GenomeNet

Database: RefSeq
Entry: NC_009009
LinkDB: NC_009009
Original site: NC_009009 
LOCUS       NC_009009            2388435 bp    DNA     circular CON 28-AUG-2016
DEFINITION  Streptococcus sanguinis SK36 chromosome, complete genome.
ACCESSION   NC_009009
VERSION     NC_009009.1
DBLINK      BioProject: PRJNA58381
            Assembly: GCF_000014205.1
KEYWORDS    RefSeq.
SOURCE      Streptococcus sanguinis SK36
  ORGANISM  Streptococcus sanguinis SK36
            Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae;
            Streptococcus.
REFERENCE   1  (bases 1 to 2388435)
  AUTHORS   Xu,P., Alves,J.M., Kitten,T., Brown,A., Chen,Z., Ozaki,L.S.,
            Manque,P., Ge,X., Serrano,M.G., Puiu,D., Hendricks,S., Wang,Y.,
            Chaplin,M.D., Akan,D., Paik,S., Peterson,D.L., Macrina,F.L. and
            Buck,G.A.
  TITLE     Genome of the opportunistic pathogen Streptococcus sanguinis
  JOURNAL   J. Bacteriol. 189 (8), 3166-3175 (2007)
   PUBMED   17277061
REFERENCE   2  (bases 1 to 2388435)
  AUTHORS   Xu,P., Alves,J.M., Kitten,T., Peterson,D.L., Macrina,F. and
            Buck,G.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (07-JUN-2006) Virginia Commonwealth University, Philips
            Institute, Richmond, VA 23298, USA
REFERENCE   3  (bases 1 to 2388435)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (03-NOV-2000) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CP000387.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..2388435
                     /organism="Streptococcus sanguinis SK36"
                     /mol_type="genomic DNA"
                     /strain="SK36"
                     /db_xref="taxon:388919"
     gene            214..1566
                     /gene="dnaA"
                     /locus_tag="SSA_0001"
                     /db_xref="GeneID:4807412"
     CDS             214..1566
                     /gene="dnaA"
                     /locus_tag="SSA_0001"
                     /function="DNA replication, recombination, and repair"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="binds to the dnaA-box as an ATP-bound complex at
                     the origin of replication during the initiation of
                     chromosomal replication; can also affect transcription of
                     multiple genes including itself."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiation protein"
                     /protein_id="YP_001034021.1"
                     /db_xref="GeneID:4807412"
                     /translation="MTKEQDFWNRILELAHAQLKQTTYDFFVAEAKLVKVEEKQAIIF
                     LDSPVKQLFWEQNLVGVILTAGFEIFNDQIAGKYIFEEETNTETSKSVVTSPQISTVQ
                     PSLPPIDTGLKSKYTFDNFVQGDGNIWAKAAALAVSENLATTYNPLFIYGGPGLGKTH
                     LLNAIGNQILENIPDARVKYIPAETFINDFLEHLRLGEMDSFKKIYRSLDLLLIDDIQ
                     SLGGKKVSTQEEFFNTFNALHGENKQIVLTSDRSPDHLDNLEERLVTRFKWGLTQNIT
                     PPDFETRIAILRNKIEDLDYIFPNDTLEYLAGQFDSNVRDLEGALNDISLIARVRHLK
                     EITIDIAAEAIRARKQDSSQVTVIPIDKIQSEVGKFYGVSVKEMKGSRRVQNIVLARQ
                     VAMYLTRELTDNSLPKIGREFGGKDHTTVIHAHGKIKTMIESDDNLRLEIESIKNKIK
                     "
     misc_feature    235..1560
                     /gene="dnaA"
                     /locus_tag="SSA_0001"
                     /note="chromosomal replication initiator protein DnaA;
                     Region: DnaA; TIGR00362"
                     /db_xref="CDD:273037"
     misc_feature    547..1179
                     /gene="dnaA"
                     /locus_tag="SSA_0001"
                     /note="P-loop containing Nucleoside Triphosphate
                     Hydrolases; Region: P-loop_NTPase; cl21455"
                     /db_xref="CDD:304359"
     misc_feature    667..690
                     /gene="dnaA"
                     /locus_tag="SSA_0001"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(670..693,856..858,958..960)
                     /gene="dnaA"
                     /locus_tag="SSA_0001"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    844..861
                     /gene="dnaA"
                     /locus_tag="SSA_0001"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    997..999
                     /gene="dnaA"
                     /locus_tag="SSA_0001"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    1291..1560
                     /gene="dnaA"
                     /locus_tag="SSA_0001"
                     /note="C-terminal domain of bacterial DnaA proteins. The
                     DNA-binding C-terminal domain of DnaA contains a
                     helix-turn-helix motif that specifically interacts with
                     the DnaA box, a 9-mer motif that occurs repetitively in
                     the replication origin oriC. Multiple...; Region:
                     Bac_DnaA_C; cd06571"
                     /db_xref="CDD:119330"
     misc_feature    order(1360..1362,1384..1389,1408..1410,1426..1434,
                     1459..1473,1480..1482,1489..1494)
                     /gene="dnaA"
                     /locus_tag="SSA_0001"
                     /note="DnaA box-binding interface [nucleotide binding];
                     other site"
                     /db_xref="CDD:119330"
     gene            1725..2861
                     /gene="dnaN"
                     /locus_tag="SSA_0002"
                     /db_xref="GeneID:4807815"
     CDS             1725..2861
                     /gene="dnaN"
                     /locus_tag="SSA_0002"
                     /EC_number="2.7.7.7"
                     /function="DNA replication, recombination, and repair"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="binds the polymerase to DNA and acts as a sliding
                     clamp"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="YP_001034022.1"
                     /db_xref="GeneID:4807815"
                     /translation="MIHFSINKNLFLQALNTTKRAISHKNAIPILSTVKIDVTKEGIT
                     LIGSNGQVSIENFISTQNENAGLLVNSTGSILLEATFFINVVSSLPDIILDFKEIEQK
                     QIVLTSGKSEITLKGKDADQYPRIQEISASNPLVLETKILKDVINETAFAASVQESRP
                     ILTGVHFVLTDNRSLKTVATDSHRMSQKKITLEKNGDNFDVVIPSRSLREFTAVFTDE
                     IETVEVFFANNQILFRSENISFYTRLLEGNYPDTDRLIPTEFTSVLTFNTSDLRAAME
                     RARLLSNATQNGTVKLEITGGVVSAHVNSPEVGRVNEEIDTESVTGEDLTISFNPTYL
                     IDALKAIDSEKVTISFISSVRPFTLVPSEDTENFIQLITPVRTN"
     misc_feature    1728..2855
                     /gene="dnaN"
                     /locus_tag="SSA_0002"
                     /note="DNA polymerase III subunit beta; Validated; Region:
                     PRK05643"
                     /db_xref="CDD:235541"
     misc_feature    1731..2852
                     /gene="dnaN"
                     /locus_tag="SSA_0002"
                     /note="Beta clamp domain. The beta subunit (processivity
                     factor) of DNA polymerase III holoenzyme, refered to as
                     the beta clamp, forms a ring shaped dimer that encircles
                     dsDNA (sliding clamp) in bacteria. The beta-clamp is
                     structurally similar to the trimeric...; Region:
                     beta_clamp; cd00140"
                     /db_xref="CDD:238082"
     misc_feature    order(1797..1799,1962..1964,1983..1985,2340..2342)
                     /gene="dnaN"
                     /locus_tag="SSA_0002"
                     /note="putative DNA binding surface [nucleotide binding];
                     other site"
                     /db_xref="CDD:238082"
     misc_feature    order(1965..1967,1974..1976,2052..2054,2058..2060,
                     2562..2564,2658..2663)
                     /gene="dnaN"
                     /locus_tag="SSA_0002"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238082"
     misc_feature    order(2262..2264,2268..2279,2712..2714,2841..2852)
                     /gene="dnaN"
                     /locus_tag="SSA_0002"
                     /note="beta-clamp/clamp loader binding surface; other
                     site"
                     /db_xref="CDD:238082"
     misc_feature    order(2262..2264,2268..2273,2487..2489,2595..2597,
                     2634..2639,2721..2723,2841..2852)
                     /gene="dnaN"
                     /locus_tag="SSA_0002"
                     /note="beta-clamp/translesion DNA polymerase binding
                     surface; other site"
                     /db_xref="CDD:238082"
     gene            2989..3183
                     /locus_tag="SSA_2390"
                     /db_xref="GeneID:4806949"
     CDS             2989..3183
                     /locus_tag="SSA_2390"
                     /note="GC: 38.46%; Codon Adaptation Index (CAI): 0.78.
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034023.1"
                     /db_xref="GeneID:4806949"
                     /translation="MYEIGHFVEMKKPHACTIKATGKKANRWEITRVGADIKIRCTNC
                     EHLVMMSRHDFERKMKKIID"
     misc_feature    2989..3180
                     /locus_tag="SSA_2390"
                     /note="Bacterial protein of unknown function (DUF951);
                     Region: DUF951; cl01864"
                     /db_xref="CDD:321703"
     gene            complement(3303..3794)
                     /locus_tag="SSA_0004"
                     /db_xref="GeneID:4806741"
     CDS             complement(3303..3794)
                     /locus_tag="SSA_0004"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 33.13%; Transmembrane domains: 1. Codon
                     Adaptation Index (CAI): 0.811. LipoP prediction: SpII.
                     SignalP prediction: Yes (prob. 1); Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="YP_001034024.1"
                     /db_xref="GeneID:4806741"
                     /translation="MKKNTFKTLFLSFLAVSALFVLAACSSPKKAYFQLIDQNTKQDS
                     RITVEYKGDELLINETNNTFYYKPVGLTKDTAKEQTEAYAKSIEGIKGLTHKIEYKDD
                     YLTEKLTIDFSKADIEELQSKQLLQTSGNQKADYISYKETAKLLEKAGYKEIKDGKFE
                     NLK"
     misc_feature    complement(<3648..3776)
                     /locus_tag="SSA_0004"
                     /note="Predicted small periplasmic lipoprotein YifL
                     (function unknown0 [Function unknown]; Region: YifL;
                     COG5567"
                     /db_xref="CDD:227854"
     misc_feature    complement(3339..3680)
                     /locus_tag="SSA_0004"
                     /note="Protein of unknown function (DUF1307); Region:
                     DUF1307; pfam06998"
                     /db_xref="CDD:284428"
     gene            3961..5076
                     /gene="ychF"
                     /locus_tag="SSA_0005"
                     /db_xref="GeneID:4806806"
     CDS             3961..5076
                     /gene="ychF"
                     /locus_tag="SSA_0005"
                     /function="Translation, ribosomal structure and
                     biogenesis"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /GO_function="GO:0005554 - molecular function unknown"
                     /note="translation-associated GTPase; the crystal
                     structure of the Haemophilus influenzae YchF protein
                     showed similarity to the yeast structure (PDB: 1NI3);
                     fluorescence spectroscopy revealed nucleic acid binding;
                     the yeast protein YBR025c interacts with the translation
                     elongation factor eEF1"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-dependent nucleic acid-binding protein EngD"
                     /protein_id="YP_001034025.1"
                     /db_xref="GeneID:4806806"
                     /translation="MALTAGIVGLPNVGKSTLFNAITKAGAEAANYPFATIDPNVGRV
                     EVPDARLDKLTELIKPQKKVPTTFEFTDIAGIVKGASKGEGLGNKFLANIREVDAIVH
                     VVRAFDDENVMREQGRESEFVDPMADIETINLELILADLESINKRYARVEKMARTQKD
                     KDSVAEFNVLQKIKPVLEDGLSARTIEFTEEEQKIVKGLFLLTTKPVLYVANVSEDEV
                     ADPDNIDYVKQIREFAATENAEVVVISARAEEEISELDDEDKSEFLEAIGLTESGVDK
                     LTRAAYHLLGLGTYFTAGEKEVRAWTFKRGMKAPQAAGIIHSDFEKGFIRAVTMSYND
                     LVHYGSEKAVKEAGRLREEGKEYIVQDGDIMEFRFNV"
     misc_feature    3961..5073
                     /gene="ychF"
                     /locus_tag="SSA_0005"
                     /note="GTP-binding protein YchF; Reviewed; Region:
                     PRK09601"
                     /db_xref="CDD:236583"
     misc_feature    3973..4815
                     /gene="ychF"
                     /locus_tag="SSA_0005"
                     /note="YchF GTPase; Region: YchF; cd01900"
                     /db_xref="CDD:206687"
     misc_feature    3985..4008
                     /gene="ychF"
                     /locus_tag="SSA_0005"
                     /note="G1 box; other site"
                     /db_xref="CDD:206687"
     misc_feature    order(3994..3996,4000..4011,4594..4599,4603..4605,
                     4693..4701)
                     /gene="ychF"
                     /locus_tag="SSA_0005"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206687"
     misc_feature    4054..4077
                     /gene="ychF"
                     /locus_tag="SSA_0005"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206687"
     misc_feature    4066..4068
                     /gene="ychF"
                     /locus_tag="SSA_0005"
                     /note="G2 box; other site"
                     /db_xref="CDD:206687"
     misc_feature    order(4171..4200,4219..4248)
                     /gene="ychF"
                     /locus_tag="SSA_0005"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206687"
     misc_feature    4174..4185
                     /gene="ychF"
                     /locus_tag="SSA_0005"
                     /note="G3 box; other site"
                     /db_xref="CDD:206687"
     misc_feature    4594..4605
                     /gene="ychF"
                     /locus_tag="SSA_0005"
                     /note="G4 box; other site"
                     /db_xref="CDD:206687"
     misc_feature    4693..4701
                     /gene="ychF"
                     /locus_tag="SSA_0005"
                     /note="G5 box; other site"
                     /db_xref="CDD:206687"
     misc_feature    4819..5070
                     /gene="ychF"
                     /locus_tag="SSA_0005"
                     /note="Protein of unknown function (DUF933); Region:
                     YchF-GTPase_C; pfam06071"
                     /db_xref="CDD:283681"
     gene            5149..5718
                     /gene="pth"
                     /locus_tag="SSA_0006"
                     /db_xref="GeneID:4806199"
     CDS             5149..5718
                     /gene="pth"
                     /locus_tag="SSA_0006"
                     /EC_number="3.1.1.29"
                     /note="Enables the recycling of peptidyl-tRNAs produced at
                     termination of translation"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-tRNA hydrolase"
                     /protein_id="YP_001034026.1"
                     /db_xref="GeneID:4806199"
                     /translation="MVKLIVGLGNPGEKYIETKHNVGFMLVDKICKDLDLKFTADKIF
                     QADIASTFLNGEKVYFVKPTTFMNESGKAVQALLAYYGLDIEDLLVIYDDLDMEVGKI
                     RLRSKGSAGGHNGIKSIIKHIGSQEFKRIKIGIGRPKEGVTVVHHVLGKFDKDDYTTI
                     LNTLDKVDNAVNYYLQSGNFEQTMQKYNG"
     misc_feature    5149..5715
                     /gene="pth"
                     /locus_tag="SSA_0006"
                     /note="Peptidyl-tRNA hydrolase [Translation, ribosomal
                     structure and biogenesis]; Region: Pth; COG0193"
                     /db_xref="CDD:223271"
     misc_feature    order(5176..5178,5206..5208,5344..5349,5425..5427,
                     5485..5487)
                     /gene="pth"
                     /locus_tag="SSA_0006"
                     /note="putative active site [active]"
                     /db_xref="CDD:238259"
     misc_feature    5206..5208
                     /gene="pth"
                     /locus_tag="SSA_0006"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238259"
     gene            5711..9214
                     /gene="trcF"
                     /locus_tag="SSA_0008"
                     /db_xref="GeneID:4806337"
     CDS             5711..9214
                     /gene="trcF"
                     /locus_tag="SSA_0008"
                     /function="DNA replication, recombination, and repair /
                     Transcription"
                     /note="GC: 36.87%; Codon Adaptation Index (CAI): 0.788.
                     Helix-turn-helix prediction: AraC. Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription-repair coupling factor"
                     /protein_id="YP_001034027.1"
                     /db_xref="GeneID:4806337"
                     /translation="MDNKMNLIDLFCQNQQISDWKKNLHKSSRQLIMGLSASTKAITI
                     AAGLEEADKILVLTSSQNEADRLASDLISLLGEDKVYTFLADDTPIAEFVFASQEKIF
                     SRLDALNFLIDHQKSGILVTNVAASKLLLPDPIDFKTTNINLIVGQEYDLNNLVKMLS
                     RTGYKKVSQVLSQGEYSLRGDILDIFERSAEFPYRLEFFGDEIDGIRIFNPENQTSIE
                     NIESILIKPASDILLSEKDYARGRENLEAILEKAVDPALKSYLEELLISAKEEFHHAD
                     IRKFLSYFYQKEWTILDYLPVHSPVFFDDFQKIVDRHAQFELETAGLLTDDLQNCKAL
                     SSQKYFADKYQDYRQYKPATFFSSFQKGLGNLKFDALYQFNQYPMQEFFSQFPLLKEE
                     INRYKKSGYTIILQANSSAGLQSLHKNLQEYDIHLDYIKEAEIHKNAVQLIEGNLVQG
                     FNFVDEKIVLITEYEIIHKKIKRKIRRQNISNAERLKDYNELEKGDYVVHNIHGIGRY
                     LGIETIEISGVHRDYLTIQYQNSDRISIPVDQIDLLSKYVASDGKTPKVNKLNDGRFQ
                     KSKQKVQHQVQDIADDLIKLYAERSQLKGFAFSADDSNQEEFDNDFPYVETEDQLRSI
                     QEVKKDMESSRPMDRLLVGDVGFGKTEVAMRAAFKAVNDHKQVAVLVPTTVLAQQHYT
                     NFKERFNDFAVNVEVLSRFRSKAEQKQTLEKLQKGQVDIIIGTHRLLSKDVEFADLGL
                     IIIDEEQRFGVKHKETLKELKKKVDVLTLTATPIPRTLHMSMLGIRDLSVIETPPTNR
                     YPVQTYVLESNPTVIREAVLREIDRGGQVYYLYNKVDTIEQKVSELRELIPEASIGYV
                     HGQMSEIRLENTLLDFINGEYDILVTTTIIETGVDIPNANTLFVENADHMGLSTLYQL
                     RGRVGRSNRIAYAYLMYRPDKILTEVSEKRLEAIKGFTELGSGFKIAMRDLSIRGAGN
                     ILGSMQSGFIDSVGFEMYSQLLEEAIAKKQGRENKRQKSNAEINLQIDAYLPSDYISD
                     ERQKIEIYKRIREIDSRVNYENLQDELIDRFGEYPDVVAYLLEIGLAKSYLDQAFVKS
                     VERQQNTVMIHFEKISQQLYLTQDYFEALSMTNLKARIGEKNGLIEVIFDVRNKKDYE
                     ILEGLVNFGEKMLEIKQRKAE"
     misc_feature    5762..9196
                     /gene="trcF"
                     /locus_tag="SSA_0008"
                     /note="Transcription-repair coupling factor (superfamily
                     II helicase) [Replication, recombination and repair,
                     Transcription]; Region: Mfd; COG1197"
                     /db_xref="CDD:224118"
     misc_feature    6140..6364
                     /gene="trcF"
                     /locus_tag="SSA_0008"
                     /note="Bifunctional transglycosylase second domain;
                     Region: UB2H; pfam14814"
                     /db_xref="CDD:291480"
     misc_feature    7181..7474
                     /gene="trcF"
                     /locus_tag="SSA_0008"
                     /note="CarD-like/TRCF domain; Region: CarD_TRCF;
                     smart01058"
                     /db_xref="CDD:215001"
     misc_feature    7559..8050
                     /gene="trcF"
                     /locus_tag="SSA_0008"
                     /note="DEAD/DEAH box helicase; Region: DEAD; pfam00270"
                     /db_xref="CDD:278688"
     misc_feature    7646..7660
                     /gene="trcF"
                     /locus_tag="SSA_0008"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    7940..7951
                     /gene="trcF"
                     /locus_tag="SSA_0008"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    8108..8500
                     /gene="trcF"
                     /locus_tag="SSA_0008"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    order(8204..8215,8279..8284,8357..8365)
                     /gene="trcF"
                     /locus_tag="SSA_0008"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    order(8381..8383,8447..8449,8459..8461,8468..8470)
                     /gene="trcF"
                     /locus_tag="SSA_0008"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     misc_feature    8756..9016
                     /gene="trcF"
                     /locus_tag="SSA_0008"
                     /note="This domain is found in proteins necessary for
                     strand-specific repair in DNA such as TRCF in Escherichia
                     coli; Region: TRCF; smart00982"
                     /db_xref="CDD:198050"
     gene            9305..9571
                     /locus_tag="SSA_0009"
                     /db_xref="GeneID:4806683"
     CDS             9305..9571
                     /locus_tag="SSA_0009"
                     /function="Translation, ribosomal structure and
                     biogenesis"
                     /note="GC: 38.58%; Codon Adaptation Index (CAI): 0.771.
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-associated heat shock protein (S4)"
                     /protein_id="YP_001034028.1"
                     /db_xref="GeneID:4806683"
                     /translation="MRLDKYLKVSRIIKRRPVAKEVADKGRIKVNGILAKSSTDLKVD
                     DLVEVRFGNKLLTVKVLEMKDSTKKEDAAKMYEIVSETRIEEDA"
     misc_feature    9305..9562
                     /locus_tag="SSA_0009"
                     /note="Ribosomal 50S subunit-recycling heat shock protein,
                     contains S4 domain [Translation, ribosomal structure and
                     biogenesis]; Region: HslR; COG1188"
                     /db_xref="CDD:224109"
     misc_feature    order(9308..9310,9344..9349,9353..9358,9362..9367,
                     9374..9379,9383..9385,9404..9409,9410..9424,9428..9430)
                     /locus_tag="SSA_0009"
                     /note="RNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238095"
     gene            9564..9932
                     /gene="divIC"
                     /locus_tag="SSA_0010"
                     /db_xref="GeneID:4806487"
     CDS             9564..9932
                     /gene="divIC"
                     /locus_tag="SSA_0010"
                     /function="Cell division and chromosome partitioning"
                     /note="GC: 38.48%; Transmembrane domains: 1. Codon
                     Adaptation Index (CAI): 0.823. Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein DivIC"
                     /protein_id="YP_001034029.1"
                     /db_xref="GeneID:4806487"
                     /translation="MPKNIVQLNNRFIQDENQRRRYVDQERRKRNRFMGWVLILVILL
                     FILPTYNLYQSYQTLLQRREQYSKLKEKYQTLSEEKVYQSDIATKLKDDSYAAKYARA
                     KYSFSKEGEYIYTIPDLLPQ"
     misc_feature    9591..9929
                     /gene="divIC"
                     /locus_tag="SSA_0010"
                     /note="Septum formation initiator; Region: DivIC; cl11433"
                     /db_xref="CDD:325027"
     gene            9935..10063
                     /locus_tag="SSA_0011"
                     /db_xref="GeneID:4806151"
     CDS             9935..10063
                     /locus_tag="SSA_0011"
                     /note="GC: 32.56%; Codon Adaptation Index (CAI): 0.794.
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034030.1"
                     /db_xref="GeneID:4806151"
                     /translation="MEDLLKTIEQFLAFSDEKLEELSEKNQALKLQENQKERGKHA"
     gene            10056..11339
                     /locus_tag="SSA_0012"
                     /db_xref="GeneID:4806501"
     CDS             10056..11339
                     /locus_tag="SSA_0012"
                     /function="Defense mechanisms"
                     /note="GC: 37.54%; Codon Adaptation Index (CAI): 0.812.
                     LipoP prediction: SpI. SignalP prediction: Yes (prob.
