                     /protein_id="WP_011704505.1"
                     /db_xref="GeneID:4488872"
                     /translation="MLAQTHIKQQLDALRHGNASGFVRLRVAIEVGSFLGWLAAQTLY
                     PRIYWHARGHDRPEYVALGCLRELTEPQAIRQVCEHTSQPHDDSPRYYGGLAFDPTQP
                     GWQGFGPCRFVLPRIELVRRGECVTLCLNLWLPEQTGSDAFEVELQAAAAALDALRPE
                     APLPPLTRHSWQREDCPSQPQWQTLVEQVTAPEFQAHTPKVVLSRQSRLTHDGATLTA
                     DPQAVAPWSLLASWAQHGQDCFHFGFQFSPEQSFIACSPERLYRREQQHLFTEALAGT
                     IRRSGDEATDAALAAELLADSKNRLENRLVHADILSRLAPLTTDATLTEPRILKLRLL
                     QHLKCDIEAELKPGVCDWQLLEALHPTPAVGGAPREAALAFIREREPYDRGWYAGACG
                     MLSRETSEFSVAIRSARITAQAITLFAGAGIVAGSEPAAEWAELDNKIANVLSLLG"
     gene            567589..568494
                     /locus_tag="AHA_RS02665"
                     /old_locus_tag="AHA_0533"
                     /db_xref="GeneID:4488873"
     CDS             567589..568494
                     /locus_tag="AHA_RS02665"
                     /old_locus_tag="AHA_0533"
                     /EC_number="2.5.1.74"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017412592.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1,4-dihydroxy-2-naphthoate
                     polyprenyltransferase"
                     /protein_id="WP_026080210.1"
                     /db_xref="GeneID:4488873"
                     /translation="MTNTLSIWLLAARLRTLPLACSSILLGSGLAASRGAFDGTIMAL
                     SLLTAILLQILSNLANDYGDAVSGADNGERIGPQRAVVSGLITRRQMCVAMALTALAA
                     VVSGLALLGCAFGDQWLQILTFVLLGGAAIVAAITYTVGKTPYGYRGFGDISVFLFFG
                     LLGVLGSYYLFTKTLQWDLLLPATACGLLATAVLNINNVRDIETDAVSGKITLAVRLG
                     RNRAIAYHWVLLGAALLTTIAFLLTQPASFWPWIFLPAMKPLTDAAKTLRQSFDGEVL
                     TGALKKTAISAFLFSLLLSIGLALS"
     gene            568601..568816
                     /locus_tag="AHA_RS02670"
                     /old_locus_tag="AHA_0534"
                     /db_xref="GeneID:4488874"
     CDS             568601..568816
                     /locus_tag="AHA_RS02670"
                     /old_locus_tag="AHA_0534"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017408921.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_164927530.1"
                     /db_xref="GeneID:4488874"
                     /translation="MRDSLKQKIIQVCHQKIAQKGEAVGVSFYAFFTNRNDDPELLME
                     AATWWIQTQRLDHFEKATKILQLVEQA"
     gene            complement(568896..570293)
                     /locus_tag="AHA_RS02675"
                     /old_locus_tag="AHA_0535"
                     /db_xref="GeneID:4488875"
     CDS             complement(568896..570293)
                     /locus_tag="AHA_RS02675"
                     /old_locus_tag="AHA_0535"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005315998.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PepSY domain-containing protein"
                     /protein_id="WP_011704508.1"
                     /db_xref="GeneID:4488875"
                     /translation="MKNRDANHYQRIWRWHFYAGLFVAPFLILLSLTGIVYLFKPQLD
                     NLMYPELMKVAPVSQPLSADQLLVKAMVTMPDASLSKYLPPVSPEASAQFIVRQGGNE
                     LTLFLDPASGTLLGTLDNKWNLQAVARALHAELMIGTVGDRLIELAAGWGIVLLISGL
                     YLWWPRKGPGVGGILWPRWSQRGRLWWRDLHAVVGFWGAGFLLLLLLSGMTWTGFWGD
                     QFAAVWNRFPAAMWNEVPKSAPLARSLNHAHQQTVPWAVENTPIPSSAEPKAHDHSAM
                     GHGGEHDGMVMTEHRIPLQQVVEIATARQVTPGYSITPPAGASGVYTIAISADDPRND
                     ATLHIDQYSGKVLADVRWQDYGPVAKTVETGVMLHMGKLYGWPHQLAMLLICLLVLLS
                     SVSGLWIWWSRRPSGRLAAPPLPASLPPMRGAIALLILLGICFPLVGGSMLVIWLLDC
                     LLFARRRAPRLARVS"
     gene            570566..570961
                     /locus_tag="AHA_RS02680"
                     /old_locus_tag="AHA_0536"
                     /db_xref="GeneID:4488876"
     CDS             570566..570961
                     /locus_tag="AHA_RS02680"
                     /old_locus_tag="AHA_0536"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017780374.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011704509.1"
                     /db_xref="GeneID:4488876"
                     /translation="MKLQPHGHFEMQRRGQVLICRPSGPFNLAGAMAYEAQFSQQIAS
                     LRDAPWGIVEVATEFEAAGPEVLTRFRRQFGWCASNGCAFLAVVLAGSFKQYLADQVF
                     SGLPFQGVRYFEQTDEALQWLERQLAGLV"
     gene            complement(571145..571435)
                     /locus_tag="AHA_RS02685"
                     /old_locus_tag="AHA_0537"
                     /db_xref="GeneID:4488877"
     CDS             complement(571145..571435)
                     /locus_tag="AHA_RS02685"
                     /old_locus_tag="AHA_0537"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005363120.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YkgJ family cysteine cluster protein"
                     /protein_id="WP_011704510.1"
                     /db_xref="GeneID:4488877"
                     /translation="MTQTTRPEVSCQNCEACCCRLEVMLFTDTGVPDRYVEEREGEVP
                     VMHRLEDGWCAALDRNTMMCRIYEVRPLICREFEMGEPDCIDERDKWFIKLN"
     gene            complement(571508..572884)
                     /gene="dbpA"
                     /locus_tag="AHA_RS02690"
                     /old_locus_tag="AHA_0538"
                     /db_xref="GeneID:4488878"
     CDS             complement(571508..572884)
                     /gene="dbpA"
                     /locus_tag="AHA_RS02690"
                     /old_locus_tag="AHA_0538"
                     /EC_number="3.6.4.13"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704511.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent RNA helicase DbpA"
                     /protein_id="WP_011704511.1"
                     /db_xref="GeneID:4488878"
                     /translation="MNNEFSSLNLSPALQDNLASLGYLQMTPIQAQSLPLVLDGKDLI
                     AKAKTGSGKTAAFGLGLLANLDVNRLEVQALVLCPTRELADQVATEIRRLARTLPNVK
                     LVTLCGGTPTAPQSATLSFGAHIAVGTPGRILKHLEQGTLELDGLKTLVLDEADRMLD
                     MGFGEDINRVISHAPRDRQTLLFSATYPEGIAQMSRGVQRNPVEVSVESLHEDSAIEQ
                     KLYEVPAGQRLDALGWLLSHYQPSSCVVFCNTKRACNDVADHLAAKGFSALALNGDLE
                     QRERDQVLVRFANGSATILVATDVAARGLDIKELGAVINYELTYDPEVHVHRIGRTGR
                     AGQQGLALSLYQPNEAQRVNFIEEYQQAPIPQGDLAGIGRDIKPIAPQMVTLSIDAGR
                     KSKVRAGDILGALTGEGGIAGADVGKIQISEQYSYVAVKRQVASAALKRLQEGKIKGR
                     SYRARKLG"
     gene            complement(572942..573280)
                     /locus_tag="AHA_RS02695"
                     /db_xref="GeneID:44141871"
     CDS             complement(572942..573280)
                     /locus_tag="AHA_RS02695"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_139348842.1"
                     /db_xref="GeneID:44141871"
                     /translation="MNIKIINKQIVKNKPFSLKGLFSQLSHIYLKPGEWRHSGEVKFT
                     ANLFNQIKVTNVYLICDEWPGFFQLIPERQWGIFRRAGQHAATGFPRPQPRHRRRPVV
                     QKSATPGSAF"
     gene            573449..574654
                     /locus_tag="AHA_RS02700"
                     /old_locus_tag="AHA_0539"
                     /db_xref="GeneID:4488879"
     CDS             573449..574654
                     /locus_tag="AHA_RS02700"
                     /old_locus_tag="AHA_0539"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000376337.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside permease NupC"
                     /protein_id="WP_016349310.1"
                     /db_xref="GeneID:4488879"
                     /translation="MEYVHFVLGLVMVLALALLANRHNWKQIKLRYIGQLLVVELALA
                     WFMLNSEVGLAVVGGFAAGFTKLMEFAKQGTDFVFGGLVNEGAFSFFLMVLMPIVFIS
                     VLIGILQYIRLLPLVIRGIGTVLAKINGMGKLESFNAISSMIVGQSENFIALKNILPH
                     LNEKQMYTLAATAMSTVSMSIVGAYMQLIEPRYVVAALVLNMFSTFIVLSLINPYEPD
                     NTVTDAKALAEGDEHHSPKKENFFEMLGEYIMAGFTVAVIVGAMLVGFIALIALINYL
                     FEMAFGVNFQFVMGYLFYPIAWILGIPSGEALQAGSIMATKLVTNEFVAMMDLGKIAA
                     QLSPRTIGILSIFMVSFANFSSIGIIAGAVKALNEEKGNMVSRFGLKLVYGSTLVSLL
                     SAVIAGVML"
     gene            complement(574747..575247)
                     /locus_tag="AHA_RS02705"
                     /old_locus_tag="AHA_0540"
                     /db_xref="GeneID:4488880"
     CDS             complement(574747..575247)
                     /locus_tag="AHA_RS02705"
                     /old_locus_tag="AHA_0540"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017412797.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_011704513.1"
                     /db_xref="GeneID:4488880"
                     /translation="MTAQGHLLFSVTCTLLAHKLQLTPALADASLWHTIPAALASALL
                     PDLDHPRSVLGQRLPWISKPLSRLFGHRGFTHSLLAVAAAIWGLDQSLAPALLPTGVK
                     DALIIGYLSHLLGDWLTPAGIPLLWPSKRRYRLPGWPLKSGSAVETSFCTLTLLAAGY
                     WAHWPG"
     gene            complement(575340..575894)
                     /locus_tag="AHA_RS02710"
                     /old_locus_tag="AHA_0541"
                     /db_xref="GeneID:4488881"
     CDS             complement(575340..575894)
                     /locus_tag="AHA_RS02710"
                     /old_locus_tag="AHA_0541"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308410.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome b561"
                     /protein_id="WP_011704514.1"
                     /db_xref="GeneID:4488881"
                     /translation="MTTSEVKVWDPLIRVFHWATVTLCLLNFFVLEEGSKPHKYAGYT
                     VGILLIIRLLWGLVGPHYARFGQWWPTPARVRYYLRQLAQGSHPYYLGHNPVGALMIW
                     LLLLSLVGTVVTGWLTTWDAFWGEDWLEELHGIIANTLMAAVGVHAAVVILTDRLTRS
                     DLVRAMVLGKKRVPADAKVEDPRS"
     gene            complement(575943..576212)
                     /locus_tag="AHA_RS02715"
                     /old_locus_tag="AHA_0542"
                     /db_xref="GeneID:4488882"
     CDS             complement(575943..576212)
                     /locus_tag="AHA_RS02715"
                     /old_locus_tag="AHA_0542"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308413.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PepSY domain-containing protein"
                     /protein_id="WP_011704515.1"
                     /db_xref="GeneID:4488882"
                     /translation="MKLTPLLLLIPLLSGAALADPQCTQADKSKWMSEADAQQQIKAM
                     GYDIKKFKVTKTNCYEIYGWDKEKRKVEIYFDPTDLKKVKEEIDE"
     gene            complement(576334..576786)
                     /locus_tag="AHA_RS02720"
                     /old_locus_tag="AHA_0543"
                     /db_xref="GeneID:4488883"
     CDS             complement(576334..576786)
                     /locus_tag="AHA_RS02720"
                     /old_locus_tag="AHA_0543"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017412796.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YaiI/YqxD family protein"
                     /protein_id="WP_011704516.1"
                     /db_xref="GeneID:4488883"
                     /translation="MPIWVDADACPIPVKEILYRAAHRAQVVTTLVANQGLRVPPSPF
                     IKTQQVEKGFDVADHVIAQQVKPGDLVITGDIPLASWVIDAGGEALNPRGEIYTRETI
                     KARLGMRNFMEELRSAGVQTGGPAPLNAADKQRFANALDKWLIRGKLS"
     gene            576892..577884
                     /gene="zntB"
                     /locus_tag="AHA_RS02725"
                     /old_locus_tag="AHA_0544"
                     /db_xref="GeneID:4488884"
     CDS             576892..577884
                     /gene="zntB"
                     /locus_tag="AHA_RS02725"
                     /old_locus_tag="AHA_0544"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005315978.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc transporter ZntB"
                     /protein_id="WP_024943648.1"
                     /db_xref="GeneID:4488884"
                     /translation="MNMSKKDEQMDRVPSDVIYGLTLDGRGGMQPLVAGSEIPAQQPG
                     WLHLDYGNPEAARWLLQTPLLNDAARESLLGQSNRPKLVRMGETVLLILRGINHNKDH
                     RPEEMVALRIYITPDLIISSRRRPLLSEQDVFNQLKLGGGADTPADWLVEICDALTDR
                     AGEFVEELHDQILDLEEMVLMRDLPANGRLALIRKQLIMIRRYLSPQRDLVARLANEK
                     ISWLDEDDRRRLLDIADRLRRWLDDLDAGVARTAVLADEINNLMAEATNRRAYQMSVM
                     ALLFLPASFLTGLFGINLGGIPGAESPTAFWIFCGSLVALATGLAVWLKHRRWW"
     gene            577894..578412
                     /locus_tag="AHA_RS02730"
                     /old_locus_tag="AHA_0545"
                     /db_xref="GeneID:4488521"
     CDS             577894..578412
                     /locus_tag="AHA_RS02730"
                     /old_locus_tag="AHA_0545"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704518.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mechanosensitive ion channel"
                     /protein_id="WP_011704518.1"
                     /db_xref="GeneID:4488521"
                     /translation="MTTWESFGVTLLLLLGHTLVRGLIHKSLLALAQTRQVSENRVLY
                     VEHVFHFLLGCATLLILAGVWGLDFSRLVVLASSFFAVLGVAMVAQWSILSNITASIT
                     IFFAFPYKIGDRIRILDKDDSVTGVITEIGLFYVRVRDDNGDLVTYPANLILQKPVRR
                     LEGKGVEPLQPE"
     gene            complement(578455..578703)
                     /locus_tag="AHA_RS02735"
                     /old_locus_tag="AHA_0546"
                     /db_xref="GeneID:4488522"
     CDS             complement(578455..578703)
                     /locus_tag="AHA_RS02735"
                     /old_locus_tag="AHA_0546"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704519.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011704519.1"
                     /db_xref="GeneID:4488522"
                     /translation="MTVSELRQLYQQQAFKEAEILQDAILPGWIVEFRGQDGKLYEMT
                     DTLGCPRYFGSVEEARQHVHLVADCPIQVEHLYRFFER"
     gene            complement(578767..579342)
                     /locus_tag="AHA_RS02740"
                     /old_locus_tag="AHA_0547"
                     /db_xref="GeneID:4488523"
     CDS             complement(578767..579342)
                     /locus_tag="AHA_RS02740"
                     /old_locus_tag="AHA_0547"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005315975.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone"
                     /protein_id="WP_011704520.1"
                     /db_xref="GeneID:4488523"
                     /translation="MSETRPNPLLAPLLTLLRQASGSYKVHELLAELRRQEVIPPLPG
                     DEQLQLFRLNFLIMNALYHLQAELHGEGWWLVISTLDIRLEPLAIREGASALAQGEAL
                     RSYYLDWQVFWQTDREEVEALLGSFWRACERDEHRAEALTLFALPTGAQPDAIRRRWR
                     ELALQHHPDRGGDADTFIRLRWAWEHLKSAK"
     gene            complement(579339..581126)
                     /locus_tag="AHA_RS02745"
                     /old_locus_tag="AHA_0548"
                     /db_xref="GeneID:4488524"
     CDS             complement(579339..581126)
                     /locus_tag="AHA_RS02745"
                     /old_locus_tag="AHA_0548"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349318.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:proton antiporter"
                     /protein_id="WP_164927531.1"
                     /db_xref="GeneID:4488524"
                     /translation="MIALSLAGIALVSVLAQWLAWSLRVPAILFLLLTGLLLGPVSGL
                     LDPDALLGDLLFPLVSLSVAIILFEGALTLHLAELKGIGKVVRNLCSVGMLASFAVIG
                     SAGYFLLGLDWRVAMVLGAVLVVTGPTVVAPMLNVIRPTREVDRILRWEGIVIDPIGA
                     LFAVLVFEAVRLGSQGDLIGHTLLALAKTVGVGSLIGVGAGWLTTLLIRKDWLPVSLH
                     KFGVLALVLVTFSLSNWLSHESGLLAVTVFGIWLANQEGLDLEEVLAFKEDLAVILIS
                     SLFILLAARLDLAQLWQLGPMVLALLCVVQFVARPLCILVSTWGSDLSWRARALLGWI
                     APRGIVAAAVSASFAISLHQAGIPDADKLVPLVFAVIISTVVLQSLTSAPLAGLLKMR
                     QSAPNTWLIIGANSVARAIGKALADQGVPVQLCDPAWEFCKQARMSNLPCYFGNPQSE
                     HAELHLPLTSISTVLALSPNRHNNALGVLHFAHLYGEEKVYSLRSSEQHGKANRESAT
                     FRARQNLFGPDINYARLSGLLSRGGQIKATRLSEAFDWTQYQEANPGAIPLFVLDGKG
                     RARIVTGPVEPLAGELLIALQPPKETATP"
     gene            complement(581303..581824)
                     /locus_tag="AHA_RS02750"
                     /old_locus_tag="AHA_0549"
                     /db_xref="GeneID:4488525"
     CDS             complement(581303..581824)
                     /locus_tag="AHA_RS02750"
                     /old_locus_tag="AHA_0549"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010672759.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MltR family transcriptional regulator"
                     /protein_id="WP_005308438.1"
                     /db_xref="GeneID:4488525"
                     /translation="MTTHQEDEVLERLNEQDGPRGFFLEVVTILEEAVDSLMRRAFRQ
                     EEYAVKYAIEPLLNQSGPLGQLEVRLKLIFALGLISLERYQDLEAYLKIRDFLVRDPK
                     DYRFSDKPIRDLLARLHGVSQGGMMPQEAPANEEDWPFYQMQLNRLDQVVRSALVLAV
                     ADCVTELHKESPI"
     gene            complement(581933..583078)
                     /locus_tag="AHA_RS02755"
                     /old_locus_tag="AHA_0550"
                     /db_xref="GeneID:4488526"
     CDS             complement(581933..583078)
                     /locus_tag="AHA_RS02755"
                     /old_locus_tag="AHA_0550"
                     /EC_number="1.1.1.17"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017412793.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mannitol-1-phosphate 5-dehydrogenase"
                     /protein_id="WP_016349320.1"
                     /db_xref="GeneID:4488526"
                     /translation="MKTLHFGAGNIGRGFIGKLLADASHQVTFADVNETLIDQLNHRQ
                     EYKVHVVGADQKLDVVRNVAAVSSAGHEVIARIITADLVTTAVGPNILDKIASTLAKG
                     LQARFDAGNLTPLNVIACENMVRGTSHLKQEVLKYLPVAYHATLDACIGFVDSAVDRI
                     VPPAAANDDPLEVTVESFSEWIVDQTQFKGELPQVAGMEPTDNLMAFVERKLFTLNTG
                     HIVTAYLGKLRGYRTIREAIEDPLIRSKVRRAMEESGAVLVQRYGFDPRLHAAYIEKI
                     LARFANPYLVDEIDRVGRQPLRKLAAGDRLVKPLLGTLEYGLPSDHLQEGIAAALHYR
                     NADDPQAVELQQLLAELGPAQALARITGLAADSDIVSAIVTRYGNLK"
     gene            complement(583116..585038)
                     /locus_tag="AHA_RS02760"
                     /old_locus_tag="AHA_0551"
                     /db_xref="GeneID:4488527"
     CDS             complement(583116..585038)
                     /locus_tag="AHA_RS02760"
                     /old_locus_tag="AHA_0551"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005363103.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS mannitol transporter subunit IICBA"
                     /protein_id="WP_011704523.1"
                     /db_xref="GeneID:4488527"
                     /translation="MLSPDTKVKIQNFGRFLSNMVMPNIGAFIAWGFITALFIPTGWL
                     PSETLAKLVGPMITYLLPLLIGYTGGKLMGGERGGVVGAITTMGVIVGTDIPMFMGAM
                     MVGPLGGWAIKRFDKAMEGRVKSGFEMLVNNFSAGLIGMLLAILAFFVIGPFVKVLSG
                     VLAGGVGFLVDNNLLPLTSIFVEPAKILFLNNAINHGIFSPLGIQQATEHGRSIFFLI
                     EANPGPGMGVLLAYMVFGRGAAKQSAAGASIIHFFGGIHEIYFPYVLMNPRLILAVIA
                     GGMTGVFTLTLFNAGLVSPASPGSIFAVLLMTPKASLIGVLLSIVASTTVSFLVAAVF
                     VRAQQPEADEADALGEATRKMKAMKGAKPETAAAKKPGGELMAVRNIVVACDAGMGSS
                     AMGAGLLRKRVQAAGLDISVTNRAIDQLDDQVDWVITHKDLTERARRHAPHAHHISLT
                     NFLDNGLYQELVQSLTQAVNDDVANPQLLVAANDDSYEPQAAEVFTLSRHDVHLGLKA
                     DNKEAAIRAAGKLLAERGYVAPDYVNAMLEREQLVSTYLGESIAVPHGTIAAKEFVKR
                     TGIVICQYPAGVAFGEEADEVARLVIGIAARNDEHMQVITRLTNALDEPGLIDRLAST
                     QDPQEFLDLLGAEQAA"
     gene            complement(585493..586539)
                     /locus_tag="AHA_RS02765"
                     /old_locus_tag="AHA_0552"
                     /db_xref="GeneID:4488528"
     CDS             complement(585493..586539)
                     /locus_tag="AHA_RS02765"
                     /old_locus_tag="AHA_0552"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005315957.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1624 domain-containing protein"
                     /protein_id="WP_011704524.1"
                     /db_xref="GeneID:4488528"
                     /translation="MTTPHNRLEGLDLARAMALIGMVLVNFRIAMGVLAGGPTWLKPL
                     LDALEGRSAASFVVLAGIGLGLSTRKLAWSAAMSHTARRALFLLIVGLLNYLVFPADI
                     IHYYAVYFLLGACCLRLPSPWLLALIPLLAASFVGLLFLLDYDRGWQWHSFSYPEFWT
                     LAGFIRNLLFNGWHPVVPWLGFLLYGLWLSRQSLANPVTQRWLLAGGVSAMALAKGLS
                     LWLPTLLPAPELAPLLATQPIPPAPLYLLFGMGAASTLIALCLWLGRALPEARWWRVW
                     LPVGRQTLTLYLAHIMFGMGVLEAIGWLQGQDLPEVVLAASLFALAALLFANLWSLRF
                     ERGPLEWLMRRLCG"
     gene            complement(586561..587154)
                     /locus_tag="AHA_RS02770"
                     /old_locus_tag="AHA_0553"
                     /db_xref="GeneID:4488529"
     CDS             complement(586561..587154)
                     /locus_tag="AHA_RS02770"
                     /old_locus_tag="AHA_0553"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308445.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR/AcrR family transcriptional regulator"
                     /protein_id="WP_164927532.1"