                     0.979); Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="Beta-lactamase class A"
                     /protein_id="YP_001034031.1"
                     /db_xref="GeneID:4806501"
                     /translation="MRKFLLLIFLLPALFSSITVISTEKDFVLDEEEKYHFTSTAYGR
                     YYDSIPTNPNVYEETPTFTDSTLSKTAGKLVPDQPIQITGFYVNEEEVPIFKLKNGQF
                     VIADKNTIYEDTVQSIEDIHQEMWLKPGFTLYDKANINGAKKINATVAPYTKVSIVQI
                     VQTVKGTYAQIEGQGWVSMEFLDETDNRMDKVQEILSSKYNKADYSIYVKQLDTGKEA
                     GINQDQEMYSASVTKLPYLYYVQEQLDQKKLSLDQKFKYIGAVNDFAGAYEPEGSGSI
                     AKSADDKEYSVQDLINRVAKESDNVAHNILGYYATNQSDKNFQQTINKIAGKKWDVEE
                     RQASSRMTGNILEAIYEQNGMIIDALSQTNYDNQRISKNIDAKVAHKIGDAYDFKHDA
                     AIVYTDSPFIIVIFTNNATYDNISQIADDVYGVLK"
     misc_feature    10182..11303
                     /locus_tag="SSA_0012"
                     /note="Beta-lactamase class A [Defense mechanisms];
                     Region: PenP; COG2367"
                     /db_xref="CDD:225242"
     misc_feature    10692..11267
                     /locus_tag="SSA_0012"
                     /note="Beta-lactamase enzyme family; Region:
                     Beta-lactamase2; pfam13354"
                     /db_xref="CDD:290092"
     gene            11336..12613
                     /gene="mesJ"
                     /locus_tag="SSA_0013"
                     /db_xref="GeneID:4806716"
     CDS             11336..12613
                     /gene="mesJ"
                     /locus_tag="SSA_0013"
                     /EC_number="6.3.4.-"
                     /function="Cell division and chromosome partitioning"
                     /GO_function="GO:0016879 - ligase activity, forming
                     carbon-nitrogen bonds"
                     /note="GC: 38.11%; Codon Adaptation Index (CAI): 0.801.
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="PP family ATPase"
                     /protein_id="YP_001034032.1"
                     /db_xref="GeneID:4806716"
                     /translation="MIKQEFLKKMQEKKYFQDHRKVLIAVSGGLDSMTLLQLLIVSQK
                     ELAIELAIAHVNHKQRPESDQEEKALVKIAEQLGVKIFTSSFSGNFSENAARQFRYDF
                     FGKVMQEGHYTALVTAHHADDQAETVFMRLLRGARLRHLSGMKAVQPFACGELIRPLL
                     TFHKSDFPDIQHFEDSSNFQNDYLRNRIRNLYLPDLEKENPQFKDSLRYLGKEIEDWQ
                     TALSHLTRDLDIENVQVFHQQIPQVQRFLLQNYLENFSGLNLSKQQFEEVLNILQTKA
                     NYQHTLKKDYELVKDYQRFEIRKISRKPDLKMDSILLEFENLIEFGYYRFSFGIPLSG
                     ENIQKIFVSRETSLTLRFRKEGDSILLNGHHKKLRRLFIDKKVSFEERNSSVVVEQNH
                     QILAILNIAISDLSKALKSDIMSTVLYIQKIDG"
     misc_feature    11339..12202
                     /gene="mesJ"
                     /locus_tag="SSA_0013"
                     /note="tRNA(Ile)-lysidine synthase TilS/MesJ [Translation,
                     ribosomal structure and biogenesis]; Region: TilS;
                     COG0037"
                     /db_xref="CDD:223115"
     misc_feature    11396..11917
                     /gene="mesJ"
                     /locus_tag="SSA_0013"
                     /note="N-terminal domain of predicted ATPase of the
                     PP-loop faimly implicated in cell cycle control [Cell
                     division and chromosome partitioning]. This is a subfamily
                     of Adenine nucleotide alpha hydrolases
                     superfamily.Adeninosine nucleotide alpha hydrolases...;
                     Region: PP-ATPase; cd01992"
                     /db_xref="CDD:238950"
     misc_feature    order(11408..11416,11420..11431,11495..11497,11501..11503)
                     /gene="mesJ"
                     /locus_tag="SSA_0013"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238950"
     misc_feature    12377..12559
                     /gene="mesJ"
                     /locus_tag="SSA_0013"
                     /note="TilS substrate C-terminal domain; Region: TilS_C;
                     smart00977"
                     /db_xref="CDD:198045"
     gene            12606..13160
                     /gene="hpt"
                     /locus_tag="SSA_0014"
                     /db_xref="GeneID:4805773"
     CDS             12606..13160
                     /gene="hpt"
                     /locus_tag="SSA_0014"
                     /EC_number="2.4.2.8"
                     /function="Nucleotide transport and metabolism"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 32.79%; Codon Adaptation Index (CAI): 0.846.
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypoxanthine guanine phosphoribosyltransferase"
                     /protein_id="YP_001034033.1"
                     /db_xref="GeneID:4805773"
                     /translation="MGKIMLEQDIKKILISHDEIVDAAKKLGQQLTKDYQDKNPIFVG
                     ILKGSVPFMAELIKHIDTHIELDFMLVSSYHGGTASSGVINVIKDIDQDITGRDILFV
                     EDIIDTGQTLKNLCNLFKERNAASVKIATLLDKPEGRVVEIDADYTCFTIPNEFVVGY
                     GLDYNENYRNIPYIGILKEEVYTK"
     misc_feature    12630..13148
                     /gene="hpt"
                     /locus_tag="SSA_0014"
                     /note="Hypoxanthine-guanine phosphoribosyltransferase
                     [Nucleotide transport and metabolism]; Region: HptA;
                     COG0634"
                     /db_xref="CDD:223707"
     misc_feature    order(12741..12743,12747..12749,12912..12920,12924..12938,
                     13008..13010)
                     /gene="hpt"
                     /locus_tag="SSA_0014"
                     /note="active site"
                     /db_xref="CDD:206754"
     gene            13178..15157
                     /gene="ftsH"
                     /locus_tag="SSA_0015"
                     /db_xref="GeneID:4806676"
     CDS             13178..15157
                     /gene="ftsH"
                     /locus_tag="SSA_0015"
                     /EC_number="3.4.24.-"
                     /function="Posttranslational modification, protein
                     turnover, chaperones"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 41.72%; Transmembrane domains: 2. Codon
                     Adaptation Index (CAI): 0.818. LipoP prediction: SpI.
                     SignalP prediction: Yes (prob. 0.458); Curator(s): J.
                     Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane ATPase FtsH"
                     /protein_id="YP_001034034.1"
                     /db_xref="GeneID:4806676"
                     /translation="MKNKQNNGFIKNPFLYILIIVVLVTGFQYFFSGDTGGRSQQINY
                     TELVKEIKENNVTEMSYQPNGSVVEISGTYKTPQESKEDTGILFFTPNISKVEKFTSI
                     ILPSDITISDLQKLASEHNTEISIKRESSSGMWITILTSIVPFVIVIFFFMSMMNQGG
                     GGGARGAMNFGRNKARAANKEDIKVRFSDVAGAEEEKQELVEVVEFLKDRKRYTKLGA
                     RIPAGVLLEGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGASRVRSLFEDA
                     KKAAPAIIFIDEIDAVGRQRGVGLGGGNDEREQTLNQLLIEMDGFEGNEGIIIIAATN
                     RSDVLDPALLRAGRFDRKVLVGRPDVKGREAILRVHAKNKPLAKNVDLKLVAQQTPGF
                     VGADLENVLNEAALVAARRNKKVIDADDIDEAEDRVIAGPSKKDKMVSERDRQMVAYH
                     EAGHTIVGLVLSNARVVHKVTIVPRGRAGGYMIALPKEDQMLLSKEDMKEQLAGLMGG
                     RVAEEIIFNVQTTGASNDFEQATQMARSMVTEYGMSEKLGPVQYEGNHAMFGAASPQK
                     SISEQTAYEIDEEVRELLNEARNKAAEIIQSHRETHKLIAEALLKYETLDSNQIKSLY
                     ETGKMPEESELELDKEAHALSYDEIKTKMEEKSSE"
     misc_feature    13214..13552
                     /gene="ftsH"
                     /locus_tag="SSA_0015"
                     /note="FtsH Extracellular; Region: FtsH_ext; pfam06480"
                     /db_xref="CDD:310823"
     misc_feature    13577..15046
                     /gene="ftsH"
                     /locus_tag="SSA_0015"
                     /note="TIP49 C-terminus; Region: TIP49; cl27568"
                     /db_xref="CDD:332389"
     gene            15263..15334
                     /locus_tag="SSA_2412"
                     /db_xref="GeneID:4806577"
     tRNA            15263..15334
                     /locus_tag="SSA_2412"
                     /product="tRNA-Glu"
                     /inference="profile:tRNAscan-SE:1.23"
                     /db_xref="GeneID:4806577"
     gene            15340..15416
                     /locus_tag="SSA_2413"
                     /db_xref="GeneID:4806604"
     tRNA            15340..15416
                     /locus_tag="SSA_2413"
                     /product="tRNA-Asn"
                     /inference="profile:tRNAscan-SE:1.23"
                     /db_xref="GeneID:4806604"
     gene            15627..16112
                     /gene="comX"
                     /locus_tag="SSA_0016"
                     /db_xref="GeneID:4806630"
     CDS             15627..16112
                     /gene="comX"
                     /locus_tag="SSA_0016"
                     /note="GC: 32.72%; Codon Adaptation Index (CAI): 0.803.
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="ComX1, transcriptional regulator of
                     competence-specific genes"
                     /protein_id="YP_001034035.1"
                     /db_xref="GeneID:4806630"
                     /translation="MDFRTTYEKVKWIVWKCKKDYYIHLWEHSDWEQEGMLVLYELLL
                     KEKRIENDEEKLYRYFKTKFRNHIHDKIRKQESQKRKLDRQPYEEVSEIGHRLKSKEL
                     FLDELVAFREAIDNYKRTLDDVGLDNYQRLMSNERFKGRRAMLKDLKNHLKDFQDNTI
                     L"
     misc_feature    15627..>15971
                     /gene="comX"
                     /locus_tag="SSA_0016"
                     /note="RNA polymerase sigma factor, sigma-70 family;
                     Region: sigma70-ECF; TIGR02937"
                     /db_xref="CDD:274357"
     gene            16379..17929
                     /locus_tag="SSA_2400"
                     /db_xref="GeneID:4806210"
     rRNA            16379..17929
                     /locus_tag="SSA_2400"
                     /product="16S small subunit ribosomal RNA"
                     /inference="similar to RNA sequence, other
                     RNA:INSD:AF077835.1"
                     /note="rRNA_16S_1"
                     /db_xref="GeneID:4806210"
     gene            17991..18063
                     /locus_tag="SSA_2414"
                     /db_xref="GeneID:4806722"
     tRNA            17991..18063
                     /locus_tag="SSA_2414"
                     /product="tRNA-Ala"
                     /inference="profile:tRNAscan-SE:1.23"
                     /db_xref="GeneID:4806722"
     gene            18190..21087
                     /locus_tag="SSA_2404"
                     /db_xref="GeneID:4805959"
     rRNA            18190..21087
                     /locus_tag="SSA_2404"
                     /product="23S large subunit ribosomal RNA"
                     /inference="similar to RNA sequence, other
                     RNA:INSD:AB168128.1"
                     /note="rRNA_23S_1"
                     /db_xref="GeneID:4805959"
     gene            21206..21321
                     /locus_tag="SSA_2408"
                     /db_xref="GeneID:4805809"
     rRNA            21206..21321
                     /locus_tag="SSA_2408"
                     /product="5S ribosomal RNA"
                     /inference="similar to RNA sequence, other
                     RNA:INSD:AF302131.1"
                     /note="rRNA_5S_1"
                     /db_xref="GeneID:4805809"
     gene            21325..21397
                     /locus_tag="SSA_2415"
                     /db_xref="GeneID:4806734"
     tRNA            21325..21397
                     /locus_tag="SSA_2415"
                     /product="tRNA-Val"
                     /inference="profile:tRNAscan-SE:1.23"
                     /db_xref="GeneID:4806734"
     gene            21414..21486
                     /locus_tag="SSA_2416"
                     /db_xref="GeneID:4805898"
     tRNA            21414..21486
                     /locus_tag="SSA_2416"
                     /product="tRNA-Asp"
                     /inference="profile:tRNAscan-SE:1.23"
                     /db_xref="GeneID:4805898"
     gene            21519..21591
                     /locus_tag="SSA_2417"
                     /db_xref="GeneID:4806475"
     tRNA            21519..21591
                     /locus_tag="SSA_2417"
                     /product="tRNA-Lys"
                     /inference="profile:tRNAscan-SE:1.23"
                     /db_xref="GeneID:4806475"
     gene            21597..21678
                     /locus_tag="SSA_2418"
                     /db_xref="GeneID:4807686"
     tRNA            21597..21678
                     /locus_tag="SSA_2418"
                     /product="tRNA-Leu"
                     /inference="profile:tRNAscan-SE:1.23"
                     /db_xref="GeneID:4807686"
     gene            21695..21767
                     /locus_tag="SSA_2419"
                     /db_xref="GeneID:4806035"
     tRNA            21695..21767
                     /locus_tag="SSA_2419"
                     /product="tRNA-Thr"
                     /inference="profile:tRNAscan-SE:1.23"
                     /db_xref="GeneID:4806035"
     gene            21782..21853
                     /locus_tag="SSA_2420"
                     /db_xref="GeneID:4807481"
     tRNA            21782..21853
                     /locus_tag="SSA_2420"
                     /product="tRNA-Gly"
                     /inference="profile:tRNAscan-SE:1.23"
                     /db_xref="GeneID:4807481"
     gene            21861..21946
                     /locus_tag="SSA_2421"
                     /db_xref="GeneID:4807534"
     tRNA            21861..21946
                     /locus_tag="SSA_2421"
                     /product="tRNA-Leu"
                     /inference="profile:tRNAscan-SE:1.23"
                     /note="tRNA-Leu_2"
                     /db_xref="GeneID:4807534"
     gene            21978..22051
                     /locus_tag="SSA_2422"
                     /db_xref="GeneID:4807688"
     tRNA            21978..22051
                     /locus_tag="SSA_2422"
                     /product="tRNA-Arg"
                     /inference="profile:tRNAscan-SE:1.23"
                     /db_xref="GeneID:4807688"
     gene            22071..22144
                     /locus_tag="SSA_2423"
                     /db_xref="GeneID:4806612"
     tRNA            22071..22144
                     /locus_tag="SSA_2423"
                     /product="tRNA-Pro"
                     /inference="profile:tRNAscan-SE:1.23"
                     /db_xref="GeneID:4806612"
     gene            22150..22223
                     /locus_tag="SSA_2424"
                     /db_xref="GeneID:4806457"
     tRNA            22150..22223
                     /locus_tag="SSA_2424"
                     /product="tRNA-Met"
                     /inference="profile:tRNAscan-SE:1.23"
                     /db_xref="GeneID:4806457"
     gene            22237..22310
                     /locus_tag="SSA_2425"
                     /db_xref="GeneID:4806781"
     tRNA            22237..22310
                     /locus_tag="SSA_2425"
                     /product="tRNA-Met"
                     /inference="profile:tRNAscan-SE:1.23"
                     /note="tRNA-Met_2"
                     /db_xref="GeneID:4806781"
     gene            22323..22412
                     /locus_tag="SSA_2426"
                     /db_xref="GeneID:4806405"
     tRNA            22323..22412
                     /locus_tag="SSA_2426"
                     /product="tRNA-Ser"
                     /inference="profile:tRNAscan-SE:1.23"
                     /db_xref="GeneID:4806405"
     gene            22432..22505
                     /locus_tag="SSA_2427"
                     /db_xref="GeneID:4806259"
     tRNA            22432..22505
                     /locus_tag="SSA_2427"
                     /product="tRNA-Met"
                     /inference="profile:tRNAscan-SE:1.23"
                     /note="tRNA-Met_3"
                     /db_xref="GeneID:4806259"
     gene            22511..22583
                     /locus_tag="SSA_2428"
                     /db_xref="GeneID:4806742"
     tRNA            22511..22583
                     /locus_tag="SSA_2428"
                     /product="tRNA-Phe"
                     /inference="profile:tRNAscan-SE:1.23"
                     /db_xref="GeneID:4806742"
     gene            22604..22674
                     /locus_tag="SSA_2429"
                     /db_xref="GeneID:4806394"
     tRNA            22604..22674
                     /locus_tag="SSA_2429"
                     /product="tRNA-Gly"
                     /inference="profile:tRNAscan-SE:1.23"
                     /note="tRNA-Gly_2"
                     /db_xref="GeneID:4806394"
     gene            22708..22781
                     /locus_tag="SSA_2430"
                     /db_xref="GeneID:4806765"
     tRNA            22708..22781
                     /locus_tag="SSA_2430"
                     /product="tRNA-Ile"
                     /inference="profile:tRNAscan-SE:1.23"
                     /db_xref="GeneID:4806765"
     gene            22791..22878
                     /locus_tag="SSA_2431"
                     /db_xref="GeneID:4805790"
     tRNA            22791..22878
                     /locus_tag="SSA_2431"
                     /product="tRNA-Ser"
                     /inference="profile:tRNAscan-SE:1.23"
                     /note="tRNA-Ser_2"
                     /db_xref="GeneID:4805790"
     gene            22951..23766
                     /gene="mreC"
                     /locus_tag="SSA_0017"
                     /db_xref="GeneID:4805879"
     CDS             22951..23766
                     /gene="mreC"
                     /locus_tag="SSA_0017"
                     /function="Cell envelope biogenesis, outer membrane"
                     /note="in some organisms this protein is a transmembrane
                     protein while in others it is periplasmic; involved in
                     some organisms with other components of the MreBCD complex
                     and with penicillin binding proteins in the periplasm or
                     cell wall"
                     /codon_start=1
                     /transl_table=11
                     /product="rod shape-determining protein MreC"
                     /protein_id="YP_001034036.1"
                     /db_xref="GeneID:4805879"
                     /translation="MNRFKKSKFLISFFVLVVAMTILILSTSSSWFVSTTSNIISLVD
                     RLVGSPFAFVADKKESMSDLMSTYRENQQLKKNLYKIEEKAGKADSLEDENEQLRKLL
                     EFKEADKNQIQIASEVIARTPASWKNELTIDKGTSDNVTDAMLVVANGGLVGSVSETS
                     SQSSLVSLLTNEENSTKISVRIQTKSGPVYGIITGYDEKNSAYIISQLNSAEDIKEGD
                     EVATSGLGAYNAENIPVGKVLSVSEAKDQLNKIVLVKPAADLSDIRAVMLVGN"
     misc_feature    22951..23757
                     /gene="mreC"
                     /locus_tag="SSA_0017"
                     /note="rod shape-determining protein MreC; Provisional;
                     Region: PRK13922"
                     /db_xref="CDD:237560"
     gene            23768..24268
                     /gene="mreD"
                     /locus_tag="SSA_0018"
                     /db_xref="GeneID:4807655"
     CDS             23768..24268
                     /gene="mreD"
                     /locus_tag="SSA_0018"
                     /function="Cell envelope biogenesis, outer membrane"
                     /note="GC: 30.74%; Transmembrane domains: 5. Codon
                     Adaptation Index (CAI): 0.765. Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="cell-shape determining protein MreD"
                     /protein_id="YP_001034037.1"
                     /db_xref="GeneID:4807655"
                     /translation="MRDIKEHLLTPIILFFVLLIDGQISTFLANILPLQWHLVSHFIF
                     IFMLFVSINLSRNYNILLFCCLGLIYDVYYFHTIGIALILFPLLSLLVCQSSSTMLLN
                     KFTRFLSVLILVFLFELTSFAFAVFLNLSSLNLQDFVLSILVPTILLNGLIFLIFQPI
                     FEKMYL"
     misc_feature    23789..24262
                     /gene="mreD"
                     /locus_tag="SSA_0018"
                     /note="rod shape-determining protein MreD; Region: MreD;
                     cl01087"
                     /db_xref="CDD:294686"
     gene            24365..25579
                     /gene="pcsB"
                     /locus_tag="SSA_0019"
                     /db_xref="GeneID:4806506"
     CDS             24365..25579
                     /gene="pcsB"
                     /locus_tag="SSA_0019"
                     /function="Function unknown"
                     /note="GC: 42.63%; Codon Adaptation Index (CAI): 0.794.
                     LipoP prediction: SpI. SignalP prediction: Yes (prob. 1);
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="secreted antigen GbpB/SagA; peptidoglycan
                     hydrolase; PcsB protein"
                     /protein_id="YP_001034038.1"
                     /db_xref="GeneID:4806506"
                     /translation="MKKKLLTSILLSTVILSQGAALVSVKAETTDEKIAAQDSKINSL
                     TEQQQSAQAQVNEIQGQVSAIQKQQEELKAENEKLSAESARLSAEIDELSKNIVARNE
                     SLANQARSTQTNGTATSYINTVVNSSSITEAISRVAAMSEIVSANNKMLEQQKKDKEV
                     IAEKQVANNEAINTVIANQEKLADDEQALATKQAELKAAQASLAAEKATAENEKNSLL
                     EEKAAAEKAAAEAAAREAAYKAEQESKRQAIEASGNTTLQAQVQAVVNSAPAAEAAAP
                     AAPAVTQSVARANRPVYSSSASSYPVGQCTWGAKTLAPWAGDYWGNGGQWSASAAAAG
                     FRVGSQPEVGAIACWTDGGYGHVAVVTAVQSTTSIQVSEANYLGQQSIGNYRGWFNPT
                     TAQGTVSYIYPN"
     misc_feature    24365..25018
                     /gene="pcsB"
                     /locus_tag="SSA_0019"
                     /note="Uncharacterized N-terminal domain of peptidoglycan
                     hydrolase CwlO [Function unknown]; Region: CwlO1; COG3883"
                     /db_xref="CDD:226400"
     misc_feature    <25235..25573
                     /gene="pcsB"
                     /locus_tag="SSA_0019"
                     /note="Surface antigen [Cell wall/membrane/envelope
                     biogenesis]; Region: COG3942"
                     /db_xref="CDD:226451"
     gene            25704..26669
                     /gene="prsA"
                     /locus_tag="SSA_0020"
                     /db_xref="GeneID:4807349"
     CDS             25704..26669
                     /gene="prsA"
                     /locus_tag="SSA_0020"
                     /EC_number="2.7.6.1"
                     /function="Nucleotide transport and metabolism / Amino
                     acid transport and metabolism"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="catalyzes the formation of 5-phospho-alpha-D-ribose
                     1-phosphate from D-ribose 5-phosphate and ATP"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose-phosphate pyrophosphokinase"
                     /protein_id="YP_001034039.1"
                     /db_xref="GeneID:4807349"
                     /translation="MSFSDLKLFALSSNQELAQRVAQEIGLPLGKSTVRQFSDGEIQV
                     NIEESIRGKHVFILQSTSSPVNDNLMEILIMVDALKRASAESINVVMPYYGYARQDRK
                     ARAREPITSKLVANMLEIAGVDRMLTIDLHAAQIQGFFDIPVDHLMGAPLIADYFERR
                     NMTGGDYVVVSPDHGGVSRARKLAEFLKTPIAIIDKRRSVDKMNSSEVMNIIGKVEGK
                     TCILIDDMIDTAGTICHAADALAEAGAVEVYASCTHPVLSGPAMDNIQKSAIKKLVVL
                     DTIYLPQERLIDKIEQISIAHLLGEAIVRIHEKRPLSPLFEIGKK"
     misc_feature    25704..26663
                     /gene="prsA"
                     /locus_tag="SSA_0020"
                     /note="ribose-phosphate pyrophosphokinase; Provisional;
                     Region: PRK02269"
                     /db_xref="CDD:167353"
     gene            26982..27551
                     /locus_tag="SSA_0021"
                     /db_xref="GeneID:4806989"
     CDS             26982..27551
                     /locus_tag="SSA_0021"
                     /note="GC: 44.21%; Codon Adaptation Index (CAI): 0.781.