                     /db_xref="GeneID:4488529"
                     /translation="MTTNNLRLEQRREQIIQAALGCFIERGFHQTGMRDIAAAAGVSL
                     GNLYNHFARKEELIALIASLEAAELQPLLDELVQGPARAALARFAAGYLAWSLTPENL
                     LLGTEILAELTRHPEMAATFASNQRQLCDTLAAAVRRGQQAGELAAHLQPDLTAQLLL
                     DALEGQAVRHALALHPEQAPVEQRLPSLLDQLLGPAR"
     gene            complement(587343..589364)
                     /locus_tag="AHA_RS02775"
                     /old_locus_tag="AHA_0554"
                     /db_xref="GeneID:4488530"
     CDS             complement(587343..589364)
                     /locus_tag="AHA_RS02775"
                     /old_locus_tag="AHA_0554"
                     /EC_number="3.1.13.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349324.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exoribonuclease II"
                     /protein_id="WP_011704526.1"
                     /db_xref="GeneID:4488530"
                     /translation="MFQDNPLLAQLKQQIRENIPKKEGVIRASDRGFGFLEVDEKTSY
                     FVPPPYMKKVMHGDRVSALIRTEKEKEVAEPDALLEQSVTRFVARVKMFRDRLNVVAD
                     HPLIKDAIKARVKKGLDEKEFKEGDWVVATLKRHALVDGNFSAEITQTIASQEDHNVP
                     WWVVLARHNLAQVEPADLPEWKVIEEEELPRTDLTATPFFTIDGAKTKDMDDALAIRK
                     LDNGWELLVAIADPTAYVAEGSELDKEAAQRAFTVYMPGRNVPMIPRTLSDELCSLKE
                     GEERNTLCARLLIAEDGLLLEETEFFAARISSHARLTYDDVSDWAEHGKQLDIDAGVL
                     AQLPLMKAMTEARIAWRTEHALVFPDRPDYDFELGENGEVLAIHVEPRRIANRMVEES
                     MIAANICAGRVLGKQVGYGIFNVHTGFDEESLDGAIDLLKSAEAPFEKEEIASLSGFC
                     ALRRWIDNLDTRWLDGKIRRFQSYALMSAEPGAHYGLGLDAYATWTSPIRKYGDMVNH
                     RLLKAVIAGKTPGERPSLELTEHLTACRRLHRMVERDIGDWLYVRYLKADAGTDKVFN
                     AEIIDVMRAGLKLRLRENGAVVFMPARHILDNKDRLECNWDNGRVYLDKTEVVYELGQ
                     IIEVKLTEAVEETRSLIAKPAVELVPGPAPVAPTSEADATPADEAPKAE"
     gene            complement(589465..590364)
                     /locus_tag="AHA_RS02780"
                     /old_locus_tag="AHA_0555"
                     /db_xref="GeneID:4488531"
     CDS             complement(589465..590364)
                     /locus_tag="AHA_RS02780"
                     /old_locus_tag="AHA_0555"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704527.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator ArgP"
                     /protein_id="WP_011704527.1"
                     /db_xref="GeneID:4488531"
                     /translation="MKALDYKLLLALDAVMQEQNFERAAQRLHITQSAISQRIKQLEQ
                     QFAEPLLIRGQPLQATALGQKLLAHYRQVRQLELELAGELSPAEPQAPIRVSIAVNAD
                     SLATWFLPALAPLLEQHPIELNLLVDDESRTLDRVREGQAFGAVSLHGQPLAGCCVDE
                     LGEMRYLLTASPAFVARHFPQGLTLAALAKAPAVAFDQRDDMHVSYMARHFGLEPGGY
                     PCHTVRSSEAFVAMAEQGLACCLIPELQIRRQLAEGSLLDLSPDQHLVERLYWHRWVL
                     ERGLHKQISQRLIEQGRRALQPG"
     gene            complement(590632..591255)
                     /locus_tag="AHA_RS02785"
                     /old_locus_tag="AHA_0556"
                     /db_xref="GeneID:4488532"
     CDS             complement(590632..591255)
                     /locus_tag="AHA_RS02785"
                     /old_locus_tag="AHA_0556"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005315937.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_011704528.1"
                     /db_xref="GeneID:4488532"
                     /translation="MLVFKGKLKEHPRWEVENELYRFRNRVFSDRLGWDVESHRGLEQ
                     DSFDTPDTHWVLIEDEEGLCGCIRLLSCAQDYMLPSIFPTALAGEAPPRSNDVWELTR
                     LAIDAERAPRLGNGISELTCIIFREVYAFAKAQGIRELVAVVSLPVERIFRRLGLPIE
                     RLGHRQAVDLGAVRGVGIRFHLDERFARAVGQPLQGAYDEARELVTE"
     gene            591318..592103
                     /locus_tag="AHA_RS02790"
                     /old_locus_tag="AHA_0557"
                     /db_xref="GeneID:4488533"
     CDS             591318..592103
                     /locus_tag="AHA_RS02790"
                     /old_locus_tag="AHA_0557"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017785811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_011704529.1"
                     /db_xref="GeneID:4488533"
                     /translation="MKQDQLLEYLEHFTSVTDGDRLAELIGRFTLGMGYDYYRFALII
                     PMSMQRPKVVLFNQCPDSWVQAYTANHMLACDPIIQLARKQTLPIYWNRLDERARFLQ
                     EGSLDVMGLAAEFGLRNGISFPLHGAAGENGIILSFITAERASSDLLLESSPILSWMS
                     NYIFEAAIRIVRVSLREDDPQEALTDRETECLFWASEGKTSGEIACILGITERTVNYH
                     LNQVTRKTGSMNRYQAIAKGVSSGILLPNLEQVVVTNFPKLMQ"
     gene            592316..592936
                     /locus_tag="AHA_RS02795"
                     /old_locus_tag="AHA_0558"
                     /db_xref="GeneID:4488534"
     CDS             592316..592936
                     /locus_tag="AHA_RS02795"
                     /old_locus_tag="AHA_0558"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349327.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid transporter"
                     /protein_id="WP_011704530.1"
                     /db_xref="GeneID:4488534"
                     /translation="MFATTLQGFTLGLAMIIPIGAQNAFVLSRGIHRNHHLLTATLCC
                     LCDLVLIGIGVFGGANLLAASPIGLALLTWGGVLFLGWFGIRSLRSAWRGQGAKLADS
                     PQLMGVKSVLAMTLGVTLLNPHVYLDTLMLLGSFGSQFAEELRPAFAAGAMLASLVWF
                     YSLAFGAAALSPWLARGRVQQAIDTIVGFIMLGLALQLASGALLAS"
     gene            593063..595042
                     /locus_tag="AHA_RS02800"
                     /old_locus_tag="AHA_0559"
                     /db_xref="GeneID:4488535"
     CDS             593063..595042
                     /locus_tag="AHA_RS02800"
                     /old_locus_tag="AHA_0559"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010635239.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional 2',3'-cyclic-nucleotide
                     2'-phosphodiesterase/3'-nucleotidase"
                     /protein_id="WP_164927533.1"
                     /db_xref="GeneID:4488535"
                     /translation="MKLGAIAAIVLLSACSNENDSKAQPGEVALRLIQTSDIHSNVLG
                     YDYYQNKEDRKFGLSRTALLIRAARAENPNNLLLDNGDLIQGTPLADYIFEQSGAGYL
                     DKQAHPVFKAMNELGYDAGNLGNHEFNYGLDYLTKTLQGAKFPYVNANVFEAGAFKRD
                     AKGQIDWSGNKFTPYLLLERKVKDDKGQLQTVKVGILGLTPPQVLQWDKRHLEGKVVV
                     ADMVETANHYVPELRAKGADIVVVVAHTGINASSYEAMMENSAWHLAKVKGVDALMLG
                     HAHKNFPGDFPDLPEVDNKAGTLSGIPTVMPGYWGNHLGIIDLKLEQVDGKWQVKQSQ
                     ASLRKIDSSEGSAVDQRVVDLVQADHDATNQWLDEPLGKITSSIHSFFALVQDDPSVQ
                     LVSDAQRKHAEQLQKDGLLKESYPILSVAAPFRGGRNGINDFTYVAQGDISLRNVSDL
                     YIYPNTLQVVEVNGATVKEWLEMSAGQFNQIDTGKTEVQWLVNEKFPTYNFDVIDGVN
                     YEVDITQPARYNKEGAKVSDGQRISSLTFNGQPIDPTQKFYVVTNNYRASGGGHFPGI
                     DGSNIVHEDPFETREIIAQYLKAQSADNPAGFSPAANNNWHMKALPANVDVRLYSSPR
                     EEAKQLAGADLEYKSTLPMDDAQHPGYAIFRLIRQ"
     gene            complement(595108..595584)
                     /locus_tag="AHA_RS02805"
                     /old_locus_tag="AHA_0560"
                     /db_xref="GeneID:4488536"
     CDS             complement(595108..595584)
                     /locus_tag="AHA_RS02805"
                     /old_locus_tag="AHA_0560"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005315904.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine zipper 2TM domain-containing protein"
                     /protein_id="WP_005308463.1"
                     /db_xref="GeneID:4488536"
                     /translation="MLKRITLIALLATTTATTLSGCANSDVYSGDVYTKDRAKQVQTV
                     SYGTILSTRPVKIQADENSLIGTIGGAVVGGLLGSTIGGGRGSDIAAAGGAIAGAAAG
                     KAAGDKLNQVDGVELEIKKENGESIVVVQKASPTFVPGARVRMTQGNGTINVAVVN"
     gene            complement(595722..596174)
                     /locus_tag="AHA_RS02810"
                     /old_locus_tag="AHA_0561"
                     /db_xref="GeneID:4488537"
     CDS             complement(595722..596174)
                     /locus_tag="AHA_RS02810"
                     /old_locus_tag="AHA_0561"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005315886.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_011704532.1"
                     /db_xref="GeneID:4488537"
                     /translation="MHQPPVLRVARHTDMHAIWQIDVNVFGEDVYPGFFFRQAMDLWP
                     ELLLVAELDGKLLGYALGGLGQDRSQGWLLSLAVLPEARGFGLAERMMLQVEQSLLTL
                     GIERVRLTVDPANPAQRLYFRLGYQQLAEERDYFGPGEDRLLLEKRLG"
     gene            complement(596295..596690)
                     /locus_tag="AHA_RS02815"
                     /old_locus_tag="AHA_0562"
                     /db_xref="GeneID:4488538"
     CDS             complement(596295..596690)
                     /locus_tag="AHA_RS02815"
                     /old_locus_tag="AHA_0562"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005355031.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrous oxide-stimulated promoter family
                     protein"
                     /protein_id="WP_045791081.1"
                     /db_xref="GeneID:4488538"
                     /translation="MTTHHSHPARPARADKAPVHPRLKREQQTVSAMIRLYCDHHHQD
                     PVCRHCQQLQEFAHQRLRRCRYGHGHKPTCANCHIHCYAPAMRKQIQLVMKWSGPRML
                     WHHPWLALRHLLDSRRKAPKRPGSRPLPP"
     gene            complement(596803..598605)
                     /locus_tag="AHA_RS02820"
                     /old_locus_tag="AHA_0563"
                     /db_xref="GeneID:4488539"
     CDS             complement(596803..598605)
                     /locus_tag="AHA_RS02820"
                     /old_locus_tag="AHA_0563"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010635236.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminopeptidase P family protein"
                     /protein_id="WP_011704534.1"
                     /db_xref="GeneID:4488539"
                     /translation="MNHFEIIETRVAQVRAELAMMELDAFIVPHDDEHLGEYIPAYAE
                     RLDWITGFNGSAGLAIILAQRAALFIDGRYTVQARMQAPAELFEFLHLVEDPHVQWLA
                     DQLPSGSRVGFDARLHSLAWYHNAKAVLTERGIELVRVEQNPIDLHWSDRPAPTKNPA
                     ILYSEALAGQSSQAKREMLASDLRKRGLDAVLLTQAEPINWLLNLRGRDVERLPVVLG
                     FAVLYANATMDFFVDTDKIDCFAFSQHVGQDVSVYPIDKLGDVLQRIGEDQQKVLADP
                     NTANAWTQLVMEEAGAILVAGQDPTMLPKACKNEVELAGMRAAHLRDGVAVTRFLAWL
                     DRLIASGEFDGVDEGTLADQLEAFRREQEHYVEPSFDTISALGPNAAMCHYRHTNGTP
                     RTFGQDSIYLVDSGAQYLDGTTDITRTLKVGELTDEHKAMFTRVLQGHIALDQARFPR
                     GTAGIQLDVLARQPLWQAGYNYDHGTGHGVGHFLSVHEGPQRIAPKGSLVALQPGMVL
                     SNEPGYYREDAFGIRCENLVVVTEQEQIGELPMLGFERLTYVPFDTRLIDRSLLSPAE
                     FRWINEYHAEVYRRLSPLLEGEDLAWLEQATSLI"
     gene            complement(598639..599304)
                     /locus_tag="AHA_RS02825"
                     /old_locus_tag="AHA_0564"
                     /db_xref="GeneID:4489386"
     CDS             complement(598639..599304)
                     /locus_tag="AHA_RS02825"
                     /old_locus_tag="AHA_0564"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017408942.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_011704535.1"
                     /db_xref="GeneID:4489386"
                     /translation="MTPPYKTRTQMVMENLRGRILRGEFPAGAPLRQDAIAKELAVSR
                     IPVREALMQLEAQGLVKFEAHRGAVVTMLDAAAIEELFYLRALLEADTLFHAVDLMTE
                     ETFARAQAILAQFDQALESGTQIERWAELNHSFHATLYQAAGRPQALELIAQINLSCD
                     RYVRFELLFASDGVDKAEREHAQLLELCRARRKHEAVVLLKQHIEAAGQSIKRILDSG
                     HNH"
     gene            complement(599480..601105)
                     /gene="pckA"
                     /locus_tag="AHA_RS02830"
                     /old_locus_tag="AHA_0565"
                     /db_xref="GeneID:4489387"
     CDS             complement(599480..601105)
                     /gene="pckA"
                     /locus_tag="AHA_RS02830"
                     /old_locus_tag="AHA_0565"
                     /EC_number="4.1.1.49"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007471102.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate carboxykinase (ATP)"
                     /protein_id="WP_011704536.1"
                     /db_xref="GeneID:4489387"
                     /translation="MTIVAEPTLAKQLGLDQYGIKNSTEILRNPSYDQLFAEETRADL
                     EGFERGVVTELGAVNVNTGIFTGRSPKDKYIVKDATTQNTVWWSDQGKNDNKAISPEV
                     WSHLKSLVTKQLSGKRLFVVDGFCGANPDTRLAVRIITEVAWQAHFVKNMFIRPSDEE
                     LKTFKPDFVVMNGAKCTNPNWKEQGLNSENFVAFNLTEKIQLIGGTWYGGEMKKGMFS
                     MMNYFLPLRGIASMHCSANVGQDGDVAIFFGLSGTGKTTLSTDPKRQLIGDDEHGWDD
                     DGVFNFEGGCYAKTIKLSKEAEPDIYNAIRRDALLENVTVAADGTIDFDDGSKTENTR
                     VSYPIYHIENIVKPVSKAGHANKVIFLTADAFGVLPPVSKLTKEQTKYHFLSGFTAKL
                     AGTERGITEPTPTFSSCFGAAFLSLHPTKYGQELVKRMEAAGAEAYLVNTGWNGTGKR
                     ISIKDTRAIIDAILDGSIEKAETKVLPIFNLEVPTALHDVNPAILDPRDTYANKAEWD
                     AKAVDLAGRFIKNFERFTDNEEGKRLVAAGPQL"
     gene            complement(601255..602139)
                     /gene="hslO"
                     /locus_tag="AHA_RS02835"
                     /old_locus_tag="AHA_0566"
                     /db_xref="GeneID:4489388"
     CDS             complement(601255..602139)
                     /gene="hslO"
                     /locus_tag="AHA_RS02835"
                     /old_locus_tag="AHA_0566"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308471.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Hsp33 family molecular chaperone HslO"
                     /protein_id="WP_024943636.1"
                     /db_xref="GeneID:4489388"
                     /translation="MSNQDLLYRYLFEEYEVRGELVQLDHTYRHVVEAQNYPVQVQKL
                     LGELLVATSLLTATLKFEGSITVQLQGNGPVRLAVINGDNNQQLRGVARYEGELPSDD
                     KLQSLIGEGQLVITITPEQGERYQGIIALDADTLAGCLEHYFAQSEQLATKLWIRTGY
                     HQGEPRAAGILLQELPAQSEDHSDDFEHLTQLTSTIKDEELFGLEAEEILYRLYHQDK
                     VRVFDPQAVEFRCTCSRARCEGALLQIEKEEVMEMVQELGKIDMHCDYCGAQYQFDGI
                     DVETLFSRAPGNDANKLH"
     gene            complement(602248..602646)
                     /gene="hslR"
                     /locus_tag="AHA_RS02840"
                     /old_locus_tag="AHA_0567"
                     /db_xref="GeneID:4489389"
     CDS             complement(602248..602646)
                     /gene="hslR"
                     /locus_tag="AHA_RS02840"
                     /old_locus_tag="AHA_0567"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010635233.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-associated heat shock protein Hsp15"
                     /protein_id="WP_041216200.1"
                     /db_xref="GeneID:4489389"
                     /translation="MPNPAETPALVRLDKWLWAARFYKTRSLARDQIEGGKVHYNGQR
                     SKPGKHVEVGALIRFWQGQDEREVRVLEVSEQRKSAPLAQQLYEETEASLKKRAENSE
                     ARRFNSQFAPSPERRPDKQERRQLIKVKQY"
     gene            602786..603709
                     /gene="gspC"
                     /locus_tag="AHA_RS02845"
                     /old_locus_tag="AHA_0568"
                     /gene_synonym="exeC"
                     /db_xref="GeneID:4489390"
     CDS             602786..603709
                     /gene="gspC"
                     /locus_tag="AHA_RS02845"
                     /old_locus_tag="AHA_0568"
                     /gene_synonym="exeC"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704539.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GspC family type II secretion system variant
                     ExeC"
                     /protein_id="WP_011704539.1"
                     /db_xref="GeneID:4489390"
                     /translation="MPYTIANRFGCQKILINMTLPFRDDLLSSLLARCKTVPLSRFSQ
                     PLFWLLLLLLAHQCAGLTWRLLDLGSRPVSQSWQPSVVANQSQGANRLDLSGVSRLAL
                     FGKAKQQAQAADVVAADAPKTQLNAQLNGVLASSDPAKSIAIIAHNGLQNSYGIGDLI
                     DGTQAKIRQVFPDRVIIERDGRDETLMLDGEEYGKPLPKPGNQDGKLSSVRNELMGNP
                     GKITDYLNISPVRVDGRMVGYRLNPGSNPELFNQLGLVANDMAVSINGLDLRDNAQAM
                     QAMQQVAGATEMTVTVERQGQLYDVYVGLSE"
     gene            603731..605764
                     /gene="gspD"
                     /locus_tag="AHA_RS02850"
                     /old_locus_tag="AHA_0569"
                     /gene_synonym="exeD"
                     /db_xref="GeneID:4489391"
     CDS             603731..605764
                     /gene="gspD"
                     /locus_tag="AHA_RS02850"
                     /old_locus_tag="AHA_0569"
                     /gene_synonym="exeD"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704540.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GspD family T2SS secretin variant ExeD"
                     /protein_id="WP_011704540.1"
                     /db_xref="GeneID:4489391"
                     /translation="MINKGKGWRLATVAAALMMAGSAWATEYSASFKNADIEEFINTV
                     GKNLNKTIIIEPSVRGKINVRSYDLLNEDQYYQFFLSVLDVYGFAVVPMDNGVLKVVR
                     SKDAKTSAIPVVDESNPGSGDEMVTRVVPVRNVSVRELAPLLRQLNDNAGGGNVVHYD
                     PSNVLLITGRAAVVNRLVEVVRRVDKAGDQEVDIVKLKYASAGEMVRLVTNLNKDGNN
                     QGGNTSLLLAPKVVADERTNSVVVSGEPKARARIIQMVHQLDRDLQSQGNTRVFYLKY
                     GKAKDLVEVLKGVSSSIEADKKGGAATTTGGGGASIGGGKLAISADETTNALVITAQP
                     DVMAELEQVVAKLDIRRAQVLVEAIIVEIADGDGLNLGVQWANTNGGGTQFTDTNLPI
                     GSVAIAAKDYQKNGTTTGLAALAKDFNGMAAGFYKGNWAALVTALSTNTKNDILSTPS
                     IVTMDNKEASFNVGQEVPVQSGSQSSTTSDQVFNTIERKTVGTKLVVTPQINEGDSVL
                     LNIEQEVSSVAQTQAPGTSTLGPTFDTRTIKNAVLVKSGETVVLGGLMDEKTQEKVSK
                     VPLLGDIPVLGYLFRSTSNSTSKRNLMVFIRPTILRDADVYSGISSNKYSQFRSEQQE
                     AAAQEGYLTSPKRQVLPQYGQGVTMSPEVQKQLQQTQQAPQASGGSQPFVGNK"
     gene            605764..607269
                     /gene="gspE"
                     /locus_tag="AHA_RS02855"
                     /old_locus_tag="AHA_0570"
                     /gene_synonym="exeE"
                     /db_xref="GeneID:4489392"
     CDS             605764..607269
                     /gene="gspE"
                     /locus_tag="AHA_RS02855"
                     /old_locus_tag="AHA_0570"
                     /gene_synonym="exeE"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005327470.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GspE family T2SS ATPase variant ExeE"
                     /protein_id="WP_011704541.1"
                     /db_xref="GeneID:4489392"
                     /translation="MAAYQLDGVDMPAALPELPFAFARNFGVILTERQGAPVLLCRQG
                     VTPQTLLEVRRVAGCAFTVEQMDREAFEELLMAHYQRDSSEARQLMEDLGNEMDFFAL
                     AEELPQSEDLLDADDDAPIIRLINAMLSEAIKEEASDIHIETFERALVIRFRIDGVLR
                     EILRPHRKLASLLVSRIKVMSRMDIAEKRVPQDGRISLRIGGRAVDVRVSTMPSSYGE
                     RVVLRLLDKNNVRLELKQLGMTLANRNIISELIRKPHGIILVTGPTGSGKSTTLYAAL
                     SEINSRDRNILTVEDPIEYDLEGVGQTQVNSKVDMTFARGLRAILRQDPDVVMVGEIR
                     DLETAQIAVQASLTGHLVMSTLHTNTAIGAITRMRDMGIEPFLLSSSLLAVLAQRLVR
                     TLCPDCRAPRAITEQERIAMGIELAPDQQVWRPVGCEQCNHTGYRGRTGIHELVVIDE
                     AVREAIHSASGELAIERLIRGHTPSIRRDGIDKVLKGQTSLEEVLRVTRED"
     gene            607271..608491
                     /gene="gspF"
                     /locus_tag="AHA_RS02860"
                     /old_locus_tag="AHA_0571"
                     /gene_synonym="exeF"
                     /db_xref="GeneID:4489393"
     CDS             607271..608491
                     /gene="gspF"
                     /locus_tag="AHA_RS02860"
                     /old_locus_tag="AHA_0571"
                     /gene_synonym="exeF"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005350050.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GspF family T2SS innner membrane protein variant
                     ExeF"
                     /protein_id="WP_011704542.1"
                     /db_xref="GeneID:4489393"
                     /translation="MAAFEYKALDGKGRNKSGVLEGDSARQVRQLLREQGLTPLEVNE
                     TTEKAKREANRFVLFRRGASTAELAMITRQLATLVGAGLTIEEALKAVAEQCEKAHLR
                     SMVATVRSKVVEGYSLADSLAAFPHVFDQLFRSMVAAGEKSGHLEKVLNRLADYTEQR
                     QHMRTKLLQAMIYPIVLTCVAIGVISILLTAVVPKVVAQFEHMGQQLPATTRFLIGTS
                     ELMQHYGLWFLLLLLVGGFVWRWWLTDDKRRRHWHQLILRLPVIGRVSRGLNTARFAR
                     TLSILNASAVPLLEGMKISGEVLSNDFARMRIGEATERVREGTSLRKSLDETKIFPPM
                     MLHMIASGEQSGELDNMLERAADNQDREFETQVNIALGVFEPMLVVSMAGVVLFIVMS
                     ILQPILELNNMVNL"
     gene            608607..609038
                     /gene="gspG"
                     /locus_tag="AHA_RS02865"
                     /old_locus_tag="AHA_0572"
                     /gene_synonym="exeG"
                     /db_xref="GeneID:4489394"
     CDS             608607..609038
                     /gene="gspG"
                     /locus_tag="AHA_RS02865"
                     /old_locus_tag="AHA_0572"
                     /gene_synonym="exeG"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005315859.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GspG family T2SS major pseudopilin variant ExeG"