                     LipoP prediction: SpI. SignalP prediction: Yes (prob. 1);
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034040.1"
                     /db_xref="GeneID:4806989"
                     /translation="MKKVLLSSAVALSLFAAAAPVFAEGTASLWVNDIDNNEVPQGST
                     DSESNKVMDELQAYRDAQSALDQQVAEAKKAPVGKSAVMEDQAGNKVLVIGEGESANA
                     DQPSVAPSTTDPSTPAYSAAPYSTASSSVPTFPAPSQSSAASSSAVGKKKAKKSENKA
                     KKAPEAKEENKENEENSEEKSLPKTSAVK"
     gene            27646..28488
                     /gene="srtB"
                     /locus_tag="SSA_0022"
                     /db_xref="GeneID:4807000"
     CDS             27646..28488
                     /gene="srtB"
                     /locus_tag="SSA_0022"
                     /function="Function unknown"
                     /note="GC: 42.94%; Transmembrane domains: 1. Codon
                     Adaptation Index (CAI): 0.795. SignalP prediction: Yes
                     (prob. 0.991); Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="surface protein cell wall anchor"
                     /protein_id="YP_001034041.1"
                     /db_xref="GeneID:4807000"
                     /translation="MQEKDRSQASNKKQLFVVGICLLLIVLVIFSVFYAFRSSASGSK
                     LRVSHPSRIETSSSSASSSQTEKDYLAERFAKLKSVNSETIGYVYAPGTQLDEPVVQT
                     KDNETYLLKTFEGKQEPYMGAVFMDKDNHKDFSDRLTWLFGHARGSKAGDHRMFNDVN
                     YYDRQDYFDKHRYVVIETPERKYYYQAMGLVIVPEETAFYRTEFKDDEDFTTQLRNIY
                     EAARTKDPEMKIKASDRYLVLSTCREEDDTIRSNLYLRQIPDSELEDFLDKHGKELTY
                     TPTR"
     misc_feature    <27835..28404
                     /gene="srtB"
                     /locus_tag="SSA_0022"
                     /note="Sortases are cysteine transpeptidases, found in
                     gram-positive bacteria, that anchor surface proteins to
                     peptidoglycans of the bacterial cell wall envelope. They
                     do so by catalyzing a transpeptidation reaction in which
                     the surface protein substrate is...; Region: Sortase;
                     cl09098"
                     /db_xref="CDD:298830"
     misc_feature    order(27958..27960,28027..28029,28063..28065,28069..28071,
                     28075..28077,28366..28371,28384..28386,28393..28395)
                     /gene="srtB"
                     /locus_tag="SSA_0022"
                     /note="active site"
                     /db_xref="CDD:99709"
     misc_feature    order(28075..28077,28369..28371,28393..28395)
                     /gene="srtB"
                     /locus_tag="SSA_0022"
                     /note="catalytic site [active]"
                     /db_xref="CDD:99709"
     gene            28669..29841
                     /gene="aspC"
                     /locus_tag="SSA_0023"
                     /db_xref="GeneID:4806991"
     CDS             28669..29841
                     /gene="aspC"
                     /locus_tag="SSA_0023"
                     /EC_number="2.6.1.-"
                     /function="Amino acid transport and metabolism"
                     /note="catalyzes the transamination of the aromatic amino
                     acid forming a ketoacid; first step in aromatic amino acid
                     degradation in lactococci"
                     /codon_start=1
                     /transl_table=11
                     /product="aromatic amino acid aminotransferase"
                     /protein_id="YP_001034042.1"
                     /db_xref="GeneID:4806991"
                     /translation="MDLSKKFNKNLGKIEISLIRQFDQSISAIPGVLRLTLGEPDFTT
                     PDHIKEAAKAAIDANQSHYTGMSGLLELRQAASSFVKEKYNLNYRPEDEVLVTIGATE
                     ALSATLTAILEEGDKVLLPAPAYPGYEPIVNLVGAEIVEIDTTANNFVLTPEMLEAAI
                     LEQGEQLKAVILNYPANPTGVTYSREQIKALADVLGKYQVFVVCDEVYSELTYTEQGH
                     VSIAEYLPDQTIVINGLSKSHAMTGWRLGFIFAPAVFTAQLIKSHQYLVTAANTMAQF
                     AGIEALTVGKDDAEPMKAEYIQRRDYIIEKMAELDFKIIKPDGAFYIFAKIPDGYNQD
                     SFAFLQDFAEKKAVAFIPGAAFGQYGEGYIRLSYAASMETIREALKRLKDYMEDYA"
     misc_feature    28669..29838
                     /gene="aspC"
                     /locus_tag="SSA_0023"
                     /note="aromatic amino acid aminotransferase; Validated;
                     Region: PRK07309"
                     /db_xref="CDD:235985"
     misc_feature    28765..29820
                     /gene="aspC"
                     /locus_tag="SSA_0023"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    order(28963..28971,29041..29043,29197..29199,29290..29292,
                     29368..29370,29374..29379,29401..29403)
                     /gene="aspC"
                     /locus_tag="SSA_0023"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    order(28972..28974,29071..29073,29269..29271,29395..29403,
                     29488..29490,29497..29499)
                     /gene="aspC"
                     /locus_tag="SSA_0023"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    29377..29379
                     /gene="aspC"
                     /locus_tag="SSA_0023"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            29834..30607
                     /gene="recO"
                     /locus_tag="SSA_0025"
                     /db_xref="GeneID:4807070"
     CDS             29834..30607
                     /gene="recO"
                     /locus_tag="SSA_0025"
                     /function="DNA replication, recombination, and repair"
                     /note="involved in DNA repair and RecFOR pathway
                     recombination; RecFOR proteins displace ssDNA-binding
                     protein and facilitate the production of RecA-coated
                     ssDNA"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RecO"
                     /protein_id="YP_001034043.1"
                     /db_xref="GeneID:4807070"
                     /translation="MLKSLTSQGLVLYNRNFREDDKLVKIFTEQAGKRMFFVKHAGKS
                     KLAPVIQPLTAANLLMKINDDGLSYIEDYQDVVTYHRINEDLFIMAYASYVAALADAS
                     LQDNQPDPALFAFLQKTLELMNNGLDYEVLTNIFEIQILSRFGVSLNFHDCAFCHRTG
                     LPFDFSFKYSGVLCPDHYHQDERRCHLNPNLPFLLDQFQAVRFSELETISLKPDIKKQ
                     LRDFIDLLYDEYVGIHLKSKKFIDSLGDWGSILKDKNEE"
     misc_feature    29849..30061
                     /gene="recO"
                     /locus_tag="SSA_0025"
                     /note="Recombination protein O N terminal; Region: RecO_N;
                     pfam11967"
                     /db_xref="CDD:288794"
     misc_feature    29858..30565
                     /gene="recO"
                     /locus_tag="SSA_0025"
                     /note="DNA repair protein RecO; Region: reco; TIGR00613"
                     /db_xref="CDD:273175"
     misc_feature    30083..30550
                     /gene="recO"
                     /locus_tag="SSA_0025"
                     /note="Recombination protein O C terminal; Region: RecO_C;
                     pfam02565"
                     /db_xref="CDD:280688"
     gene            30613..31611
                     /gene="plsX"
                     /locus_tag="SSA_0026"
                     /db_xref="GeneID:4806933"
     CDS             30613..31611
                     /gene="plsX"
                     /locus_tag="SSA_0026"
                     /function="Lipid metabolism"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="involved in acylation of glycerol-3-phosphate to
                     form 1-acyl-glycerol-3 phosphate for use in phospholipid
                     biosynthesis; functions with PlsY"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate acyltransferase PlsX"
                     /protein_id="YP_001034044.1"
                     /db_xref="GeneID:4806933"
                     /translation="MKKIAVDAMGGDNAPQALVEGVNRAVQEFSDIEILLYGDEAKIK
                     PYLTAGERVRIIHTEEKIDSDDEPTKAIRQKKEASMVLAAKAVKAGEADAMLSAGNTG
                     ALLAAGFFIVGRIKNIDRPGLLSTMPTVGGQGFDMLDLGANAENTAHHLHQYATLGSF
                     YAENVRGIKKPRVGLLNNGTESSKGDPLRKEAYELLSGDSTLNFIGNVEARDLMDDVA
                     DVVVADGFTGNAVLKSIEGTAISIMGQLKKSILGGGFKAKLGAWLLKDSLRGLKNSLD
                     YSSAGGAVLFGLKAPVVKTHGSSDAKAVYSTIRQIRTMLETDVVGKSVIEFSDAKE"
     misc_feature    30613..31578
                     /gene="plsX"
                     /locus_tag="SSA_0026"
                     /note="putative phosphate acyltransferase; Provisional;
                     Region: PRK05331"
                     /db_xref="CDD:235414"
     gene            31614..31862
                     /gene="acp"
                     /locus_tag="SSA_0027"
                     /db_xref="GeneID:4807055"
     CDS             31614..31862
                     /gene="acp"
                     /locus_tag="SSA_0027"
                     /function="Lipid metabolism / Secondary metabolites
                     biosynthesis, transport, and catabolism"
                     /note="GC: 35.34%; Codon Adaptation Index (CAI): 0.87.
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl carrier protein"
                     /protein_id="YP_001034045.1"
                     /db_xref="GeneID:4807055"
                     /translation="MSEKEIYAKIVEIIQEHDSSKLHITPELNLKEELGVDSVDLMEF
                     IINLEEAFDIEIPDEDMDNFKTISDVVAYIHEKLKKQH"
     misc_feature    31614..31850
                     /gene="acp"
                     /locus_tag="SSA_0027"
                     /note="Phosphopantetheine attachment site; Region:
                     PP-binding; cl09936"
                     /db_xref="CDD:299128"
     gene            32023..32730
                     /gene="purC"
                     /locus_tag="SSA_0028"
                     /db_xref="GeneID:4807177"
     CDS             32023..32730
                     /gene="purC"
                     /locus_tag="SSA_0028"
                     /EC_number="6.3.2.6"
                     /note="catalyzes the formation of
                     (S)-2-(5-amino-1-(5-phospho-D-ribosyl)imidazole-4-
                     carboxamido)succinate from
                     5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxylate and
                     L-aspartate in purine biosynthesis; SAICAR synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylaminoimidazole-succinocarboxamide
                     synthase"
                     /protein_id="YP_001034046.1"
                     /db_xref="GeneID:4807177"
                     /translation="MSNKLLYSGKAKDIFSTDDEQVILARYKDQATAFNGVKKEQIAG
                     KGVLNNQISSFIFEKLNAAGVATHFIGKVSDTDQLNKKVEIIPLEVVLRNYTAGSFSK
                     RFGVEEGIALETPIVEFYYKNDDLDDPFINDEHVKFLKIASDQEIAFLKEETRRINKL
                     LSDWFRQIGLKLIDFKLEFGFDKDGKIILADEFSPDNCRLWDAEGHHMDKDVFRRGLG
                     ELTDVYQVVWEKLQAIK"
     misc_feature    32023..32727
                     /gene="purC"
                     /locus_tag="SSA_0028"
                     /note="phosphoribosylaminoimidazole-succinocarboxamide
                     synthase; Reviewed; Region: PRK09362"
                     /db_xref="CDD:181800"
     misc_feature    order(32038..32043,32047..32052,32056..32058,32062..32067,
                     32089..32091,32095..32097,32224..32226,32263..32265,
                     32269..32271,32275..32277,32386..32388,32554..32556,
                     32590..32595)
                     /gene="purC"
                     /locus_tag="SSA_0028"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:133470"
     misc_feature    order(32041..32043,32047..32058,32062..32064,32089..32091,
                     32125..32127,32227..32229,32260..32271,32275..32277,
                     32287..32289,32293..32295,32299..32301,32311..32319,
                     32380..32382,32386..32388,32404..32406,32542..32550,
                     32554..32556,32593..32595,32608..32619)
                     /gene="purC"
                     /locus_tag="SSA_0028"
                     /note="active site"
                     /db_xref="CDD:133470"
     misc_feature    order(32125..32127,32287..32289,32293..32295,32299..32301,
                     32311..32319,32380..32382,32404..32406,32542..32550,
                     32608..32619)
                     /gene="purC"
                     /locus_tag="SSA_0028"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:133470"
     gene            32750..36484
                     /gene="purL"
                     /locus_tag="SSA_0030"
                     /db_xref="GeneID:4807132"
     CDS             32750..36484
                     /gene="purL"
                     /locus_tag="SSA_0030"
                     /EC_number="6.3.5.3"
                     /function="Nucleotide transport and metabolism"
                     /note="GC: 48.7%; Codon Adaptation Index (CAI): 0.782.
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylformylglycinamidine synthase"
                     /protein_id="YP_001034047.1"
                     /db_xref="GeneID:4807132"
                     /translation="MDKRIFVEKKSNFGVKSQSLVRELTHNLQLKTLSDLRMIQVYDV
                     FHLAEDLVARAEKHIFSEQVTDRLLTEEEVEDALAETTFFAIEALPGQFDQRAASSQE
                     ALFLLGAGTDVLVRTAQLYLVNKDISDSELEAIKKYLLNPVDSRFKDIEQPIQLEQFS
                     ESDKTIPVLDFFKDYTEADFKAYKQEHGLAMEVADLLFIQDYFKSIGRFPTETELKVL
                     DTYWSDHCRHTTFETELKKIDFSASKFEKQLQATYDKYLAMRDELGRGDKPQTLMDMA
                     TIFGRYERANGRLDDMEVSDEINACSVEIEVDVDGIKEPWLLMFKNETHNHPTEIEPF
                     GGAATCIGGAIRDPLSGRSYVYQAMRISGAGDITEPIAETRAGKLPQQVISKTAAHGY
                     SSYGNQIGLATTYVREYFHPGFVAKRMELGAVVGAAPKENVVREKPAAGDVVILLGGK
                     TGRDGVGGATGSSKVQTAASVETAGAEVQKGNAIEERKIQRLFRDGNVTRLIKKSNDF
                     GAGGVCVAIGELADGLEIDLDKVPLKYQGLNGTEIAISESQERMAVVVRPEDVEQFIA
                     AAAKENLLAVVVAKVTEKPNLVMHWNGETIVDIERSFLDTNGVRVVVDAKVVDAQEVL
                     PGQAVTSEASLEQDLKSLLSDLNHTSQKGLQTIFDSSVGRSTVNHPIGGRYQITPTEA
                     SVQKLPVEHGKTETVSVMAQGYNPYVAAWSPYHGAAYAVIEATARLVAAGSDWSKARF
                     SYQEYFERMDKQAERFGQPVSALLGSIEAQIQLGLPSIGGKDSMSGTFEELTVPPTLV
                     AFGVTTSTAGRILSPEFKAAGESIYYLPGQVLSQDIDFDLIKNNFENFAAIQDKYEIT
                     AAAAVKYGGLAESLALMSFGNRIGAQVDVADLPSVLQAQLGGFVFTSPKQDIPDAVKI
                     GQTKPDFTLIVNGVQLEGAELLASFEGRLEPIYPTEFKQETVIEEVPALVADTVIKAK
                     ETVAEPLVYIPVFPGTNSEYDSAKAFEAAGAKVNLVPFVTLDEAAIVKSVDSMVDNID
                     KANIIFFAGGFSAADEPDGSAKFIVNILLNEKVKKAIDAFIARGGLIIGICNGFQALV
                     KSGLLPYGNFEEAGANSPTLFYNDANQHVAKMVETRIANTNSPWLAGVQVGDIHAIPV
                     SHGEGKFVVTAEEFAELRDNGQIWSQYVDFDGQPSMDSKYNPNGSLYAIEGIMSKNGQ
                     IIGKMGHSERYEDGLFQNIPGQKDQKLFESAVRYFQASHE"
     misc_feature    32756..36466
                     /gene="purL"
                     /locus_tag="SSA_0030"
                     /note="phosphoribosylformylglycinamidine synthase, clade
                     II; Region: FGAM-synthase; TIGR01857"
                     /db_xref="CDD:130916"
     misc_feature    33389..34546
                     /gene="purL"
                     /locus_tag="SSA_0030"
                     /note="PurL subunit of the formylglycinamide
                     ribonucleotide amidotransferase (FGAR-AT), first repeat.
                     FGAR-AT catalyzes the ATP-dependent conversion of
                     formylglycinamide ribonucleotide (FGAR) and glutamine to
                     formylglycinamidine ribonucleotide (FGAM), ADP; Region:
                     PurL_repeat1; cd02203"
                     /db_xref="CDD:100034"
     misc_feature    order(33698..33709,33713..33715,33788..33790,33818..33820,
                     33827..33829,33836..33838,33968..33970,34001..34006,
                     34016..34018)
                     /gene="purL"
                     /locus_tag="SSA_0030"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100034"
     misc_feature    order(33776..33778,33788..33790,33962..33970)
                     /gene="purL"
                     /locus_tag="SSA_0030"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:100034"
     misc_feature    34790..35521
                     /gene="purL"
                     /locus_tag="SSA_0030"
                     /note="PurL subunit of the formylglycinamide
                     ribonucleotide amidotransferase (FGAR-AT), second repeat.
                     FGAR-AT catalyzes the ATP-dependent conversion of
                     formylglycinamide ribonucleotide (FGAR) and glutamine to
                     formylglycinamidine ribonucleotide (FGAM), ADP; Region:
                     PurL_repeat2; cd02204"
                     /db_xref="CDD:100035"
     misc_feature    order(34838..34849,34853..34855,34928..34930,34967..34969,
                     34976..34978,34985..34987,35090..35092,35132..35137,
                     35147..35149)
                     /gene="purL"
                     /locus_tag="SSA_0030"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100035"
     misc_feature    order(34916..34918,34928..34930,35084..35092)
                     /gene="purL"
                     /locus_tag="SSA_0030"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:100035"
     misc_feature    35681..36466
                     /gene="purL"
                     /locus_tag="SSA_0030"
                     /note="CobB/CobQ-like glutamine amidotransferase domain;
                     Region: GATase_5; pfam13507"
                     /db_xref="CDD:290241"
     misc_feature    order(35867..35872,35882..35884,35990..35992,36002..36004,
                     36188..36193,36374..36376,36380..36391)
                     /gene="purL"
                     /locus_tag="SSA_0030"
                     /note="putative active site [active]"
                     /db_xref="CDD:153211"
     misc_feature    order(35990..35992,36380..36382,36386..36388)
                     /gene="purL"
                     /locus_tag="SSA_0030"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:153211"
     gene            36579..38018
                     /gene="purF"
                     /locus_tag="SSA_0031"
                     /db_xref="GeneID:4807266"
     CDS             36579..38018
                     /gene="purF"
                     /locus_tag="SSA_0031"
                     /EC_number="2.4.2.14"
                     /function="Nucleotide transport and metabolism"
                     /note="Catalyzes first step of the de novo purine
                     nucleotide biosynthetic pathway"
                     /codon_start=1
                     /transl_table=11
                     /product="amidophosphoribosyltransferase"
                     /protein_id="YP_001034048.1"
                     /db_xref="GeneID:4807266"
                     /translation="MTYEVKSLNEECGIFGIWGHPQAAQVTYFGLHSLQHRGQEGAGI
                     LSNDHGKLKRHRDLGLVAEVFKNPADLDNLTGEAAIGHVRYATSGGASINNVQPFFFS
                     FYDMQMGLAHNGNLTNAHSLRRELEKKGSIFASSSDTEILMHLIRHSEQENFLDKLKE
                     SLRRVQGGFAYLIMREDKLYAALDPNGFRPLSIGRMKNGAWVVSSETCAFEVVGAEWV
                     RDLEPGEIVIIDDEGVTYDSYTTDTQLAICSMEYVYFARPDSVIHGVNVHAARKRMGR
                     RLAQEFQHEADIVVGVPNSSLSAASGFSEESGLPNEMGLIKNQYIQRTFIQPTQELRE
                     QGVRMKLSAVSSIVKGKRVVMVDDSIVRGTTSRRIVQLLRDAGAAEVHVAIGSPELKY
                     PCFYGIDIQNRRELISANHTVDEVCEIIGADSLTYLSLEGLIESVGIETDAPNGGLCV
                     AYFDGQYPTPLYDYEERYLESLKEKTSFY"
     misc_feature    36579..38015
                     /gene="purF"
                     /locus_tag="SSA_0031"
                     /note="amidophosphoribosyltransferase; Provisional;
                     Region: PRK07272"
                     /db_xref="CDD:235984"
     gene            38078..39100
                     /gene="purM"
                     /locus_tag="SSA_0032"
                     /db_xref="GeneID:4807296"
     CDS             38078..39100
                     /gene="purM"
                     /locus_tag="SSA_0032"
                     /EC_number="6.3.3.1"
                     /function="Nucleotide transport and metabolism"
                     /note="catalyzes the formation of
                     1-(5-phosphoribosyl)-5-aminoimidazole from
                     2-(formamido)-N1-(5-phosphoribosyl)acetamidine and ATP in
                     purine biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylaminoimidazole synthetase"
                     /protein_id="YP_001034049.1"
                     /db_xref="GeneID:4807296"
                     /translation="MTNKNAYAQSGVDVEAGYEVVERIKKHVARTERAGVMGALGGFG
                     GMFDLSQTGVKEPVLISGTDGVGTKLMLAIQYDKHDTIGQDCVAMCVNDIVAAGAEPL
                     YFLDYIATGKNEPAKLEQVVAGVAEGCVQSGAALIGGETAEMPGMYGEDDYDLAGFAV
                     GVAEKSEIIDGSKVAEGDVLLGLTSSGIHSNGYSLVRRVFADYTGEEVLPELEGKKLK
                     EVLLEPTRIYVKALLPLIKEKLVHGIAHITGGGFIENVPRMFADDLAAEIEEDKIPVL
                     PIFKALEKYGHIKHQEMFEIFNMGLGMILAVAPENVDRVKELLDEPVYEVGRIVKKEN
                     ESVLIK"
     misc_feature    38090..39064
                     /gene="purM"
                     /locus_tag="SSA_0032"
                     /note="phosphoribosylaminoimidazole synthetase;
                     Provisional; Region: PRK05385"
                     /db_xref="CDD:235439"
     misc_feature    38189..39067
                     /gene="purM"
                     /locus_tag="SSA_0032"
                     /note="PurM (Aminoimidazole Ribonucleotide [AIR]
                     synthetase), one of eleven enzymes required for purine
                     biosynthesis, catalyzes the conversion of
                     formylglycinamide ribonucleotide (FGAM) and ATP to AIR,
                     ADP, and Pi, the fifth step in de novo purine
                     biosynthesis; Region: PurM; cd02196"
                     /db_xref="CDD:100032"
     misc_feature    order(38204..38218,38249..38260,38264..38266,38270..38272,
                     38288..38290,38354..38356,38366..38368,38384..38386,
                     38393..38395,38402..38404,38495..38497,38507..38509,
                     38513..38515,38534..38539,38549..38551,38849..38851)
                     /gene="purM"
                     /locus_tag="SSA_0032"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100032"
     misc_feature    order(38354..38356,38489..38497)
                     /gene="purM"
                     /locus_tag="SSA_0032"
                     /note="putative ATP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100032"
     gene            39097..39660
                     /gene="purN"
                     /locus_tag="SSA_0033"
                     /db_xref="GeneID:4807782"
     CDS             39097..39660
                     /gene="purN"
                     /locus_tag="SSA_0033"
                     /EC_number="2.1.2.2"
                     /function="Nucleotide transport and metabolism"
                     /note="glycinamide ribonucleotide transformylase; GAR
                     Tfase; catalyzes the synthesis of
                     5'-phosphoribosylformylglycinamide from
                     5'-phosphoribosylglycinamide and
                     10-formyltetrahydrofolate; PurN requires formyl folate for
                     the reaction unlike PurT which uses formate"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylglycinamide formyltransferase"
                     /protein_id="YP_001034050.1"
                     /db_xref="GeneID:4807782"
                     /translation="MKKIAVFASGNGSNFQVIAEQFPVEFVFSDHRDAYVLERADKLG
                     VKSYAFELREFDSKAAYEQAIVDLLEEHQIDLVCLAGYMKIVGPTLLAAYEGRIINIH
                     PAYLPEFPGAHGIEDAWQAGVSESGVTIHWVDSGVDTGKIIQQVRVPRLADDTIESFE
                     TRIHEAEYKLYPEVLNGLGVERKVDSK"
     misc_feature    39097..39648
                     /gene="purN"
                     /locus_tag="SSA_0033"
                     /note="phosphoribosylglycinamide formyltransferase;
                     Reviewed; Region: purN; PRK05647"
                     /db_xref="CDD:235544"
     misc_feature    order(39118..39120,39133..39141,39331..39354,39367..39369,
                     39394..39405,39427..39429,39487..39489,39493..39498,
                     39505..39510,39595..39597)
                     /gene="purN"
                     /locus_tag="SSA_0033"
                     /note="active site"
                     /db_xref="CDD:187714"
     misc_feature    order(39133..39138,39334..39339,39397..39399,39403..39405,
                     39595..39597)
                     /gene="purN"
                     /locus_tag="SSA_0033"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187714"
     misc_feature    order(39331..39333,39340..39342,39346..39354,39367..39369,
                     39394..39396,39493..39498,39505..39510)
                     /gene="purN"
                     /locus_tag="SSA_0033"
                     /note="cosubstrate binding site; other site"
                     /db_xref="CDD:187714"
     misc_feature    order(39394..39396,39400..39402,39508..39510)
                     /gene="purN"
                     /locus_tag="SSA_0033"
                     /note="catalytic site [active]"
                     /db_xref="CDD:187714"
     gene            39687..40451
                     /locus_tag="SSA_0034"
                     /db_xref="GeneID:4806876"
     CDS             39687..40451
                     /locus_tag="SSA_0034"
                     /note="GC: 27.84%; Transmembrane domains: 2. Codon
                     Adaptation Index (CAI): 0.693. Weakly similar to
                     ribonuclease domain. Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034051.1"
                     /db_xref="GeneID:4806876"
                     /translation="MFQSVFLLTTILFIVDSMNILTKIPFLSNISDRYDWLGYFGAII
                     GVYVTIKVFEDTLANDRLKREESEKNNQDLMSKERRLNNKPILIVRSLTFNDMINVFN
                     SSNQENRDLIDKIGIADSAIITDQNNYIEQNSKNKVLYLELKNVGLNHAIINSYKINN
                     EETQELIPIHTKVIVRRDQCGYLTITFSDSEFENNKLNIYYTDIFDNCYMSQFSLVGG
                     EFKQSTSKSKYYDGKIKQTVLSEYKPERSIVNNDLN"
     gene            40455..42017
                     /gene="purH"
                     /locus_tag="SSA_0035"
                     /db_xref="GeneID:4807051"
     CDS             40455..42017
                     /gene="purH"
                     /locus_tag="SSA_0035"
                     /EC_number="2.1.2.3"
                     /EC_number="3.5.4.10"
                     /note="involved in de novo purine biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional
                     phosphoribosylaminoimidazolecarboxamide
                     formyltransferase/IMP cyclohydrolase"
                     /protein_id="YP_001034052.1"
                     /db_xref="GeneID:4807051"
                     /translation="MKGKNMTKRVLISVSDKTGIVEFAKELKALGWDIISTGGTKVVL
                     DNEGVGTIAIDDVTGFPEMMDGRVKTLHPNIHGGLLARRDLDSHLQAAKENQIDLIDL
                     VVVNLYPFKETILKPGVEYADAVENIDIGGPSMLRSAAKNHASVTVVVDPADYALVLE
                     ELAANGQTTYETRQRLAAKVFRHTAAYDALIADYFTDQVGESKPEKLTLTYELKQPMR
                     YGENPQQDADFYQTALPLDYSIASAKQLNGKELSFNNIRDADAAIRIIRDFKDRPTVV
                     ALKHMNPCGIGQADDIETAWDYAYESDPVSIFGGIVVLNRQVDAATAEKMHSIFLEII
                     IAPSYTAEALAILTNKKKNLRILELAFDAQAASGAEKEVTGVLGGLLVQNQDVIEENS
                     ADWQVVTKRQPSEQERVALEFAWKSVKYVKSNGIIITNDRQVLGVGPGQTNRVASVKI
                     AIEQAKDRLDGAALASDAFFPFADNIEEIAEAGIKAIIQPGGSVRDEESIIAADKHGL
                     TMIFTGVRHFRH"
     misc_feature    40464..42014
                     /gene="purH"
                     /locus_tag="SSA_0035"
                     /note="bifunctional
                     phosphoribosylaminoimidazolecarboxamide
                     formyltransferase/IMP cyclohydrolase; Provisional; Region:
                     purH; PRK00881"
                     /db_xref="CDD:234854"
     misc_feature    40476..41039
                     /gene="purH"
                     /locus_tag="SSA_0035"
                     /note="Inosine monophosphate cyclohydrolase domain. This
                     is the N-terminal domain in the purine biosynthesis
                     pathway protein ATIC (purH). The bifunctional ATIC protein
                     contains a C-terminal ATIC formylase domain that
                     formylates...; Region: IMPCH; cd01421"
                     /db_xref="CDD:238709"
     misc_feature    order(40497..40499,40503..40505,40563..40565,40572..40574,
                     40659..40664,40770..40772,40839..40841)
                     /gene="purH"
                     /locus_tag="SSA_0035"
                     /note="purine monophosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238709"
     misc_feature    order(40632..40634,40641..40646,40653..40658,40665..40673,
                     40680..40685,40692..40694,40836..40844,40851..40853,
                     40863..40868,40875..40877,40974..40976,40983..40991,
                     41013..41021,41025..41030,41037..41039)
                     /gene="purH"
                     /locus_tag="SSA_0035"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238709"
     misc_feature    order(40659..40661,40839..40841)
                     /gene="purH"
                     /locus_tag="SSA_0035"
                     /note="putative catalytic residues [active]"
                     /db_xref="CDD:238709"
     misc_feature    40869..41819
                     /gene="purH"
                     /locus_tag="SSA_0035"
                     /note="AICARFT/IMPCHase bienzyme; Region: AICARFT_IMPCHas;
                     smart00798"
                     /db_xref="CDD:214822"
     gene            complement(42140..44089)
                     /locus_tag="SSA_0036"
                     /db_xref="GeneID:4807018"
     CDS             complement(42140..44089)
                     /locus_tag="SSA_0036"
                     /function="General function prediction only"
                     /note="GC: 45.38%; Codon Adaptation Index (CAI): 0.777.