                     /protein_id="WP_005308483.1"
                     /db_xref="GeneID:4489394"
                     /translation="MQKRRQSGFTLLEVMVVIVILGILASLVVPNLMGNKEKADQQKA
                     VSDIVALENALDMYKLDNNRYPTTEQGLDALVNKPTAAPEPRSYREGGYIKRLPQDPW
                     GNPYQMLSPGQFGKIDIFSMGLDGEAGTDDDIGNWNLKDFQ"
     gene            609086..>609196
                     /locus_tag="AHA_RS02870"
                     /pseudo
                     /db_xref="GeneID:44141872"
     CDS             609086..>609196
                     /locus_tag="AHA_RS02870"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308485.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin-type N-terminal cleavage/methylation
                     domain-containing protein"
                     /db_xref="GeneID:44141872"
     gene            609202..609753
                     /gene="gspH"
                     /locus_tag="AHA_RS02875"
                     /old_locus_tag="AHA_0573"
                     /gene_synonym="exeH"
                     /db_xref="GeneID:4489395"
     CDS             609202..609753
                     /gene="gspH"
                     /locus_tag="AHA_RS02875"
                     /old_locus_tag="AHA_0573"
                     /gene_synonym="exeH"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704543.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GspH family T2SS minor pseudopilin variant ExeH"
                     /protein_id="WP_011704543.1"
                     /db_xref="GeneID:4489395"
                     /translation="MKHSRQAGFTLLEVLLVAMLMGLVATAVTLSMGGARGDRELDKQ
                     ARRFMAVLQQAQEYSVMDGRLVGLRVEDNSWQFMQRAAKDRKWQVMSGDKLLDRVELP
                     DNMRLAIELEGFSWRTESDEKYEKGRDEKERTPQVFIFPGGELTPFVLTLTQQDDDLR
                     YVRTVKADEFGRLRLLQDEEEEE"
     gene            609750..610109
                     /gene="gspI"
                     /locus_tag="AHA_RS02880"
                     /old_locus_tag="AHA_0574"
                     /gene_synonym="exeI"
                     /db_xref="GeneID:4489396"
     CDS             609750..610109
                     /gene="gspI"
                     /locus_tag="AHA_RS02880"
                     /old_locus_tag="AHA_0574"
                     /gene_synonym="exeI"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704544.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GspI family T2SS minor pseudopilin variant ExeI"
                     /protein_id="WP_011704544.1"
                     /db_xref="GeneID:4489396"
                     /translation="MNARGMTLLEVMVALAVFAIAGLAVMKTASEHLSGLNYLEQKTL
                     ATWVVENQLVQQKLEAKWPGDSWVEGDEQMAGQTWYWRYRGVATADSNFKALDMEVRT
                     TPKADSPVAMIRTYISR"
     gene            610178..610807
                     /gene="gspJ"
                     /locus_tag="AHA_RS02885"
                     /old_locus_tag="AHA_0575"
                     /gene_synonym="exeJ"
                     /db_xref="GeneID:4489397"
     CDS             610178..610807
                     /gene="gspJ"
                     /locus_tag="AHA_RS02885"
                     /old_locus_tag="AHA_0575"
                     /gene_synonym="exeJ"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704545.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GspJ family T2SS minor pseudopilin variant ExeJ"
                     /protein_id="WP_011704545.1"
                     /db_xref="GeneID:4489397"
                     /translation="MIRSQRQAGFTLLEMLVAIAIFAGLSLGAYQVLQGVLTSDEVAK
                     RKEARLSELQLAFSVLERDITQMVPRSGRIDGENNKVLLAASRFGQQSDDWGMAFMRG
                     GWLNPDGMLPRSGLQRVGWRLKDHKLERLSYLYPDPVIGTEPRIQPMLERVTALRLYF
                     YDKGAWKEEWTQRNVLPYGLAVELDLEDYGTIRRQFLIGAGGQRAENGN"
     gene            610897..611922
                     /gene="gspK"
                     /locus_tag="AHA_RS02890"
                     /old_locus_tag="AHA_0576"
                     /gene_synonym="exeK"
                     /db_xref="GeneID:4489398"
     CDS             610897..611922
                     /gene="gspK"
                     /locus_tag="AHA_RS02890"
                     /old_locus_tag="AHA_0576"
                     /gene_synonym="exeK"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704546.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GspK family T2SS minor pseudopilin variant ExeK"
                     /protein_id="WP_011704546.1"
                     /db_xref="GeneID:4489398"
                     /translation="MAIKRGRGRSRTTPGRQGGMALLVVLLILSVMVIIASNMSGRLQ
                     LELRRTANLTAGKQAWWYAMSAEALVSKVLAQDFKDDPNVVSLGQNWARQDAVFPVDD
                     GKLTGRVRDLQSCFNLNSLSVPLKDGISGDDLEKQPYPVKVFKALLKQLEVEDYEAVQ
                     LTDAIRDWTDKDTVLVSSYGAEDAYYEGLTPPYLTANQWMLGTDELRAVRGVSAKLYA
                     RLAPYVCALPNDKLVVNVNTIRPEQSALLVALYLDKVGLDDAKRVLTSRPQKGWKNKK
                     EMTDQMPVQVGNIQGLDAALDVKSSYFEARLIAEVGDTRARLESVFVRGKDNKLVMLR
                     RLNGGAE"
     gene            612042..613226
                     /gene="gspL"
                     /locus_tag="AHA_RS02895"
                     /old_locus_tag="AHA_0577"
                     /gene_synonym="exeL"
                     /db_xref="GeneID:4489399"
     CDS             612042..613226
                     /gene="gspL"
                     /locus_tag="AHA_RS02895"
                     /old_locus_tag="AHA_0577"
                     /gene_synonym="exeL"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704547.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GspL family type II secretion system protein
                     ExeL"
                     /protein_id="WP_011704547.1"
                     /db_xref="GeneID:4489399"
                     /translation="MSESLVIRLGTNAQQPVEWLVWSGGEEEVIASGTLASAHALGEL
                     QERAGGRPAVVLVPGSDLIFRRVSLPGKYSRQSAAALPYLLEEQIASDVDELHLVVLG
                     HQGHEVDLMAVDKEKMQTWLGWLEQAGLKSRQLLPDVLALPQASEGWSALQLGKEWLL
                     RQGPCQGIVADEPLLAMLLAAEPAPVTIHSHTPPPAIAAASWQAADPELPMLLLARGA
                     LASQANLLQGPYRPQTEYSRYWQQWRKVAVVAGALLVVAFAQRGVQLYQLAEQDKALK
                     AEIRQVYTRIFPGESRIVNVRSQMTQHLQQLGQTPQDGVLMVLTELAPTFAEVPGLKP
                     EVLRFDAARGELRLQVTAPGFAEIERFRELAGKRFDVQQGEVRSTEGKVEGALVLKGK
                     SS"
     gene            613223..613714
                     /locus_tag="AHA_RS02900"
                     /old_locus_tag="AHA_0578"
                     /db_xref="GeneID:4489400"
     CDS             613223..613714
                     /locus_tag="AHA_RS02900"
                     /old_locus_tag="AHA_0578"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017765230.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system protein M"
                     /protein_id="WP_011704548.1"
                     /db_xref="GeneID:4489400"
                     /translation="MMDKLQGWWRGISAREQRLVAVGGSVLLIGFCYWVIWQPIGNRI
                     DERERQVLSQQQTLAWLKEKGEEVLALQGGQGHQLDTSGTLEGVVNRTAFNQKIKIAR
                     LQPQGQELQVWIDTVAFDDLLIWLATLADRHGVQVQVIEVARENLAPGLVKVRRLQLS
                     RPQ"
     gene            613776..614531
                     /gene="gspN"
                     /locus_tag="AHA_RS02905"
                     /old_locus_tag="AHA_0579"
                     /gene_synonym="exeN"
                     /db_xref="GeneID:4489401"
     CDS             613776..614531
                     /gene="gspN"
                     /locus_tag="AHA_RS02905"
                     /old_locus_tag="AHA_0579"
                     /gene_synonym="exeN"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704549.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GspN family type II secretion system protein
                     ExeN"
                     /protein_id="WP_011704549.1"
                     /db_xref="GeneID:4489401"
                     /translation="MKQRVLIAVLFLAAYLVFLLAKLPASLVVRYLPLPPLVQLEGVS
                     GTLWSGQVARLQYASESLTQLRWELNGWSLLRFAPEVSLRFGERSGLNGQGVVGWSGA
                     AFGRDITLNVPAPWLLARVPMQLPVPVTVAGQLQLKLDQVAQGNPWCDNLYGNLYWYG
                     ADADTPAGKLVLGDPEIKLTCIDSRLVAELKQGSEAVQVQGKLELQANRQYLFQGTLK
                     PGPDLPEQMKQGLPFLGQPDGQGRFPLRYQGRI"
     gene            complement(614592..615407)
                     /locus_tag="AHA_RS02910"
                     /old_locus_tag="AHA_0580"
                     /db_xref="GeneID:4489402"
     CDS             complement(614592..615407)
                     /locus_tag="AHA_RS02910"
                     /old_locus_tag="AHA_0580"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019840803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="WP_164927534.1"
                     /db_xref="GeneID:4489402"
                     /translation="MNQTLATDALTRSMTEVVDALHGSAFPAALVRLIQQQVAFDCAL
                     LLGVGQRPVYLYDNLHHQRALLFDRYLTRHFSQDPFMQALEQGLPAGVWTLAQVSRGR
                     LDPEYRHHFYQATGWQEEVGLILPVRGGLTLMLFLGRLDKRSSLSRDELARLEALFPL
                     VHSLCRQHWREEAALLAQSPMLPGGADLKATVEQAIASVGGASLTRRERQVAGLLLQG
                     LDTEAIAGTLGIGSGTVKNHRKHLYAKLHLRSRAELFRFFLNHLITAPAGTPP"
     gene            615563..616831
                     /gene="tyrS"
                     /locus_tag="AHA_RS02915"
                     /old_locus_tag="AHA_0581"
                     /db_xref="GeneID:4489403"
     CDS             615563..616831
                     /gene="tyrS"
                     /locus_tag="AHA_RS02915"
                     /old_locus_tag="AHA_0581"
                     /EC_number="6.1.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017408952.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine--tRNA ligase"
                     /protein_id="WP_011704551.1"
                     /db_xref="GeneID:4489403"
                     /translation="MINPHLLDELTRRGLVAQNSDPVALADHLATPRTVYCGFDPTAG
                     SLHIGHLVPLLMLRRFQLAGHTPVALVGGATGLIGDPSFKATERNLNSSETVQGWVAS
                     LSAQIKALLPASEGLAAPLLVNNADWMGQMSALDFLRDIGKHFSVNAMLVRESVRQRL
                     ARPDQGISFTEFSYALLQSQDYAVLNQRLGCTLQIGGNDQWGNITSGMDLTRRLHQAQ
                     VYGMTLPLITKADGTKFGKTEGGAIWLDPALTSPYAFYQFWLGTADEDVYRFLRYYSF
                     MPLTEIEALEAEDAKRQGRKLAQQVLADELTELVHGKGALAAAQRISELLFSGEVARL
                     GESDLAQLAQDGMPGWRIEGETDLVTLLVESGLANSKRIARELLAAGAISLNGEIRRE
                     EPLRAADRLFGRHLLLRRGKKQYRLVTWQG"
     gene            complement(616925..617593)
                     /gene="yrfG"
                     /locus_tag="AHA_RS02920"
                     /old_locus_tag="AHA_0582"
                     /db_xref="GeneID:4489404"
     CDS             complement(616925..617593)
                     /gene="yrfG"
                     /locus_tag="AHA_RS02920"
                     /old_locus_tag="AHA_0582"
                     /EC_number="3.1.3.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005343056.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GMP/IMP nucleotidase"
                     /protein_id="WP_011704552.1"
                     /db_xref="GeneID:4489404"
                     /translation="MPTPLPWHQIDTVLLDMDGTLIDLHFDNHLWQQLVPERYAERLG
                     LPLAEARVQIEAHYQAVSGTLNWYCVDYWSETLGLDIRALKQESLAKIQWRPHVIPFL
                     AALRAAGKQLVLFTNAHPASLSVKDAQLGLAGHLDLMVSTHELGWSKESQHCWQALAE
                     RLAFDPARTLFVDDSERILRAAADYGIGYQLAIQNPDSCQPEQHITAFPAIRDYAELL
                     PLAE"
     gene            617732..618340
                     /gene="nudE"
                     /locus_tag="AHA_RS02925"
                     /old_locus_tag="AHA_0583"
                     /db_xref="GeneID:4489405"
     CDS             617732..618340
                     /gene="nudE"
                     /locus_tag="AHA_RS02925"
                     /old_locus_tag="AHA_0583"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308512.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ADP compounds hydrolase NudE"
                     /protein_id="WP_164927535.1"
                     /db_xref="GeneID:4489405"
                     /translation="MSDLHQRKPVHLSVDTMAHDKSKPEILKAEIVAESRLFKVESLH
                     LKFSNGEERVYERMRGGSRGAVMVVPLFDAHTLLLVREYAAGTHSYELGFPKGLIDPG
                     EDAFEAGNRELMEEAGFGANSLTLLKQVSLAPGYFSSRMDILLARDLFPEQRVGDEPE
                     PLEVIPWPLNRIDELLARPDFTESRSISALLLAQRWLAEQAE"
     gene            618378..619190
                     /gene="cysQ"
                     /locus_tag="AHA_RS02930"
                     /old_locus_tag="AHA_0584"
                     /db_xref="GeneID:4489251"
     CDS             618378..619190
                     /gene="cysQ"
                     /locus_tag="AHA_RS02930"
                     /old_locus_tag="AHA_0584"
                     /EC_number="3.1.3.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005315821.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3'(2'),5'-bisphosphate nucleotidase CysQ"
                     /protein_id="WP_011704554.1"
                     /db_xref="GeneID:4489251"
                     /translation="MQELLAWVPGVKEIAREAGRILHEIYHGGQFERQLKEDATPVTS
                     ADLAADAYLKQALSALTPHVPVLTEEAADIPFSQRANWRQYWLVDPLDGTGEFIAGSG
                     DFATLIALVQDNVPVLGVIYAPESNVLYWAVRGHGAFKEANGEVHPISAMHHEHDQPD
                     SLVVAISRRQKLENLTRRLNPAINYELIPLGSSSLKSCLVAEGAADCYVRLGPTGEWD
                     TAAAQCIVEAAGGRILSLALQPLRYNETESLENPDFIVMGDPDLAWGSILAH"
     gene            619602..620873
                     /locus_tag="AHA_RS02935"
                     /old_locus_tag="AHA_0585"
                     /db_xref="GeneID:4489252"
     CDS             619602..620873
                     /locus_tag="AHA_RS02935"
                     /old_locus_tag="AHA_0585"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017411728.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine transporter"
                     /protein_id="WP_011704555.1"
                     /db_xref="GeneID:4489252"
                     /translation="MSLSVDVTKELSGSCSTTVSATPWRRHDTHWVISLFGTAVGAGI
                     LFLPINLGLGGIWPLIIVSVLAGPMTFLAHRGLARFVLSSSRPHADFTEVAQEHFGKM
                     AGRLISALYFLSIFPILLIYGVGLTNTVESFMINQLGMDAPNRVMLSGLLVFAMIAVM
                     LAGEKAMLRAFAVMVYPLAAILAALSCYLIPQWQWPQLGSLEGGSFLNTVWLALPVTV
                     FAFSHAAAISGFANVQRREYGELAEAKSSLILRNTTVMLVGFVLFFVFSCVLSLSPAQ
                     LAEAKAQNVSVLSYLANITDNPVIVTLGPLIAFIAISSSFLGHFLGARESLKSLIAKP
                     TGLSLAKADRLGIALMFFSIWGAAIINPGILGLMETLSGPVIAMILFIMPVVAIYKVE
                     ALARFRHRWANGFILLTGALAVSALIFSLLK"
     gene            complement(620947..621285)
                     /locus_tag="AHA_RS02940"
                     /old_locus_tag="AHA_0586"
                     /db_xref="GeneID:4489253"
     CDS             complement(620947..621285)
                     /locus_tag="AHA_RS02940"
                     /old_locus_tag="AHA_0586"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019840797.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA-binding protein"
                     /protein_id="WP_010635217.1"
                     /db_xref="GeneID:4489253"
                     /translation="MQTISWQDFEMVELRVGTLVRVEPFPEARRPAYKVWADFGPELG
                     VRKSSAQITDLYQPQELVGRQIVAVVNFPPKQIGPIQSEFLLTGFYRPDGAVVIAIPE
                     QAVQNGAKLG"
     gene            complement(621370..622122)
                     /locus_tag="AHA_RS02945"
                     /old_locus_tag="AHA_0587"
                     /db_xref="GeneID:4489254"
     CDS             complement(621370..622122)
                     /locus_tag="AHA_RS02945"
                     /old_locus_tag="AHA_0587"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308520.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_011704556.1"
                     /db_xref="GeneID:4489254"
                     /translation="MTRPQAASSLSAPFSLRRYQSDICSHSHDHAQLVIPLDGPIEIE
                     VQGQGRRLAPGFACIIAPGERHDYAADPALSFLVQESHWLPGELGERPFIELDQAQRH
                     YLAFLHRMVAEGRHVAGMEQVWLGLLAEAQQAGSRARARLAPRIGKVQRHIEAHLAEP
                     LSNARLAALACLGQSQFKHAFQQQVGMSVSHYIRARRMALARTLLAHTALPVGEIASR
                     CGYQNQGAFGERFLAETGLTPSLWRQQNGRLP"
     gene            complement(622158..622481)
                     /gene="metJ"
                     /locus_tag="AHA_RS02950"
                     /old_locus_tag="AHA_0588"
                     /db_xref="GeneID:4489255"
     CDS             complement(622158..622481)
                     /gene="metJ"
                     /locus_tag="AHA_RS02950"
                     /old_locus_tag="AHA_0588"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005327165.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="met regulon transcriptional regulator MetJ"
                     /protein_id="WP_005308521.1"
                     /db_xref="GeneID:4489255"
                     /translation="MGTEWNGDYVSPYAEHGKKSEQVKKITVSIPLKVLKVLTDERTR
                     RQVNNLRHATNSELLCEAFLHAFTGQPLPCDEDLRKDHPDSVPAEARAIMEALGKEIE
                     DFDAE"
     gene            622690..623853
                     /gene="metB"
                     /locus_tag="AHA_RS02955"
                     /old_locus_tag="AHA_0589"
                     /db_xref="GeneID:4489256"
     CDS             622690..623853
                     /gene="metB"
                     /locus_tag="AHA_RS02955"
                     /old_locus_tag="AHA_0589"
                     /EC_number="2.5.1.48"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005315807.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cystathionine gamma-synthase"
                     /protein_id="WP_011704557.1"
                     /db_xref="GeneID:4489256"
                     /translation="MTHKATQAVRTGIETDQQHGAVVPPIYLSSNYTFADFGEPRQYD
                     YARSGNPTRTNLADALAALEGGAGAVVTGTGMGAVHLVTTALLKAGDLLLAPHDCYGG
                     TWRLFEYLAAKGHYRVQFVDQGDAAALAEALAQQPALVWVETPSNPLLRVVDIAAIAE
                     ASHAAGAKVAVDNTFLSPLLQQPLALGADLVVHSTTKYINGHSDVVGGVAIAKDPELA
                     DSLVWWANCLGLTSGAFDSYLTLRGLRTLAPRLRAHQENTDRILAFLQQQPLVKRIYH
                     PSLPSHPGHDIARRQQSGFGAMLSFELDCSEAGIRAFLAALTLFSVAESLGGVESLVA
                     HPASMTHRAMTPAAQQAAGISSQLLRLSVGIEHGEDLVADLAAAFAQAQQVAK"
     gene            623853..626321
                     /locus_tag="AHA_RS02960"
                     /old_locus_tag="AHA_0590"
                     /db_xref="GeneID:4489257"
     CDS             623853..626321
                     /locus_tag="AHA_RS02960"
                     /old_locus_tag="AHA_0590"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704558.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional aspartate kinase/homoserine
                     dehydrogenase II"
                     /protein_id="WP_011704558.1"
                     /db_xref="GeneID:4489257"
                     /translation="MEQQQQGEIAVATEAGLKRRHVHKFGGSSLADPVCYRRVASILE
                     QQAEQQGGGRELVVVSAAGKTTNRLIQLVELAEAGDEAAGEAISALQAYQQSLIDGLL
                     EGELHLELSQQLADDMQLIAKTLEGQFDRFERNGLLAFGEVWSARLLAALLTSRGDKA
                     IWLDARSFLRAEDGALVKVDTALSSELLKARLAEHAGRIVVTGFIAADMEGRSLLLGR
                     NGSDYSASLLALLADGESTTIWSDVAGVYSADPRRVKEARLLERLSLAEANELARLGS
                     SVLHSRTLQPVADSRQRLTLRCSYNPDEGCTHILRRAPRSGGARIVSSVDQIALIELK
                     VLPQTHYEQTVAAIEAHLARHRLNPLTLQRQPDRRILRLAYTLEVAQGAFELLRDFQL
                     QGSFTGLIQREGYSLVALVGAGVTDNAEQCHRFYQLLADQPLEFVQVAKDGLSLVAVL
                     RQVVLEPLLIALHSALFSRPNRVGLVVFGKGNIGGHWLNLYAREKARLEHELNLALTL
                     YGVFSSEGGLLDEEGLDPLKVQDNFNPKPLIWPELLAQLEQHGFDTLIALDMTASETV
                     SRYYPDFAQLGIHIIAANKFAGAADSEFYQRIKQTCRDHQVQWRYNATVGAGLPIQSS
                     IQMLRQSGDRIQGVSGIFSGTLSWLFQQYDGSRPFSELVDEAWQHGLTEPDPREDLSG
                     QDVRRKLLILAREAGFELDSADIELENLVPVSLRKVSTDQFMDRLKDLDDPIQTAFEG
                     ARRVGKVLRYVARFEHDGKARVGLEALEPHHPFANLLPCDNIFAIESDSYRTNPLVIQ
                     GPGAGREVTAAAIQYDLWQICASL"
     gene            complement(626974..629607)
                     /gene="ppc"
                     /locus_tag="AHA_RS02965"
                     /old_locus_tag="AHA_0591"
                     /db_xref="GeneID:4489258"
     CDS             complement(626974..629607)
                     /gene="ppc"
                     /locus_tag="AHA_RS02965"
                     /old_locus_tag="AHA_0591"
                     /EC_number="4.1.1.31"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349356.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate carboxylase"
                     /protein_id="WP_005308531.1"
                     /db_xref="GeneID:4489258"
                     /translation="MNEKYAALRANVGMLGQLLGKSIKDHQGQAFLDKIETIRQLAKS
                     SRKGNETDRERLLDTLRNLSDDELLPVARAFSQFLNLANVAEQFHTISRRCEEQVCTP
                     DPLEQMFDKLKASNLSQEAIIQAVRELDIDLVLTAHPTEVTRRTLIHKHVQLNDCLEA
                     LELSDLLPRERDKILNRIEQLVNQAWHTNEIREQRPTPVDEAKWGFAVVENSLWPAIP
                     EFMRNLDERLQHHLGVRLPLDAAPVKFTSWMGGDRDGNPFVTAKVTAEVLELGRWMAV
                     SLFYKDIKELTSELSMSDCTDAVRERVGDHPEPYRALVRELREQLRETQEFLTAKVQG
                     QASESRDLVKTTAQLREPLELCYHSLHACGMGNIADGMLLDVLRKLACFGIHLVKLDI
                     RQDGERHGQVFSELTRYLGMGDYAEWSEDDKQAFLLNELNSRRPLIPTDWEPSDETRE
                     TLDTCKVIAQHDPDAFGIYIISMAGAPSDVLAVQLLLKEAGCKFRMPVAPLFETQEDL
                     MAGTAVMERLLSVDWYRGYIQGRQYVMIGYSDSAKDAGMMAAGWAQYAAMESLVALAE
                     ANNLRLTLFHGRGGTVGRGGAPAHQAILSQPPGSLRGGLRVTEQGEMIRFKFGLPKVA
                     IQSLNLYTSAVLEGNLLPPPKPKECWRAVMEQLASVSCDHYRSIVRGHPDFVPYFRAA
                     TPEMELGKLPLGSRPSKRKPNGGVESLRAIPWIFAWTQNRLMLPAWLGAHKGLQQAIA
                     DGQKGVLEEMSRQWPFFRTRLEMLEMVFLKADVWLAEYYDTRLVPKELWGLGKQLRQE
                     LADSIQVVLELRPQGDLLDDQPWIKESIKLRNPYTDPLNVLQVELLGRSRNHAETLHP
                     ELDQALMVTIAGIAAGMRNTG"
     gene            complement(629823..630968)
                     /gene="argE"
                     /locus_tag="AHA_RS02970"
                     /old_locus_tag="AHA_0592"
                     /db_xref="GeneID:4489259"
     CDS             complement(629823..630968)
                     /gene="argE"
                     /locus_tag="AHA_RS02970"
                     /old_locus_tag="AHA_0592"
                     /EC_number="3.5.1.16"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005355047.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetylornithine deacetylase"
                     /protein_id="WP_011704559.1"
                     /db_xref="GeneID:4489259"
                     /translation="MANLDFFSLYKNIIAIPSISSTDPRWDQSNEAVIRLLADWFGQL
                     GFQCEVTALPDLPGKFNLVATIGQGEGGLLLAGHTDTVPFDEGAWRKDPFKVTEEGNR
                     LYGLGTIDMKGFFAFIVEALKEIDLKTLSKPLRILATADEETTMAGARAIAAAAELKP
                     DYAVIGEPTGLVPVVAHKGHMSEAIRITGRSGHSSDPANGVNALEIMHQAMGQVLKLQ
                     HSLKEKYADHRFAVPQPTLNLGYIQGGDSPNRICGCCELHIDMRPTPQVGPDELMGML
                     KEALSPIEIHQPGCLHLQHLHEPIPAYACADDSELVREAERASGRAAESVNYCTEAPF
                     IQQLGCETIVLGPGHIAQAHQPDEYLDLSFVKPTTRVLQHLIRRFCL"
     gene            631237..632244
                     /gene="argC"
                     /locus_tag="AHA_RS02975"
                     /old_locus_tag="AHA_0593"
                     /db_xref="GeneID:4489260"
     CDS             631237..632244
                     /gene="argC"
                     /locus_tag="AHA_RS02975"
                     /old_locus_tag="AHA_0593"
                     /EC_number="1.2.1.38"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349358.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyl-gamma-glutamyl-phosphate reductase"
                     /protein_id="WP_011704560.1"
                     /db_xref="GeneID:4489260"
                     /translation="MLNTVIVGASGYAGAELAALVQNHPQLKLFGLYVSAGSQDAHKR
                     FSSLHPQWVGALDQPLLPLDEDGMTRILTQADLVLLATAHEVSATLAPKFLAKGLPVF
                     DLSGAFRVRDQQFYASYYGFTHDSEQWLDQAAYGLAEWNAEAVKAAQLIAVPGCYPTA
                     SLCALKPLQQAGLIAKGWQPIINAVSGVSGAGRKAAINTSFCEVSLNPYGTFNHRHQP
                     EISHHLGKEVLFQPHLGNYVRGILATIYVQLADGVTPTQVDQAYLKAYEGKPLVRLTG
                     QMPSIRGVAGTPYCDLAWQQQGNMLVVVCAIDNLLKGAASQAMQCINIKFGFEPATGL
                     I"
     gene            632268..633047
                     /gene="argB"
                     /locus_tag="AHA_RS02980"
                     /old_locus_tag="AHA_0594"
                     /db_xref="GeneID:4489261"
     CDS             632268..633047
                     /gene="argB"
                     /locus_tag="AHA_RS02980"
                     /old_locus_tag="AHA_0594"
                     /EC_number="2.7.2.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349359.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetylglutamate kinase"
                     /protein_id="WP_011704561.1"
                     /db_xref="GeneID:4489261"
                     /translation="MDKQTLVIKLGGALIENDEALTALFATLKTFLDEQHRPLVLVHG
                     GGCLVDDLLKGLGLTSTKKNGLRVTPFEQIPFIAGALAGTANKMMMAKAIATDIPAVG
                     LCLADGGLCQVTQLDPALGAVGDCQPGNPALVTGILGQGFLPVVSSIGITAQGQLMNV
                     NADQAATAIAEALGADLVMLSDVSGILDGKGKLVPQLDKVTALDLMEKGVISDGMAVK
                     VKAALHAAETLGKPVCVASWRYPDQLLKLLAGGAVGTQVAI"
     gene            633073..633984
                     /locus_tag="AHA_RS02985"
                     /old_locus_tag="AHA_0595"
                     /db_xref="GeneID:4489262"
     CDS             633073..633984
                     /locus_tag="AHA_RS02985"
                     /old_locus_tag="AHA_0595"
                     /EC_number="2.1.3.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005313762.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine carbamoyltransferase"
                     /protein_id="WP_164927536.1"
                     /db_xref="GeneID:4489262"
                     /translation="MQHLLKDSDLNKAQIEALIALGKAVKADPKKYGQALAGKSVVTL
                     FEKPSLRTRVTFDIGIAKLGGHSVYLDQQNGALGKRESVQDFAANLSRWCDAIVARVF
                     DHQTLVELAEHGTVPVVNSLCNLYHPCQGLADFMTISEHYGDLSKVKLAYLGDGNNVS
                     HSLLLLGATLGTNVTLVCPKGHGPDTQIFLQAQALAAQSGATIHISDDVAAIEGFDVA
                     YTDTWVSMGDNTPMEQVKDIFMPYQINQALLDRTGIQHVLHCQPAHRELEITSQVMDG
                     PGSLIMDEAENRMHIQNAVLLTLLGHK"
     gene            634039..635274
                     /locus_tag="AHA_RS02990"
                     /old_locus_tag="AHA_0596"
                     /db_xref="GeneID:4489263"
     CDS             634039..635274
                     /locus_tag="AHA_RS02990"
                     /old_locus_tag="AHA_0596"
                     /EC_number="6.3.4.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017408964.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="argininosuccinate synthase"
                     /protein_id="WP_011704563.1"
                     /db_xref="GeneID:4489263"
                     /translation="MSGINKIVLAYSGGLDTSAIIPWLKENYDAEIIAFVADVGQERD
                     DLEGIEQKAIASGATKCIVKDLREEFVKEYVYPTLKTGAVYEGTYLLGTSMARPVIAK
                     AMVEAALAEGADAISHGCTGKGNDQVRFEGAVAALAPQLKVIAPWRLWDMRSREDLLA
                     YLETRNIPCKATLKKIYSRDANAWHISTEGGELESTWNEPSEAVWQWTVPAEQAPDQP
                     EYVKLTVAQGEVVAVDDQPLSPHQILTTLNERAGKHGVGRIDITENRMVGMKSRGCYE
                     TPGGTVMVAALRAVEELVLDRPTRAWREKLGAEFSHLVYDGRWFTPLCKAIVASANAI
                     AEDLDGEVVLKMYKGQVTAVQKKSPNSLYSEDFATFGADEVYDQSHAEGFIRLYTLAS
                     RIRAMKEQHQAIGGDHTHG"
     gene            635484..636869
                     /gene="argH"
                     /locus_tag="AHA_RS02995"
                     /old_locus_tag="AHA_0597"
                     /db_xref="GeneID:4489264"
     CDS             635484..636869
                     /gene="argH"
                     /locus_tag="AHA_RS02995"
                     /old_locus_tag="AHA_0597"
                     /EC_number="4.3.2.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017411531.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="argininosuccinate lyase"
                     /protein_id="WP_011704564.1"
                     /db_xref="GeneID:4489264"
                     /translation="MALWGGRFSQGADSRFKQFNDSLRFDYRLAEQDIQGSMAWAKAL
                     VKVGVLTADEQGKLQQAMEVLLASVQQDPQQILISDAEDIHSWVESALIAAVGDLGKK
                     LHTGRSRNDQVATDLKLWCKAQGELLLGSITALQQGLVASARANQAAVLPGYTHLQRA
                     QPVTYAHWALAYVEMLERDYSRLQDALKRLDTSPLGCGALAGTAYAIDREALALDMGF
                     AGATRNSLDSVSDRDHVVELMHVASLSMTHLSRFAEDLIFYNTGEAGFVELSDAVTSG
                     SSLMPQKKNPDALELIRGKTGRVVGAQMGMLMSLKALPLAYNKDMQEDKEGLFDALDT
                     WHDCLDMAALVLIDLKVNGERTMAAAQGGYANATELADYLVAKGIPFREAHHIVGETV
                     VYAIQVKKPLEELTIGEFQRFSPVIEFDVYPNLELEATLAKRVAKGGVAREQVEAALI
                     AAETWLAKRAG"
     gene            complement(636990..637625)
                     /locus_tag="AHA_RS03000"
                     /old_locus_tag="AHA_0598"
                     /db_xref="GeneID:4489265"
     CDS             complement(636990..637625)
                     /locus_tag="AHA_RS03000"
                     /old_locus_tag="AHA_0598"
                     /inference="COORDINATES: protein motif:HMM:NF017885.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ImmA/IrrE family metallo-endopeptidase"
                     /protein_id="WP_164927537.1"
                     /db_xref="GeneID:4489265"
                     /translation="MTFAIDNRKNIISLADAKGISSAAELLYAIYGDVNYLELPIDIK
                     DIARKIEKVNLLSDFDLNDLFVSGFLKIKKDESGLVDKIDIWVNPTEVLTRQRFTLAH
                     EVGHLFNDIIPNIDNLEEDMIVDVAFNRGALKSHKETKADRFAAQLLMPPQLISRELS
                     NLVTILKEKKEKVSVDYLIKILSKKFLVSEKSMKIRLESLGYIKANDNDRD"
     gene            complement(637622..638317)
                     /locus_tag="AHA_RS03005"
                     /db_xref="GeneID:44141873"
     CDS             complement(637622..638317)
                     /locus_tag="AHA_RS03005"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_139348843.1"
                     /db_xref="GeneID:44141873"
                     /translation="MSNETLNLLLKQENNLLKNQVTALETKNLTSEQYGEVRTLYIEN
                     AILKERVISLEKQIKDIKSDTDDLIDKYEASLVNITEAKKTSEIAISTQDKLQATYSD
                     MYSSSLTWYSVVLGIITLIGFLFAIRIRRQEVKDLCQDAKSQLSEDQSLIDIVAHTFE
                     HATIAEKLDILKGNIVEELQKELPSMIHDKVVAYSSSQSASDTRESPVEAESETVVDL
                     AQALSEVIEEEQT"
     gene            complement(638445..638906)
                     /locus_tag="AHA_RS03010"
                     /old_locus_tag="AHA_0599"
                     /db_xref="GeneID:4489266"
     CDS             complement(638445..638906)
                     /locus_tag="AHA_RS03010"
                     /old_locus_tag="AHA_0599"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010635200.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011704566.1"
                     /db_xref="GeneID:4489266"
                     /translation="MIAISTLLPLASLALKLGSKLLGDGTPQAKAETPVQEERLAPTV
                     QSLFQRLGVKDANSEQSRPAINHFMGALMQTLGQEYSGQSLPQAIDAARTQLADGTQS
                     TRLDALQSELDTLKDSLGASNLNLDQLLGAFKQTLPNGKGEGVGRMLNTSV"
     gene            complement(639107..639319)
                     /locus_tag="AHA_RS03015"
                     /old_locus_tag="AHA_0600"
                     /db_xref="GeneID:4489267"
     CDS             complement(639107..639319)
                     /locus_tag="AHA_RS03015"
                     /old_locus_tag="AHA_0600"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005313739.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_016349365.1"
                     /db_xref="GeneID:4489267"
                     /translation="MTMWTGIVLIVFISALFGFLSKRARYQLGDIRITDRLGKQDVLI
                     NQLQERIANLEAIVIEEEKRRPFKEL"
     gene            complement(639428..639769)
                     /locus_tag="AHA_RS03020"
                     /old_locus_tag="AHA_0601"
                     /db_xref="GeneID:4489268"
     CDS             complement(639428..639769)
                     /locus_tag="AHA_RS03020"
                     /old_locus_tag="AHA_0601"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005313737.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1294 domain-containing protein"
                     /protein_id="WP_011704568.1"
                     /db_xref="GeneID:4489268"
                     /translation="MIWLALLPLLWTAWLGLADANWWPLAIVTTMSLLTVLAYAHDKR
                     QAIRGGWRIPESRLHLLELFGGWPGALVARHWLRHKTQKGSYRRVFWFIVLLHLTLWG
                     LWLGRPLWQTI"
     gene            complement(639766..640356)
                     /locus_tag="AHA_RS03025"
                     /old_locus_tag="AHA_0602"
                     /db_xref="GeneID:4489269"
     CDS             complement(639766..640356)
                     /locus_tag="AHA_RS03025"
                     /old_locus_tag="AHA_0602"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704569.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar O-acetyltransferase"
                     /protein_id="WP_011704569.1"
                     /db_xref="GeneID:4489269"
                     /translation="MASDWDKVLAGGALDSQSEEIANDRIRGQALLAQLNASPAGDEA
                     LRQRLCGELFGHCPDSCWISTPFTCEFGRNIHIGEKTFFNFNITILDVGEVHIGSHVL
                     LAPNVQIYTATHTMDYLERRNWTAYNKPVRIGDDCWIGGGAIICPGVTIGPRSIIGAG
                     AVITRDIPADSVAVGNPARVIRSLSPDAPRGWELAL"
     gene            complement(640437..641699)
                     /locus_tag="AHA_RS03030"
                     /old_locus_tag="AHA_0603"
                     /db_xref="GeneID:4490150"
     CDS             complement(640437..641699)
                     /locus_tag="AHA_RS03030"
                     /old_locus_tag="AHA_0603"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010635197.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MgtC/SapB family protein"
                     /protein_id="WP_011704570.1"
                     /db_xref="GeneID:4490150"
                     /translation="MWINAEPVNGALVSLAIGLIIGLERGWQVRQLGDNQRIAGMRTY
                     GLIGLLGGVCALLLPTLGPWLPLLGLLAVVTGCGLSVWLAQRWQGEFGLTSSVAMLLT
                     YLLGLMSVLLSPSEAVACAVLAALLMGLKGKIQQGMLFLSETEFHATLRFLLISLVLL
                     PVLPNEEMGPLDAFNPFKIWLMVVVIAGISFCGHFAVRLLGTRAGLVLTSILAGLASS
                     TALTLQFARLNKEQGGLERLLATGILLAGATMWLRLLVLVLLIHSELAMRLAAPLLLL
                     AATVYGFAFWFWRQREELTDGPVQPQTSNPLDLATAIKFGLLLALIGFMATLLQSKVG
                     NSGVYLLSLVSGITDVDAITLSLSQLSHKELALEVAARGILLAGLVNSLVKGLLALGI
                     GGRRLGLRVLLPYFVSALLILPLIWPGT"
     gene            641909..642910
                     /locus_tag="AHA_RS03035"
                     /old_locus_tag="AHA_0604"
                     /db_xref="GeneID:4490151"
     CDS             641909..642910
                     /locus_tag="AHA_RS03035"
                     /old_locus_tag="AHA_0604"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017765250.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_011704571.1"
                     /db_xref="GeneID:4490151"
                     /translation="MKLRMTALTLLSLLALGQANAAEIRLLNVSYDPTRELFQEFNGA
                     FAKEWKAKTGDDVVVSQSHGGSGKQARAVVDGLEADVVSLALAYDVDAVAKQGLTAAD
                     WQSRLANNAAPYTSTIVFLVRKDNPKQIKDWDDLVRKDVAIVTPNPKTSGGARWNYLA
                     AWGYALKKSGSEEGAKQFVGDLYKNVKVLDSGARGATTSFIERGLGDVLLAWENEALL
                     VLGQPGNSDKFELVVPSVSILAEPPVAVVDKVAKKHGTEAVAKAYLDYLYSDEGQRII
                     AKYHYRPSNPAILKETAAQFPQLALFTVKDLEGDWDKAQKKHFAQGALFDQIYQPGR"
     gene            642967..643542
                     /locus_tag="AHA_RS03040"
                     /old_locus_tag="AHA_0605"
                     /db_xref="GeneID:4490152"
     CDS             642967..643542
                     /locus_tag="AHA_RS03040"
                     /old_locus_tag="AHA_0605"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308568.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_011704572.1"
                     /db_xref="GeneID:4490152"
                     /translation="MNKILLVPGLHNSGPDHWQSRWHQYFPHWQRMVGLPWDRPDLTV
                     WSAKLASKLRSRRGRAHLVAHSFGALAAITAARQQPDKVASLFIVAPADPARFGLPDE
                     LLAGSLKVSAQLVASRNDPWMSFERAEYWSRQWQVPLFDAGEVGHINAQSGHGEWNQG
                     LNLLGTLYRRAEMVVEPTPAVWERRAALSFR"
     gene            643795..644661
                     /gene="cysT"
                     /locus_tag="AHA_RS03045"
                     /old_locus_tag="AHA_0606"
                     /db_xref="GeneID:4490153"
     CDS             643795..644661
                     /gene="cysT"
                     /locus_tag="AHA_RS03045"
                     /old_locus_tag="AHA_0606"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017411530.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate ABC transporter permease subunit CysT"
                     /protein_id="WP_011704573.1"
                     /db_xref="GeneID:4490153"
                     /translation="MFFITNGCVMRFGSYSVLPGFGPTLGFSLLYLGVLVLLPLSALV
                     LFAVNNLTLAEFWQVIGSPRVLASFRLSFGAALVAALLNALFGLILAWVLVRYTFPGR
                     RLVDALIDLPFAMPTAVSGIALCAIFAPNGWIGQWVAPFGIELAYNPIGVVIALTFIG
                     LPFVVRTLQPVLREAETEQEEAAASLGADRWQTFIRVLWPTLVPALLTGFALAFARAV
                     GEYGSVIFIAGNLPMVSEIAPLMIMSHLEEYDYAGASAIAVVMLLISFILLLLINKLQ
                     AWSWARIGGSRI"
     gene            644658..645554
                     /gene="cysW"
                     /locus_tag="AHA_RS03050"
                     /old_locus_tag="AHA_0607"
                     /db_xref="GeneID:4490154"
     CDS             644658..645554
                     /gene="cysW"
                     /locus_tag="AHA_RS03050"
                     /old_locus_tag="AHA_0607"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017411529.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate ABC transporter permease subunit CysW"
                     /protein_id="WP_011704574.1"
                     /db_xref="GeneID:4490154"
                     /translation="MNASNASLALATGEAAPTTSVRQPPVIREPVWVKWLLITVGLGW
                     FAALLLLPLATVFIQALSPGLTFFWHAISEPDALSALGLTALVTLCSVPLNLLFGVAA
                     AWAIARFRFPGRQLLITIIDLPFSVSPVIAGLMFVLMFGSRGWFGEWLSEHDIKVIFA
                     TPGIILATTFITVPFVVRELLPQMEARGPEEEEAAIMLGASGLQMFWRVTLPGIRWSL
                     MYGLLLCTARAVGEFGAVSVVSGHIRGQTNTLPLHIEILYNEYQTGAAFAVASLLALF
                     GIFTLLGETLLARLRAQPTHSH"
     gene            645577..646644
                     /locus_tag="AHA_RS03055"
                     /old_locus_tag="AHA_0608"
                     /db_xref="GeneID:4490155"
     CDS             645577..646644
                     /locus_tag="AHA_RS03055"
                     /old_locus_tag="AHA_0608"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005332405.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate ABC transporter ATP-binding protein"
                     /protein_id="WP_011704575.1"
                     /db_xref="GeneID:4490155"
                     /translation="MSIQVQGLNKHFNQYAALADINLDFHDGELVALLGPSGCGKTTL
                     LRIIAGLEQADSGSVIIRGEDASDLHVRERNVGFVFQHYALFRHMTVFENVAFGLRVK
                     PRSERPAEAAIRARVKELLDLVQLSHVAARYPTQLSGGQRQRVALARALAVQPKVLLL
                     DEPFGALDAQVRKELRRWLRELHDELHVTSLFVTHDQEEALEVADRVVLMNAGKVEQI
                     GTPAEVYDQPASSFVHSFLGSVNLFRGRVAGQGLGIGEQLLGGPISSQLAEGSAAVAY
                     VRPHELEILPADAPGGISATITRLLPMGPRIRVELRGNGDTNGAHFEAELSKEAARAF
                     SPGQGVRLVAKQAQLYPDYQI"
     gene            646821..647768
                     /gene="cbl"
                     /locus_tag="AHA_RS03060"
                     /old_locus_tag="AHA_0609"
                     /db_xref="GeneID:4490156"
     CDS             646821..647768
                     /gene="cbl"
                     /locus_tag="AHA_RS03060"
                     /old_locus_tag="AHA_0609"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005970850.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HTH-type transcriptional regulator Cbl"
                     /protein_id="WP_011704576.1"
                     /db_xref="GeneID:4490156"
                     /translation="MNFQQLRIIREAARRDYNLTEVANALFTSQSGVSRHIRELEEEL
                     GIELFIRYGKRLLGMTEPGKELLVIAERILNDANNIRKLASTFANRESGRLLVATTHT
                     QARYALPRVVKAFREQFPLVQLELRQGSPEEIVRLVQTGEVDIGISSEQLDKSEGVVA
                     FPYYRWHHNIVVPEQHPLTAERELTLAALAHWPIITYQAGLTGRARVDEAFAEAGIAP
                     QILLTAQDSDVIKTYVELEMGVGILADMAFDTQRDKGLVQLDGSRLFAPHTAWIGLKQ
                     GQFQHNFAWQFIQLCNPELALADIQARAMGSEAAIDFQI"
     gene            complement(647841..649265)
                     /gene="gbpA"
                     /locus_tag="AHA_RS03065"
                     /old_locus_tag="AHA_0610"
                     /db_xref="GeneID:4490157"
     CDS             complement(647841..649265)
                     /gene="gbpA"
                     /locus_tag="AHA_RS03065"
                     /old_locus_tag="AHA_0610"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308580.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylglucosamine-binding protein GbpA"
                     /protein_id="WP_164927538.1"
                     /db_xref="GeneID:4490157"
                     /translation="MAAKIQLNHVAATLALLVSGSVLAHGYISQPESRNYLCKTGGNS
                     QCGAVQWEPQSVEGPSGFPQAGPPDGQIASAGSASWRELNAQTSDRWTRREVQAGPFA
                     ISWTFTANHVTRNWRYYLTKQDWNPNQPLTRAAFELTPFCVVDGNMTQPPKQVTHQCN
                     LPQRTGYQVILGVWEVGDTSNSFYNVIDANFKGGTQPPLAWSQGGTIYPSTELAVGDK
                     ARTLVFDANGVRPDLQTELTIASPEQGQKNNWAHALATKINAEQSQIRAGQQSGEGQF
                     NPIYGQNPVYFKAGSALERVEIQLEQQQPPVSNGVSVSGLESDYLLDEGKLTLNFTVA
                     AEGDLTVTNTLYDHGGAAKGQTSADIKDSTHSFTMPLTGLSAGHHQLVIEGKPKAGGD
                     AVQQTLDLMLKDPAAGGDYQFTFPDGLKSYTDGTKVLQPKNGKVYQCKPFPYRGWCSQ
                     WSASATQYEPGVGTNWQDAWIQVN"
     regulatory      complement(649328..649413)
                     /regulatory_class="riboswitch"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF01051"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="cyclic di-GMP riboswitch class I; Derived by
                     automated computational analysis using gene prediction
                     method: cmsearch."