                     LipoP prediction: SpI. SignalP prediction: Yes (prob.
                     0.997); Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034053.1"
                     /db_xref="GeneID:4807018"
                     /translation="MKKYQKLFLLSGAVLGLFASHSTVHATETPESEVKILGPTDRAS
                     NVDVTVNDRTVSISYTRSQAQEPYLIAHAVWSEENGQDDLKWYDTPQTPITDIDLSNH
                     PGYGTFHVHTYIRIGERLVALNATTFHVDKPASKTNASVSGGTGRISFSRNKDQTHSK
                     IVHAVWSEEKGSDDLQWYDAGEESTEFNLSKHRGYGRYFVDTYENVNGKMIFLSGTTF
                     HLENPKPIIETSFPQTGIMEITVKNVPDTMYKVVLPTWSDKKGQDDLQWYEASKNPDG
                     SYSARVELRKHNYDTGTYNIHLYGQSYVQPESTGITGTTVQVDSGKLPSDEEQKPLFT
                     VENINPKQGTYTVKTTETSLSKPIQSVRVPIWSTSNQSNLKWYAATPNGDGSFSATFD
                     IRNHQALSGTYNNHVYVTYKDGSERSYAADAVSMSTDQIQAKVAVRKTEANRYEVTVT
                     DAYGDGDIILPTWSEVNGQDDIKWYTANKVGNGTYKFTVDTQNHKGSGLFNTHVYRRK
                     AGQLIGLTGTSYQVEKSSVQSANIQPNYAAANATTYPVGQCTWGAKALAPWAGNYWGN
                     GGQWAASARRAGFRTGSTPEVGAIACWDDGGYGHVGVVTHVESNTRIQIQESNYLGKQ
                     YISNFRGWFDPTASYWGRLTYIYPK"
     misc_feature    complement(43748..>43873)
                     /locus_tag="SSA_0036"
                     /note="GBS Bsp-like repeat; Region: GBS_Bsp-like;
                     pfam08481"
                     /db_xref="CDD:285655"
     misc_feature    complement(43442..>43615)
                     /locus_tag="SSA_0036"
                     /note="GBS Bsp-like repeat; Region: GBS_Bsp-like;
                     pfam08481"
                     /db_xref="CDD:285655"
     misc_feature    complement(43148..43411)
                     /locus_tag="SSA_0036"
                     /note="GBS Bsp-like repeat; Region: GBS_Bsp-like;
                     pfam08481"
                     /db_xref="CDD:285655"
     misc_feature    complement(42845..43087)
                     /locus_tag="SSA_0036"
                     /note="GBS Bsp-like repeat; Region: GBS_Bsp-like;
                     pfam08481"
                     /db_xref="CDD:285655"
     misc_feature    complement(42536..42787)
                     /locus_tag="SSA_0036"
                     /note="GBS Bsp-like repeat; Region: GBS_Bsp-like;
                     pfam08481"
                     /db_xref="CDD:285655"
     misc_feature    complement(42143..>42496)
                     /locus_tag="SSA_0036"
                     /note="Surface antigen [Cell wall/membrane/envelope
                     biogenesis]; Region: COG3942"
                     /db_xref="CDD:226451"
     misc_feature    complement(42233..42472)
                     /locus_tag="SSA_0036"
                     /note="CHAP domain; Region: CHAP; pfam05257"
                     /db_xref="CDD:283032"
     gene            44412..45674
                     /gene="purD"
                     /locus_tag="SSA_0037"
                     /db_xref="GeneID:4806862"
     CDS             44412..45674
                     /gene="purD"
                     /locus_tag="SSA_0037"
                     /EC_number="6.3.4.13"
                     /function="Nucleotide transport and metabolism"
                     /note="catalyzes the formation of
                     N(1)-(5-phospho-D-ribosyl)glycinamide from
                     5-phospho-D-ribosylamine and glycine in purine
                     biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylamine--glycine ligase"
                     /protein_id="YP_001034054.1"
                     /db_xref="GeneID:4806862"
                     /translation="MKLLVVGSGGREHAIAKKLLESQGVEQVFVAPGNDGMTLDGLDL
                     VNIGISEHSKLIEFAKENDVAWSFIGPDDALAAGIVDDFNQAGLKAFGPSRLAAELEW
                     SKDFAKEIMVKYGVPTAAYGTFSDFEEAKAYIEKQGAPIVVKADGLALGKGVVVAETV
                     EQAVEAAQEMLLDNKFGDSGARVVIEEFLDGEEFSLFAFVNGDKFYIMPTAQDHKRAY
                     DGDKGPNTGGMGAYAPVPHLPQSVVDQSVETIIKPVLKGMIAEGRPYLGVLYAGLILT
                     ADGPKVIEFNSRFGDPETQIILPRLTSDFAQNITDILDKKEPAITWLDEGVTLGVVVA
                     SEGYPLDYEKGKPLPEKTAGDIITYYAGAKFAENSRALLSNGGRVYMLVTTADTVSAA
                     QEKIYDQLKKQDTTGLFYRTDIGSKAVK"
     misc_feature    44412..45671
                     /gene="purD"
                     /locus_tag="SSA_0037"
                     /note="phosphoribosylamine--glycine ligase; Provisional;
                     Region: PRK00885"
                     /db_xref="CDD:234856"
     misc_feature    44415..44714
                     /gene="purD"
                     /locus_tag="SSA_0037"
                     /note="Phosphoribosylglycinamide synthetase, N domain;
                     Region: GARS_N; pfam02844"
                     /db_xref="CDD:280931"
     misc_feature    44718..45293
                     /gene="purD"
                     /locus_tag="SSA_0037"
                     /note="Phosphoribosylglycinamide synthetase, ATP-grasp (A)
                     domain; Region: GARS_A; pfam01071"
                     /db_xref="CDD:279419"
     misc_feature    45393..45662
                     /gene="purD"
                     /locus_tag="SSA_0037"
                     /note="Phosphoribosylglycinamide synthetase, C domain;
                     Region: GARS_C; pfam02843"
                     /db_xref="CDD:280930"
     gene            45973..46461
                     /gene="purE"
                     /locus_tag="SSA_0039"
                     /db_xref="GeneID:4807083"
     CDS             45973..46461
                     /gene="purE"
                     /locus_tag="SSA_0039"
                     /EC_number="4.1.1.21"
                     /function="Nucleotide transport and metabolism"
                     /note="GC: 51.12%; Codon Adaptation Index (CAI): 0.752.
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="5-(carboxyamino)imidazole ribonucleotide mutase"
                     /protein_id="YP_001034055.1"
                     /db_xref="GeneID:4807083"
                     /translation="MKPIISIIMGSKSDWATMQKTAEVLERFGVAYEKKVVSAHRTPD
                     LMFQHAEEARSRGIKVIIAGAGGAAHLPGMVAAKTTLPVIGVPVKSRALSGLDSLYSI
                     VQMPGGVPVATMAIGEAGATNAALTALRILAIEDQDLAATLADFAEEQGKIAEESSNE
                     LI"
     misc_feature    45973..46458
                     /gene="purE"
                     /locus_tag="SSA_0039"
                     /note="Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase
                     [Nucleotide transport and metabolism]; Region: PurE;
                     COG0041"
                     /db_xref="CDD:223119"
     gene            46448..47539
                     /gene="purK"
                     /locus_tag="SSA_0040"
                     /db_xref="GeneID:4807079"
     CDS             46448..47539
                     /gene="purK"
                     /locus_tag="SSA_0040"
                     /EC_number="4.1.1.21"
                     /function="Nucleotide transport and metabolism"
                     /note="With PurE catalyzes the conversion of
                     aminoimidazole ribonucleotide to carboxyaminoimidazole
                     ribonucleotide in the de novo purine nucleotide
                     biosynthetic pathway"
                     /codon_start=1
                     /transl_table=11
                     /product="5-(carboxyamino)imidazole ribonucleotide
                     synthase"
                     /protein_id="YP_001034056.1"
                     /db_xref="GeneID:4807079"
                     /translation="MSSSKTIGIIGGGQLGQMMAISAIYMGHKVIALDPAADCPASRV
                     AEIIAAPYNDVDALRQLAERCDVLTYEFENVDADGLDAVIKDGQLPQGTDLLRISQNR
                     IFEKDFLANKAQVTVAPYKVVTSSQDLADIDLSKNYVLKTATGGYDGHGQKVIRSEED
                     LEEAYALADSADCVLEEFINFDLEISVIVSGNGKDVTVFPVQENIHRNNILSKTIVPA
                     RISESLADKAKAMAVRIAEQLKLSGTLCVEMFATADDIIVNEIAPRPHNSGHYSIEAC
                     DFSQFDTHILGVLGAPLPVIQLHAPAVMLNVLGQHVEAAETYVTENPSAHLHLYGKIE
                     AKHNRKMGHVTLFSDKPDSVVEFGEGIDF"
     misc_feature    46487..47515
                     /gene="purK"
                     /locus_tag="SSA_0040"
                     /note="phosphoribosylaminoimidazole carboxylase ATPase
                     subunit; Reviewed; Region: PRK06019"
                     /db_xref="CDD:235674"
     gene            47802..48029
                     /locus_tag="SSA_0041"
                     /db_xref="GeneID:4807223"
     CDS             47802..48029
                     /locus_tag="SSA_0041"
                     /note="GC: 39.47%; Codon Adaptation Index (CAI): 0.761.
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034057.1"
                     /db_xref="GeneID:4807223"
                     /translation="MIQIIVNAFVEEGKETAVVEVLFASADHEKVKAKYQELKIQYPD
                     NYLAIYDLPLDTDLSSLPHYPSVAISKEEFN"
     gene            48033..48731
                     /locus_tag="SSA_0042"
                     /db_xref="GeneID:4806965"
     CDS             48033..48731
                     /locus_tag="SSA_0042"
                     /EC_number="5.1.1.13"
                     /function="Cell envelope biogenesis, outer membrane"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 44.06%; Codon Adaptation Index (CAI): 0.766.
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid recemase"
                     /protein_id="YP_001034058.1"
                     /db_xref="GeneID:4806965"
                     /translation="MKTIGLIGGMSWESTTSYYQIINETIKKELGGLHSAKILLYSVD
                     FAEIEHYQAVGDWEKSGQLLADVAQRLEQAGADFIVICTNTMHKVAPQIQDKITIPIL
                     HIAQATAQALLTDGIQKVGLLGTKYTMTQDFYKEKLIESGLEVLIPDQAGITEVNRII
                     YDELCLGDIKESSKQTYLAVIDDLKKAGAEAVILGCTEIGLLVKQSDTDLPLYDTTVI
                     HAEKAAEWAVNKRL"
     misc_feature    48033..48713
                     /locus_tag="SSA_0042"
                     /note="Aspartate/glutamate racemase [Cell
                     wall/membrane/envelope biogenesis]; Region: RacX; COG1794"
                     /db_xref="CDD:224707"
     gene            48941..49168
                     /locus_tag="SSA_0043"
                     /db_xref="GeneID:4806901"
     CDS             48941..49168
                     /locus_tag="SSA_0043"
                     /note="GC: 37.72%; Codon Adaptation Index (CAI): 0.78.
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034059.1"
                     /db_xref="GeneID:4806901"
                     /translation="MIQIIVNAFVEKDKTGAVVEVLFASSDQEKVKAKYEELVAQHPE
                     NYLAIYDLPLDKDLNTLDHYPSVVVVKEELE"
     gene            49181..50317
                     /locus_tag="SSA_0044"
                     /db_xref="GeneID:4807449"
     CDS             49181..50317
                     /locus_tag="SSA_0044"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 29.02%; Codon Adaptation Index (CAI): 0.751.
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034060.1"
                     /db_xref="GeneID:4807449"
                     /translation="MNFILMEINYLKITKKILFLDSQIDKKLPIESTEVINNKSFFKK
                     HKLIEKYFSKLYGKMRLDELKSKAGICFSFELPKKIEKQLYDFGKIVIENKDFKLKQQ
                     VDEIYNLLFLRQYKNIIVLSTAIWLVKDSCVQENNTYFITQSGYQNQVSIEMPYTLAN
                     GEHKTIELTEKELKKVEQNYFLLYSIMTKPLPVTPTVIHHSIRTLTIENDKLDRSKES
                     SFVRALLNLQNARRSGQLSVKIDFYMQVLQCIYALEGMKSTKIEKTLQEVTKNLLDLT
                     VTEQTVLANALLLSSNSTEDEFENENKGIFNTIKKAFRIRSKQSHGNKINYSAVDIEN
                     TSIMVDEYVRRVLQIVLLNPELDYNTKEEAKKVSEYFINLGKDS"
     gene            50473..51009
                     /locus_tag="SSA_0045"
                     /db_xref="GeneID:4807577"
     CDS             50473..51009
                     /locus_tag="SSA_0045"
                     /note="GC: 27%; Transmembrane domains: 2. Codon Adaptation
                     Index (CAI): 0.761. SignalP prediction: Yes (prob. 0.467);
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034061.1"
                     /db_xref="GeneID:4807577"
                     /translation="MNVVSVALLITSLLPLSINESKSGLMLSAFFSLYTMLVQYFCST
                     LNYNERALKYHYHQLELENFILKLKNLLLCEKTRRPYNDMDFEKFQKYKIILEKYQIS
                     LQGYENHSDLDYRIARKQIERYNKKDEIKKNIKWHVKLAEWLSYKDFTIDNIFIYFQI
                     PIITLIILAYIWVAVVGL"
     gene            51034..52329
                     /gene="purB"
                     /locus_tag="SSA_0046"
                     /db_xref="GeneID:4807879"
     CDS             51034..52329
                     /gene="purB"
                     /locus_tag="SSA_0046"
                     /EC_number="4.3.2.2"
                     /function="Nucleotide transport and metabolism"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="Catalyzes two discrete reactions in the de novo
                     synthesis of purines: the cleavage of adenylosuccinate and
                     succinylaminoimidazole carboxamide ribotide"
                     /codon_start=1
                     /transl_table=11
                     /product="adenylosuccinate lyase"
                     /protein_id="YP_001034062.1"
                     /db_xref="GeneID:4807879"
                     /translation="MINRYSRPEMANIWTEENKYKAWLEVEILADEAWAELGEIPKED
                     VALIREKAGFDIDRILEIEQETRHDVVAFTRAVSETLGEERKWVHYGLTSTDVVDTAY
                     GYLYKQANDIIREDLRRFTDIIAERAREHKFTIMMGRTHGVHAEPTTFGLKLATWYSE
                     MKRNIERFEIAAAGVEAGKISGAVGNFANIPPFVESYVCEKLGIRPQEISTQVLPRDL
                     HAEYFSALALIATSIERMATEIRGLQKSEQREVEEFFAKGQKGSSAMPHKRNPIGSEN
                     MTGLARVIRGHMVTAFENVSLWHERDISHSSAERIIAPDTTILIDYMLNRFGNIVKNL
                     TVFPENMKRNMNSTFGLIFSQRAMLTLIEKGMTREQAYDLVQPKTAQSWDNQVDFKPL
                     LEADPEVTSRLTQEEIDEIFNPVYYTKRVDEIFKRVGLD"
     misc_feature    51043..52314
                     /gene="purB"
                     /locus_tag="SSA_0046"
                     /note="Adenylsuccinate lyase (ASL)_subgroup 1; Region:
                     Adenylsuccinate_lyase_1; cd01360"
                     /db_xref="CDD:176464"
     misc_feature    order(51076..51081,51238..51240,51265..51267,51292..51297,
                     51301..51306,51448..51465,51469..51471,51487..51492,
                     51499..51501,51508..51513,51529..51534,51550..51552,
                     51580..51591,51598..51600,51604..51606,51652..51654,
                     51658..51663,51682..51684,51694..51696,51715..51717,
                     51736..51738,51748..51750,51754..51759,51763..51768,
                     51838..51843,51856..51858,51868..51870,51877..51882,
                     51886..51891,51898..51903,51910..51918,51922..51945,
                     51952..51957,51961..51966,51976..51978,52096..52098,
                     52108..52110,52117..52122,52135..52140,52285..52287,
                     52291..52293,52303..52305)
                     /gene="purB"
                     /locus_tag="SSA_0046"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176464"
     misc_feature    order(51235..51237,51298..51300,51454..51456,51667..51669,
                     51835..51837,51841..51843,51856..51858)
                     /gene="purB"
                     /locus_tag="SSA_0046"
                     /note="active site"
                     /db_xref="CDD:176464"
     gene            complement(52374..52940)
                     /locus_tag="SSA_0047"
                     /db_xref="GeneID:4807871"
     CDS             complement(52374..52940)
                     /locus_tag="SSA_0047"
                     /EC_number="1.6.5.2"
                     /function="General function prediction only"
                     /note="GC: 44.44%; Codon Adaptation Index (CAI): 0.795.
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H dehydrogenase (quinone)"
                     /protein_id="YP_001034063.1"
                     /db_xref="GeneID:4807871"
                     /translation="MKTLIIYTYPSPTGFNTAILKEVQSNLSKKHEVKTLDLYTENFD
                     PILRFDQEHRRRDLHKDPEMAKYRDLITWADHLIFIFPIWWSGMPAILKGFIDRVFAA
                     DFAYSYKKVGMQGHLQGKSGWIIVSHNTPGFALPFVQDYGKVLKNQILKLCGISPVKL
                     TELNGVERKTDQQRQEMLKKIGQLASQI"
     misc_feature    complement(52377..52940)
                     /locus_tag="SSA_0047"
                     /note="Putative NADPH-quinone reductase (modulator of drug
                     activity B) [General function prediction only]; Region:
                     MdaB; COG2249"
                     /db_xref="CDD:225158"
     gene            complement(52937..53533)
                     /locus_tag="SSA_0048"
                     /db_xref="GeneID:4807840"
     CDS             complement(52937..53533)
                     /locus_tag="SSA_0048"
                     /function="Transcription"
                     /note="GC: 44.05%; Codon Adaptation Index (CAI): 0.773.
                     Helix-turn-helix prediction: AraC. Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR/AcrR family transcriptional regulator"
                     /protein_id="YP_001034064.1"
                     /db_xref="GeneID:4807840"
                     /translation="MKRNTAQLKEQLIQTGIEEIGKHGIEQLSLRTVAKACGVTHGTP
                     YRHFESKEGYLKVVLTQLSLFLNQEINENIDATGSARDRLTQLGLNFIIFAKTYPHFF
                     EALFIKFPFKYMKVTQDTILLESDLPGFDKFKELVLKLREEENFSNSEAESLFHFWSF
                     ITGLAVLTNSPIGQDLDPQAIQSTIEHMLDIYIKGERS"
     misc_feature    complement(<53213..53533)
                     /locus_tag="SSA_0048"
                     /note="DNA-binding transcriptional regulator, AcrR family
                     [Transcription]; Region: AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    complement(53375..53500)
                     /locus_tag="SSA_0048"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:278848"
     misc_feature    complement(53024..53281)
                     /locus_tag="SSA_0048"
                     /note="WHG domain; Region: WHG; pfam13305"
                     /db_xref="CDD:290044"
     gene            53752..54741
                     /locus_tag="SSA_0049"
                     /db_xref="GeneID:4807641"
     CDS             53752..54741
                     /locus_tag="SSA_0049"
                     /EC_number="2.7.1.29"
                     /function="Carbohydrate transport and metabolism"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="with DhaL and DhaM forms dihydroxyacetone kinase,
                     which is responsible for phosphorylating dihydroxyacetone;
                     DhaK is the dihydroxyacetone binding subunit of the
                     dihydroxyacetone kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroxyacetone kinase subunit DhaK"
                     /protein_id="YP_001034065.1"
                     /db_xref="GeneID:4807641"
                     /translation="MKKIINDPTAVVDEMLEGLAYIHSDLVYRVEGFDIIARKSEKTG
                     KVGLISGGGSGHEPSHAGFVGEGMLSAAICGAVFTSPTPDQVLQAIKEADEGAGVFMV
                     IKNYSGDIMNFEMAQEMAEMEGIEVASVVVDDDIAVEDSLYTQGRRGVAGTILVHKIL
                     GDAARAGKSLTEIKALADELVKHIHTVGLALSGATVPEVGKPGFVLADDEIEFGIGIH
                     GEPGYRKEKMQPSKDLAKELVEKLSQSVELKSGKKIGILINGMGATPLMEQYVFAADV
                     ANFLAEAGVEVVYKKLGNYMTSIDMAGISLTFIQLDQPDWLTALNSPVTTAAW"
     misc_feature    53752..54738
                     /locus_tag="SSA_0049"
                     /note="dihydroxyacetone kinase subunit DhaK; Provisional;
                     Region: PRK14481"
                     /db_xref="CDD:237724"
     misc_feature    53752..54732
                     /locus_tag="SSA_0049"
                     /note="Dihydroxyacetone kinase [Carbohydrate transport and
                     metabolism]; Region: DAK1; COG2376"
                     /db_xref="CDD:225251"
     gene            54752..55330
                     /locus_tag="SSA_0050"
                     /db_xref="GeneID:4807608"
     CDS             54752..55330
                     /locus_tag="SSA_0050"
                     /EC_number="2.7.1.29"
                     /function="Carbohydrate transport and metabolism"
                     /note="GC: 52.5%; Codon Adaptation Index (CAI): 0.739.
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroxyacetone kinase phosphatase
                     domain-containing protein"
                     /protein_id="YP_001034066.1"
                     /db_xref="GeneID:4807608"
                     /translation="MDAARAKKWMQLFNEKIQDQKDYLSDLDTPIGDGDHGANMARGM
                     AAAVESLAAKDFASAAEVFQAVSMQLISKVGGASGPLYGSAFMGMAKAEKDGKDLSEV
                     IQAGLDMIQKRGKAVPGEKTMVDVWSGIPISLQSGDLTLEKIGSLVEATKDLKATKGR
                     ASYVGERSIDHIDPGSASSGLLFEALLETEAG"
     misc_feature    54770..55309
                     /locus_tag="SSA_0050"
                     /note="DAK2 domain; Region: Dak2; cl22522"
                     /db_xref="CDD:304574"
     gene            55330..55704
                     /locus_tag="SSA_0051"
                     /db_xref="GeneID:4807753"
     CDS             55330..55704
                     /locus_tag="SSA_0051"
                     /function="Function unknown"
                     /note="GC: 49.07%; Codon Adaptation Index (CAI): 0.718.
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system mannnose-specific transporter subunit
                     IIA"
                     /protein_id="YP_001034067.1"
                     /db_xref="GeneID:4807753"
                     /translation="MADTGILIVSHSKNLAQGLFDLISQVAADVAISYVGGLDDGSIG
                     TSFEGIQAALDANDKDTILAFFDLGSARMNLEMVADFSDKEIIINNVPLVEGAYTAAA
                     LLQAGADLPNVLLQVRELEIKK"
     misc_feature    55336..55701
                     /locus_tag="SSA_0051"
                     /note="phosphotransferase mannnose-specific family
                     component IIA; Provisional; Region: PRK14484"
                     /db_xref="CDD:184702"
     gene            complement(56032..56748)
                     /locus_tag="SSA_0052"
                     /db_xref="GeneID:4807526"
     CDS             complement(56032..56748)
                     /locus_tag="SSA_0052"
                     /function="Transcription"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 42.4%; Codon Adaptation Index (CAI): 0.784.
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_001034068.1"
                     /db_xref="GeneID:4807526"
                     /translation="MAIPKYQQIKDELKQQIISGKFENGDKFYTEAELIQMFNVSSIT
                     VVRALNELANDGYIIRQQGKGTFVSRARKHKLVEFSDVETFPIQKDKVTVLSIKRGND
                     LKILDKLELAPTQFYYKIDRVRRTGDKIYIYHQTYIPEQYINPNYPDMDYYSSIYNRF
                     KTDYHIHMNDEHFEETNEIVFPTPKDVAKVLEVDTNFPTVHQVKITQLESTGQILEYS
                     ETYKRGDFFKIKFISCNRDH"
     misc_feature    complement(56050..56748)
                     /locus_tag="SSA_0052"
                     /note="DNA-binding transcriptional regulator, GntR family
                     [Transcription]; Region: MngR; COG2188"
                     /db_xref="CDD:225099"
     gene            56888..58675
                     /locus_tag="SSA_0053"
                     /db_xref="GeneID:4807486"
     CDS             56888..58675
                     /locus_tag="SSA_0053"
                     /EC_number="3.2.1.23"
                     /function="Carbohydrate transport and metabolism"
                     /note="GC: 48.1%; Codon Adaptation Index (CAI): 0.764.
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-galactosidase"
                     /protein_id="YP_001034069.1"
                     /db_xref="GeneID:4807486"
                     /translation="MARFKIGHSFCLDDREFKILSGAIHYFRVQPEDWYHSLYNLKAL
                     GFNTVETYLPWNMHEPQKGVFNFQGILDIEAFLQTAQDLGLYAIIRPSPFICAEWEFG
                     GLPAWLLNENMRIRSSDEAFLQAVASYYDELLPRLTPRLLDNGGNILMMQVENEYGSY
                     GEDKAYLRAIRQLMEERGVTCPLFTSDGPWRATLRAGTLIDDDVFVTGNFGSKADYNF
                     AQLQEFFDEHGKKWPLMCMEFWDGWFNRWKEPIIKRDPDELARAVHEVLQQGSINLYM
                     FHGGTNFGFMNGCSARGVIDLPQVTSYDYDALLDERGNPTDKYYAVQRMLKEHYPEYP
                     QMEPLVKESFELGNIPLSQKVSLFETLPDLAEPIESLYPMKMEELGQNVGYLLYRTWA
                     SWDADQERLRVIDGRDRMQLYVDGQHMATQYQTEIGQDIMVDGQKKAGHQLDILMENM
                     GRVNYGHKLLADTQQKGIRTGVCKDLHFLLDWQHYPLPLEHPEKIDFSKGWQEKQPAF
                     YAFDFKMKALKDTYLDLSDFGKGVVFVNGVSIGRFWNVGPTLSLYIPHSLLREGDNRI
                     IIFETEGIYSETIHLVNQPTFKTIKGENL"
     misc_feature    56894..58672
                     /locus_tag="SSA_0053"
                     /note="Beta-galactosidase GanA [Carbohydrate transport and
                     metabolism]; Region: GanA; COG1874"
                     /db_xref="CDD:224786"
     misc_feature    56912..57868
                     /locus_tag="SSA_0053"
                     /note="Glycosyl hydrolases family 35; Region:
                     Glyco_hydro_35; pfam01301"
                     /db_xref="CDD:279624"
     misc_feature    <58409..58585
                     /locus_tag="SSA_0053"
                     /note="Beta-galactosidase jelly roll domain; Region:
                     BetaGal_dom4_5; pfam13364"
                     /db_xref="CDD:290101"
     gene            58672..59148
                     /locus_tag="SSA_0054"
                     /db_xref="GeneID:4807891"
     CDS             58672..59148
                     /locus_tag="SSA_0054"
                     /EC_number="2.7.1.69"
                     /note="GC: 47.59%; Transporter classification
                     TC:4.A.6.1.2. Codon Adaptation Index (CAI): 0.764.
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphotransferase system sugar-specific EIIB
                     component"
                     /protein_id="YP_001034070.1"
                     /db_xref="GeneID:4807891"
                     /translation="MTIVGARIDGRLIHGQVANLWTTKLNISRIMVIDDEVAENAIEK
                     SGLKLATPAGVKLSVLPIAKAAENILAGKYDSQRLLIVARKPDRFLRLVEAGVPLETL
                     NVGNMSQSDETRSITRSINVVDADVEAFHKLHEKGVKLTAQMVPNDPVEDFMKLLK"
     misc_feature    58672..59145
                     /locus_tag="SSA_0054"
                     /note="Phosphotransferase system,
                     mannose/fructose/N-acetylgalactosamine-specific component
                     IIB [Carbohydrate transport and metabolism]; Region: AgaB;
                     COG3444"
                     /db_xref="CDD:225976"
     misc_feature    order(58690..58692,58702..58704,58711..58713)
                     /locus_tag="SSA_0054"
                     /note="active site"
                     /db_xref="CDD:237975"
     misc_feature    58711..58713
                     /locus_tag="SSA_0054"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:237975"
     gene            59174..60079
                     /locus_tag="SSA_0055"
                     /db_xref="GeneID:4807381"
     CDS             59174..60079
                     /locus_tag="SSA_0055"
                     /note="GC: 45.14%; Transporter classification
                     TC:4.A.6.1.2. Transmembrane domains: 7. Codon Adaptation
                     Index (CAI): 0.767. Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system transporter subunit IIC"
                     /protein_id="YP_001034071.1"
                     /db_xref="GeneID:4807381"
                     /translation="MIQWWQILLLTLYSAYQICDELTIVSSAGSPVFAGFITGLIMGD
                     LTTGLFIGGSLQLFVLGVGTFGGASRIDATSGAVLATAFSVAQGIKPELAIATIAVPV
                     ATLLTYFDILGRMTTTYFAHRVDAAVERFDYKGIERNYLLGALPWALSRALPVFLALA
                     YGGTFVQAIVDGVAGVKWLAAGLTLAGRMLPGLGFAILLRYLPVKRNLHYLALGFGLT
                     AMLTVLYSNIQTLGGAVSSIVGTLPKDAAVTFANNFKGLSMIGVAIFGIFLAVQHFKY
                     SQRTVVAAPAASTNSESEEIEDDEL"
     misc_feature    59174..60034
                     /locus_tag="SSA_0055"
                     /note="Phosphotransferase system,
                     mannose/fructose/N-acetylgalactosamine-specific component
                     IIC [Carbohydrate transport and metabolism]; Region: ManY;
                     COG3715"
                     /db_xref="CDD:226238"
     gene            60066..60890
                     /locus_tag="SSA_0056"
                     /db_xref="GeneID:4807120"
     CDS             60066..60890
                     /locus_tag="SSA_0056"
                     /note="GC: 42.18%; Transporter classification
                     TC:4.A.6.1.1. Transmembrane domains: 5. Codon Adaptation
                     Index (CAI): 0.793. Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphotransferase system sugar-specific EIID
                     component"
                     /protein_id="YP_001034072.1"
                     /db_xref="GeneID:4807120"
                     /translation="MTNSNYKLTKEDFKQINKRSLFTFQLGWNYERMQGSGYLYMLLP
                     QLRKMYGDGTPELKEMMKLHTQFFNTSPFFHTIIAGFDLAMEEKDGVKSKDAVNGIKT
                     GLMGPFAPLGDSIFGSLVPAIMGSIAATMAIAGQPWGIFLWIAVAVAYDIFRWKQLEF
                     AYKEGVNLITNMQSTLTALVEAASVLGIFMVGGLIATMINFEVSWVWNIGEKAIDFQD
                     MMNLIFPRLIPAVFTGFIFWLLGKKGMNSTKAIFIIIIMAVSFSAIGYFLLGQVPE"
     misc_feature    60087..60860
                     /locus_tag="SSA_0056"
                     /note="PTS system mannose/fructose/sorbose family IID
                     component; Region: EIID-AGA; pfam03613"
                     /db_xref="CDD:281596"
     gene            60902..61306
                     /locus_tag="SSA_0057"
                     /db_xref="GeneID:4807447"
     CDS             60902..61306
                     /locus_tag="SSA_0057"
                     /EC_number="2.7.1.69"
                     /function="Carbohydrate transport and metabolism"
                     /note="GC: 42.72%; Transporter classification
                     TC:4.A.6.1.2. Codon Adaptation Index (CAI): 0.789.
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphotransferase system sugar-specific EII
                     component"
                     /protein_id="YP_001034073.1"
                     /db_xref="GeneID:4807447"
                     /translation="MSKKLVLVSHGRFCEELKTTTEMIMGPQEDIHAVALLPEEGPED
                     FAAKFLETVKDFEDYLVFADLLGGTPCNVVSRFIMEGQDIELYAGVNLPMVIEFINSS
                     LTGAEVSYPSKAAENIVKVNDVLAGLMDDEDE"
     misc_feature    60908..61219
                     /locus_tag="SSA_0057"
                     /note="PTS_IIA, PTS system, mannose/sorbose specific IIA
                     subunit. The bacterial phosphoenolpyruvate: sugar
                     phosphotransferase system (PTS) is a multi-protein system
                     involved in the regulation of a variety of metabolic and
                     transcriptional processes. This family...; Region:
                     PTS_IIA_man; cd00006"
                     /db_xref="CDD:237978"
     misc_feature    order(60929..60931,60971..60976,61007..61009,61106..61108,
                     61199..61201)
                     /locus_tag="SSA_0057"
                     /note="active pocket/dimerization site"
                     /db_xref="CDD:237978"
     misc_feature    order(60929..60931,61091..61093,61106..61108)
                     /locus_tag="SSA_0057"
                     /note="active site"
                     /db_xref="CDD:237978"
     misc_feature    60929..60931
                     /locus_tag="SSA_0057"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:237978"
     gene            61617..62795
                     /gene="agaS"
                     /locus_tag="SSA_0060"
                     /db_xref="GeneID:4807968"
     CDS             61617..62795
                     /gene="agaS"
                     /locus_tag="SSA_0060"
                     /EC_number="5.3.1.-"
                     /EC_number="5.-.-.-"
                     /function="Cell envelope biogenesis, outer membrane"
                     /note="GC: 49.79%; Codon Adaptation Index (CAI): 0.771.
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="tagatose-6-phosphate ketose/aldose isomerase"
                     /protein_id="YP_001034074.1"
                     /db_xref="GeneID:4807968"
                     /translation="MRKRMLDYSQEELQRLGADITTREIYQQPEVWKEAFDSYKSQTA
                     DIAAFLKKIEVKHDYIKVIFAGAGSSAYVGDTLTPYFRQIYDERKWNFNAIATTDIVA
                     NPLVHLKREVPTVLVSFARSGNSPESVATVDLAKQLVDDLYQITITCAAQGKLAQQAQ
                     GDEKNLLLLQPEASNDAGFAMTSSFSSMMLTALLVFDRAELDQKEAKVAALIQLSQDV
                     LERVADVQQLVDLDFSRVIYLGAGPFFGLAHEAQLKILELTAGQIATMYESPVGFRHG
                     PKSLINQDTVVLVFGSADAYTKAYDLDLVREVAGDGIVRRLVMLTDREEQLEGVEQVV
                     LSTQEPLGDSYRIFPYIVYAQLFALLSSLKVKNRPDTPSPTGTVNRVVQGVIIHPFGQ
                     "
     misc_feature    61677..62786
                     /gene="agaS"
                     /locus_tag="SSA_0060"
                     /note="putative sugar isomerase, AgaS family; Region:
                     agaS_fam; TIGR02815"
                     /db_xref="CDD:131862"
     misc_feature    61797..62204
                     /gene="agaS"
                     /locus_tag="SSA_0060"
                     /note="SIS (Sugar ISomerase) domain repeat 1 found in
                     Glucosamine 6-phosphate synthase (GlmS) and
                     Glucosamine-6-phosphate deaminase (GlmD). The SIS domain
                     is found in many phosphosugar isomerases and phosphosugar
                     binding proteins. GlmS contains a N-terminal...; Region:
                     SIS_GlmS_GlmD_1; cd05008"
                     /db_xref="CDD:240141"
     misc_feature    order(61815..61820,61848..61853,61875..61880,61899..61901,
                     61914..61916,61926..61928,61935..61937,61995..61997)
                     /gene="agaS"
                     /locus_tag="SSA_0060"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240141"
     misc_feature    order(61821..61826,61974..61982)
                     /gene="agaS"
                     /locus_tag="SSA_0060"
                     /note="active site"
                     /db_xref="CDD:240141"
     misc_feature    62322..62771
                     /gene="agaS"
                     /locus_tag="SSA_0060"
                     /note="AgaS-like protein. AgaS contains a SIS (Sugar
                     ISomerase) domain which is found in many phosphosugar
                     isomerases and phosphosugar binding proteins. AgaS is a
                     putative isomerase in Escherichia coli. It is similar to
                     the glucosamine-6-phosphate synthases...; Region:
                     SIS_AgaS_like; cd05010"
                     /db_xref="CDD:240143"
     misc_feature    order(62346..62348,62490..62492)
                     /gene="agaS"
                     /locus_tag="SSA_0060"
                     /note="putative active site [active]"
                     /db_xref="CDD:240143"
     gene            62810..63847
                     /locus_tag="SSA_0061"
                     /db_xref="GeneID:4806574"
     CDS             62810..63847
                     /locus_tag="SSA_0061"
                     /EC_number="4.1.2.40"
                     /function="Carbohydrate transport and metabolism"
                     /note="catalyzes the reversible reaction of
                     dihydroxyacetone phosphate with glyceraldehyde 3-phosphate
                     to produce tagatose 1,6-bisphosphate; in Streptococcus
                     pyogenes there are two paralogs of tagatose-bisphosphate
                     aldolase, encoded by lacD1 and lacD2; expression of lacD1
                     is highly regulated by environmental conditions while
                     lacD2 specializes in an efficient utilization of
                     carbohydrate sources"
                     /codon_start=1
                     /transl_table=11
                     /product="tagatose 1,6-diphosphate aldolase"
                     /protein_id="YP_001034075.1"
                     /db_xref="GeneID:4806574"
                     /translation="MEKLQISHKKVSHLKKLSNEQGIIGALAIDQRGSLKKMLASGED
                     APSGDQALVQFKELISSQLTPYASSILLDPEFGLPAAELRDASCGLIVAYEKTGYDVT
                     AEGRLPDLLPNWSASRIRDMGADAVKVLIYYDVDDKPEINDIKQAWVERVGSECLAED
                     IPYFLEILTYDAKSDSVLDANYAKLKPHKVNEAVKLFSDPRYHVDVLKVEVPVNMNFV
                     EGFTKEGVEPVYSVTEAQAFFKEQSDATHLPFIFLSAGVSAELFQETLRLAHEAGSQF
                     NGVLCGRATWKDAVSVFAQEGAAAAQAWLDETGRQNIEDLNQVLRQTAVSWVDKLDLP
                     FEDRTWQVRDF"
     misc_feature    62819..63811
                     /locus_tag="SSA_0061"
                     /note="tagatose 1,6-diphosphate aldolase; Reviewed;
                     Region: PRK04161"
                     /db_xref="CDD:235232"
     gene            63872..64918
                     /gene="galM"
                     /locus_tag="SSA_0062"
                     /db_xref="GeneID:4806696"
     CDS             63872..64918
                     /gene="galM"
                     /locus_tag="SSA_0062"
                     /EC_number="5.1.3.3"
                     /function="Carbohydrate transport and metabolism"
                     /note="GC: 49.28%; Codon Adaptation Index (CAI): 0.779.
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="aldose 1-epimerase"
                     /protein_id="YP_001034076.1"
                     /db_xref="GeneID:4806696"
                     /translation="MKSYRESIFGKLGGQEILAYTFENDQGYRLTVMNYGATVVQYVT
                     PDKDNHFDNIVVGFDQFEDYIGNSPKHGASIGPVAGRIAGATFDLNGQTFQLEANNGL
                     NCNHSGSSGWGSAVFEVEEVSNDGLTFYTERTDGTGGFPGNLKIWVSYTLTEKGKLEI
                     SYQVQTDQDTLVNPTNHSYFNLSGRFNQPIDDHILQLNTDGVYPIAADGLPEKKADAE
                     RDFVKKLTKGASLKEIFAATDEQIRLVSGLDHPFALNPSRDQAGTLYHPASGRRLTIQ
                     TQAPCLVIYSANCVDDSVQFDGQPMIQHNGLALEAQALPDAIHSSQQSDVILKAGQIF
                     TSRTVYFADVPATL"
     misc_feature    63929..64891
                     /gene="galM"
                     /locus_tag="SSA_0062"
                     /note="galactose mutarotase_like; Region:
                     galactose_mutarotase_like; cd09019"
                     /db_xref="CDD:185696"
     misc_feature    order(64079..64081,64112..64114,64187..64189,64400..64402,
                     64406..64408,64616..64618,64724..64726,64799..64801)
                     /gene="galM"
                     /locus_tag="SSA_0062"
                     /note="active site"
                     /db_xref="CDD:185696"
     misc_feature    order(64400..64402,64799..64801)
                     /gene="galM"
                     /locus_tag="SSA_0062"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:185696"
     gene            65475..66473
                     /gene="ruvB"
                     /locus_tag="SSA_0063"
                     /db_xref="GeneID:4806365"
     CDS             65475..66473
                     /gene="ruvB"
                     /locus_tag="SSA_0063"
                     /EC_number="3.1.22.4"
                     /function="DNA replication, recombination, and repair"
                     /note="promotes strand exchange during homologous
                     recombination; RuvAB complex promotes branch migration;
                     RuvABC complex scans the DNA during branch migration and
                     resolves Holliday junctions at consensus sequences; forms
                     hexameric rings around opposite DNA arms; requires ATP for
                     branch migration and orientation of RuvAB complex
                     determines direction of migration"
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction DNA helicase RuvB"
                     /protein_id="YP_001034077.1"
                     /db_xref="GeneID:4806365"
                     /translation="MSRILDNELMGDEELVERTLRPQYLQEYIGQDKVKDQLKIFIEA
                     AKLRDEALDHTLLFGPPGLGKTTMAFVIANELGVNLKQTSGPVIEKSGDLVAILNDLE
                     PGDVLFIDEIHRLPMAVEEVLYSAMEDFYIDIMIGSGETSRSVHLDLPPFTLIGATTR
                     AGMLSNPLRARFGITGHMEYYEAGDLTEIVERTAEIFEMAITHEAAKELALRSRGTPR
                     IANRLLKRVRDYAQIMGNGLIDDKITDQALSMLDVDQEGLDYVDQKILKTMIEVYGGG
                     PVGLGTLSVNIAEERETVEDMYEPYLIQKGFVMRTRTGRVATRKAYEHLGYEYMKE"
     misc_feature    65481..66461
                     /gene="ruvB"
                     /locus_tag="SSA_0063"
                     /note="Holliday junction DNA helicase RuvB; Reviewed;
                     Region: ruvB; PRK00080"
                     /db_xref="CDD:234619"
     gene            66470..67039
                     /locus_tag="SSA_0064"
                     /db_xref="GeneID:4806650"
     CDS             66470..67039
                     /locus_tag="SSA_0064"
                     /note="GC: 45.44%; Codon Adaptation Index (CAI): 0.79.