                     /bound_moiety="cyclic di-GMP"
                     /db_xref="RFAM:RF01051"
     gene            complement(649679..651376)
                     /locus_tag="AHA_RS03070"
                     /old_locus_tag="AHA_0611"
                     /db_xref="GeneID:4490158"
     CDS             complement(649679..651376)
                     /locus_tag="AHA_RS03070"
                     /old_locus_tag="AHA_0611"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005313698.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="WP_011704578.1"
                     /db_xref="GeneID:4490158"
                     /translation="MFKLGDIAVSRKLMLLLSLALIGFIALLLISASALHRNLMSERE
                     ARLQAVLDLAMSRIQTLAATLPAPQAQAEAKAMLNSMRFDGDNYLFVLDENRRMVVHP
                     VRPELVGQQMGESGTATAGVHWQQMVDLGKGGHSGRLEYKWISPSGEAAQKMSLVAGY
                     QPWGWILGSGVLLQDIQATIWSQYQLMGGATLLVTLLMGLLGFAISRSIVNPLAEINR
                     AMQQVAAGDLVVSIPVHGQDELGAVASCTNQGLNAIRRALLEASQGARNVADAALRIA
                     ASAEQTNQAVNSQRDQLAQLATAMNEMSATISDVAGHAENTARDTQDATSEAGLGNRD
                     VHASVHGIQALATEVEQATLQVNQLKEGVMQISEVTAVISAISEQTNLLALNAAIEAA
                     RAGEQGRGFAVVADEVRQLASRTRQSTEEIQSTIAQLQQRAVTAASAMDASRKLAESS
                     VSQSEKAGQDLSLIVNHIQHVSDMATQIATAAEQQSMVAEDMNRNVSGINDSALEMSQ
                     SASQLARESELLAGLSRSLDERLAVFKLGSAIDQQLEQRLAPLHRQVSPAERPRVRH"
     gene            651672..653519
                     /locus_tag="AHA_RS03075"
                     /old_locus_tag="AHA_0612"
                     /db_xref="GeneID:4490159"
     CDS             651672..653519
                     /locus_tag="AHA_RS03075"
                     /old_locus_tag="AHA_0612"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010635189.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oligoendopeptidase F"
                     /protein_id="WP_011704579.1"
                     /db_xref="GeneID:4490159"
                     /translation="MSSIARNYLNQLNADYLQVHRRKEDLFWSTYMGTSDDQAGFTAA
                     EQAYKAFCADPARLPVLRQMQAQAEETELKRGLGGWIAFFECNVIEDPQAAALMDELV
                     AAEAALFARRRELKLTLLDEQGRQVAGSLPAASTALAASSDEAVRQSALAMFHTLEQW
                     VVDNGYLAIVALRNRFARAMGYRDYFDYKVHKNEQMSPAQLFAILDDFIAGTEQRLHQ
                     SLAELKAAKGEAALLPHNLRYSVSGDVTRQLDPYVPFSRALQDWVESFRRLGIQYRGA
                     TLTLDLLTREGKYENGFCHGPVPSFWQEGEWVPAVVNFTSLANPAQVGSGWSGLNTLF
                     HEGGHAAHFANVTGNAPCFSQEFPPTSMAYAETQSMFCDSLLDDADWLKRYARNAAGE
                     PIPDALIKAMIEARQPFRAFNERQIALVAYFERDLYAMDEAERTPAAVLVLARRWERK
                     ILGGESPRPLLAIPHLLNQESACAYHGYLLALMAVEQTRAYFLKRDGYLTDNPRIGPD
                     LAAHYWGPGNGMTHDETLQSLTGKGFSAGPLARACNQSVAEAWQQAEACMAAARQRPP
                     VGEGEPLNARIRVVHGDQLIADNSGSEAAMLADFECWIRDHYQETVTSH"
     gene            653596..654387
                     /locus_tag="AHA_RS03080"
                     /old_locus_tag="AHA_0613"
                     /db_xref="GeneID:4490160"
     CDS             653596..654387
                     /locus_tag="AHA_RS03080"
                     /old_locus_tag="AHA_0613"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349374.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_011704580.1"
                     /db_xref="GeneID:4490160"
                     /translation="MGTTARWRWLLATLLLTGGLAQPARALQALTEQMPPYNYQLAGQ
                     PVSGFSVDLLHALLARSGLALRGDIQLQPWARAYQNARYQAGSILFSVARTPEREQQF
                     QWVGPFGPRTIRVWRLSSRTDIQPRSLQEASHYRIAVVRNSASAQQLIRQGLAPVSVN
                     SEEDKFRMLLRGRVELVTALDLGAAFHMHQLGHGLAALTPLFVYDDGEQYYFALNLAT
                     EPAKVQALQRALDQMRQDGSLEALRRRWLNLHALPPAPASGATPS"
     gene            complement(654401..656596)
                     /locus_tag="AHA_RS03085"
                     /old_locus_tag="AHA_0614"
                     /db_xref="GeneID:4490161"
     CDS             complement(654401..656596)
                     /locus_tag="AHA_RS03085"
                     /old_locus_tag="AHA_0614"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308589.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase"
                     /protein_id="WP_011704581.1"
                     /db_xref="GeneID:4490161"
                     /translation="MNGLPIRAPALGWLLISLLAAPLAAAPLTLQGETQRYRIDPDTL
                     AISVNQIPVSAGQPARQVDQLQQGEQQASWHWPAQDARVEVKLDGDDLLLTLVSDSPR
                     QLAWFSLPKNQTHLSLAFGEGSRFSVRDSDWLGYVGDELAELNTHYDLKLPLWSQDAG
                     KQTYSWILQTPYDNRLRFSRQGGRLQLSASHEFSSFNQQAPMVVRLSVGDDWLAGARR
                     YRAWLQSEGAWQSLADKVARIPAGRRLIGASHVYLWGDALLDRQDVTAWPALQAKLRQ
                     KPEWLQGFNSEEREALAANAPEPWQQALIMAGLNRLIADQLPLPAQQGPQAQSKVLAL
                     RQQWVKSQFGEQLVAQERWGQGLSLPVIEALQQAGLRKLWLGTPQWTAALQQGYALTA
                     AQRQGYLVGSYDSYDTAIAPGTNDSWLTAQLPPEIGKRCAIFEANGEPKPGFGGEGVY
                     LNPGCTLPFAKSRMSELAKASGINSLFLDVDGTAMASNDYNPAHQQGSQAMIADRNAR
                     MSWVGERLGLVLGSEDGNALTSKPLLFAHGIQSWGFGWTDAAMRKQAKSPYYLGKWWP
                     DEAPQVFFQPARLKPRYLKTVFNPADRLPLYQAVFHDSVLNSHHWLLDNLKFPGIKEE
                     RALLGLLYNTPPLVNLSRSTLASRLPELVRLDSQFGPLHEALWDKALVGFRWRDGVGR
                     VQETRFSDGSRLVANFGHSSIMIDGHKLPGRQLLVALKDKPVSVLKIQG"
     gene            656929..657588
                     /locus_tag="AHA_RS03090"
                     /old_locus_tag="AHA_0615"
                     /db_xref="GeneID:4490162"
     CDS             656929..657588
                     /locus_tag="AHA_RS03090"
                     /old_locus_tag="AHA_0615"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308591.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_164927539.1"
                     /db_xref="GeneID:4490162"
                     /translation="MKRAKWKPWLGLGALLAGVIGWYLWPQGVAPGQAAGDEERAADS
                     GPLAELTPLAAMPAPALKPAPIAAPAKPDRLREDGSQQLETPWQAAEVDADFPLAEPG
                     DAVEQPQPIALQGSDLERAQVGDSVALPMPDGSTLQARVTKVELQRGGERNWQGEIRV
                     DGDSYPVNFTVGKQATFGFIGTPQGSYSVETLGGKGWVYKNPPLDLGHGGDDALIPTH
                     Q"
     gene            657609..658952
                     /locus_tag="AHA_RS03095"
                     /old_locus_tag="AHA_0616"
                     /db_xref="GeneID:4490163"
     CDS             657609..658952
                     /locus_tag="AHA_RS03095"
                     /old_locus_tag="AHA_0616"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308593.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011704583.1"
                     /db_xref="GeneID:4490163"
                     /translation="MQKTTLGIMIAGLLGATPVLAETIDLMVLHSPGLAARYQGDAQT
                     RIQHMINVTNQIYAASGLDLTVRAVHDQQVNYPDGGTDKSALNAVTYQQDPAFKQVPT
                     LRTRYGADMVVLMRPQTGDHGSCGLAWVGGSATYTDGSKAYADGDVSQDAGSMFSHVT
                     ATGCGDVVLAHELGHNMGLNHSRLQDGTGGTYHYALGHGVRGSFATVMAYPSSFGVYS
                     HEYKFSSPDLICKGQPCGVDYRDQANGADAVRALRVTTPQIAAFYPTMVTEALPDLGE
                     LERSLETRRQDLAAAQEHYSQQVAARTALQDRQQTLKGNFDRYQRELSQLNQRNRQTV
                     QEINRLVREHNSYNGSYGPEEYRRIRAIQASLSARIDQLHDENNAIIRQSNEISQRYQ
                     AEVNEYNGSWDRYNQLVAAVKSADGKVDEARRELELAEHRYQLALARQPAETQPA"
     gene            complement(659059..662220)
                     /locus_tag="AHA_RS03100"
                     /old_locus_tag="AHA_0617"
                     /db_xref="GeneID:4490164"
     CDS             complement(659059..662220)
                     /locus_tag="AHA_RS03100"
                     /old_locus_tag="AHA_0617"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017408984.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S41 family peptidase"
                     /protein_id="WP_011704584.1"
                     /db_xref="GeneID:4490164"
                     /translation="MRYRLSLLLLLLCSSLQAAEPLWLREPALSPDGKQLAFTWQGRV
                     YLSAGDGGPAVPLTDGNYLSQRPLWSPDGKLIAFAANLYGNEDVFVVPSHGGEMVRLT
                     RDSRPDLPQAFSADGKQLLLSSQRLTDPDADHFVAEGYQAGNLYWTPVAGGPLTPAQP
                     LPATLARPHGSQLAYQMPGMDQPFRKHQHSFAVSRLWLFDGKQHRQLTEDRVAASDPV
                     WDEQGKQLYYLSERSGDFNVWQRDLASGQDRQLTHFKGHPVRGLSASRQGDLVWSWQG
                     ELYRLDAGSDTPRKLVIQPLFAKVPAEQSWQPGPIDEAIARQDGEEVILVSQGDLYAV
                     DTRRERVRQLTRHPSEQSAPRYLDKEQELIYLSEQEGPAALYRLKKGQPDKLFSDPGP
                     LTEEKLLAIPGAAISVPTLSPDGKQLAFVVDGQAVHLLDLASGKQRQLVAAEFNPSRH
                     AVELAFAPDSRHLALTIQPDSAQQEIAVIDTRDAKAKPVNVSLNGYRDGEPAWSQDGG
                     ILYWQSTKYGVLGADGEPLGGSLLGLYSSRAAKSDFIAEQAPPKAGYGFEADRLAHRE
                     AIQLQPEGPILASRIVDDHLIYLVEVMDANGESEIKGYAQDLRKGETKLLFAEQPGPA
                     LASLNQDASLATLVREGEIALIDTRSGEASSHPFNLLITASWQDRMSAAFDQITRLTR
                     DEFYRADMNGVDWDGYVAAYRRLLPGISNDRDFGNLLAELAGELNVSHTWGSGPAPSL
                     RMPDETASLGGYWRERQGAVELDALLAGGPLEQETDLAPGARLLAVNGTELHSLNELD
                     ALLNHQAGQRLALTVLPKGAKEPSQLEVTAIDLQQEYQLQLDGWIAKRRSQVEQLSQG
                     RVGYVYLPEMSSAVYEEVVADALGRQRNREALIVDVRFNKGGYLANTLVEFLTGSGSA
                     QGMARSWPRLGKGETDAATRQWTKPSVVLVNAGSYSEGSAFPQYYRTLKVGPIVGEPV
                     PGTGTMVYAHTSRLIPGLAYGIPTLGLRNPDGTLYENQELIPDVQVVLTPADMLAGRD
                     PQLAAAVQAALAQLTTNAKPAAK"
     gene            662480..662956
                     /locus_tag="AHA_RS03105"
                     /old_locus_tag="AHA_0618"
                     /db_xref="GeneID:4490165"
     CDS             662480..662956
                     /locus_tag="AHA_RS03105"
                     /old_locus_tag="AHA_0618"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005343080.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L,D-transpeptidase family protein"
                     /protein_id="WP_024944607.1"
                     /db_xref="GeneID:4490165"
                     /translation="MRAVLLCLLGLWPALSFATLSADMVVVKKSSYSLTLMKDGKEVK
                     RYWIALGPAPKGHKQREGDQRTPEGRYILDYKKTNSNYYKAIHINYPNLDDIKAANEM
                     GVRPGGMIMIHGQRNSIGNTRLQPSNWTNGCIAMLNKDLDEVWNAIEPGTPIVIQP"
     gene            663105..663824
                     /locus_tag="AHA_RS03110"
                     /old_locus_tag="AHA_0619"
                     /db_xref="GeneID:4490166"
     CDS             663105..663824
                     /locus_tag="AHA_RS03110"
                     /old_locus_tag="AHA_0619"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017780430.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AzlC family ABC transporter permease"
                     /protein_id="WP_011704586.1"
                     /db_xref="GeneID:4490166"
                     /translation="MPSATCSRPVGAESTRALWWRASIDILPLSVSVIPWGILCGALA
                     LQVGLSPLQAQLMSLLVYAGAAQLSATTLFGAGTPLLPIMGSTFVITSQHLLYGFTFR
                     RDVLPLSLRWRASLAFFLTDEMFAVALKDRERSGRFDPAYALIAGFVFYLFWNAATLL
                     GIAAGQYIDGLDQMGLDFAIAATFIAMTIPAMKNLPMVAATLVSGAMALLTKPLLAEV
                     YIIISALSGMLVGYVLHRMRR"
     gene            663827..664168
                     /locus_tag="AHA_RS03115"
                     /db_xref="GeneID:44141874"
     CDS             663827..664168
                     /locus_tag="AHA_RS03115"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005313667.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_024944606.1"
                     /db_xref="GeneID:44141874"
                     /translation="MSWLMIGLLALITFFNRFAFFSRLTRYQPGAEMGAFLSFSAQSV
                     LTAIWLPIVFSYQPGIGLSWDPDYLVATLLVTVLTLLRLPTLLVVVVGMGGFFLLRWQ
                     GGVAQLLPWLG"
     gene            664285..665811
                     /locus_tag="AHA_RS03120"
                     /old_locus_tag="AHA_0620"
                     /db_xref="GeneID:4490167"
     CDS             664285..665811
                     /locus_tag="AHA_RS03120"
                     /old_locus_tag="AHA_0620"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308604.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YjjI family glycine radical enzyme"
                     /protein_id="WP_011704587.1"
                     /db_xref="GeneID:4490167"
                     /translation="MSFTETCQRIVRDPLLSPAQKSHALALAAENALPYPELPAEVSE
                     AMAKGFVCDMFEGHAPYKPRYVLPDYEKFLRQGSAWLELAPPQDFDEALDALRILYHH
                     VPSVTGMPVWLGRLDHLLLPFVGELDDEALYRKLKGFWIYLDRVLPDAFMHVNIGPDD
                     NRLCRLILRIDGDLKQVAPNLTLFHDPAQTPDSLLLQGVKNIAACSKPHIANYPLHRN
                     TFDERGFGIVSCYNALPQAGGANTLVRVSLKRVAEQAHGIDDFLGCLLPHYCRLASRL
                     IEARAAFLHQESGFFDSFLVQEGLLEEDRFVPMFGIYGMAEAVNLLMDKENLPERYGR
                     DEEANQLGYRISAQLARHVSEAPQVHAWGGRALLHSQGGLSVDRGVTPGVRIPYGEEP
                     DPASHMLALAPHHGFYHSGISEILTLDPTIRQNPQALLQLCKGALAIGMREFTANVAD
                     SDLVRVTGYMIRKSDVARFATEGSRLQTTCLGAEASELTGIRQRAPRVVGREATLCDY
                     "
     gene            665849..666700
                     /gene="yjjW"
                     /locus_tag="AHA_RS03125"
                     /old_locus_tag="AHA_0621"
                     /db_xref="GeneID:4490168"
     CDS             665849..666700
                     /gene="yjjW"
                     /locus_tag="AHA_RS03125"
                     /old_locus_tag="AHA_0621"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017787478.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YjjW family glycine radical enzyme activase"
                     /protein_id="WP_011704588.1"
                     /db_xref="GeneID:4490168"
                     /translation="MSRWLPFSCVDGPGNRLVLFLQGCNFACPGCHNPHTIGLCDHCG
                     DCVPGCPSGALTLHEGRVSWQAARCTDCDACLDLCPRSASPKTAAMTVAEVLALLRRY
                     GPLLSGITVSGGEATTQLPFVIALFTAIKGAADLAHLDCLLDSNGSLAEAGWQRLLPV
                     LDGAMIDLKGWGDSVHHMLAGYGRERVLASLQLLAQAGKLAEVRLLQVPGQSDYLVAD
                     GTLEGGLAAFLRALGPVPIRLNGFRHHGVRGAAQGWPEATREELEQLAAALAVAGLGP
                     VSLPPLL"
     gene            666893..667216
                     /locus_tag="AHA_RS03130"
                     /old_locus_tag="AHA_0622"
                     /db_xref="GeneID:4490169"
     CDS             666893..667216
                     /locus_tag="AHA_RS03130"
                     /old_locus_tag="AHA_0622"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005332629.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1820 family protein"
                     /protein_id="WP_011704589.1"
                     /db_xref="GeneID:4490169"
                     /translation="MSESNALYRVQFICHNERYEVYVREVSQGQLFGFIEIANFVWDN
                     HTALIVDPSHEKLKSEFADVNRTMIPMHHVLRVDQVRKQGAARITELGNNVSPFPSPI
                     YTKKP"
     gene            complement(667259..668182)
                     /locus_tag="AHA_RS03135"
                     /old_locus_tag="AHA_0623"
                     /db_xref="GeneID:4489348"
     CDS             complement(667259..668182)
                     /locus_tag="AHA_RS03135"
                     /old_locus_tag="AHA_0623"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017408990.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_011704590.1"
                     /db_xref="GeneID:4489348"
                     /translation="MDLIALSRLGGRHLVTLHLLLDSQSVTRTAERLCTTPSTVSKTL
                     NQLRDLLGDQLLYRQGNQLLLTPFAERLGPTLHRLLSELNGLTGQGGFDPASWQGQLT
                     FALRESGMVWPMGPILAQLMREVPGLVPDIRNKDEQGLAALAAGKLDFVILPHDQSQP
                     LPRQQGLVWETLREDKLVCLLRADHPALARSWDLDAYLSWRHIAIRDQELANPFFEQS
                     LAQLQVRRQIAAILPDFGSAAALLRQSDLILTAIGGWAEQAAPHALVSRPVPFDYGAV
                     THSLVWYGPAGEEPARRWFRQRILQLARELG"
     gene            complement(668243..669439)
                     /locus_tag="AHA_RS03140"
                     /old_locus_tag="AHA_0624"
                     /db_xref="GeneID:4489349"
     CDS             complement(668243..669439)
                     /locus_tag="AHA_RS03140"
                     /old_locus_tag="AHA_0624"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308612.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate/tyrosine/aromatic aminotransferase"
                     /protein_id="WP_011704591.1"
                     /db_xref="GeneID:4489349"
                     /translation="MFEHVDAYAGDPILTLVETFHKDTREQKVNLGIGLYYDEQGRIP
                     LLASVQQAEAQRAAAPAPRPYQPMEGAANYRTAVQHLLFGADHEAVKAGRIATIQTIG
                     GSGALKIGADLLKRYFPTSEVWVSNPTWDNHKAMFEGAGIKVHDYPYYDAATGGVQFD
                     AMIDCLSSLPAKSIVLLHPCCHNPTGVDLSRAQWDQVIALVVEKNLIPFMDIAYQGFG
                     DGLEEDAYAIRAMVAAGVSFFVSNSFSKNLSFYGERCGGLSVICQDAEEASRVLGQMK
                     ATVRRNYSSPPTHGGQITAAVMNDASLHAMWVGEVTEMRTRIKAMREKLFEVLSAKVP
                     GRDFSYFINQRGMFSYTGFTPEQVDRLREEFAVYLVRSGRMCVAGLNSRNVDYVADAM
                     AAVLKG"
     gene            complement(669609..669884)
                     /locus_tag="AHA_RS03145"
                     /old_locus_tag="AHA_0625"
                     /db_xref="GeneID:4489350"
     CDS             complement(669609..669884)
                     /locus_tag="AHA_RS03145"
                     /old_locus_tag="AHA_0625"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249989.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metal/formaldehyde-sensitive transcriptional
                     repressor"
                     /protein_id="WP_005308614.1"
                     /db_xref="GeneID:4489350"
                     /translation="MSHTIHGKKKLLARVRRIKGQAGALESALEQESDCAAILQQIAA
                     IRGAVNGLMLEVLEGHMREHLGAEEATPAERLEDLDQVVRVLRSYLK"
     gene            669956..670915
                     /gene="dmeF"
                     /locus_tag="AHA_RS03150"
                     /old_locus_tag="AHA_0626"
                     /db_xref="GeneID:4489351"
     CDS             669956..670915
                     /gene="dmeF"
                     /locus_tag="AHA_RS03150"
                     /old_locus_tag="AHA_0626"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704592.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CDF family Co(II)/Ni(II) efflux transporter
                     DmeF"
                     /protein_id="WP_011704592.1"
                     /db_xref="GeneID:4489351"
                     /translation="MSSLASSHCHQPVVHEGNPLAEQKTRWAVLLTVIMMVAEIGGGW
                     FYNSMALLADGWHMSSHALALGLSVLAYRAARHFARDHRFSFGTWKIEVLGGFTSALL
                     LVGVAGMMLFESVFRLLDPSPIHYQQAIVIAIVGLLVNLACAWLLKDDHGHHHGHGHD
                     HHHDHHDHAHPHDHGQHHGHQDLNLRAAYIHVLADAATSVLAILALVGGMLWGADWLD
                     PLMGIVGAGLVAVWAWGLLRDSGRVLLDAEMDVPLVAEIREVIAELPDAEVRDLHVWR
                     VGQQQYACVLSLLMAAPVAASEIRARLAIHEELVHVTIEVSAA"
     gene            complement(670979..671389)
                     /locus_tag="AHA_RS03155"
                     /old_locus_tag="AHA_0627"
                     /db_xref="GeneID:4489352"
     CDS             complement(670979..671389)
                     /locus_tag="AHA_RS03155"
                     /old_locus_tag="AHA_0627"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017784615.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011704593.1"
                     /db_xref="GeneID:4489352"
                     /translation="MKRIEEQARRLDQEYQEIAQLFDQFCQQAGTLAEQYHFFNWPDY
                     EDTPPLARAFTLLGEPRELRLRCQPGERGSLSGLIQVCGEEGTIHASLGFRADGHLLL
                     ESGRLLDNPPELLLKLLLGAIWQHKPEDVQGQPH"
     gene            671671..675708
                     /gene="pulA"
                     /locus_tag="AHA_RS03160"
                     /old_locus_tag="AHA_0628"
                     /db_xref="GeneID:4489353"
     CDS             671671..675708
                     /gene="pulA"
                     /locus_tag="AHA_RS03160"
                     /old_locus_tag="AHA_0628"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005313646.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pullulanase-type alpha-1,6-glucosidase"
                     /protein_id="WP_115586401.1"
                     /db_xref="GeneID:4489353"
                     /translation="MDMKKTKVALVTASLLALLSGCNDNSSSPSTPDPTDGPVARLPN
                     VQPPAEQLVAGPDQAVIALVDTQTSAARGVTGPFANYSLHLWNNDACSATAESGLNAG
                     WDDKVNTPAAADGFGPSWVVPLSKLEGCINFIARNGDLANLTGSDMKVVFSDHPDRTV
                     AIVAGKNEIFGSRAEAFTAAFGVAGASAHLIDGNTLIWQGGKDKPHVRLYYTESGTIK
                     ANAEGVFDFPYITLAPTSLTAEQQAKYPHLKDAAAFALPAGKDLKPLLKGELVAIGTD
                     ADGILQGATLVQSAGALDALYSEAATKLTYGAVVEGGNVTFRLWAPTAKSVKLALFDG
                     QHKPLGERTMTLDEASGSWSVQGGSELVGKFYRYDIQVYHPVSRKLESYQVTDPYSLS
                     LAMNSEFSQVVDLNDPALKPEGWDSLKAPHSQQNPADITIYEAHVRDLTGNDDSTPAE
                     HRGKFLGLTDTDTAPVKHLQALAKSGVSHLHLLPVFDIATVNEDPAKVANISDDFGKL
                     CQVNPEVQNSKFAGYCSSGQTIEAVLGDLQGSDSKENPQVQELYGYLRGVDSFNWGYD
                     PYHYTTPEGSYATNAEGSQRILEFREMVKAIKQNIGMNVVMDVVYNHTNEAGLGPKSV
                     LDKIVPWYYQRLNPETGSVENSTCCSNTAPEHAMFAKLMDDSLVTWARDYKIDAFRFD
                     LMGHHPKDQMVQALAAVKQVNPEMYFYGEGWNFGEVQDDKRFVQATQKHLAGTGIGSF
                     SDRLRDAVRGGSPFDGGDTIRKTQGFGNGALVDANEMDGVDRATALHQADLVRLGMAG
                     NLKDFILTDKDGMPKKGSDIDYNGQPAGYAQDPTEIQNYVDKHDNQTLFDNLIYKAPQ
                     GADLVRMQGVSLATAMLGQGIPFTHAGVELLRSKSMERDSYDSGDWYNRVDYTLADNN
                     FDKGLPRKDKDGDNYPLIEKVLGKHVKPSGADMATMVGFYQELAELRQSSRLLRLGSG
                     AEVIKRVDFRNTGPDQEPGLIVMTVDDGINAGADLDPAIDGLVVMINATNAPQSISDF
                     RDGNDQPIDLTSLQLSPAHHGGESIARDAAANGGTLTLGAWSAAVFVKPQSGAQGTGL
                     PVGKKTDLSTVPPFGDTAVYLKGFLNEWGNTNQMTFSSNFMYEFTTEVSSDKLGTTNV
                     KIADASWGPLNYGSCNAGDKLVVGTPLTLCKGGDTGNIGLDLAKAGSYKFVFTAMNKD
                     KPTLSVSFTEPVQSCKVLDTVAGNPLGYNLFVKGELSGWAAQPQYQLSYKGMDGDLAI
                     YQAAFNYTGSTEFKVANEDWSKEYLLNGGGAVTAETGYAIGFSQPGSANNSITLPQGL
                     WSVLVKVDPAGTKAGTAVIQECSAK"
     gene            complement(675901..678318)
                     /locus_tag="AHA_RS03165"
                     /old_locus_tag="AHA_0629"
                     /db_xref="GeneID:4489354"
     CDS             complement(675901..678318)
                     /locus_tag="AHA_RS03165"
                     /old_locus_tag="AHA_0629"
                     /EC_number="3.6.3.3"
                     /EC_number="7.2.2.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005313642.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc/cadmium/mercury/lead-transporting ATPase"
                     /protein_id="WP_164927540.1"
                     /db_xref="GeneID:4489354"
                     /translation="MSKSCCSHQHAAAPIKAVSKSAAPQAEHQHDSHCCDQAAPVSCC
                     ASQAPHDHQDHAASGAPEGEEPPRGGCCATPPPAHARHAHDGEHDHHEHAVAAEPPLD
                     APEQNSRRHSWQVLGMDCPSCARKIETAVSRVSGVQQARVLFATEKLVVDLAPGLSPD
                     PVTAAVLAAGFQLKGERSGKQEPSRERGPLQTLLTKYWQPLSLAGLMLVAALLPSQVG
                     QPLFTLATLWGLWPISRKAWALTKSGSPFAIETLMTVAAVGALFLGETAEAAMVLLLF