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034078.1"
                     /db_xref="GeneID:4806650"
                     /translation="MMTEKEILDQLGQDPDIRAILEIIRSLELKDSWLAAGCVRNFIW
                     NLLSERPGFDSDTDVDVIFFDPSYAEAETIELEAKLKADWPQYRWELKNQAYMHHHSP
                     GTAPYKNACEAMSKYPERCTAIGLRLPENDKLELFAPYGLEDILNFQVRPTPHFLENK
                     ERQRVYAERLAKKNWQKRWPQLEYHYLDK"
     misc_feature    66533..67015
                     /locus_tag="SSA_0064"
                     /note="Nucleotidyltransferase; Region: NTP_transf_6;
                     pfam06042"
                     /db_xref="CDD:283655"
     gene            67315..67737
                     /locus_tag="SSA_0065"
                     /db_xref="GeneID:4807973"
     CDS             67315..67737
                     /locus_tag="SSA_0065"
                     /EC_number="3.1.3.48"
                     /function="Signal transduction mechanisms"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 44.68%; Codon Adaptation Index (CAI): 0.79.
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="low molecular weight phosphotyrosine protein
                     phosphatase"
                     /protein_id="YP_001034079.1"
                     /db_xref="GeneID:4807973"
                     /translation="MKKIVFVCLGNICRSPMAEFVMKSLTDQLKIESRATSSWEHGNP
                     IHRGTQAIFKKYAIAYDRDKTSQQISPADFADFDYIIGMDESNVRDLKRMAPEDFQHK
                     IYQFEEESVPDPWYTGDFDQTYDLVLAGCKKWLERLDG"
     misc_feature    67318..67722
                     /locus_tag="SSA_0065"
                     /note="Low molecular weight protein tyrosine phosphatase;
                     Region: LMWPTP; cd16343"
                     /db_xref="CDD:319971"
     misc_feature    order(67336..67359,67432..67434,67651..67653,67657..67659)
                     /locus_tag="SSA_0065"
                     /note="active site"
                     /db_xref="CDD:319971"
     gene            67742..68155
                     /locus_tag="SSA_0066"
                     /db_xref="GeneID:4807654"
     CDS             67742..68155
                     /locus_tag="SSA_0066"
                     /function="Function unknown"
                     /note="GC: 44.2%; Transmembrane domains: 1. Codon
                     Adaptation Index (CAI): 0.79. Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034080.1"
                     /db_xref="GeneID:4807654"
                     /translation="MDKVKEFYNEYKVYLTRQNLELLAVTVIVLSAILVFTSGIPGKG
                     VLTLDQGKIKYDGTLVRGKMNGQGTMTFQNGDSYTGQFRNGIFDGKGTFTSQAGWKYE
                     GDFSKGQADGQGKLTTEGNVVYEGTFKQGIYQNAH"
     misc_feature    67742..68143
                     /locus_tag="SSA_0066"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG4642"
                     /db_xref="CDD:226989"
     misc_feature    67904..67972
                     /locus_tag="SSA_0066"
                     /note="MORN repeat; Region: MORN; pfam02493"
                     /db_xref="CDD:280628"
     gene            68145..69950
                     /locus_tag="SSA_0067"
                     /db_xref="GeneID:4808054"
     CDS             68145..69950
                     /locus_tag="SSA_0067"
                     /function="Lipid metabolism"
                     /note="GC: 45.96%; Transmembrane domains: 12. Codon
                     Adaptation Index (CAI): 0.782. Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase"
                     /protein_id="YP_001034081.1"
                     /db_xref="GeneID:4808054"
                     /translation="MRIKWFSLVRITGLLLVLLYHYFQGVFPGGFIGVDIFFTFSGFL
                     ITALLIDEFAKKKEIDIQGFFRRRFYRIVPPLVFMILVVMPFTFLIRKDFVAGIGTQI
                     AAALGFVTNFYEMLSGGNYESQFVPHILIHTWSLALEVHYYVLWGLAAWGLGKVAKST
                     ARYRGMIALVSAGLFLLSFVSMFAGALTTKNYSDIYFSSLTHVFPFFAGSILATLSGV
                     GHVSNRFKMLEQKLALKQVLGIMGGSAAVLLLLSFLLKFDNLWTYLVGFLISTILACL
                     MILAARMLHDKLPDVKEPSLINFIADTSYGVYLFHWPFYIIFTQLMSNGLAVLLTTLL
                     SLTFAALSFYILEPTLAGRQPVIMGTKMDLSSLTRPIFYSMIPLTLIMFFISVTAPKV
                     GAFEESLIVNALNQVDNKMQTTRSQVDQSKATEYNVADGITMIGDSVALRSSDQLQQI
                     LPGIELDTVVSRSLSTGLEVYKTDIANRVLKKQVVLALGTNSSGYSNELLDEYVSSLP
                     KGHQLILVTPYDGRSEGGVLAQQREYELELAKKYDYVFVADWHQTAIENPQIWEGTDY
                     VHFGSNSESIIEGGTLYANTIKQAIDEANSGNVKP"
     misc_feature    68145..69182
                     /locus_tag="SSA_0067"
                     /note="Peptidoglycan/LPS O-acetylase OafA/YrhL, contains
                     acyltransferase and SGNH-hydrolase domains [Cell
                     wall/membrane/envelope biogenesis]; Region: OafA; COG1835"
                     /db_xref="CDD:224748"
     misc_feature    68151..69110
                     /locus_tag="SSA_0067"
                     /note="Acyltransferase family; Region: Acyl_transf_3;
                     pfam01757"
                     /db_xref="CDD:280013"
     misc_feature    69435..69917
                     /locus_tag="SSA_0067"
                     /note="SGNH_hydrolase, or GDSL_hydrolase, is a diverse
                     family of lipases and esterases. The tertiary fold of the
                     enzyme is substantially different from that of the
                     alpha/beta hydrolase family and unique among all known
                     hydrolases; its active site closely...; Region:
                     SGNH_hydrolase; cl01053"
                     /db_xref="CDD:294667"
     misc_feature    order(69456..69458,69528..69530,69615..69617,69837..69839,
                     69846..69848)
                     /locus_tag="SSA_0067"
                     /note="active site"
                     /db_xref="CDD:238141"
     misc_feature    order(69456..69458,69837..69839,69846..69848)
                     /locus_tag="SSA_0067"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238141"
     misc_feature    order(69456..69458,69528..69530,69615..69617)
                     /locus_tag="SSA_0067"
                     /note="oxyanion hole [active]"
                     /db_xref="CDD:238141"
     gene            70254..72908
                     /gene="adhE"
                     /locus_tag="SSA_0068"
                     /db_xref="GeneID:4808056"
     CDS             70254..72908
                     /gene="adhE"
                     /locus_tag="SSA_0068"
                     /EC_number="1.1.1.1"
                     /function="Energy production and conversion"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 45.69%; Codon Adaptation Index (CAI): 0.794.
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional acetaldehyde-CoA/alcohol
                     dehydrogenase"
                     /protein_id="YP_001034082.1"
                     /db_xref="GeneID:4808056"
                     /translation="MAEKKKTVEQEDKALAAQKHVDELVQKGLVALEEMRKLNQEQVD
                     YIVAKASVAALDAHGELALHAYEETGRGVFEDKATKNLFACEHVVNNMRHTKTVGVIE
                     EDDVTGLTLIAEPVGVVCGITPTTNPTSTAIFKALISLKTRNPIIFAFHPSAQESSAH
                     AAQIVRDAAIAAGAPENCVQWITQPSMEATSALMNHEGIATILATGGNAMVKAAYSCG
                     KPALGVGAGNVPAYVEKSANIRQAAHDIVMSKSFDNGMVCASEQAVIIDKEVYDEFVE
                     EFKSYHTYFVNKKEKALLEEFCFGAKANSKNCAGAKLNPDIVGKPATWIAEQAGFSVP
                     EDTNILAAECKEVGEKEPLTREKLSPVIAVLKSESREDGIEKARQMVEFHGLGHSAAI
                     HTADEELTKEFGKAVRAIRVICNSPSTFGGIGDVYNAFLPSLTLGCGSYGRNSVGDNV
                     SAVNLLNIKKVGRRRNNMQWMKLPSKTYFERDSIQYLQKCRDVERVMIVTDHAMVELG
                     FLDRIIEQLDLRRNKVVYQIFADVEPDPDITTVERGTEIMRTFKPDTIIALGGGSPMD
                     AAKVMWLFYEQPEVDFRDLVQKFMDIRKRAFKFPLLGKKTKFIAIPTTSGTGSEVTPF
                     AVISDKANNRKYPIADYSLTPTVAIVDPALVLTVPGFVAADTGMDVLTHATEAYVSQM
                     ASDFTDGLALQAIKLVFENLESSVKNADFHSREKMHNASTIAGMAFANAFLGISHSMA
                     HKIGAQFHTIHGRTNAILLPYVIRYNGTRPAKTATWPKYNYYRADEKYQDIARMLGLP
                     ASTPEEGVESFAKAVYELGERVGIEMNFKAQGIDEKEWKEHSRELAFLAYEDQCSPAN
                     PRLPMVDHMQEIIEDAYYGYKERPGRRK"
     misc_feature    70275..72872
                     /gene="adhE"
                     /locus_tag="SSA_0068"
                     /note="bifunctional acetaldehyde-CoA/alcohol
                     dehydrogenase; Provisional; Region: PRK13805"
                     /db_xref="CDD:237515"
     misc_feature    70314..71645
                     /gene="adhE"
                     /locus_tag="SSA_0068"
                     /note="Coenzyme A acylating aldehyde dehydrogenase (ACDH),
                     ALDH family 20-like; Region: ALDH_F20_ACDH; cd07122"
                     /db_xref="CDD:143440"
     misc_feature    71025..71027
                     /gene="adhE"
                     /locus_tag="SSA_0068"
                     /note="putative catalytic cysteine [active]"
                     /db_xref="CDD:143440"
     misc_feature    71673..72863
                     /gene="adhE"
                     /locus_tag="SSA_0068"
                     /note="C-terminal alcohol dehydrogenase domain of the
                     acetaldehyde dehydrogenase-alcohol dehydrogenase
                     bifunctional two-domain protein (AAD); Region: AAD_C;
                     cd08178"
                     /db_xref="CDD:173937"
     misc_feature    order(71754..71756,71934..71942,71949..71951,71958..71960,
                     72090..72095,72099..72101,72156..72161,72213..72215,
                     72237..72239,72258..72260,72270..72272,72462..72464,
                     72474..72476,72504..72506)
                     /gene="adhE"
                     /locus_tag="SSA_0068"
                     /note="putative active site [active]"
                     /db_xref="CDD:173937"
     misc_feature    order(72258..72260,72270..72272,72462..72464,72504..72506)
                     /gene="adhE"
                     /locus_tag="SSA_0068"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:173937"
     gene            73177..73857
                     /locus_tag="SSA_0069"
                     /db_xref="GeneID:4808101"
     CDS             73177..73857
                     /locus_tag="SSA_0069"
                     /note="GC: 46.55%; Transmembrane domains: 6. Codon
                     Adaptation Index (CAI): 0.723. Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034083.1"
                     /db_xref="GeneID:4808101"
                     /translation="MIFLSLWAGLLSGLCWLLGDILLVGFEVNKKSYASFTEQSRIGN
                     KKLAMLMLSGSVGRLRLGALVANFSIPLMLVSLYALFGLTNKGLWSYLSITLLGIGFS
                     LSPVAHVAFYYVGLISKKAYKRSGGQVCSDEDSGLINEAVLFLDITWRTAIALTGLGW
                     LVYSLLIVAGQTILPAYLGLLTPLPLSLLTILLVEKLRIGRPYLNGAGLNIGFSLFYL
                     LLLLHIGS"
     gene            73973..74974
                     /gene="axe1"
                     /locus_tag="SSA_0070"
                     /db_xref="GeneID:4807921"
     CDS             73973..74974
                     /gene="axe1"
                     /locus_tag="SSA_0070"
                     /EC_number="3.1.1.41"
                     /function="Secondary metabolites biosynthesis, transport,
                     and catabolism"
                     /note="GC: 43.81%; Codon Adaptation Index (CAI): 0.796.
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="acetylxylan esterase"
                     /protein_id="YP_001034084.1"
                     /db_xref="GeneID:4807921"
                     /translation="MKNPTLLKEMLDYRGRDEMPDDFDTFWDKQVVEVEVPQDYQLLE
                     KDFQIAYATCYELTFKTGNGGQIYAKLVVPKLSEKVPVLFHFHGYMGQGWAWADMLAY
                     TAAGWGVVSMDVRGQSGYSLDGNREVRGNTVKGHIIRGALDGPDQLFFKDVYLDVYTL
                     VELVAGLDFVDENRLSSFGGSQGGALALVAAALNSRIKQTVAIYPFLADFRRVLEIGN
                     TSEAYDELFRYFKFHDPFHETEEQLLRTLAYIDVKNLAHRISCPVQMIIGLEDDVCYP
                     ITQFAIYNRLAGEKEYHLLPEYGHEAMNVRVSDTVFNWLCGTKIKRLSLISDFKSER"
     misc_feature    73991..74923
                     /gene="axe1"
                     /locus_tag="SSA_0070"
                     /note="Acetyl xylan esterase (AXE1); Region: AXE1;
                     pfam05448"
                     /db_xref="CDD:283177"
     misc_feature    74093..>74329
                     /gene="axe1"
                     /locus_tag="SSA_0070"
                     /note="alpha/beta hydrolases; Region: Abhydrolase;
                     cl21494"
                     /db_xref="CDD:304388"
     misc_feature    74213..74872
                     /gene="axe1"
                     /locus_tag="SSA_0070"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_5;
                     pfam12695"
                     /db_xref="CDD:289465"
     misc_feature    <74594..>74785
                     /gene="axe1"
                     /locus_tag="SSA_0070"
                     /note="Protein Kinases, catalytic domain; Region:
                     PKc_like; cl21453"
                     /db_xref="CDD:304357"
     gene            75350..76048
                     /gene="nanE"
                     /locus_tag="SSA_0071"
                     /db_xref="GeneID:4807828"
     CDS             75350..76048
                     /gene="nanE"
                     /locus_tag="SSA_0071"
                     /EC_number="5.1.3.9"
                     /function="Carbohydrate transport and metabolism"
                     /note="Converts N-acetylmannosamine-6-phosphate to
                     N-acetylglucosamine-6-phosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmannosamine-6-phosphate 2-epimerase"
                     /protein_id="YP_001034085.1"
                     /db_xref="GeneID:4807828"
                     /translation="MSQILKDDLIAKIKDGIIVSCQALPQEPLYTEAGGVIPLLVKAA
                     EQGGAVGIRANSVRDIREIKEVTSLPIIGIIKRDYPPQEPFITATMREVDELAALDIE
                     VIALDCTKRERHDGLTVADFIKQVKVKYPHQLLMADISTYEEAAAAVEAGVDFVGTTL
                     SGYTSYSPKVDGPDIELIRRLCQAGFDVIAEGKIHYPSQAKQIHDLGVRGIVVGGAIT
                     RPKEITERFVAGLK"
     misc_feature    75383..76045
                     /gene="nanE"
                     /locus_tag="SSA_0071"
                     /note="N-acetylmannosamine-6-phosphate 2-epimerase;
                     Provisional; Region: PRK01130"
                     /db_xref="CDD:234907"
     misc_feature    order(75407..75409,75413..75415,75506..75508,75569..75571,
                     75575..75577,75668..75670,75761..75763,75824..75826,
                     75836..75838,75920..75928,75989..75991)
                     /gene="nanE"
                     /locus_tag="SSA_0071"
                     /note="putative active site cavity [active]"
                     /db_xref="CDD:240080"
     gene            76062..77195
                     /locus_tag="SSA_0072"
                     /db_xref="GeneID:4807545"
     CDS             76062..77195
                     /locus_tag="SSA_0072"
                     /function="Carbohydrate transport and metabolism"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 42.5%; Transporter classification TC:3.A.1.1.2.
                     Codon Adaptation Index (CAI): 0.776. Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter"
                     /protein_id="YP_001034086.1"
                     /db_xref="GeneID:4807545"
                     /translation="MTTLTLNKLYKKYPNSDFYSVENFDLDIKDKEFIVFVGPSGCGK
                     STTLRMIAGLEDITEGELYIDQNLVNDIAPKDRDIAMVFQNYALYPHMTVYDNMAFGL
                     KLRKYDKADIDKRVQEAAEILGLKELLDRKPADLSGGQRQRVAMGRAIVRDAKVFLMD
                     EPLSNLDAKLRVSMRAEIAKIHRRIGATTIYVTHDQTEAMTLADRIVIMSATKNEAGT
                     GTIGRIEQIGTPQELYNEPANKFVAGFIGSPAMNFFEVNLEGDQLTDGQGFAVGLPDG
                     QRKILEEKGYQGKKVILGIRPEDISAELIAADAFPDSVVEAEIIVSELLGSDSILYCK
                     VGVQEFSARVAAHNYHEAGQKINLVFNIAKAHFFELENGSRIK"
     misc_feature    76062..77189
                     /locus_tag="SSA_0072"
                     /note="glycerol-3-phosphate transporter ATP-binding
                     subunit; Provisional; Region: ugpC; PRK11650"
                     /db_xref="CDD:236947"
     misc_feature    76071..76745
                     /locus_tag="SSA_0072"
                     /note="The N-terminal ATPase domain of the maltose
                     transporter, MalK; Region: ABC_MalK_N; cd03301"
                     /db_xref="CDD:213268"
     misc_feature    76173..76196
                     /locus_tag="SSA_0072"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213268"
     misc_feature    order(76182..76187,76191..76199,76311..76313,76539..76544,
                     76641..76643)
                     /locus_tag="SSA_0072"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213268"
     misc_feature    76302..76313
                     /locus_tag="SSA_0072"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213268"
     misc_feature    76467..76496
                     /locus_tag="SSA_0072"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213268"
     misc_feature    76527..76544
                     /locus_tag="SSA_0072"
                     /note="Walker B; other site"
                     /db_xref="CDD:213268"
     misc_feature    76551..76562
                     /locus_tag="SSA_0072"
                     /note="D-loop; other site"
                     /db_xref="CDD:213268"
     misc_feature    76629..76649
                     /locus_tag="SSA_0072"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213268"
     misc_feature    76938..77165
                     /locus_tag="SSA_0072"
                     /note="TOBE domain; Region: TOBE_2; pfam08402"
                     /db_xref="CDD:285587"
     gene            77219..77671
                     /locus_tag="SSA_0073"
                     /db_xref="GeneID:4807499"
     CDS             77219..77671
                     /locus_tag="SSA_0073"
                     /note="GC: 31.13%; Codon Adaptation Index (CAI): 0.778.
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034087.1"
                     /db_xref="GeneID:4807499"
                     /translation="MIVTEINNLSTYVGVNPYFERLINFLKTVDLGSLPEGKIDIEGD
                     KLFGNCFSYVADGQPGDFFETHRKYLDIHLVLENTEDMAVSSVKSTTVSQPYNKEKDI
                     ELYEGKVEQLIHLKSGECLITFPEDLHQPKVRVNDLPLKKVVFKVAIS"
     misc_feature    77219..77629
                     /locus_tag="SSA_0073"
                     /note="Domain of unknown function (DUF386); Region:
                     DUF386; cl01047"
                     /db_xref="CDD:321314"
     gene            77689..79035
                     /locus_tag="SSA_0074"
                     /db_xref="GeneID:4808097"
     CDS             77689..79035
                     /locus_tag="SSA_0074"
                     /function="Carbohydrate transport and metabolism"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 36.15%; Transporter classification
                     TC:3.A.1.1.21. Transmembrane domains: 1. Codon Adaptation
                     Index (CAI): 0.807. LipoP prediction: SpII. SignalP
                     prediction: Yes (prob. 1); Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="YP_001034088.1"
                     /db_xref="GeneID:4808097"
                     /translation="MKNLKKFLFVLLTGLVALIISGCSPSGENSKGNDSGELSGEIVM
                     WHSFTQGPRLESIQKSADEFMKKHPKVKIKIETFSWNDFYTKWTTGLANGNVPDVSTA
                     LPNQVMEMINSDAIVPLNDTIDKIGKDRFNKTALNEAKIGSDYYSVPLYSHAQVMWVR
                     TDLLKQHNIEVPKTWDELYEASKKLTADGVYGMSVPLGTNDFMATRFLNFYVRSAGGS
                     LLTKDKKVDLTSDLAQEGIKYWVKMYKDVSPKDSLNYNVLQQATLFYQGKTAFDFNSG
                     FHIGGVEANSPQLLESIDAYPIPKVKASDKDQGIETSNVPMVVWKNSKHPEVAKAFLE
                     YLYEQDNYVGFLDSTPVGMLPTISGISDLPAYKENETRQKFQHAEQVINEAVQKGTAI
                     GYENGPSVEAGMLTNQHIIEQMFQDIITNGKDPMAAAKDAEKQLNDLFETVAVDVK"
     misc_feature    77809..78996
                     /locus_tag="SSA_0074"
                     /note="The periplasmic-binding component of ABC transport
                     systems specific for trehalose/maltose and similar
                     oligosaccharides; possess type 2 periplasmic binding fold;
                     Region: PBP2_TMBP_like; cd13585"
                     /db_xref="CDD:270303"
     misc_feature    order(78139..78141,78145..78147,78511..78513,78517..78519,
                     78625..78633,78775..78777)
                     /locus_tag="SSA_0074"
                     /note="chemical substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:270303"
     gene            79103..79987
                     /locus_tag="SSA_0075"
                     /db_xref="GeneID:4807406"
     CDS             79103..79987
                     /locus_tag="SSA_0075"
                     /function="Carbohydrate transport and metabolism"
                     /note="GC: 37.97%; Transporter classification
                     TC:3.A.1.1.19. Transmembrane domains: 6. Codon Adaptation
                     Index (CAI): 0.772. SignalP prediction: Yes (prob. 0.555);
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="YP_001034089.1"
                     /db_xref="GeneID:4807406"
                     /translation="MVRDRNLTRWIFVLPAVIIVGLLFVYPFFSSIFYSFTNKNLIMP
                     NYRFVGLDNYKAVLSDPNFFSAFFNSIKWTVLSLAGQVIIGFVLALALHRVRRFKKLY
                     RTLLIVPWAFPTIVIAFSWQWILNGVYGYLPNIIVKLGLMEHAPAFLTDSTWAFICLV
                     FINIWFGAPMIMVNVLSALQTVPQEQFEAAKIDGATSWQVFRHITFPHIKVVVGLLVV
                     LRTVWIFNNFDIIYLITGGGPSNATMTLPIFAYNLGWGTKLLGRASAVTVLLFIFLLT
                     VCFIYFSVISKWEKEGRK"
     misc_feature    79103..79981
                     /locus_tag="SSA_0075"
                     /note="ABC-type sugar transport system, permease component
                     [Carbohydrate transport and metabolism]; Region: UgpA;
                     COG1175"
                     /db_xref="CDD:224096"
     misc_feature    order(79349..79354,79361..79366,79379..79381,79406..79417,
                     79421..79450,79457..79462,79466..79468,79592..79597,
                     79604..79606,79610..79612,79619..79624,79628..79630,
                     79640..79645,79652..79654,79703..79705,79745..79750,
                     79757..79759,79778..79789,79796..79801,79841..79846,
                     79877..79882,79889..79894,79898..79903,79910..79915,
                     79922..79927)
                     /locus_tag="SSA_0075"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(79424..79468,79778..79795)
                     /locus_tag="SSA_0075"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(79466..79468,79577..79579,79796..79798,79835..79837,
                     79844..79846,79877..79879)
                     /locus_tag="SSA_0075"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(79655..79693,79709..79714,79724..79726)
                     /locus_tag="SSA_0075"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            79987..80820
                     /locus_tag="SSA_0076"
                     /db_xref="GeneID:4806573"
     CDS             79987..80820
                     /locus_tag="SSA_0076"
                     /function="Carbohydrate transport and metabolism"
                     /note="GC: 36.81%; Transporter classification
                     TC:3.A.1.1.17. Transmembrane domains: 6. Codon Adaptation
                     Index (CAI): 0.735. Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="YP_001034090.1"
                     /db_xref="GeneID:4806573"
                     /translation="MKKKSNFYLDIGAHLVLIIATIVAIFPLVWIIISSIKGKGELTQ
                     FPTRFWPQTFTLDYFTHVINDLHFVDNIRNSLVISLSTTVIATIISSMAAYGIVRFFP
                     KLGAIMSRLLVTTYIFPPILLAIPYSIAIAKAGLGNSIIGLIIIYLSFSVPYAVWLLV
                     GFFQTVPIGIEEAARIDGANKFVTFYKVVLPIVAPGIVATAIYTFINAWNEFLYALIL
                     INDTSKMTVAVALRSLNGSEVLDWGDMMAASVIVVLPSIIFFSIIQNKIASGLSEGSV
                     K"
     misc_feature    79987..80817
                     /locus_tag="SSA_0076"
                     /note="ABC-type glycerol-3-phosphate transport system,
                     permease component [Carbohydrate transport and
                     metabolism]; Region: UgpE; COG0395"
                     /db_xref="CDD:223472"
     gene            80878..81981
                     /locus_tag="SSA_0077"
                     /db_xref="GeneID:4806544"
     CDS             80878..81981
                     /locus_tag="SSA_0077"
                     /EC_number="1.-.-.-"
                     /function="General function prediction only"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 39.4%; Codon Adaptation Index (CAI): 0.816.
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="YP_001034091.1"
                     /db_xref="GeneID:4806544"
                     /translation="MVKYGVVGTGYFGAELARYMQKNDGAEITIVYDPENAEAVAEEL
                     GAKVAASIDELVASDEVDCVIVASPNNLHKEPVIKAAQHGKNVFCEKPIALSYEDCRE
                     MVDACKENNVTFMAGHIMNFFNGVHHAKELINQGVIGDVLYCHTARNGWEEQQPSVSW
                     KKIREKSGGHLYHHIHELDCVQFLMGGMPETVTMTGGNVAHEGENFGDEDDMIFVNME
                     FSNKRFALLEWGSAYRWGEHYVLIQGTKGAIRLDLFNCKGTLKLDGQESYFLIHESQE
                     EDDDRTRIYHSTEMDGAIAYGKPGKRTPLWLSSVIDKEMRYLHEIMQGAPVTEEFKKL
                     LTGEAALEAIATADACTQSMFEDRKVKLSEIVK"
     misc_feature    80878..81969
                     /locus_tag="SSA_0077"
                     /note="Predicted dehydrogenase [General function
                     prediction only]; Region: MviM; COG0673"
                     /db_xref="CDD:223745"
     gene            82044..82961
                     /locus_tag="SSA_0078"
                     /db_xref="GeneID:4806817"
     CDS             82044..82961
                     /locus_tag="SSA_0078"
                     /EC_number="4.1.3.3"
                     /function="Amino acid transport and metabolism / Cell
                     envelope biogenesis, outer membrane"
                     /note="GC: 46.51%; Codon Adaptation Index (CAI): 0.782.
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylneuraminate lyase"
                     /protein_id="YP_001034092.1"
                     /db_xref="GeneID:4806817"
                     /translation="MSDLKKYQGVIPAFYACYDEEGEISPERTRALVEYFIAKGVQGL
                     YVNGSSGECIYLSVEDRKRVLEEVMKVAKGRLTIIAHVACNNTKDSVELARHAESLGV
                     DAIAAIPPIYFRLPEYSVAQYWNDISAAAPNTDFVIYNIPQLAGVALTPSLYKEMLKN
                     ERVIGVKNSSMPVQDIQTFVALGGEDHVVFNGPDEQFLGGRLMGAAAGIGGTYGAMPE
                     LFLKLNQLIADKELERAKELQYAINAIIGKLTSARGNMYAVIKGVLEINEGLTIGSVR
                     SPLTPLQESDRPIVEEAAQLIRQTKEQFL"
     misc_feature    82062..82931
                     /locus_tag="SSA_0078"
                     /note="TIM barrel proteins share a structurally conserved
                     phosphate binding motif and in general share an eight
                     beta/alpha closed barrel structure. Specific for this
                     family is the conserved phosphate binding site at the
                     edges of strands 7 and 8. The phosphate...; Region:
                     TIM_phosphate_binding; cl21457"
                     /db_xref="CDD:304361"
     misc_feature    82542..82544
                     /locus_tag="SSA_0078"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:188634"
     gene            82995..83879
                     /gene="glk"
                     /locus_tag="SSA_0079"
                     /db_xref="GeneID:4806739"
     CDS             82995..83879
                     /gene="glk"
                     /locus_tag="SSA_0079"
                     /EC_number="2.7.1.60"
                     /function="Transcription / Carbohydrate transport and
                     metabolism"
                     /note="GC: 46.67%; Codon Adaptation Index (CAI): 0.804.
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="ROK family protein"
                     /protein_id="YP_001034093.1"
                     /db_xref="GeneID:4806739"
                     /translation="MKHYVAIDIGGTNIKYGLINEAETLVEAHEMPTEAHKGGPGILQ
                     KVEGIVAAYLEKGALVGICISSAGMVDPDKGEIFYAGPQIPNYAGTQFKKVLEEKFSL
                     PCEIENDVNCAGLAEAMSGSGKGAKIALCLTIGTGIGGCLVVDGQVFHGFSNSACEVG
                     YLHLPDGAFQDVASTTALVNYVAELHGEDAEHWNGRRIFKEATEGNKLCIEGIDRMVG
                     YLGQGIANICYVVNPEVVILGGGIMGQEAILRPRIQAALQDALVPSIADKTKLAFAHH
                     QNTAGMFGAYYHFKNRQV"
     misc_feature    82995..83870
                     /gene="glk"
                     /locus_tag="SSA_0079"
                     /note="Sugar kinase of the NBD/HSP70 family, may contain
                     an N-terminal HTH domain [Transcription, Carbohydrate
                     transport and metabolism]; Region: NagC; COG1940"
                     /db_xref="CDD:224851"
     misc_feature    83007..83864
                     /gene="glk"
                     /locus_tag="SSA_0079"
                     /note="Nucleotide-Binding Domain of the sugar
                     kinase/HSP70/actin superfamily; Region:
                     NBD_sugar-kinase_HSP70_actin; cl17037"
                     /db_xref="CDD:302596"
     misc_feature    order(83016..83027,83031..83033,83037..83039,83319..83321,
                     83391..83402)
                     /gene="glk"
                     /locus_tag="SSA_0079"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212657"
     gene            83925..84254
                     /gene="blpT"
                     /locus_tag="SSA_0080"
                     /db_xref="GeneID:4805929"
     CDS             83925..84254
                     /gene="blpT"
                     /locus_tag="SSA_0080"
                     /note="GC: 40%; Codon Adaptation Index (CAI): 0.781.
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="superfamily I DNA/RNA helicase"
                     /protein_id="YP_001034094.1"
                     /db_xref="GeneID:4805929"
                     /translation="MAERSFIQEAAQLLGSLMEDFQKKTIQSSDEIRFYECLAEVLRS
                     LEKTKALDNRLLIALESFHKSASFLIGLSSLKLDQSTYQKWRAYDAFHLEKIQPQLEI
                     YGPILPL"
     gene            complement(84310..85161)
                     /locus_tag="SSA_0081"
                     /db_xref="GeneID:4808096"
     CDS             complement(84310..85161)
                     /locus_tag="SSA_0081"
                     /function="Transcription"
                     /note="GC: 42.72%; Transmembrane domains: 1. Codon
                     Adaptation Index (CAI): 0.765. Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="RpiR family transcriptional regulator"
                     /protein_id="YP_001034095.1"
                     /db_xref="GeneID:4808096"
                     /translation="MSQQNILAIIESHLDKMTDLEQRIGHYFLDPNSIQEDLSSLQVA
                     QTLHISQAALTRFAKKCGFKGYREFSFQYLQDLQKAQTEADNMPSSLSRHVLYNYNQI
                     HQQTKELIDEEKLERVAQIIEEADRVYFFGTGSSGLVARDMKLRFMRLGVVCEALTDQ
                     DGFAWTTSILDKNCLVIGFSLSGQTQSIIDSLIDAKNMGAKTILVTGQPEKIQEDFTE
                     VVPVALQSKPEFILRISAQFPMLLMIDLIYAFFLEINREKKERIFNSFWENQKLNGYY
                     RRNIHKR"
     misc_feature    complement(84376..85158)
                     /locus_tag="SSA_0081"
                     /note="DNA-binding transcriptional regulator, MurR/RpiR
                     family, contains HTH and SIS domains [Transcription];
                     Region: RpiR; COG1737"
                     /db_xref="CDD:224651"
     misc_feature    complement(84925..85149)
                     /locus_tag="SSA_0081"
                     /note="Helix-turn-helix domain, rpiR family; Region:
                     HTH_6; pfam01418"
                     /db_xref="CDD:279726"
     misc_feature    complement(84412..84825)
                     /locus_tag="SSA_0081"
                     /note="RpiR-like protein. RpiR contains a SIS (Sugar
                     ISomerase) domain, which is found in many phosphosugar
                     isomerases and phosphosugar binding proteins. In E. coli,
                     rpiR negatively regulates the expression of rpiB gene.
                     Both rpiB and rpiA are ribose phosphate...; Region:
                     SIS_RpiR; cd05013"
                     /db_xref="CDD:240144"
     misc_feature    complement(order(84622..84624,84754..84756))
                     /locus_tag="SSA_0081"
                     /note="putative active site [active]"
                     /db_xref="CDD:240144"
     gene            85577..85900
                     /locus_tag="SSA_0083"
                     /db_xref="GeneID:4805776"
     CDS             85577..85900
                     /locus_tag="SSA_0083"
                     /note="GC: 49.07%; Codon Adaptation Index (CAI): 0.75.
                     Helix-turn-helix prediction: AraC. Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034096.1"
                     /db_xref="GeneID:4805776"
                     /translation="MANETLEKMQEIETAAEEVLMGYRTQTQELRQQVDEDLRQLALT
                     YDNETQKLAEELTASSQQKLVLLQQDLEQTTQQNEDKVAAALTDKKADLARAIVEKVV
                     EAYGH"
     gene            85890..87845
                     /gene="ntpI"
                     /locus_tag="SSA_0085"
                     /db_xref="GeneID:4807323"
     CDS             85890..87845
                     /gene="ntpI"
                     /locus_tag="SSA_0085"
                     /EC_number="3.6.3.14"
                     /function="Energy production and conversion"
                     /note="Produces ATP from ADP in the presence of a proton
                     gradient across the membrane. Subunit I is part of the
                     membrane proton channel."
                     /codon_start=1
                     /transl_table=11
                     /product="V-type ATP synthase subunit I"
                     /protein_id="YP_001034097.1"
                     /db_xref="GeneID:4807323"
                     /translation="MAISQMRQLSLLLPKELLDQLLFYLQGLESVQIHDLRQEEDWQA
                     AFEQALVGRPDQHLSQQDLLSRQEKLERLIAELEPFMPKKKLLESLKEEPLELSFAAL
                     EQAGKARDEEALLEGISKQLRVLQEAKEQIEADRLEVAALEKWEPLELTPQAAATFSH
                     LGALIGTIPNTDDDALRLTLGAHPDLKFQEVFTDDTEHGVLVLYKTGSLEEVRKILKE
                     YGFKPFEYDHEELPAERVAQLKANIRQQEAVAEALTESLAASKNELDQLKVQLDYLCN
                     LSSRQESKNQLASTQNLAALEGWIESNQVQALEACLTEQFGQSILIQVREIREDEEDK
                     VPTKLKNNALVEPFELVTEMYSLPKYGDKDPTPVVSLFYFVFFGMMVADIGYGLLLFV
                     GTSLALHFLHVKPGLAKNLRFFRLLGVAVIIWGLVYGSFFGFELPFALISTSSDAMTI
                     LVISVVFGFVTVLAGLFLSGLKNIRLKDYAEAYNAGFAWVLILLGLLLLALGNFFPSL
                     SFAATIGQWLAIINALGILAVSIVSAKSLAGLGSGLFNLYNVSGYVGDLVSFTRLMAL
                     GLSGASIGSAFNLIVSLFPPVARFSIGILLFIALHLVNMFLSFLSGYVHGARLIFVEF
                     FGKFYDGGGKPFTPLKPSEKYVQQSKK"
     misc_feature    85890..87830
                     /gene="ntpI"
                     /locus_tag="SSA_0085"
                     /note="V-type ATP synthase subunit I; Validated; Region:
                     PRK05771"
                     /db_xref="CDD:235600"
     misc_feature    <86523..>87062
                     /gene="ntpI"
                     /locus_tag="SSA_0085"
                     /note="V-type ATPase 116kDa subunit family; Region:
                     V_ATPase_I; pfam01496"
                     /db_xref="CDD:279793"
     misc_feature    87144..87296
                     /gene="ntpI"
                     /locus_tag="SSA_0085"
                     /note="Protein of unknown function (DUF2929); Region:
                     DUF2929; pfam11151"
                     /db_xref="CDD:288053"
     misc_feature    <87561..87806
                     /gene="ntpI"
                     /locus_tag="SSA_0085"
                     /note="V-type ATPase 116kDa subunit family; Region:
                     V_ATPase_I; pfam01496"
                     /db_xref="CDD:279793"
     gene            87979..88458
                     /gene="ntpK"
                     /locus_tag="SSA_0086"
                     /db_xref="GeneID:4807653"
     CDS             87979..88458
                     /gene="ntpK"
                     /locus_tag="SSA_0086"
                     /EC_number="3.6.3.14"
                     /note="produces ATP from ADP in the presence of a proton
                     gradient across the membrane; the K subunit is a
                     nonenzymatic component which binds the dimeric form by
                     interacting with the G and E subunits"
                     /codon_start=1
                     /transl_table=11
                     /product="V-type ATP synthase subunit K"
                     /protein_id="YP_001034098.1"
                     /db_xref="GeneID:4807653"
                     /translation="MEHLASYFGTYGGAFFAGLGVALAVFLSGMGSALGVGSTGQAAA
                     ALLKEQPEKFAQALILQLLPGTQGLYGFVIGITVFFNIKPELALQSGVAYFLAALPVA
                     IVGYFSAKHQGRVATAGIQILAKRPEEVMKGVILAAMVETYAILAFVVSFIMVLNVK"
     misc_feature    87979..88455
                     /gene="ntpK"
                     /locus_tag="SSA_0086"
                     /note="V-type ATP synthase subunit K; Validated; Region:
                     PRK06558"
                     /db_xref="CDD:235830"
     gene            88469..89059
                     /gene="ntpE"
                     /locus_tag="SSA_0087"
                     /db_xref="GeneID:4806364"
     CDS             88469..89059
                     /gene="ntpE"
                     /locus_tag="SSA_0087"
                     /EC_number="3.6.3.15"
                     /note="GC: 49.75%; Codon Adaptation Index (CAI): 0.772.
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="V-type sodium ATPase subunit E"
                     /protein_id="YP_001034099.1"
                     /db_xref="GeneID:4806364"
                     /translation="MSDISDLKASVLEQAHEKGRLLLAEATEKIEQEAKEREAQLVRQ
                     KLGQREQQLKEISRRSQRDIQQLENQKRQSTLVIKQRVLRELFEEAYAQMAAWSPAEE
                     EHFLKSVLAKYPEKELALTFGALSAEKFSSSQLEDLKRSFPQVHFSDQSIAGQAGFVL
                     SQGRVDDSYLYRDLLDSVWQEESYRLAQDIFKDQAE"
     misc_feature    88496..>88753
                     /gene="ntpE"
                     /locus_tag="SSA_0087"
                     /note="ATP synthase (E/31 kDa) subunit; Region:
                     vATP-synt_E; cl23750"
                     /db_xref="CDD:304907"
     gene            89070..90083
                     /gene="ntpC"
                     /locus_tag="SSA_0088"
                     /db_xref="GeneID:4807893"
     CDS             89070..90083
                     /gene="ntpC"
                     /locus_tag="SSA_0088"
                     /EC_number="3.6.3.15"
                     /function="Energy production and conversion"
                     /note="GC: 50%; Transporter classification TC:3.A.2.2.2.
                     Codon Adaptation Index (CAI): 0.77. Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="V-type sodium ATPase subunit C"
                     /protein_id="YP_001034100.1"
                     /db_xref="GeneID:4807893"
                     /translation="MSETSFSQVNTAISVQEASFLMPQQYDQLLQADDAASRSALLQG
                     TVYAMDAEAIKDLNAIEQVLMKHLYSVYNWALEISPSKELVEIFTLRYTYHNLKVFLK
                     GRATGQSLEHLLMPVGTYSLEVLEHLVMAFSAEYCPDFMLEEVLATWQEYQDYQDVRV
                     LEIGMDMAYFQHLKRLTQELEDESLLQLVNLTIDFYNAITVKRAVGLGKPRSFMRQLL
                     SDEGSLSAANWIAMAEQGDFLTWFSQINPCGYDLDLRSYEEKMRNQTLTTVELEYLAD
                     LLQAKLLAAGQFETDGPLPLARYLLGKELEVKNLRLILTGMDNQLPVELIRERMRPIY
                     GQD"
     misc_feature    89070..90068
                     /gene="ntpC"
                     /locus_tag="SSA_0088"
                     /note="Archaeal/vacuolar-type H+-ATPase subunit C/Vma6
                     [Energy production and conversion]; Region: NtpC; COG1527"
                     /db_xref="CDD:224444"
     misc_feature    89094..90050
                     /gene="ntpC"
                     /locus_tag="SSA_0088"
                     /note="ATP synthase (C/AC39) subunit; Region:
                     vATP-synt_AC39; pfam01992"
                     /db_xref="CDD:280216"
     gene            90070..90390
                     /gene="ntpG"
                     /locus_tag="SSA_0089"
                     /db_xref="GeneID:4806678"
     CDS             90070..90390
                     /gene="ntpG"
                     /locus_tag="SSA_0089"
                     /EC_number="3.6.3.14"
                     /function="Energy production and conversion"
                     /note="produces ATP from ADP in the presence of a proton
                     gradient across the membrane; the F subunit is part of the
                     catalytic core of the ATP synthase complex"
                     /codon_start=1
                     /transl_table=11
                     /product="V-type ATP synthase subunit F"
                     /protein_id="YP_001034101.1"
                     /db_xref="GeneID:4806678"
                     /translation="MDKTSYKIAVVGNRDTILPFKLIGFQTFPVKEAQETINTLRRLA
                     REDFGIIYLTEDMAADIPETLAYYDQLEIPALVLIPTHKGSTGLALSRIHENVEKAVG
                     QDIL"
     misc_feature    90076..90387
                     /gene="ntpG"
                     /locus_tag="SSA_0089"
                     /note="V-type ATP synthase subunit F; Provisional; Region:
                     PRK01395"
                     /db_xref="CDD:179293"
     gene            90398..91093
                     /locus_tag="SSA_0090"
                     /db_xref="GeneID:4806087"
     CDS             90398..91093
                     /locus_tag="SSA_0090"
                     /function="Translation, ribosomal structure and
                     biogenesis"
                     /note="GC: 48.85%; Codon Adaptation Index (CAI): 0.754.
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="YP_001034102.1"
                     /db_xref="GeneID:4806087"
                     /translation="MRINQLGQPIGDALPDFQPGDLPNLERIEGQYVIIERLSKDKHG
                     ADLYEVYGPDSPADMWTYLFQNPAQNQEEWSQKLEQMLAAQDRFHYAIVDKESGKTLG
                     TFALMRIDRNNRVIEVGAVTYSPKLKRTRLATEAQYLLARYVFEDLEYRRYEWKCDSL
                     NQPSRRAAERLGFTYEGRFRQAVVYKGRNRDTDWLSMIDKDWPIVKSRLEKWLSPDNF
                     NEKSQQIKALSDF"
     misc_feature    90497..91015
                     /locus_tag="SSA_0090"
                     /note="Protein N-acetyltransferase, RimJ/RimL family
                     [Translation, ribosomal structure and biogenesis,
                     Posttranslational modification, protein turnover,
                     chaperones]; Region: RimL; COG1670"
                     /db_xref="CDD:224584"
     misc_feature    90680..90919
                     /locus_tag="SSA_0090"
                     /note="Acetyltransferase (GNAT) family; Region:
                     Acetyltransf_1; pfam00583"
                     /db_xref="CDD:278980"
     gene            91177..93048
                     /gene="ntpA"
                     /locus_tag="SSA_0091"
                     /db_xref="GeneID:4806981"
     CDS             91177..93048
                     /gene="ntpA"
                     /locus_tag="SSA_0091"
                     /EC_number="3.6.3.14"
                     /function="Energy production and conversion"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="produces ATP from ADP in the presence of a proton
                     gradient across the membrane; the A subunit is part of the
                     catalytic core of the ATP synthase complex"
                     /codon_start=1
                     /transl_table=11
                     /product="V-type ATP synthase subunit A"
                     /protein_id="YP_001034103.1"
                     /db_xref="GeneID:4806981"
                     /translation="MKSKLLLSLLFDFHGEARKISQEWRKIVSQGKIIKVSGPLVLAS
                     GMQEANIQDICRVGDLGLIGEIIEMRRDQASIQVYEETSGLGPGEPVITTGSPLSVEL
                     GPGLISQMFDGIQRPLERFQTITASDFLVRGVQLPNLDREAKWDFVPGLSVGDAVEAG
                     DVLGTVQETNLVEHRIMVPVGVSGRLANISAGSFTVEETVYEIEQADGSVFKGTLMQK
                     WPVRRGRPFAQKLIPVEPLVTGQRVIDTFFPVTKGGAAAVPGPFGAGKTVVQHQVAKF
                     ANVDIVIYVGCGERGNEMTDVLNEFPELIDPTTGQSIMQRTVLIANTSNMPVAAREAS
                     IYTGITIAEYFRDMGYSVAIMADSTSRWAEALREMSGRLEEMPGDEGYPAYLGSRIAE
                     YYERAGRVKTLGSTAREGSITAIGAVSPPGGDISEPVTQNTLRIVKVFWGLDAQLAQR
                     RHFPAINWLSSYSLYLDEVGAYIDQHEKIAWAEKVTKAMNILQKESELQEIVRLVGLD
                     SLSEKDRLTMNAAKMIREDYLQQNAFDDVDTYTSFKKQVALLSNILTFDAEANRALEL
                     GAYFREIMEGTVELRDRIARSKFIHEDQLGKIQALSQTIEETLHQILAQGGLDNERH"
     misc_feature    91261..93021
                     /gene="ntpA"
                     /locus_tag="SSA_0091"
                     /note="V-type ATP synthase subunit A; Provisional; Region:
                     PRK04192"
                     /db_xref="CDD:235248"
     misc_feature    91273..91461
                     /gene="ntpA"
                     /locus_tag="SSA_0091"
                     /note="ATP synthase alpha/beta family, beta-barrel domain;
                     Region: ATP-synt_ab_N; pfam02874"
                     /db_xref="CDD:280947"
     misc_feature    91465..92571
                     /gene="ntpA"
                     /locus_tag="SSA_0091"
                     /note="V/A-type ATP synthase catalytic subunit A. These
                     ATPases couple ATP hydrolysis to the build up of a H+
                     gradient, but V-type ATPases do not catalyze the reverse
                     reaction. The Vacuolar (V-type) ATPase is found in the
                     membranes of vacuoles, the golgi...; Region: V_A-ATPase_A;
                     cd01134"
                     /db_xref="CDD:238554"
     misc_feature    91954..91977
                     /gene="ntpA"
                     /locus_tag="SSA_0091"
                     /note="Walker A motif/ATP binding site; other site"
                     /db_xref="CDD:238554"
     misc_feature    92233..92247
                     /gene="ntpA"
                     /locus_tag="SSA_0091"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238554"
     misc_feature    92635..>92838
                     /gene="ntpA"
                     /locus_tag="SSA_0091"
                     /note="ATP synthase alpha/beta chain, C terminal domain;
                     Region: ATP-synt_ab_C; pfam00306"
                     /db_xref="CDD:278722"
     gene            93035..94429
                     /gene="ntpB"
                     /locus_tag="SSA_0092"
                     /db_xref="GeneID:4807001"
     CDS             93035..94429
                     /gene="ntpB"
                     /locus_tag="SSA_0092"
                     /EC_number="3.6.3.14"
                     /function="Energy production and conversion"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="produces ATP from ADP in the presence of a proton
                     gradient across the membrane; the B subunit is part of the
                     catalytic core of the ATP synthase complex"
                     /codon_start=1
                     /transl_table=11
                     /product="V-type ATP synthase subunit B"
                     /protein_id="YP_001034104.1"
                     /db_xref="GeneID:4807001"
                     /translation="MSVIKEYRTVSEVVGPLMIVDQVAGVHFNELVEIQLHDGSKRQG
                     QVLEVQEDKAMVQLFEGSSGINLEKAKVRFTGRPLELPVSEDMVGRIFNGMGKPIDGG
                     PAILPEKYLDIDGQAINPVARDYPDEFIQTGISAIDHLNTLVRGQKLPVFSGSGLPHK
                     ELAAQIARQATVLNSDENFAVVFVAMGITFEEAEFFMNDLRETGAIDRSVLFINLAND
                     PAIERIATPRIALTAAEYLAYEKDMHVLVIMTDMTNYCEALREVSAARREVPGRRGYP
                     GYLYTNLSTLYERAGRLVGKKGSVTQIPILSMPEDDITHPIPDLTGYITEGQIILSRE
                     LYNSGYRPPINVLPSLSRLKDKGSGEGKTRGDHAATMNQLFAAYAQGKQAKELAVVLG
                     ESALSETDKLYVRFTDRFEQEYINQGFQTNRTIEESLDLGWELLSILPRTELKRIKDD
                     MIDQYLPQTKEEER"
     misc_feature    93044..94423
                     /gene="ntpB"
                     /locus_tag="SSA_0092"
                     /note="V-type ATP synthase subunit B; Provisional; Region:
                     PRK04196"
                     /db_xref="CDD:235251"
     misc_feature    93062..93262
                     /gene="ntpB"
                     /locus_tag="SSA_0092"
                     /note="ATP synthase alpha/beta family, beta-barrel domain;
                     Region: ATP-synt_ab_N; pfam02874"
                     /db_xref="CDD:280947"
     misc_feature    93266..94093
                     /gene="ntpB"
                     /locus_tag="SSA_0092"
                     /note="V/A-type ATP synthase (non-catalytic) subunit B.