                     MLGEHLEAYAAGRARAGVTALMALVPDKALRIRTTAEGEVREEVAADQLRPGDIIEIA
                     PGARLAADARLLDALGAFDESALTGESIPVERRQGDKVPAGSLAADRVLRLEVVSEPG
                     NNAIDRILHLIEEAETQRAPIERFIDRFSRWYTPAMMLVALLVVLVPPLAFGQSWDEW
                     VYRGLALLLIGCPCALVISTPAAVTSALAAATRQGALIKGGAALERLAHIDTVAFDKT
                     GTLTLGKPQLTELVSLNGQPEAELLALAAAIEQGSHHPLARAVVTAASERGLSLAAAQ
                     ALRALPGMGVEGRIDGTLWQLLAPSRVATLDAAMQARVATLEQQGKTVVVLGQPDATP
                     AALLALRDQIRPEAAAALQELNQLGLQSIMLTGDNPRAAEAIASELGMGWRAGLLPEG
                     KVDEIAKLGLSQKVAMIGDGINDAPAMKRASIGIAMGGGTDVALETADAALTHNQLGG
                     VAAMIRLSRAALANIHQNIALALGLKAIFLVTSLLGITGLWIAVLADTGATALVTANA
                     LRLLRKR"
     gene            678536..679036
                     /gene="tpx"
                     /locus_tag="AHA_RS03170"
                     /old_locus_tag="AHA_0630"
                     /db_xref="GeneID:4489355"
     CDS             678536..679036
                     /gene="tpx"
                     /locus_tag="AHA_RS03170"
                     /old_locus_tag="AHA_0630"
                     /EC_number="1.11.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308624.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiol peroxidase"
                     /protein_id="WP_011704596.1"
                     /db_xref="GeneID:4489355"
                     /translation="MSNSVTLQGNPVSVAGHFPVAGEQAKPFSLVAKDLSDLTLVSFA
                     GQRKILNIFPSVDTPTCATSVRKFNEQASALNNAVVLCISADLPFAQSRFCGAEGLDK
                     VVTLSTLRGAAFLQDYGVAFSSGPLVGLAARAIVVLDEENKVLHSELVAEVADEPNYA
                     TALAVL"
     gene            complement(679099..679917)
                     /locus_tag="AHA_RS03175"
                     /old_locus_tag="AHA_0631"
                     /db_xref="GeneID:4489356"
     CDS             complement(679099..679917)
                     /locus_tag="AHA_RS03175"
                     /old_locus_tag="AHA_0631"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349390.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter substrate-binding domain-containing
                     protein"
                     /protein_id="WP_011704597.1"
                     /db_xref="GeneID:4489356"
                     /translation="MTRHPSLLLLLLLCLTGLTSLSLSRADTAAAPAAKPVRILNAHL
                     GELPGLINADKTGPFVDLVRAIDDLYPEVSIRITIYPLARAMAGVIAGTADFSLPAIR
                     NLQDADLLPYRFSTRSFGKVTHVLYSNTDHLITPDMAYGIVPTKRDLLIEATPGFLPI
                     PLQRSMSIEQSLRKLSRGRIDAFIWAQEEADLMLRQLKLTNIHREHLGDFEDVFIIAK
                     GPTGDEVDRFLGEAIERLAASGKLAEIYSRLHRPYVEWQPHPEPLPAKDATKAP"
     gene            680086..681306
                     /locus_tag="AHA_RS03180"
                     /old_locus_tag="AHA_0632"
                     /db_xref="GeneID:4489357"
     CDS             680086..681306
                     /locus_tag="AHA_RS03180"
                     /old_locus_tag="AHA_0632"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349391.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase"
                     /protein_id="WP_011704598.1"
                     /db_xref="GeneID:4489357"
                     /translation="MTFDELALAPALLATLPADLKCPTRVQQLAIPAALAGRDLLALA
                     RTGSGKTLAFGLPLLQRLDPASDRVQGLVLVPTRELAVQVSEALQGPAAGLGLRLVTL
                     CGGVAQALQQAELALGPQLLVATPGRLRDLLAQQLLGLSQLRHLVLDEADRLLEMGFW
                     PDIQWLLNAMPVERQTLLFSATLPAELDALATGLLTEPVRVEADPRNSVADDIEERLY
                     LVNKSSKVPALISLLKAHEWPQVLVFISARDDADGVARKLAKAGITVAALHGEKEQAV
                     REQALGDFKAGKVRVLVATDLMARGIHVEALPLVINLDLPASAPVYVHRIGRTARAGR
                     SGLAISLTCHGEADTLAAIRTLTGRELPLAELAGFPVTDQPASGEGKRAPRDKQANRR
                     TQAKRSVKQFKSKG"
     gene            681402..682895
                     /locus_tag="AHA_RS03185"
                     /old_locus_tag="AHA_0633"
                     /db_xref="GeneID:4489358"
     CDS             681402..682895
                     /locus_tag="AHA_RS03185"
                     /old_locus_tag="AHA_0633"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308630.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkaline phosphatase family protein"
                     /protein_id="WP_011704599.1"
                     /db_xref="GeneID:4489358"
                     /translation="MASLVMGPLLGLEAETQYSICFLAGPDCKGAGVRINGSLLAAGK
                     QADTPRGGFWRVSWTATPAEAGSSVEYQILLDGEPARDLAGEDRWQFHLPGSAERVRI
                     GYASCNGFSDFKLLTSTPQPYVMWDKLDAEHATHPFSLLLMGGDQVYADSLWTTVPSL
                     KAWNELDMAEKVKRKATRTMEEQLDRFYCDLYCKQWGRPEVARLLARIPSAMMWDDHD
                     IFDGWGSYPESPDNLQGCDVYRVIYAAASRYFRLFQLRSVANVSLLDPVKLGHHSWRL
                     SFRGYQILALDNRANRTRAQVMSPSQWDQINDALAACDAGHLLVLAGVPVVYRDFSFT
                     EAALDATPWEEELTDDLKDHWRAKDHQGERARLIMRLLDNARIRRQKDAGCKTLILSG
                     DVHVGCLGVIQDKRDGVLNVHQLVSSGIVHPCPTQFQWMGILAMTNDDAEYLDENRLI
                     RAELIKPFGAPVYLRTRNFATLLMGTDNKLWANWHCENGLAASYPLA"
     gene            complement(682969..683757)
                     /locus_tag="AHA_RS03190"
                     /old_locus_tag="AHA_0634"
                     /db_xref="GeneID:4489359"
     CDS             complement(682969..683757)
                     /locus_tag="AHA_RS03190"
                     /old_locus_tag="AHA_0634"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017412707.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011704600.1"
                     /db_xref="GeneID:4489359"
                     /translation="MKRRYGLLALAVLALLLLNLSWQEAPTPPAHTGQLAQPATAEAP
                     QTQPPLAPASGPVAATAVPAGPAPAPASWRELPDEMNRQLASEVSDSEQPLAERLANL
                     EAIEAQWLSEGESLFRLQGRYALALEQLAQEHEQLPLAERLAALTRLQDEWAADHPDL
                     AAELFNPAARLQQARQLWGDEELATLARHFLPAAQAEATVQFAASRQQQLAQRSHYQQ
                     QLTELEQQLAASRGNMDEASWQQHREAVLGQFRRDFFAQTPEQP"
     gene            complement(683754..685070)
                     /locus_tag="AHA_RS03195"
                     /old_locus_tag="AHA_0635"
                     /db_xref="GeneID:4489360"
     CDS             complement(683754..685070)
                     /locus_tag="AHA_RS03195"
                     /old_locus_tag="AHA_0635"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017409000.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sphingomyelin phosphodiesterase"
                     /protein_id="WP_115586402.1"
                     /db_xref="GeneID:4489360"
                     /translation="MHKPLSYAALLLASQFPLQALADTDVYLTNNSPDPVQLEIRQSG
                     SGQLQAGSQWLQHRTELGPWESAMVLSFNRYEGVKAGKSYLFETRVTTPGGDTYRLNQ
                     KMEGTWWNSTLQHGGETPADNSGWQSDRAIHRLSGPQELAFAAKFTGRYDDLHYMLTP
                     PRQVEQPEADEARLKVASYNVWALPVIAASIGERLALLPEYLKGYDALLLQEVFDGRR
                     EGFLQALAKEYPYQTRVLDKPGVNIHDGGVVIVSRYPIVREAQLVYPQCTGTDCFADK
                     GVMYAEVIKGGKAWHLFATHTASFDTDEARRLRQIQFGQIRTLAASLKIPASDTVIYG
                     GDFNVNKRKFADDYAGMLANLNADEPGYGGYTEATFDPRINPYAGGPLSGGANVEYLD
                     YLVASREYGAVCHNLNSVWIPRSSDGSLWPASNLSDHFPVKGEISR"
     gene            complement(685279..686838)
                     /locus_tag="AHA_RS03200"
                     /old_locus_tag="AHA_0636"
                     /db_xref="GeneID:4489361"
     CDS             complement(685279..686838)
                     /locus_tag="AHA_RS03200"
                     /old_locus_tag="AHA_0636"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005313603.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="WP_011704602.1"
                     /db_xref="GeneID:4489361"
                     /translation="MTTTQREGEIRFPDHLSLISTTDPASHITYANQHFCDVAGYHPA
                     EMEGVPHNLVRHPDMPKAAFADMWQRLRQGKSWMGLVKNRAKSGKFYWVNAYVTPILN
                     EQRQIIEYQSVRTRPSEHDIAWAEQLYARIRAGKALPWLSRLALEPGLLTLLLSGGAL
                     LTLLMAIISGNPLWGAPGALALLAQMLHGWRLQQRLNRLARTAGEEMGTPLCQVLYTR
                     RRDTLAALELALRMKRAELKAVVGRSADTNQQILQAAEDDRGNIQTIDIHLQQQRAQS
                     EQLAAAITELSHSIRDVASNAHQASELVGEVQQVSAEGLRALATTQSSVDQLHHELDA
                     NHAVLARLTGDSQKISGILEVISQIADQTNLLSLNAAIEAARAGEQGRGFAVVADEIR
                     ALAQKTRSSTGEINEMIQALQQTTRQLADGMSQGAQTSDRCQQHVGTTAEVLNQINRM
                     LARVTHTSDEIAQAVSQQADVTSTLDKGIHQIHQLASHTADNSRQALDGITLLVERLH
                     ALSRLINQFQH"
     gene            complement(687080..687910)
                     /locus_tag="AHA_RS03205"
                     /old_locus_tag="AHA_0637"
                     /db_xref="GeneID:4489362"
     CDS             complement(687080..687910)
                     /locus_tag="AHA_RS03205"
                     /old_locus_tag="AHA_0637"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005332286.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CPBP family intramembrane metalloprotease"
                     /protein_id="WP_011704603.1"
                     /db_xref="GeneID:4489362"
                     /translation="MLPLPDSLIWGALALAVLLCLARQRLPGFIMLAVALLAAFGLGH
                     LSPIALLASAAGLLLAWRTPSLPQPWRAVALGAVLLWAVALMLHLIPGFTNLKVLDQV
                     QAGPASVPFNMYLNLDKPLVFFGLLLAWPALLGPGGTVQWRRLALLLVPLAALLIAAW
                     QLGALKPEAGLPGWWWLFAINNLLFTCVAEEALFRGFLQQGIAAHSRRWLGVLVASLL
                     FGAAHLAGGPLLVLFAALAGVCYGLAFLLSGRLNVAIAIHFLFNFAHLALFTYPLASR
                     "
     gene            complement(688074..688364)
                     /locus_tag="AHA_RS03210"
                     /old_locus_tag="AHA_0638"
                     /db_xref="GeneID:4489363"
     CDS             complement(688074..688364)
                     /locus_tag="AHA_RS03210"
                     /old_locus_tag="AHA_0638"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005313598.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011704604.1"
                     /db_xref="GeneID:4489363"
                     /translation="MSIYDFDDELPEDEQEQPKKAAPAKKKGKQVLNTQVNLSPRDAS
                     RLNGMHVEAIATLDDVSLPKNVIFKAGLIALGELEASKRADIIARVIAESGR"
     gene            complement(688428..688802)
                     /locus_tag="AHA_RS03215"
                     /old_locus_tag="AHA_0639"
                     /db_xref="GeneID:4489364"
     CDS             complement(688428..688802)
                     /locus_tag="AHA_RS03215"
                     /old_locus_tag="AHA_0639"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308639.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YacL family protein"
                     /protein_id="WP_011704605.1"
                     /db_xref="GeneID:4489364"
                     /translation="MDYEFRRDPFGGYRARFSMGHEAIGQWLIDEVGKDEEKLDELFA
                     IIDQLSSRTRVEYRLLGGDYSLLLTHEEAEVKANVLNIEQDEDLDDLAYYDDEQLAMC
                     GLEDFAQVLGSWRAFIRNEDMG"
     gene            689124..690239
                     /locus_tag="AHA_RS03220"
                     /old_locus_tag="AHA_0640"
                     /db_xref="GeneID:4489365"
     CDS             689124..690239
                     /locus_tag="AHA_RS03220"
                     /old_locus_tag="AHA_0640"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308641.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate diacid regulator"
                     /protein_id="WP_011704606.1"
                     /db_xref="GeneID:4489365"
                     /translation="MQLNDTLARQIVSRAMKILSFSVNVMDEHGLIIASGNPERLHQR
                     HEGAVLALTENRVVEISDATARELKGVRPGINLPIAYQGELLGVIGISGDPDEVRAYA
                     ELVRMTAELILEQAALTEQLQWDKRHKEELVLQLIRGEGRDDQLQQAARFLGLDLAQP
                     RVVAVLALEEADPARLRELVHLLENPERDNLVAINGLDEIVVLKPAQLSDGIWQSAQE
                     RSRIKQLLARIPHFRVRIGVGDYFAGTGGLARSYQTARDTLRRGMRQAPRKQVYFFED
                     YRLPVLLGSLADSWQADQLRAPLHKLAQEDTKGTLQKTLRQYFLQDCDLHPCAEALFI
                     HPNTLRYRLTRIEQITGLNFNKLDDKFLLYLGLNLDS"
     gene            690359..691621
                     /locus_tag="AHA_RS03225"
                     /old_locus_tag="AHA_0641"
                     /db_xref="GeneID:4489366"
     CDS             690359..691621
                     /locus_tag="AHA_RS03225"
                     /old_locus_tag="AHA_0641"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005354386.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntP family permease"
                     /protein_id="WP_011704607.1"
                     /db_xref="GeneID:4489366"
                     /translation="MIPVSALGALAALSIAIFLILKKVPPAYGMIVGALAGGLIGGAD
                     LTQTVALMIGGAQGITTAVMRILAAGVLAGVLIESGAATTIAETIVKKLGETRALLAL
                     ALATLILTAVGVFVDVAVITVAPIALAIARRADLSKAAILLAMIGGGKAGNVMSPNPN
                     AIAAADAFHLPLTSVMAAGIIPGLFGLVMAYWLAKRLNNKGSKVAADEVVSFNGSKLP
                     GFAAAISAPLVAILLLALRPIAGIVVDPLIALPLGGLVGALMMGKFSKVNQFAVSGLA
                     RMAPVAIMLLGTGTLAGIIANSGLKDVLISGLTASGLPSYLLAPISGALMSLATASTT
                     AGTVVASNVFSSTLIELGISSLAGAAMIHAGATVFDHMPHGSFFHATGGSVHMGVGER
                     LKLIPYETAVGLTIAAVSTLMFGVFGLA"
     gene            691631..692764
                     /locus_tag="AHA_RS03230"
                     /old_locus_tag="AHA_0642"
                     /db_xref="GeneID:4486826"
     CDS             691631..692764
                     /locus_tag="AHA_RS03230"
                     /old_locus_tag="AHA_0642"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010635162.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerate kinase"
                     /protein_id="WP_011704608.1"
                     /db_xref="GeneID:4486826"
                     /translation="MKIVIAPDSFKESLSAMAVADAIEAGFKQVLPDATYVKLPMADG
                     GEGTVQSLVDATGGRILPFYVTAPLGNKVQGFVGLLGDGERAVIEMAAASGLHLVAPE
                     LRNPLHTSSSGTGELILAALDMGVKHLILGIGGSATNDGGAGMIQALGGKLLKRDGTP
                     IAPGGAGLAELASIDLSGLDSRLAKITIEVACDVDNPLCGPKGASAVFGPQKGATPEM
                     VAQLDANLAHYADCIEQALGKQVKEIAGAGAAGGMGAALVGLLGAELKPGIQIVIEAL
                     KLAEAVADADLVITGEGRIDSQTIHGKTPIGVARCAKQFGKPVIGIAGCLTDDCGVVH
                     EHGLDAVFAVVNRAMSLPEALATATTNLQLTARNVAALYLLRP"
     gene            692975..693538
                     /locus_tag="AHA_RS03235"
                     /old_locus_tag="AHA_0643"
                     /db_xref="GeneID:4486827"
     CDS             692975..693538
                     /locus_tag="AHA_RS03235"
                     /old_locus_tag="AHA_0643"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308646.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NnrU family protein"
                     /protein_id="WP_011704609.1"
                     /db_xref="GeneID:4486827"
                     /translation="MILLTLGVLLFTLIHLYPCFAGAHRARLRERLGENRYKGLFSLL
                     VFIAIACIIAGWRTASPLPLYFLPVWGPTLMMAVMPIALILFCSGQGPNHLRRWLVHP
                     QLLGTLLWAGAHLAVNSEARSLVLFGGIGLWALVSIVWISVRDWQRHPRPVANWYGTG
                     LSVGAGLALTALLIFWGHGMLTGIPLY"
     gene            693601..694134
                     /locus_tag="AHA_RS03240"
                     /old_locus_tag="AHA_0644"
                     /db_xref="GeneID:4486828"
     CDS             693601..694134
                     /locus_tag="AHA_RS03240"
                     /old_locus_tag="AHA_0644"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005313573.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione peroxidase"
                     /protein_id="WP_011704610.1"
                     /db_xref="GeneID:4486828"
                     /translation="MKWIMLLLTLGAGAAVAACPDYFNVEMRELNSTQRHNLCQLTEG
                     KVVLVVNTASYCGYRGQFRDLEQLYQTYKEKGLMVLGFPSNDFWQEAGDEGKTASVCR
                     RDYGVTFPMFNRIAVRGADASPLYRGLAAAAGEAPGWNFHKYLIGRDGKLVASYGANQ
                     NPADDPLQKEVKRALGL"
     gene            694217..695152
                     /locus_tag="AHA_RS03245"
                     /old_locus_tag="AHA_0645"
                     /db_xref="GeneID:4486829"
     CDS             694217..695152
                     /locus_tag="AHA_RS03245"
                     /old_locus_tag="AHA_0645"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308648.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_016349403.1"
                     /db_xref="GeneID:4486829"
                     /translation="MVIFDALVREQGISAAARRLGVSKSHISKQLAQLETELGAQLVQ
                     RTTRRFSLTELGQEYARHCRALVAVALEADSMVAERRGKVSGILHLGVGQSFGRLHVI
                     PRLKAFQDRYPELELEVSLFDHRTNLVDEGLDLWITTYEDKPEALVGQRLADIHFVLV
                     ASPDYLLSHGTPLHPRDLAQHNCITYQSRERRYHEWSFRQGKERQTVQVAGNYRVDLA
                     EAVRDAALAGLGIAYVANYLLDKELQSGQLIPLLPQWRPNQKMAVHAVYARREHLDPK
                     IRLFIDFLKESFGPNPYWEQRLAPWLGGKLSGTEE"
     gene            695335..696531
                     /locus_tag="AHA_RS03250"
                     /old_locus_tag="AHA_0646"
                     /db_xref="GeneID:4486830"
     CDS             695335..696531
                     /locus_tag="AHA_RS03250"
                     /old_locus_tag="AHA_0646"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704612.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NupC/NupG family nucleoside CNT transporter"
                     /protein_id="WP_011704612.1"
                     /db_xref="GeneID:4486830"
                     /translation="MIALLGILSILAVATLCSDNRRRIPLRTVGLALCLQILFAGLVL
                     WLPAGQHVLNGVSESVSSVIGYGQEGIAFLFGDLAKFKLGFIFAFNVLPVIIFFSAVI
                     AILYHIGLMPKVIALLGGGLQKLLGTGRAESLSATANIFVGMVEAPLVVKPYLSKMSD
                     SQFFAVMSCGLASVAGGTLVGYASIGVELKYLIAAAFMSAPAGLAMAKILVPPAAEEQ
                     DHHQDVVIPRATNVIEAAADGAMSGLNIAVAVGATLLAFVGVIAMLNGLLGWAGDLVG
                     LELSFQIILGWLFAPVSWLIGIPWEQAQAAGALIGTKIVVNEFVAFIALVQDQTLSES
                     SKAIVTFALCGFANISSMAILIGGLGAMVPERKSFIARYGMRAILAGVLANLMSASLA
                     GLFLAL"
     gene            complement(696794..697288)
                     /locus_tag="AHA_RS03255"
                     /old_locus_tag="AHA_0647"
                     /db_xref="GeneID:4486831"
     CDS             complement(696794..697288)
                     /locus_tag="AHA_RS03255"
                     /old_locus_tag="AHA_0647"
                     /EC_number="2.1.1.63"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308651.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methylated-DNA--[protein]-cysteine
                     S-methyltransferase"
                     /protein_id="WP_011704613.1"
                     /db_xref="GeneID:4486831"
                     /translation="MKFSFCDSAHGPLLIAIDRDGLRYVEFVLGEQPVTPTDEWQRDD
                     QALAPFIEQFAAYFAGRLRRFDLPLAARGTPFQQSVWRALGDIPYGETVSYLEIAQAI
                     GNPKAVRAVGAANGRNPLSIIVPCHRVIGRSGELTGYAGGIPIKRWLLALEQQTDDNF
                     ALTP"
     gene            complement(697322..697738)
                     /gene="arfB"
                     /locus_tag="AHA_RS03260"
                     /old_locus_tag="AHA_0648"
                     /db_xref="GeneID:4486832"
     CDS             complement(697322..697738)
                     /gene="arfB"
                     /locus_tag="AHA_RS03260"
                     /old_locus_tag="AHA_0648"
                     /EC_number="3.1.1.29"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349405.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminoacyl-tRNA hydrolase"
                     /protein_id="WP_011704614.1"
                     /db_xref="GeneID:4486832"
                     /translation="MLVISNSVTLPWHELQFQTMRAQGNGGQHVNKTDSAVWLRFDYR
                     NSPSLTPLYKEGLDKLSDSRVHDGFIMIRVETHRSQDMNRKEAMNRLVELLKKAAWRP
                     KARHATKPTRSSQRKRVDAKKRKGEIKSTRGKPVVD"
     gene            697940..698278
                     /gene="glnK"
                     /locus_tag="AHA_RS03265"
                     /old_locus_tag="AHA_0649"
                     /db_xref="GeneID:4486833"
     CDS             697940..698278
                     /gene="glnK"
                     /locus_tag="AHA_RS03265"
                     /old_locus_tag="AHA_0649"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000767166.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="P-II family nitrogen regulator"
                     /protein_id="WP_011704615.1"
                     /db_xref="GeneID:4486833"
                     /translation="MKLITAIIKPFKLDDVREAIANLGVEGLTVSEVKGFGRQKGHTE
                     LYRGAEYQVDFLPKVKLEIATADDNVEGVIEAICKAAYTGKIGDGKIFVYDLLQAVRI
                     RTGESDDEAL"
     gene            698483..699493
                     /locus_tag="AHA_RS03270"
                     /old_locus_tag="AHA_0650"
                     /db_xref="GeneID:4486834"
     CDS             698483..699493
                     /locus_tag="AHA_RS03270"
                     /old_locus_tag="AHA_0650"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012128851.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular solute-binding protein"
                     /protein_id="WP_164927541.1"
                     /db_xref="GeneID:4486834"
                     /translation="MMKMKMLALAFSALVAQSALAAGEVNVYSNRQDELIKPIIQQFE
                     KESGIKVNVVFAKEGLNERLEREGKLSPADLMLTVDISRLTDLVDKGLVQPVDSKILQ
                     ENIPAIYRDPDNRWFALTTRVRAIYSSKDRLGKLDTISYEDLAKPEFKGKICTRSGKH
                     EYNVALVSSMIAHHGMAETRSWLEGVKANLARKPQGNDRDQVKAIKDGICDLSLGNSY
                     YLGAMLKDPAQKAWADAVYINFPNQADRGAHVNVSGVAMTKYAKNKAEAQKLMEFLAG
                     DTAQHMYADVNAEYPVKAGVEPSAMVKSWGSFKSDALPVSDYAKHRKDALQLLDEVKF
                     DL"
     gene            699534..701159
                     /locus_tag="AHA_RS03275"
                     /old_locus_tag="AHA_0651"
                     /db_xref="GeneID:4486835"
     CDS             699534..701159
                     /locus_tag="AHA_RS03275"
                     /old_locus_tag="AHA_0651"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017411610.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter permease"
                     /protein_id="WP_011704617.1"
                     /db_xref="GeneID:4486835"
                     /translation="MKNFGWITGSWASALLLALPVLALVFSALLADGDLFGHLADTVL
                     FDYLANTLGLVVGVVLLSLLFGVPTAWLVAMCQVPGRRALQWALMLPMAMPSYIVAYV
                     YTDLLDYSGPLQAGLRQLVGWGGPADYWFPAIRSLGGAAWVLALVLFPYVYLLTRASF
                     LEQSVSLIHSSRLLGCSPWQSFRRLSLPLARPAIMVALSLVAMETLADFATVHFFAIN
                     TLTTAVYDTWLGYGSLATAAKLSCLMLLAVVLLIALERRSRSRQQVFQKSMGHEQPLR
                     YPLKGMSRWLAGLWCWGLVLAGFGLPFVILLDYGVRYFELSWTPEFVRFASNSLAISA
                     LTALLAMGIALLLGFCRRLDGGIKSLLPLRIAAMGYAMPGTVLAIGVLVPLTALDFAI
                     NDLAEWLGRQGPGLLLTGTITAIVFGYLVRFVAIAIGSVESSMGKISPSLDMAARSLG
                     QGDGAMLRRVHLPLVRRGLFAGAMLVFIESMKELPAALLLRPFNFDTLATHVYQFVSD
                     EMLERGALGAIVIVLVGLLPLIWVNRNLDGAGH"
     gene            701229..702263
                     /locus_tag="AHA_RS03280"
                     /old_locus_tag="AHA_0652"
                     /db_xref="GeneID:4486836"
     CDS             701229..702263
                     /locus_tag="AHA_RS03280"
                     /old_locus_tag="AHA_0652"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010673070.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_011704618.1"
                     /db_xref="GeneID:4486836"
                     /translation="MSCLQVENVSCRYNGRNVLELLSLTVADNEIVCLLGASGCGKTT
                     LLKAIAGLLPLAEGTIRLGDTLLDGPGASVPPEARNIGMIFQDYALFPHLTVADNVGF
                     GLTKLDRRARQQQVEEALALVNLQGLGDRYPHQLSGGQQQRVAIARALVCKPRLMLLD
                     EPFSNIDTQVRMKLILEIRALLKQQGIGAIFVSHSKEEAFAFADRLALFRAGHIEQVG
                     QPEQLYRRPQNRFVAEFLGGVNYLAAEVVDSHCVRTALGVICGSEPHGRAVGELLQLM
                     LRPQQLLLESAADGELKVVEQQFLGHHCRVLFESGELRLEASIGEPLEGARARVRVTP
                     HVLVLFDPLP"
     gene            702367..703272
                     /locus_tag="AHA_RS03285"
                     /old_locus_tag="AHA_0653"
                     /db_xref="GeneID:4486837"
     CDS             702367..703272
                     /locus_tag="AHA_RS03285"
                     /old_locus_tag="AHA_0653"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005313552.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Dyp-type peroxidase"
                     /protein_id="WP_011704619.1"
                     /db_xref="GeneID:4486837"
                     /translation="MKAQAGICAEPNLHALYLMFNRTGDAAELVARLAGLPALWEAVA
                     ADFPAAGFSGLVAVGADAWDGLYPAARPPQFRGFMAQSANGQEAPNTPFDLFVQLRAD
                     RVDVLHHAGQRVMALLAGLVALAEEVRGFRNLDCRDLTGFVDGTENPQDEHRAEVALL
                     AGGEFAGGSYIHVQRWVHAMSDWEKLALKEQEDIIGRTKVDNIEYESADKPLTAHIKR
                     VNLKTPKGESMEILRQSMPWGTMTEQGLYFISCCRTPQHFNAMLASMYKGEGSHFDHL
                     LRFTKAVTGAAFFAPSEDFLVAQGK"
     gene            complement(703359..703829)
                     /gene="argR"
                     /locus_tag="AHA_RS03290"
                     /old_locus_tag="AHA_0654"
                     /db_xref="GeneID:4486838"
     CDS             complement(703359..703829)
                     /gene="argR"
                     /locus_tag="AHA_RS03290"
                     /old_locus_tag="AHA_0654"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005340378.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator ArgR"
                     /protein_id="WP_005308670.1"
                     /db_xref="GeneID:4486838"
                     /translation="MKHNDKQEKLAKAFKALLKEERFGSQAEIVTALQEMGFENINQS
                     KVSRMLSRFGAVRTRNAKMEMVYCLPVELGVPTTSSPLKNLVLDVDHNGALVVIHTSP
                     GAAQLIARLLDSLGKAEGILGTIAGDDTIFITPTSDTDIEELYLSALELFEQTP"
     gene            704031..704771
                     /locus_tag="AHA_RS03295"
                     /old_locus_tag="AHA_0655"
                     /db_xref="GeneID:4486839"
     CDS             704031..704771
                     /locus_tag="AHA_RS03295"
                     /old_locus_tag="AHA_0655"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005357971.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding cassette domain-containing protein"
                     /protein_id="WP_005308671.1"
                     /db_xref="GeneID:4486839"
                     /translation="MGIELIGIEKSWHKVPVLQQVSFRTAPGETLVLLGPSGAGKSSL
                     LRMMNLLDTPDAGVLRIGESEFSFPSSLSTAEFNRQTQALRRKVGMVFQQYNLWPHLT
                     VMENLIEAPVKLLGMSKAAAMEKGGYLLAQLQLADKRDAWPARLSGGQQQRVAIARTL
                     MMDPQVLLFDEPTAALDPEITKEVAEIIRNLGQTGITQVVVTHEVEFARKVASQVIYL
                     EKGRIIEAGSAAIFQAPQTSRFAEFLMH"
     gene            704797..705534
                     /locus_tag="AHA_RS03300"
                     /old_locus_tag="AHA_0656"
                     /db_xref="GeneID:4486840"
     CDS             704797..705534
                     /locus_tag="AHA_RS03300"
                     /old_locus_tag="AHA_0656"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010635152.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter substrate-binding domain-containing
                     protein"
                     /protein_id="WP_011704620.1"
                     /db_xref="GeneID:4486840"
                     /translation="MKKSLLLVAAMGLLSTSVLAKEIKFATEATYAPFEYLDDKNEFQ
                     GFDIDLARAICEQAKLECSFHNQAFDSLIPSLKFRRYDAAIAAMDVTPERAAQVDFSD
                     IYYQNSAVFVTKKGAFKGPEELVDKTVGVQNGTSHQSYLVDNWVSKGLLTVPYASYQS
                     AFLDMMNGRTDGVFADTAVAADWLKQHKEYAVIGTPVTDAKYFGTGFGIAVAKGNQEL
                     LTQLNKGLADIKANGTYQKIYDKYFAH"
     gene            705538..706188
                     /gene="artQ"
                     /locus_tag="AHA_RS03305"
                     /old_locus_tag="AHA_0657"
                     /db_xref="GeneID:4486841"
     CDS             705538..706188
                     /gene="artQ"
                     /locus_tag="AHA_RS03305"
                     /old_locus_tag="AHA_0657"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005332336.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arginine ABC transporter permease ArtQ"
                     /protein_id="WP_011704621.1"
                     /db_xref="GeneID:4486841"
                     /translation="MLSLLLDAAWMTLGLALASLVGGMVLALAFSAAELSKQRALVWP
                     VATLTTLIRGLPELLVVLFIYFGSTQVLFLITGEYVEFSPFACGVLALSLLFASYATQ
                     TLRAALNAVPAGQRLAALALGLGKRHIFFRIVLPQAWRHALPGLGNQWLVLLKDTALV
                     SLIGVNEMMRQAQMASASTYQPFTWYAAAALIYLAISLVSEFGLKQASRYTRRYGG"
     gene            706191..706853
                     /gene="artM"
                     /locus_tag="AHA_RS03310"
                     /old_locus_tag="AHA_0658"
                     /db_xref="GeneID:4486842"
     CDS             706191..706853
                     /gene="artM"
                     /locus_tag="AHA_RS03310"
                     /old_locus_tag="AHA_0658"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017782222.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arginine ABC transporter permease ArtM"
                     /protein_id="WP_011704622.1"
                     /db_xref="GeneID:4486842"
                     /translation="MQDYLMTLLGGLAITLQLTAFSLLLGVLMAAAMTWVLERRIPVV
                     TQLVQLWVLIFTGTPLLIQIFLIYYGPGQFAWLKEGPLWPLLKQPWFCAVLALGFNTA
                     AYSTRLFKGALDAIPAGEVEACRALGFSAGQTLWMKVRHAARRLVPAYSNEVILVLKG
                     SSLASTITIMDVMGLAQRLNAQTYDTLAVFTVAGALYLTMNGLLTIGFRWCERRALAF
                     QG"
     gene            707075..708010
                     /gene="mdh"
                     /locus_tag="AHA_RS03315"
                     /old_locus_tag="AHA_0659"
                     /db_xref="GeneID:4486843"
     CDS             707075..708010
                     /gene="mdh"
                     /locus_tag="AHA_RS03315"
                     /old_locus_tag="AHA_0659"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011758790.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malate dehydrogenase"
                     /protein_id="WP_011704623.1"
                     /db_xref="GeneID:4486843"
                     /translation="MKVAVLGAAGGIGQALALLLKNRLPAGSELSLYDIAPVTPGVAV
                     DLSHIPTDVKVKGFCGEDPSPALVGADVVLISAGVARKPGMDRSDLFNINAGIVKNLV
                     EKCAASCPKALIGIITNPVNTTVAIAAEVLKKAGVYDKRRLFGVTTLDVIRAETFVAE
                     AKGLNVDKVRVNVIGGHSGVTILPLLSQIEGASFTADEVAAMTKRIQNAGTEVVEAKA
                     GGGSATLSMGQAACRFGLSLIKGLQGEANVIECAYVEGDGKHATFFAQPILLGKNGVE
                     TVLDYGKLSAFEQEAMDGMLATLKADIQLGVEFVK"
     gene            708447..709046
                     /locus_tag="AHA_RS03320"
                     /old_locus_tag="AHA_0660"
                     /db_xref="GeneID:4486844"
     CDS             708447..709046
                     /locus_tag="AHA_RS03320"
                     /old_locus_tag="AHA_0660"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308682.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sel1 repeat family protein"
                     /protein_id="WP_016349413.1"
                     /db_xref="GeneID:4486844"
                     /translation="MTSTPSSSSGLNVDSGTLQAVPLYRQDELLNWIEQGRHLQQVKQ
                     DRCQLTQDIEVRAEVMKVPAYQFLWGDMLAWGVCIKPNAELGVKFMWEAANQGLAPAL
                     EQLGRYYWKGTLVQKDLLKAETLMREAASLGFQRAQIEWVEMLLQGMGSPLDYEEAYH
                     WLHSTVIGDKALHQKATSLLSRLGNRMPANAIARAKAMH"
     gene            complement(709149..710342)
                     /gene="hmpA"
                     /locus_tag="AHA_RS03325"
                     /old_locus_tag="AHA_0661"
                     /db_xref="GeneID:4486845"
     CDS             complement(709149..710342)
                     /gene="hmpA"
                     /locus_tag="AHA_RS03325"
                     /old_locus_tag="AHA_0661"
                     /EC_number="1.14.12.17"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017765290.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NO-inducible flavohemoprotein"
                     /protein_id="WP_011704625.1"
                     /db_xref="GeneID:4486845"
                     /translation="MLDQATIAVIKSTIPLLESAGPALTQHFYQRMFSHNPELKDIFN
                     LAHQRSGGQPLALFNAVAAYAKNIDNLGALAGAVERIAHKHTGFLIQPEQYHIVGSHL
                     LATLKELGGSAVTDEVLDAWGKAYGVLASIFIGRESEIYQEKASQAGGWQGSRPFLIK
                     EKRVESELITSFLLAPVDGKPVLDFKPGQYLSIKLVHPELEYQEIRQYSLSDAPNGQH
                     YRISVKREPQGQVSNLLHDHLQAGDKIEVMPPTGDFYLKADGHTPVVLLSAGVGITPM
                     MSMLNQLLAKGHQADITWLHACEQGAVHAFREDIQQKSRQNANLLSRVWYREPQGSDV
                     QGEGYDFAGTMDLRAVKDRITPQAHYYFCGPVGFMQAVKQQLIAAGIPAGQLHYEVFG
                     PHQDL"
     gene            710453..710920
                     /locus_tag="AHA_RS03330"
                     /old_locus_tag="AHA_0662"
                     /db_xref="GeneID:4490669"
     CDS             710453..710920
                     /locus_tag="AHA_RS03330"
                     /old_locus_tag="AHA_0662"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308686.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Rrf2 family transcriptional regulator"
                     /protein_id="WP_011704626.1"
                     /db_xref="GeneID:4490669"
                     /translation="MRLTSYTDFGLRALLYLATLPEGELSSVAKVSALYDVSRNHMVK
                     VVNQLVKLGYLQSQRGKNGGIRMACAPETVNIGQVIRALEGNLDGIDCGSPACHIVSV
                     CLLKNALKEAMNAFLAVMDSYTLQDLLANRDELQKVFGELIPTLVLEPDEESE"
     gene            complement(710954..712234)
                     /locus_tag="AHA_RS03335"
                     /old_locus_tag="AHA_0663"
                     /db_xref="GeneID:4490670"
     CDS             complement(710954..712234)
                     /locus_tag="AHA_RS03335"
                     /old_locus_tag="AHA_0663"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017411603.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF21 domain-containing protein"
                     /protein_id="WP_011704627.1"
                     /db_xref="GeneID:4490670"
                     /translation="MDSISTSTLLIVLVILILLSAFFSSSETGMMSLNRYKLRHLAQT
                     KHKAARRVEKLLSRPDRLLGLILIGNNLVNILASAIATIVCIRVFGDLGVAIATFGLT
                     LIVLVFGEVTPKTLAAMFPEKIAYPASWVLKGLMVPLSPLVWLINGITSGLLKLLRLN
                     PSKDDALNTEELRTIVNEAGSLIPQRHQEMLLSILDLDKMTVEHIMVPRSEIYAIDIN
                     DDWKTILRQLAHCAHTKILLYRDNIDDVVGFLHARDALRLMARDQFNKSSLLREVDEI
                     YFIPEGTPLNVQLAKFQRNKERIGLIVDEYGDIQGLITLDDILEEIVGDFTTSMTPAP
                     SDEIHPQPDGSFLVEGSASIRELNKEMSWQLPIDGPRTLNGAILEYLEEIPQPNISLR
                     LAGYPIEILEVENNMVKMARIMPDLYRNESGFED"
     gene            complement(712275..713066)
                     /gene="ccsA"
                     /locus_tag="AHA_RS03340"
                     /old_locus_tag="AHA_0664"
                     /db_xref="GeneID:4490671"
     CDS             complement(712275..713066)
                     /gene="ccsA"
                     /locus_tag="AHA_RS03340"
                     /old_locus_tag="AHA_0664"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308690.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c biogenesis protein CcsA"
                     /protein_id="WP_011704628.1"
                     /db_xref="GeneID:4490671"
                     /translation="MIVISVLALAFYLLAIIASLHLLLSAKPVGQAPLFACIGLALIA
                     HGTAVAGEVLVTHSGQNLSMLNVASLVSLIISCFMTCVTRRFNGWILLPVVYSFSALL
                     LAASALIPGRYITHLEAHPQLLLHIGLALMAYSVLMIACLFALQLACLDRQLKSRKIS
                     QLPAMPPLMTVEKRLFQLISAGLFLLTLSIASGLFFLEDMFAQGKSHKAILSILAWCV
                     YVLLLWGHHTRGWRGRKVITLSLIGSFILTLAYFGSRFVKEVLLS"
     gene            713341..714717
                     /gene="ffh"
                     /locus_tag="AHA_RS03345"
                     /old_locus_tag="AHA_0665"
                     /db_xref="GeneID:4490672"
     CDS             713341..714717
                     /gene="ffh"
                     /locus_tag="AHA_RS03345"
                     /old_locus_tag="AHA_0665"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017411601.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal recognition particle protein"
                     /protein_id="WP_011704629.1"
                     /db_xref="GeneID:4490672"
                     /translation="MFENLTERLSRTLRNVSGRGRLTEENIKETLREVRMALLEADVA
                     LPVVRDFVARVKERAVGQEVAKSLSPGQAFIKIVHGELVSVMGEANEQLNLAAQPPAI
                     ILMAGLQGAGKTTTVGKLAKLLKERSKKKVLVVSADVYRPAAIKQLETLANDIGVDFF
                     PSDASQKPVDIANAAIDQARKKFYDVVIVDTAGRLHVDSDMMDEIKHLHATIKPVETL
                     FVVDAMTGQDAANTAKAFNEALPLTGVILTKADGDARGGAALSVRHITGKPVKFIGMG
                     EKTDALEPFHPDRLASRILGMGDVLSLIEEVERNVDKEKAAKLASKVKSGKGFDLEDF
                     REQLAQMRNMGGMMGMLDKLPGMSGLPDNIKDQMDDKLTVRMEAIISSMTPKERAHPD
                     LIKGSRKRRIAAGSGMQVQDVNKLLKQFTEMQRMMKKMSGKGGMRKMMGQMKNMLPPG
                     FGGGRGPF"
     gene            714902..715150
                     /gene="rpsP"
                     /locus_tag="AHA_RS03350"
                     /old_locus_tag="AHA_0666"
                     /db_xref="GeneID:4490673"
     CDS             714902..715150
                     /gene="rpsP"
                     /locus_tag="AHA_RS03350"
                     /old_locus_tag="AHA_0666"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010845359.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S16"
                     /protein_id="WP_005341383.1"
                     /db_xref="GeneID:4490673"
                     /translation="MVTIRLQRGGAKKRPFYQVVVADSRNARDGRFIERVGFFNPVAS
                     GNAEKLNLDLARIEHWVGTGAAVSDRVAKLIKDAAKAA"
     gene            715175..715696
                     /gene="rimM"
                     /locus_tag="AHA_RS03355"
                     /old_locus_tag="AHA_0667"
                     /db_xref="GeneID:4490674"
     CDS             715175..715696
                     /gene="rimM"
                     /locus_tag="AHA_RS03355"
                     /old_locus_tag="AHA_0667"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308697.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome maturation factor RimM"
                     /protein_id="WP_011704630.1"
                     /db_xref="GeneID:4490674"
                     /translation="MEKPVVLGTLGTVYGIKGWLKVNSFTDVAEAIFDYNPWLINQNG
                     VWREIQVSSWKRHNKGLICKLDGIDVREDALALTNVEIGVAADLLPALPEGEFYWRDL
                     IGCSVVTTKGYDLGKVTELMETGSNDVLVVEANVKDAFGAKERLIPFLEEQVIKNIDL
                     TARTIEVDWDPGF"
     gene            715731..716480
                     /gene="trmD"
                     /locus_tag="AHA_RS03360"
                     /old_locus_tag="AHA_0668"
                     /db_xref="GeneID:4490675"
     CDS             715731..716480
                     /gene="trmD"
                     /locus_tag="AHA_RS03360"
                     /old_locus_tag="AHA_0668"
                     /EC_number="2.1.1.228"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019840821.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (guanosine(37)-N1)-methyltransferase TrmD"
                     /protein_id="WP_011704631.1"
                     /db_xref="GeneID:4490675"
                     /translation="MWIGVISLFPEMFRAITEHGVTGRAVKSGLLQIECWNPRDFTHD
                     KHRTVDDRPYGGGPGMLMMVQPLRDAIHAAKQAAGDGAKVIYLSPQGRKLTQAGVTEL
                     ATNQKLILVAGRYEGIDERVIQTEVDEEWSIGDYVLSGGELPAMTLIDAVSRLVPGVL
                     GDQASAEQDSFTDGLLDHPHYTRPELLDGLAVPEALTSGNHEVIRRWRLKQSLGRTWQ
                     RRPELINNLALTDEQESLLAEYVREVRDSVK"
     gene            716513..716860
                     /gene="rplS"
                     /locus_tag="AHA_RS03365"
                     /old_locus_tag="AHA_0669"
                     /db_xref="GeneID:4490676"
     CDS             716513..716860
                     /gene="rplS"
                     /locus_tag="AHA_RS03365"
                     /old_locus_tag="AHA_0669"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008845077.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L19"
                     /protein_id="WP_005313505.1"
                     /db_xref="GeneID:4490676"
                     /translation="MSKIIQQLEQEQLRTDIPAFAQGDTVRVQVRVKEGGKERLQAFE
                     GIVIAKRNRGLHSAFTVRKISNGEGVERVFQTHSPLIHSVELKRRGDVRRAKLYYLRN
                     LSGKAARIKEKLN"
     gene            complement(716964..717293)
                     /locus_tag="AHA_RS03370"
                     /old_locus_tag="AHA_0670"
                     /db_xref="GeneID:4490677"
     CDS             complement(716964..717293)
                     /locus_tag="AHA_RS03370"
                     /old_locus_tag="AHA_0670"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704632.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1,4-alpha-glucan-branching protein"
                     /protein_id="WP_011704632.1"
                     /db_xref="GeneID:4490677"
                     /translation="MPINKQFLKSRPEVKVTFAVEKEAAGEAEQVLLLGEFSQWQPIE
                     LKRMKSGEFKTTLNLPTDGPAHFEYCYQLVQPNGETHYDNDWAADDYVPGPFGRDNSV
                     VRVSQPG"
     gene            complement(717376..718050)
                     /gene="mutH"
                     /locus_tag="AHA_RS03375"
                     /old_locus_tag="AHA_0671"
                     /db_xref="GeneID:4490678"
     CDS             complement(717376..718050)
                     /gene="mutH"
                     /locus_tag="AHA_RS03375"
                     /old_locus_tag="AHA_0671"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308705.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair endonuclease MutH"
                     /protein_id="WP_011704633.1"
                     /db_xref="GeneID:4490678"
                     /translation="MPTNPQSEQELLARAYAMAGFTLAQLAATADIAVPADLRRDKGW
                     VGQLIEWQLGASAGSKPEQDFPDLGIELKTIPIDPQGKPLETTFVCVAPLIGVSGQQW
                     ELSNVRNKLSRVLWIPVEGSREIPIGERRIGMPLLWSPNEEEERLLRQDWEELMDMIV
                     LGEVEQISARHGQVLQLRPKAANNKALTRAIGRNGQPIMTLPRGFYLKIGFTHGLLQR
                     HFALPA"
     gene            718784..719311
                     /gene="rppH"
                     /locus_tag="AHA_RS03380"
                     /old_locus_tag="AHA_0672"
                     /db_xref="GeneID:4490679"
     CDS             718784..719311
                     /gene="rppH"
                     /locus_tag="AHA_RS03380"
                     /old_locus_tag="AHA_0672"
                     /EC_number="3.6.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005357996.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA pyrophosphohydrolase"
                     /protein_id="WP_011704634.1"
                     /db_xref="GeneID:4490679"
                     /translation="MIDGDGFRPNVGIVICNRDGQVLWAKRYGQHSWQFPQGGVDDGE
                     TPEQAMYRELYEEIGLKPEDVTIMATSRNWLKYRLPKRLVRWDSSPVCIGQKQKWFLL
                     QLDPGRESRIQFGCHGHPEFDDWRWVSFWYPVRQVVSFKREVYRRVMKEFAPLAMPVP
                     AVQVNKKDGRRNRPR"
     gene            719326..721605
                     /gene="ptsP"
                     /locus_tag="AHA_RS03385"
                     /old_locus_tag="AHA_0673"
                     /db_xref="GeneID:4490680"
     CDS             719326..721605
                     /gene="ptsP"
                     /locus_tag="AHA_RS03385"
                     /old_locus_tag="AHA_0673"
                     /EC_number="2.7.3.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017411600.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate--protein phosphotransferase"
                     /protein_id="WP_011704635.1"
                     /db_xref="GeneID:4490680"
                     /translation="MLTELRRIVESMAEANTLELALQALVSQTRLAMMVDCCSVYVSE
                     PEMRRYRLAATDGLAESAVGKATLPFEQGIVGLVGQREELINLADAPSHPSFKFLPDV
                     AEEAFRSFLGAPIMHQRQVVGILVVQQKESRLFDEGEESFMVTLAAQLAARIAQAQAK
                     GWLQKTDWSKPLRGIAGASGIAMAKAWVWRPRKELNSITPRKDEDHARQLERLNVAVE
                     EVRHDLESLALRFRESYSQDSVAIFDIYLHLLNDPGYIKPIRNKVSKEHWTGVSAVKL
                     ISDRLIDQFKGMKDPYLQERSTDVKDIAQRLISRLVQNEPEHIAIGEPVVLVADEVTA
                     TILAEVPREFLTGVVSLKGGTNSHAAILARAMGVAAIMGVDLPLGDIGGRMLVVDGYS
                     GDLFIEPNQVILTEYRQLLSEERALDTLVRSVDNQPSETADGVPVSLLLNAGLSADTE
                     ISLNQLADGVGLYRTEIPFMLQDSFPSEWEQTARYRGILETYRNRPVCMRTLDVGGDK
                     QLPYFPIVEENPFLGWRGIRLTLDHPELFLVQLKAMLRASEGLDNLAIMLPMISSVSE
                     IKASRRLLDQAWREVSEEAASREAVIRYPSLGVMIEVPSALYILPEMAPLIDFWSVGS
                     NDLTQYLLAVDRNNARVANIYDAFHPAVIRALQLLVDASHRYQKPVSVCGELAGDPVG
                     VLLLLAMGYRRFSMNTHNIARIKYVLRQSTLSELTVLLTDGLKHDNPHVLRGLFARYL
                     EEHGLGGLLRAGHKTKQTD"
     gene            721673..722497
                     /gene="lgt"
                     /locus_tag="AHA_RS03390"
                     /old_locus_tag="AHA_0674"
                     /db_xref="GeneID:4490681"
     CDS             721673..722497
                     /gene="lgt"
                     /locus_tag="AHA_RS03390"
                     /old_locus_tag="AHA_0674"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005892407.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prolipoprotein diacylglyceryl transferase"
                     /protein_id="WP_011704636.1"
                     /db_xref="GeneID:4490681"
                     /translation="MQHDGYWVFSQIDPVAFSLGPLSVRWYGLMYLFGFAFAMWLAGR
                     RADAPNSGWTRNEVSDLLFYGFLGVILGGRVGYVLFYNFDMFLADPLYLFKIWTGGMS
                     FHGGLIGVITAMVWFAHKTNRHFFTVADFVAPLIPFGLGVGRIGNFLNGELWGRVTDV
                     PWAIIFPEAGPEPRHPSQLYQFALEGVVLFIILNLFWRKNPPRGAISGMFLLFYGLFR
                     FLVEFVRQPDSQLGLYFQEISMGQILSTPMIIIGALMIWVAYKRPQLFGNSVKEAK"
     gene            722497..723291
                     /gene="thyA"
                     /locus_tag="AHA_RS03395"
                     /old_locus_tag="AHA_0675"
                     /db_xref="GeneID:4490682"
     CDS             722497..723291
                     /gene="thyA"
                     /locus_tag="AHA_RS03395"
                     /old_locus_tag="AHA_0675"
                     /EC_number="2.1.1.45"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005123418.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thymidylate synthase"
                     /protein_id="WP_011704637.1"
                     /db_xref="GeneID:4490682"
                     /translation="MRAYLDLMQKILDEGTVKSDRTGTGTISLFGHQMRFNLAEGFPL
                     VTTKKCHLRSIIHELLWFLNGDTNTAYLKEHGVSIWDEWADENGDLGPVYGAQWRSWP
                     AADGSVIDQIQKAVDDIKHNPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLS
                     CQLYQRSCDVFLGLPFNIASYALLTHMMAQQCDLEVGDFVWTGGDVHLYSNHMEQTAL
                     QLTREPRPLPTLVIKRKPDSIFDYKFEDFEIEGYDPHPGIKAPVAI"
     gene            723518..724708
                     /gene="nhaA"
                     /locus_tag="AHA_RS03400"
                     /old_locus_tag="AHA_0676"
                     /db_xref="GeneID:4490683"
     CDS             723518..724708
                     /gene="nhaA"
                     /locus_tag="AHA_RS03400"
                     /old_locus_tag="AHA_0676"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308714.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Na+/H+ antiporter NhaA"
                     /protein_id="WP_011704638.1"
                     /db_xref="GeneID:4490683"
                     /translation="MSDVIKKFLKLEAASGIILIMAAMLAMILANSGLAGSYQAFLDT
                     QVQVRIAALDINKPLLLWINDGFMAVFFLLVGLEVKREMLEGALSSRVQATFPAIAAV
                     GGMLAPALIYAFFNYSDEVARAGWAIPAATDIAFALGVMALLGKRVPVSLKVFLLALA
                     IMDDLGVIIIIALFYTQQLSLTALAIGILATLTLLWMNRRGEDRISLYMLVGLVLWVA
                     VLKSGVHATLAGVIVGFMIPLSGKRYASPLKQLEHALHPWSAYLILPLFAFANAGVSL
                     EGIGLSALLSPVPLGIMLGLFIGKPLGVFTISWLAVKLGIAQLPNGVNFKQIFAVSIL
                     CGIGFTMSMFIASLAFEHGGLDYGSYSRLGILVGSTLAAIVGYLALRIALPNREADQS
                     TEGL"
     gene            724705..725112
                     /locus_tag="AHA_RS03405"
                     /db_xref="GeneID:44141875"
     CDS             724705..725112
                     /locus_tag="AHA_RS03405"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011898350.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_026080223.1"
                     /db_xref="GeneID:44141875"
                     /translation="MKRLGWLALLALSQTAWAGSLQDCQQDAASAGCSAYLNGVVDSA
                     LMLGDKQAKAQFGETFAERALSSRAGERVKQSNKRYCGERMPDPARLKAHLQAQFDAN
                     KVDSISDMYDILAAELSCYRSPRSAGTPSDVTP"
     gene            725099..726031
                     /gene="nhaR"
                     /locus_tag="AHA_RS03410"
                     /old_locus_tag="AHA_0677"
                     /db_xref="GeneID:4490684"
     CDS             725099..726031
                     /gene="nhaR"
                     /locus_tag="AHA_RS03410"
                     /old_locus_tag="AHA_0677"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308802.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional activator NhaR"
                     /protein_id="WP_011704639.1"
                     /db_xref="GeneID:4490684"
                     /translation="MSHLNYNHLYYFWMTQKKGSVTQAAEALFLTPQTVTGQIKLLEQ
                     RLGGKLLMRKGRSLEATELGQLVFRYADKMFSLSYEMLDIVNYRKESQILFDVGIADA
                     LSKRLASRVLLSVIPNDGSIHLRCFESTHELLLEQLSEHKLDMILSDCPVDSSQHAGL
                     LSKRLGGCGVSFFCKAPLPLLPFPACLEERKLLIPGRRTAMGRQLTQWFEQQGVSPSI
                     LGEFDDAALMKAFGFFNQGIFMAPTIYREEILEGEEVMLLGETQDLMEEYYVIFAERM
                     IQHPAVKRVCESDFSFLFAGQEDFTTIQPATLSF"
     gene            726081..726383
                     /locus_tag="AHA_RS03415"
                     /old_locus_tag="AHA_0678"
                     /db_xref="GeneID:4490685"
     CDS             726081..726383
                     /locus_tag="AHA_RS03415"
                     /old_locus_tag="AHA_0678"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005358010.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="winged helix-turn-helix transcriptional
                     regulator"
                     /protein_id="WP_016349423.1"
                     /db_xref="GeneID:4490685"
                     /translation="MQLEEMEANASRAVALLKALANERRLFILCQLLERELSVGELNE
                     RLGLSQSALSQHLAVLRRDELVETRKEAQTVYYSLRSHEVREMIGLLHKLYCSEQK"
     gene            complement(726434..726697)
                     /gene="rpsT"
                     /locus_tag="AHA_RS03420"
                     /old_locus_tag="AHA_0679"
                     /db_xref="GeneID:4490686"
     CDS             complement(726434..726697)
                     /gene="rpsT"
                     /locus_tag="AHA_RS03420"
                     /old_locus_tag="AHA_0679"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005345658.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S20"
                     /protein_id="WP_005308808.1"
                     /db_xref="GeneID:4490686"
                     /translation="MANIKSAKKRALQSEKRRQHNASRRSMTRTYLKKVIAAIASGDK
                     AAATAAFAVAQPIMDRMATKGLIHKNKAARHKSRLSAQIKAMA"
     gene            726889..728454
                     /gene="murJ"
                     /locus_tag="AHA_RS03425"
                     /old_locus_tag="AHA_0680"
                     /db_xref="GeneID:4490687"
     CDS             726889..728454
                     /gene="murJ"
                     /locus_tag="AHA_RS03425"
                     /old_locus_tag="AHA_0680"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349424.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="murein biosynthesis integral membrane protein
                     MurJ"
                     /protein_id="WP_011704641.1"
                     /db_xref="GeneID:4490687"
                     /translation="MSKKLIKSGMIVSGMTLASRVMGLVRDVVIANLLGAGVAADVFF
                     FANRIPNFLRRLFAEGAFNQAFVPVMTEYKKKGDESEVRELLAAVAGTLGGIVTVVTL
                     LGVLGSGVLTALFGWGWFWDWLHGGPAAEKFEMASLMLKITFPYLWFITFTAMAGAIL
                     NTFGRFGVSSFTPIFLNITMIAAAWWISPWLDDPELALAIGVFLGGLVQFLFQFPFLR
                     QINMLVWPKWGWHHPGVVKIRTLMIPALFGVSVSQINLLVNTMLASFLATGAISYLYY
                     SDRLLEFPLGMFGVAISTVILPALAKKHVDADPADFSRTMDWGVRMVMLLGLPAMVGI
                     AVLREPILRVLFMRGEFGLHEVSMSSASLLASTTGLLSLMLIKVLAPGYYARQDTRTP
                     VRIGMMSMAANMACNLIFIYPLGYVGLALSTACSGTLNAALLFKGLHQQNVYRPSRHT
                     GVFCLKLLTASLLMGSVLLYFSPDLAQWGAWHMSKASMQLTMLLVLGGAIYAGVLLAL
                     GIRPKDLRAGRDD"
     gene            complement(728494..728691)
                     /locus_tag="AHA_RS03430"
                     /db_xref="GeneID:44141876"
     CDS             complement(728494..728691)
                     /locus_tag="AHA_RS03430"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_164927494.1"
                     /db_xref="GeneID:44141876"
                     /translation="MMTLMNSIKVANGQYTPPVTGLDIVNTADKLHQCLVRRCYENRR
                     IIYQAALWVSPVADPISAIPP"
     gene            728596..729570
                     /gene="ribF"
                     /locus_tag="AHA_RS03435"
                     /old_locus_tag="AHA_0681"
                     /db_xref="GeneID:4487673"
     CDS             728596..729570
                     /gene="ribF"
                     /locus_tag="AHA_RS03435"
                     /old_locus_tag="AHA_0681"
                     /EC_number="2.7.1.26"
                     /EC_number="2.7.7.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017787506.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional riboflavin kinase/FAD synthetase"
                     /protein_id="WP_011704642.1"
                     /db_xref="GeneID:4487673"
                     /translation="MELIRGIHNIKPRHRGCVLTIGNFDGVHQGHHAVLFRLQEKAAQ
                     LGLPACVMLFEPQPLELFAGAAAPARLSRLREKYEALKGMQIDRMLCVRFNHRFAEQS
                     ATTFIEQLLVEKLGVHYLVVGDDFRFGKGREGDFHLLEEAGRRFGFEVISTQSFQLSR
                     QRVSSTLVREALAAGRMAEVELMLGRPYTISGRVAHGDKLGRTIGFPTANLALKRQVI
                     PVGGVFAVEVLCSGKTFPGVANVGVRPTLSGTQARLEVHLFDFSGDLYGQQVKVLLRH
                     KLREEQKFASFTALKEQIERDALAARAWFGLPLLHLPSTLLEKKGTQD"
     gene            729570..732431
                     /gene="ileS"
                     /locus_tag="AHA_RS03440"
                     /old_locus_tag="AHA_0682"
                     /db_xref="GeneID:4487674"
     CDS             729570..732431
                     /gene="ileS"
                     /locus_tag="AHA_RS03440"
                     /old_locus_tag="AHA_0682"
                     /EC_number="6.1.1.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005341357.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isoleucine--tRNA ligase"
                     /protein_id="WP_011704643.1"
                     /db_xref="GeneID:4487674"
                     /translation="MSDYKHTLNLPETEFPMRGDLAKREPNMLKRWYDQDLYGAIRRA
                     KAGKPSFILHDGPPYANGSIHIGHSVNKILKDIIIKSKGLSGFDSPYVPGWDCHGLPI
                     ELKVEGMVGKPGEKVSAAEFRAECRKYAKTQIEAQKTDFIRLGVLGDWEHPYLTMDFG
                     TEANIIRSMAKIVENGHLHKGSKPVHWCTDCGSALAEAEVEYYDKNSPSIDVRFKAVD
                     EAGVAAKFDCAEGHTGKGPISAVIWTTTPWTLPANRGIAMHADLDYALVQVEGEHPER
                     LILAAELVKDVMDRAGIEQFHNLGYAKGAALELLRFNHPFYSFDVPVVLGDHVTLDAG
                     TGAVHTAPGHGQEDFVVGQKYGLEVANPVGSNGVYLPDTELFAGQHVFKANASVVEVL
                     TERGALLHHKVFNHSYPHCWRHKTPIIFRATPQWFISMEQKGLRQRALEEIERIEQDG
                     IKQHGQSGWVPAWGKNRIQAMVENRPDWCISRQRTWGVPISLFVHKETQELHPESVRL
                     MHEVAKRVEQSGIQAWWDLDKAELLGSDADLYDKVPDTLDVWFDSGSTHSSVVDARPE
                     FNGNPADMYLEGSDQHRGWFMSSLMIGVAMKDKAPYNQVLTHGFTVDGQGRKMSKSIG
                     NVVSPQDVMNKLGADILRLWVASTDYTGEMTVSDEILKRSADAYRRIRNTARFLLANL
                     NGFNPATDMVAPADMVVVDRWAVGRAKAVQAEIMAAFDEYNFHGVTQKLMQFCSIEMG
                     SFYLDVIKDRQYTAKADSLARRSCQTALYHIAEAMVRWMAPIMSFTADEIWALLPGER
                     GEFVFTEEWYDGLFGLEAGETLNDDFWAEILTVRGEVNKALEVARGEKRIGGSLQAEL
                     TLFAKPALAARLNALADELRFVLLTSKAKVVSVDAAPADAVATERDDLWLSVAQSAAA
                     KCDRCWHHVEDVGTIAGHEEICGRCVTNVEGDGETRQFA"
     gene            732431..732934
                     /gene="lspA"
                     /locus_tag="AHA_RS03445"
                     /old_locus_tag="AHA_0683"
                     /db_xref="GeneID:4487675"
     CDS             732431..732934
                     /gene="lspA"
                     /locus_tag="AHA_RS03445"
                     /old_locus_tag="AHA_0683"
                     /EC_number="3.4.23.36"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017780264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein signal peptidase"
                     /protein_id="WP_011704644.1"
                     /db_xref="GeneID:4487675"
                     /translation="MNMTHHKSGLRWLWLAVLAFVLDQASKLAVVKLLPFGYPGVEIT
                     PFFNLVHVYNKGAAFSFLADQGGWQRWFFAVLAFAICGLLIHWLRKQSVAQRWSGIAY
                     SLIIGGALGNVFDRLVLGHVVDFLDFYWQRAHWPAFNLADSFIFIGAAMIVLDGFRSE
                     KKKDVTP"
     gene            732931..733383
                     /gene="fkpB"
                     /locus_tag="AHA_RS03450"
                     /old_locus_tag="AHA_0684"
                     /db_xref="GeneID:4487676"
     CDS             732931..733383
                     /gene="fkpB"
                     /locus_tag="AHA_RS03450"
                     /old_locus_tag="AHA_0684"
                     /EC_number="5.2.1.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005340448.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FKBP-type peptidyl-prolyl cis-trans isomerase"
                     /protein_id="WP_011704645.1"
                     /db_xref="GeneID:4487676"
                     /translation="MSQPIAADSSVLFHFAIKLEDGSVADSTALQGKPARLRMGDGSL
                     TSSFEQCLLGLREGESKSFTLAPEEAFGLSNPDNIYHLDRAKFGADVEPKVGTIILFD
                     QPNGSELPGIIRAVAGMSVTVDFNHPLAGHTVTFEVEILGVDDEEAVH"
     gene            733383..734318
                     /gene="ispH"
                     /locus_tag="AHA_RS03455"
                     /old_locus_tag="AHA_0685"
                     /gene_synonym="lytB"
                     /db_xref="GeneID:4487677"
     CDS             733383..734318
                     /gene="ispH"
                     /locus_tag="AHA_RS03455"
                     /old_locus_tag="AHA_0685"
                     /gene_synonym="lytB"
                     /EC_number="1.17.7.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005313459.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxy-3-methylbut-2-enyl diphosphate
                     reductase"
                     /protein_id="WP_011704646.1"
                     /db_xref="GeneID:4487677"
                     /translation="MNILLANPRGFCAGVDRAISIVESALEKFGAPIYVRHEVVHNRY
                     VVNKLKEAGAVFVEELDEVPDDSIVIFSAHGVSKAVREMAKSRALKVFDATCPLVTKV
                     HMEVHRASRKGSEAVLIGHAGHPEVIGTMGQYENREGGMYLVETPEDVAKLKVKNPDD
                     LCFVTQTTLSVDETSDVIDALRAHFPKIQGPRKDDICYATQNRQDAVREMAGLVDAML
                     VVGSRNSSNSNRLRELAEKVGAKAYLIDDASMIEADWLAGVEAIGVTAGASAPEVLVQ
                     SVITRLRELGGKVVAEHPGREENVVFEVPPELRIL"
     gene            734580..735083
                     /locus_tag="AHA_RS03460"
                     /old_locus_tag="AHA_0686"
                     /db_xref="GeneID:4487678"
     CDS             734580..735083
                     /locus_tag="AHA_RS03460"
                     /old_locus_tag="AHA_0686"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349428.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin-type N-terminal cleavage/methylation
                     domain-containing protein"
                     /protein_id="WP_011704647.1"
                     /db_xref="GeneID:4487678"
                     /translation="MFLRSGFSLIELMVTVALISILLTLGVPSFSAILRNMTLTSQAN
                     NFVAAINLARSEAIRRNTAVTLSATASNLTQNHWESGWQIWVDRNGNGTLDNGELLRL
                     FPDMGAGTLVSNTSLVRFSGNGFLDGRQQVALVFSLQPPECAQEASRDITITPAGRPS
                     IVETSCI"
     gene            735080..735493
                     /gene="pilV"
                     /locus_tag="AHA_RS03465"
                     /old_locus_tag="AHA_0687"
                     /db_xref="GeneID:4487679"
     CDS             735080..735493
                     /gene="pilV"
                     /locus_tag="AHA_RS03465"
                     /old_locus_tag="AHA_0687"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308826.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV pilus modification protein PilV"
                     /protein_id="WP_011704648.1"
                     /db_xref="GeneID:4487679"
                     /translation="MKRHQGVSLLEIMIAVLVLSIGILGMATLQLQALKSNQSALTRT
                     EATQFGYMITDMMRANRSAALLGQYNVGLGEAVSGSSMAIQDVQYWKQALTGLPGGDG
                     AIAVSAGQATITIQWNASRLATEPALRSMTLRTDL"
     gene            735490..736584
                     /locus_tag="AHA_RS03470"
                     /old_locus_tag="AHA_0688"
                     /db_xref="GeneID:4487680"
     CDS             735490..736584
                     /locus_tag="AHA_RS03470"
                     /old_locus_tag="AHA_0688"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019838722.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PilW family protein"
                     /protein_id="WP_011704649.1"
                     /db_xref="GeneID:4487680"
                     /translation="MSGRRTLLRQAGVGLVEVMIALLLSLLTVGVIIQVLLGNHKTYL
                     TGEAIARVQEDSRFAVNLLQQELRMVGYQGCLSKQGVNITNTLNGGTALPYNFTVYLR
                     GYDNVTATLPTALSALFTAAEPKPKPGTDVLLVQGPTGAGVPVTRNNSAAQLFVQQLS
                     SKANYCGTGKQGYSDLCEGDIVMVSDCQKARIFQITQTQVVGGGSEVNIGHSNDNKYT
                     PGNTVSSWGGASSPVEERFGAGSVLSRMETRIYYIARPSANAPYALYRKSGLAAGMLL
                     VDGVTDVQLTFGEDQNRDRAADRYVSAASNPNWDNVLGIGVQLLMRSGQGNVVSDPQA
                     ISFAGATFQAVDNHWYWVAETTVALRNRLP"
     gene            736616..737071
                     /locus_tag="AHA_RS03475"
                     /old_locus_tag="AHA_0689"
                     /db_xref="GeneID:4487681"
     CDS             736616..737071
                     /locus_tag="AHA_RS03475"
                     /old_locus_tag="AHA_0689"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349431.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein"
                     /protein_id="WP_039214245.1"
                     /db_xref="GeneID:4487681"
                     /translation="MALVISLIFLAVVSLLAMASMQSALLQEKMAGNQKESQQALQAA
                     EAALRAAERYLEAGSSGPYDNSAGLYEFVSVAVDPASPSTAWRTYANSGLSGRAPEYF
                     IERLPYTQGSNESLAVDEPISERRLYRITARGFGLSDESRVLLQSTYSR"
     gene            737083..740436
                     /locus_tag="AHA_RS03480"
                     /old_locus_tag="AHA_0690"
                     /db_xref="GeneID:4487682"
     CDS             737083..740436
                     /locus_tag="AHA_RS03480"
                     /old_locus_tag="AHA_0690"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017782212.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus biosynthesis protein"
                     /protein_id="WP_011704651.1"
                     /db_xref="GeneID:4487682"
                     /translation="MRASGYGLSALLLCTQVQAALDIAQVPLYLGTRAEPNIMFSLDD
                     SGSMHFELMPEGLIENSARYVYPRADNVYGSEDYDNRTVTFTSNNDRNAYTRSSNNNK
                     LYYNPQQSYRPWAKADGTLMANASISCAPHNPFNTAAGCRDLTKNNRSKSLRYYTGFS
                     STDYNDDETFWPAVYFAYKGSGDVKKVGSYTRVEIKSGSTYGGRPNRSDCKSAPVCTY
                     DEEIQNFANWYTYYRSRILAARAGVGRAFASQGQALRVGFATINASGSVIRGVAPFSG
                     TDRSAFFSDLYSRDIPAAGTPLRTSLKDVGEYFSRTDNNGPWAASAGSTLPHLTCRQS
                     YNILMTDGYWNGDTPSVGDLDKDGYSNTLADVAYKYWKTDLRADLADKVPTSTADPAN
                     WQHLVNFTVGLGVNGSLNPANGIPNRWPNPHDPDDKEYKNATYIPEYKIDDLWHAALN
                     SKGSFFSAGDPDIFAAALSSTLAQIAARNSSASSVTANATRLDSNTHIYQARYNSGDW
                     SGQLISIPLNSDGSLGNMAWDAATLIPAHTSRSIFTRQNGVGIPFTWAALNATNRALF
                     NLAGDSQGENRVAYLRGDRSREQSNGGLFRSRSDLLGDIINSDPVYVGSRDYGYGSAT
                     GLTQAERDGYLSFLGSTAIRSRTPMLYVGANDGMLHGFRVANGVETLAYIPVSLLGDL
                     SLLTKPDYSHRYYVDGTAKVGDAYLGSSWKTVLLGSTGAGGKAVFAIDVTAPDNFTAD
                     KMLWEFTNTEMGVALAAPTLVRVKSGNKWVALVANGYNSTSQTARLFVLDLATGAVIK
                     EIDTQVGSASEPNGLSSPLPVDEDGDRVADYVYAGDLQGNLWKFDLTDNNSAQWGSAF
                     KTGNKPKPLFQACNGTCSASTRQPVTMRPLAIRHPKGGIMVLMGTGSYFTNDDKLLPA
                     TPRLEAVYGIWDTGASVLSSQLLQQSITHEYSANGTTIKFNVRVVSNTGVNYTSQKGW
                     YLVLKSPALSKGVGERAVSEMLYRNKRLIFNTLIPSADACDFGGRSWLMELDPVSGAR
                     LTYSVFDVNGDGAVNDDDYVGIKDSGGNDIKVPVSGKQFDELTTTPSVVEDADMERKY
                     ISGSSGNISVTLEEGAGDLGGRQSWLQLE"
     gene            740445..740846
                     /locus_tag="AHA_RS03485"
                     /old_locus_tag="AHA_0691"
                     /db_xref="GeneID:4487683"
     CDS             740445..740846
                     /locus_tag="AHA_RS03485"
                     /old_locus_tag="AHA_0691"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017763999.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin-type N-terminal cleavage/methylation
                     domain-containing protein"
                     /protein_id="WP_011704652.1"
                     /db_xref="GeneID:4487683"
                     /translation="MVRGFSLMELMIAVAVTAILTVIAYPSYNSYMASAKRAEAKAAL
                     LEAAQYMERQFTADGNYDGGNLASAGLATLPRDGGTAYYNLALNASGASYTLTAIPTG
                     VMNGDPCGLLTLDQGGQQGVSMASMTAAECW"
     gene            complement(740851..741237)
                     /locus_tag="AHA_RS03490"
                     /old_locus_tag="AHA_0692"
                     /db_xref="GeneID:4488314"
     CDS             complement(740851..741237)
                     /locus_tag="AHA_RS03490"
                     /old_locus_tag="AHA_0692"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005308836.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin-type N-terminal cleavage/methylation
                     domain-containing protein"
                     /protein_id="WP_011704653.1"
                     /db_xref="GeneID:4488314"
                     /translation="MRIKQSGITLLELIVVVTIVAIIASVAYPSFTDGLRKSRRAEAL
                     KGLLSMQLKQEEFRVSNTSYSATPSQVGNPTSSYYDFSISGATATNYTLIATSKGAQV
                     GDKSGSTICNTLTLNKADTKTPAACW"
     gene            741332..741868
                     /locus_tag="AHA_RS03495"
                     /old_locus_tag="AHA_0693"
                     /db_xref="GeneID:4488315"
     CDS             741332..741868
                     /locus_tag="AHA_RS03495"
                     /old_locus_tag="AHA_0693"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016349435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin-type N-terminal cleavage/methylation
                     domain-containing protein"
                     /protein_id="WP_011704654.1"
                     /db_xref="GeneID:4488315"
                     /translation="MEGRKGRSAGFTLIELMVALSLVALLLTVAIPSYQSLRQDQMVK
                     AATQAVYTDMMLLKSEALKRNRNLQMILFNSGTGNWCYRISIDGSCASCNDTCSSIEG
                     RKGVDASEFPGIILTGTYTESSSQIRPISFSPRRGTLPSGSITVSSSAASMKVVTNNL
                     GRVRTCAVSNLVGEVACN"
     gene            741859..742482
                     /locus_tag="AHA_RS03500"
                     /old_locus_tag="AHA_0694"
                     /db_xref="GeneID:4488316"
     CDS             741859..742482
                     /locus_tag="AHA_RS03500"
                     /old_locus_tag="AHA_0694"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011704655.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV pilin"
                     /protein_id="WP_011704655.1"
                     /db_xref="GeneID:4488316"
                     /translation="MQLKIRGFNLVELMVAMVAGLLLVAAVISLFATILKANYTAMQT
                     SRLNQEVQLLTDMMARDIQRAGYDANATQFLAAPSGSRSSFYFDTATDLMGETATGSG
                     LYTCIRVRYDNDENGVLSSDDTLVYSYSSSSKGIKQGTGTTTCGNGSLISSDDTVEIT
                     AMTFRLLPSSQVSGARALQLMVSGRFKATPALTLNLQRDIKLRNDGY"
     gene            742484..743581
                     /locus_tag="AHA_RS03505"
                     /old_locus_tag="AHA_0695"
                     /db_xref="GeneID:4488317"
     CDS             742484..743581
                     /locus_tag="AHA_RS03505"
                     /old_locus_tag="AHA_0695"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017787512.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011704656.1"
                     /db_xref="GeneID:4488317"