                     These ATPases couple ATP hydrolysis to the build up of a
                     H+ gradient, but V-type ATPases do not catalyze the
                     reverse reaction. The Vacuolar (V-type) ATPase is found in
                     the membranes of vacuoles, the golgi...; Region:
                     V_A-ATPase_B; cd01135"
                     /db_xref="CDD:238555"
     misc_feature    93491..93514
                     /gene="ntpB"
                     /locus_tag="SSA_0092"
                     /note="Walker A motif homologous position; other site"
                     /db_xref="CDD:238555"
     misc_feature    93776..93787
                     /gene="ntpB"
                     /locus_tag="SSA_0092"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238555"
     misc_feature    94148..94423
                     /gene="ntpB"
                     /locus_tag="SSA_0092"
                     /note="ATP synthase alpha/beta chain, C terminal domain;
                     Region: ATP-synt_ab_C; pfam00306"
                     /db_xref="CDD:278722"
     gene            94426..95049
                     /gene="ntpD"
                     /locus_tag="SSA_0093"
                     /db_xref="GeneID:4807114"
     CDS             94426..95049
                     /gene="ntpD"
                     /locus_tag="SSA_0093"
                     /EC_number="3.6.3.14"
                     /note="produces ATP from ADP in the presence of a proton
                     gradient across the membrane; the D subunit is part of the
                     catalytic core of the ATP synthase complex"
                     /codon_start=1
                     /transl_table=11
                     /product="V-type ATP synthase subunit D"
                     /protein_id="YP_001034105.1"
                     /db_xref="GeneID:4807114"
                     /translation="MTRLNVKPTRMELNNLKARLKTAVRGHKLLKDKRDELMRRFIES
                     VRENNQLRQKVESALVGHLQDFVMAKALESDLMVEEIFAVPTREVNLHVETENIMSVR
                     VPKMHAHIDNPHTDDEGDVVYSYVASNSQMDETIESMSDLLPDLLRLAEIEKSCQLMA
                     DEIEKTRRRVNGLEYATIPDLKETIYYIEMKLEEAERASLVRMMKVK"
     misc_feature    94426..95046
                     /gene="ntpD"
                     /locus_tag="SSA_0093"
                     /note="V-type ATP synthase subunit D; Reviewed; Region:
                     PRK00373"
                     /db_xref="CDD:178991"
     gene            95485..96582
                     /locus_tag="SSA_0094"
                     /db_xref="GeneID:4807098"
     CDS             95485..96582
                     /locus_tag="SSA_0094"
                     /function="Function unknown"
                     /note="GC: 45.81%; Codon Adaptation Index (CAI): 0.791.
                     LipoP prediction: SpI. SignalP prediction: Yes (prob. 1);
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="cell wall metabolism, LysM type protein"
                     /protein_id="YP_001034106.1"
                     /db_xref="GeneID:4807098"
                     /translation="MKMNKKLLLASTVALSALPLLTTRAEEQPQNWTARTVEQIKADI
                     TSNENQQTYTVQYGDTLGNIAQAMNIDLVDLAKINQIANADLIFPGTVLTITTNGHNE
                     ITSVEIQSYQAGNNAGLVTEDYTASEIFGTEQAAPAAPAQAAETPAPTVEEAVAAPAD
                     QAPAPAEEAPAPVAEVASEAAPAAEANAAAPVEAAPQPAVAASSEAPAEAAPEATELG
                     QDQVSQATAAVEPTTYNAPAVTDAASVTTNNPANEGLQPQTAALKEEIAAKYGITEFS
                     LYRPGDSGDHGKGLAADFIVGDNTELGNQVAADVTSNMTERGISYVIWQQQFYAPFES
                     IYGPANTWNQMPDRGSVTENHYDHVHVSMNE"
     misc_feature    95635..95769
                     /locus_tag="SSA_0094"
                     /note="Lysine Motif is a small domain involved in binding
                     peptidoglycan; Region: LysM; cd00118"
                     /db_xref="CDD:212030"
     gene            96695..98179
                     /gene="thrC"
                     /locus_tag="SSA_0095"
                     /db_xref="GeneID:4806923"
     CDS             96695..98179
                     /gene="thrC"
                     /locus_tag="SSA_0095"
                     /EC_number="4.2.3.1"
                     /function="Amino acid transport and metabolism"
                     /note="catalyzes the formation of L-threonine from
                     O-phospho-L-homoserine"
                     /codon_start=1
                     /transl_table=11
                     /product="threonine synthase"
                     /protein_id="YP_001034107.1"
                     /db_xref="GeneID:4806923"
                     /translation="MTLVYQSTRDEKNRVTASQAILQGLATDGGLFTPITYPQVDLDF
                     AKLKDASYQEVAKLVLSAFLDDFSEAELDYCINHAYDSKFDDAAIAPLVKLDGQYNLE
                     LFHGATIAFKDMALSILPHLMTTAAKKHGLENKIVILTATSGDTGKAAMAGFADVPGT
                     EIIVFYPKDGVSKVQELQMTTQTGANTHVVAIDGNFDDAQTNVKRMFNDTDLRARLLE
                     HKLQFSSANSMNIGRLVPQIVYYVYAYAQLVKAGEIIAGDKVNFTVPTGNFGNILAAY
                     YAKQIGLPVGKLICASNENNVLTDFFKTHIYDKKRSFKVTSSPSMDILVSSNLERLIF
                     HLSGNSAEKTAALMAALNEHGQYELTDFDAEILELFAADYATEQETAAEIKRVYQASD
                     YIEDPHTAVASAVYQKYLAETGDQRKTVIASTASPYKFPVVAVEAVTGQTGLSDFEAL
                     DQLHELSGVALPPAVDGLETAPVRHKTTVAADQMQTAVEDYLGL"
     misc_feature    96707..98176
                     /gene="thrC"
                     /locus_tag="SSA_0095"
                     /note="threonine synthase; Validated; Region: PRK09225"
                     /db_xref="CDD:236418"
     misc_feature    96707..98122
                     /gene="thrC"
                     /locus_tag="SSA_0095"
                     /note="Threonine synthase catalyzes the final step of
                     threonine biosynthesis. The conversion of
                     O-phosphohomoserine into threonine and inorganic phosphate
                     is pyridoxal 5'-phosphate dependent. The Thr-synth_1 CD
                     includes members from higher plants, cyanobacteria;
                     Region: Thr-synth_2; cd01560"
                     /db_xref="CDD:107203"
     misc_feature    order(97028..97030,97493..97498,97964..97966)
                     /gene="thrC"
                     /locus_tag="SSA_0095"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:107203"
     misc_feature    97028..97030
                     /gene="thrC"
                     /locus_tag="SSA_0095"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:107203"
     gene            98288..99565
                     /gene="norN"
                     /locus_tag="SSA_0097"
                     /db_xref="GeneID:4807205"
     CDS             98288..99565
                     /gene="norN"
                     /locus_tag="SSA_0097"
                     /function="Defense mechanisms"
                     /note="GC: 51.64%; Transporter classification
                     TC:2.A.66.1.10. Transmembrane domains: 11. Codon
                     Adaptation Index (CAI): 0.747. Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="MATE family transporter"
                     /protein_id="YP_001034108.1"
                     /db_xref="GeneID:4807205"
                     /translation="MTTYKKIMNIALPAMAENFLQMLMGMVDSYLVASLGLIAISGVS
                     VAGNIITIYQAIFIALGAAISSLISKTLAQGDKERLAYHTAEAIKLTLLLSLLLGLIS
                     LLFGRQMLDLLGTEKAVAEAGGLYLALVGGTIVLLGLMTSFGALVRVTRNPRFPMYVS
                     LLTNVLNALFSGLGIYIFRLGIIGVALGTVLARLVGVLILWRELDLSTIRWRWSLDGE
                     LLRLSLPAAGERLMMRAGDVVIIAIVVVFGTDAVAGNAIGEVLTQFNYMPIFGVATAT
                     VMLVGHAIGEGDMQEVGLIRQRTFWLSFACMLPVALGIFAFGRPLTLLYTDNSGAITA
                     SLSVMLFSLLGTPMAVGTVIYTAIWQGLGNSRLPFYATTVGMWLIRIVVGYLLGVTFG
                     LGLPGVWTGMLLDNAFRWLFLKVLFDRKMRKIT"
     misc_feature    98297..99562
                     /gene="norN"
                     /locus_tag="SSA_0097"
                     /note="Na+-driven multidrug efflux pump [Defense
                     mechanisms]; Region: NorM; COG0534"
                     /db_xref="CDD:223608"
     misc_feature    98300..99556
                     /gene="norN"
                     /locus_tag="SSA_0097"
                     /note="Multidrug and toxic compound extrusion family and
                     similar proteins; Region: MATE_like; cl09326"
                     /db_xref="CDD:298879"
     gene            99562..100176
                     /locus_tag="SSA_0098"
                     /db_xref="GeneID:4807174"
     CDS             99562..100176
                     /locus_tag="SSA_0098"
                     /function="General function prediction only"
                     /note="GC: 45.85%; Codon Adaptation Index (CAI): 0.744.
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="HAD superfamily hydrolase"
                     /protein_id="YP_001034109.1"
                     /db_xref="GeneID:4807174"
                     /translation="MIKAFIWDLDGTLLDSYDAILAGIEETYTHYGLDFDRASIHSYI
                     LKHSVQKLLEEVASEKGLDAADMNAFRGASLKEKNAQVHLMEGTAEILAWAEEQGIAQ
                     FVYTHKGLNAHQILRDLGIYDYFTEIITTANGFERKPHPEGVDYLIEKYGLDKQETYY
                     IGDRTLDVDVAANSGIQSINFCDYRPEINQKIEKLMVIKQLFTR"
     misc_feature    99562..100167
                     /locus_tag="SSA_0098"
                     /note="Phosphoglycolate phosphatase, HAD superfamily
                     [Energy production and conversion]; Region: Gph; COG0546"
                     /db_xref="CDD:223620"
     misc_feature    99571..100086
                     /locus_tag="SSA_0098"
                     /note="haloacid dehalogenase superfamily, subfamily IA,
                     variant 1 with third motif having Dx(3-4)D or Dx(3-4)E;
                     Region: HAD-SF-IA-v1; TIGR01549"
                     /db_xref="CDD:273686"
     misc_feature    order(99583..99591,99877..99882)
                     /locus_tag="SSA_0098"
                     /note="active site"
                     /db_xref="CDD:119389"
     misc_feature    99583..99600
                     /locus_tag="SSA_0098"
                     /note="motif I; other site"
                     /db_xref="CDD:119389"
     misc_feature    99877..99879
                     /locus_tag="SSA_0098"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     gene            complement(100224..100709)
                     /locus_tag="SSA_0099"
                     /db_xref="GeneID:4807167"
     CDS             complement(100224..100709)
                     /locus_tag="SSA_0099"
                     /note="GC: 35.39%; Transmembrane domains: 2. Codon
                     Adaptation Index (CAI): 0.753. Curator(s): M. Serrano"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034110.1"
                     /db_xref="GeneID:4807167"
                     /translation="MFPITIPTLVTEEVYQRFAWSIFLRGKSFLLNIIILIGILSLYL
                     TFLPDNLKRFSFFTVLFISLVTFSAMYFGMDFQIKKAYQKTPFWKNMEQTLIFEKDKF
                     SVKSKRGEFLYSYDDIVKVFHTKDDFYIMLRPNIGFPIEKKNCTPEALEFLLELHIEN
                     M"
     misc_feature    complement(100242..100421)
                     /locus_tag="SSA_0099"
                     /note="YcxB-like protein; Region: YcxB; pfam14317"
                     /db_xref="CDD:291015"
     gene            100820..103462
                     /gene="polA"
                     /locus_tag="SSA_0100"
                     /db_xref="GeneID:4807265"
     CDS             100820..103462
                     /gene="polA"
                     /locus_tag="SSA_0100"
                     /EC_number="2.7.7.7"
                     /function="DNA replication, recombination, and repair"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="has 3'-5' exonuclease, 5'-3' exonuclease and
                     5'-3'polymerase activities, primarily functions to fill
                     gaps during DNA replication and repair"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase I"
                     /protein_id="YP_001034111.1"
                     /db_xref="GeneID:4807265"
                     /translation="MEKKNKLLLIDGSSVAFRAFFALYNQIDRFKSPSGLHTNAIYGF
                     HLMLNHLLERVQPTHVLVAFDAGKTTFRTEMYADYKAGRAKTPDEFREQLPFIREMLK
                     HLGIHYYDLAQYEADDIIGTLDKMAEKTAVPYDVTIVSGDKDLIQLTDENTVVEISKK
                     GVAEFEEFTPAYLMEKMGITPEQFIDLKALMGDQSDNIPGVTKIGEKTGLKLLLEYGS
                     LENLYENIDQLKASKMKENLINDKDKAFLSKTLATINTQAPIEIGLDDLVYKGPQVEA
                     LSKFYDEMGFKQLKAQLGTGQDPVEVKPIEFTKVTEVTADMLAPEQFFYFEILGDNYH
                     KEEVVGLAWGDSRQIYVGSSDLLQQPLFQEFLTKTALKTYDIKRAKVLLSHYGIELPA
                     AAFDARLAKYLLSTVEDNELVTIARLYGQTILPTDDEVYGKGAKRALPEQEQLFKHLA
                     RKIQVLLETEEPMQEQLRAHDQLDLLLEMEQPLAFVLAKMEIAGIKVERETLQGMQAE
                     NEKTLESLTQEIYDLAGQEFNINSPKQLGTILFEDMGLPLEYTKKTKTGYSTAVDVLE
                     RLAPIAPIVSKILEYRQISKLQSTYIIGLQEAIAADGKIHTRYVQDLTQTGRLSSVDP
                     NLQNIPVRLEQGRLIRKAFVPEWADSVLLSSDYSQIELRVLAHISQDEHLIAAFQHGE
                     DIHTATAMRVFGIEKAEDVTPNDRRNAKAVNFGVVYGISDFGLANNLGISRKAAKDYI
                     QTYFERFPGIKNYMETIVREARDKGYVETIYHRRRSLPDINSRNFNIRNFAERTAINS
                     PIQGSAADILKVAMINLDRALTEKNFKSRMLLQVHDEIVLEVPNDELTAVRKLVKETM
                     ETAIELAVPLVADENAGQTWYEAK"
     misc_feature    100829..103459
                     /gene="polA"
                     /locus_tag="SSA_0100"
                     /note="DNA polymerase I; Provisional; Region: PRK05755"
                     /db_xref="CDD:235591"
     misc_feature    100838..101371
                     /gene="polA"
                     /locus_tag="SSA_0100"
                     /note="PIN domain of the 5'-3' exonuclease of Taq DNA
                     polymerase I and homologs; Region: PIN_53EXO; cd09859"
                     /db_xref="CDD:189029"
     misc_feature    order(100850..100852,101012..101014,101162..101164,
                     101168..101173,101243..101245,101249..101251)
                     /gene="polA"
                     /locus_tag="SSA_0100"
                     /note="active site"
                     /db_xref="CDD:189029"
     misc_feature    order(100850..100852,101168..101170,101243..101245)
                     /gene="polA"
                     /locus_tag="SSA_0100"
                     /note="metal binding site 1 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:189029"
     misc_feature    101030..101068
                     /gene="polA"
                     /locus_tag="SSA_0100"
                     /note="putative 5' ssDNA interaction site; other site"
                     /db_xref="CDD:189029"
     misc_feature    order(101162..101164,101171..101173)
                     /gene="polA"
                     /locus_tag="SSA_0100"
                     /note="metal binding site 3; metal-binding site"
                     /db_xref="CDD:189029"
     misc_feature    order(101243..101245,101249..101251)
                     /gene="polA"
                     /locus_tag="SSA_0100"
                     /note="metal binding site 2 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:189029"
     misc_feature    101357..101632
                     /gene="polA"
                     /locus_tag="SSA_0100"
                     /note="5'-3' exonuclease, C-terminal SAM fold; Region:
                     5_3_exonuc; pfam01367"
                     /db_xref="CDD:279678"
     misc_feature    order(101390..101413,101417..101446,101450..101461)
                     /gene="polA"
                     /locus_tag="SSA_0100"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:188618"
     misc_feature    order(101396..101398,101405..101407)
                     /gene="polA"
                     /locus_tag="SSA_0100"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:188618"
     misc_feature    101768..102286
                     /gene="polA"
                     /locus_tag="SSA_0100"
                     /note="inactive DEDDy 3'-5' exonuclease domain of Bacillus
                     stearothermophilus DNA polymerase I and similar family-A
                     DNA polymerases; Region: DNA_polA_I_Bacillus_like_exo;
                     cd06140"
                     /db_xref="CDD:176652"
     misc_feature    102314..103450
                     /gene="polA"
                     /locus_tag="SSA_0100"
                     /note="Polymerase I functions primarily to fill DNA gaps
                     that arise during DNA repair, recombination and
                     replication; Region: DNA_pol_A_pol_I_C; cd08637"
                     /db_xref="CDD:176474"
     misc_feature    order(102563..102565,102575..102577,102584..102589,
                     102659..102667,102671..102673,102677..102688,
                     102785..102790,102872..102874,102935..102937,
                     102947..102949,103199..103201,103220..103222,
                     103313..103321)
                     /gene="polA"
                     /locus_tag="SSA_0100"
                     /note="active site"
                     /db_xref="CDD:176474"
     misc_feature    order(102563..102565,102575..102577,102584..102589,
                     102659..102667,102671..102673,102677..102688,
                     102971..102973,103196..103201,103208..103210,
                     103220..103222,103313..103321)
                     /gene="polA"
                     /locus_tag="SSA_0100"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:176474"
     misc_feature    order(102785..102790,102794..102796,102872..102874,
                     102935..102937,102947..102949,103319..103321)
                     /gene="polA"
                     /locus_tag="SSA_0100"
                     /note="catalytic site [active]"
                     /db_xref="CDD:176474"
     gene            103736..104173
                     /locus_tag="SSA_0101"
                     /db_xref="GeneID:4807258"
     CDS             103736..104173
                     /locus_tag="SSA_0101"
                     /function="General function prediction only"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 48.17%; Codon Adaptation Index (CAI): 0.81.
                     Curator(s): M. Serrano"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034112.1"
                     /db_xref="GeneID:4807258"
                     /translation="MTYHFQNPSDAIVKHYLKNSKVIAVVGLSDREETTSNRVSKEMQ
                     DRGYRIIPVNPRAAGSQIFGETVYASLKDIPFPVDIVDVYRRSEFLPDVALDFLQTDA
                     KIFWAQLGLESEEAEQILRTAGRDDIVMDRCIKREHTRLVLGE"
     misc_feature    103748..104170
                     /locus_tag="SSA_0101"
                     /note="Predicted CoA-binding protein [General function
                     prediction only]; Region: YccU; COG1832"
                     /db_xref="CDD:224745"
     gene            104175..104687
                     /locus_tag="SSA_0102"
                     /db_xref="GeneID:4806898"
     CDS             104175..104687
                     /locus_tag="SSA_0102"
                     /note="GC: 46.78%; Codon Adaptation Index (CAI): 0.758.
                     Curator(s): M. Serrano"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034113.1"
                     /db_xref="GeneID:4806898"
                     /translation="MAKLVIIRGNSGSGKSSLAGKLQTHYGRGTLLISQDTVRRDTLK
                     EKVEPGNLSIGLTETLARFGYEHDLLVLVEGFYETDIYGQMLERLKKIFAPQVFAYYY
                     DLSFEETVRRHQTRAKQEEFTPADMKRWWKDRDFLGWEEEAFFTDEDSLEAAFDKICS
                     ALDRTEYNSK"
     misc_feature    104175..104666
                     /locus_tag="SSA_0102"
                     /note="hypothetical protein; Provisional; Region:
                     PRK06762"
                     /db_xref="CDD:235858"
     gene            complement(104720..105580)
                     /locus_tag="SSA_0103"
                     /db_xref="GeneID:4806877"
     CDS             complement(104720..105580)
                     /locus_tag="SSA_0103"
                     /function="Function unknown"
                     /note="GC: 42.28%; Transmembrane domains: 6. Codon
                     Adaptation Index (CAI): 0.727. SignalP prediction: Yes
                     (prob. 0.47); Curator(s): M. Serrano"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034114.1"
                     /db_xref="GeneID:4806877"
                     /translation="MNLSHIRAQARTVRSQTRGIFLLFAAPTLVSILSILLSLDDNLR
                     DSIPSLTFSQSIYLLISKNLFPTTIQFILTLLLLSASYTMMRVLRKTKDDVNFSDIGH
                     LFTSKTFTPVFKTVLLKQLLIFLWNIPMFCGSLLAIFNAYKILSISEKIPAHTVVTAQ
                     SAAGQQILQYTPGMLLGTLLIFTGLGIAIPQYYAYAQAEFILYDQLEAGSYQGAFYAI
                     RQSRKLMKGYKGKIFMLNLSFIGWNLLARLTYGLLNVIVLPYTATAYILFYEELKKEK
                     AISKENNSQA"
     misc_feature    complement(104753..105571)
                     /locus_tag="SSA_0103"
                     /note="Protein of unknown function (DUF975); Region:
                     DUF975; cl10504"
                     /db_xref="CDD:299184"
     gene            105733..106875
                     /gene="tgt"
                     /locus_tag="SSA_0104"
                     /db_xref="GeneID:4807049"
     CDS             105733..106875
                     /gene="tgt"
                     /locus_tag="SSA_0104"
                     /EC_number="2.4.2.29"
                     /function="Translation, ribosomal structure and
                     biogenesis"
                     /note="Exchanges the guanine residue with
                     7-aminomethyl-7-deazaguanine in tRNAs with GU(N)
                     anticodons (tRNA-Asp, -Asn, -His and -Tyr)"
                     /codon_start=1
                     /transl_table=11
                     /product="queuine tRNA-ribosyltransferase"
                     /protein_id="YP_001034115.1"
                     /db_xref="GeneID:4807049"
                     /translation="MSTSPIQYRLIKKEKHTGARLGEIITPHGTFPTPMFMPVGTQAT
                     VKTQSPEELKQMGSGIILANTYHLWLRPGDELIARAGGLHTFMNWDQPILTDSGGFQV
                     YSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYD
                     YVKKSIERTSRWAERGLKAHSRPHDQGLFGIVQGAGFEDLRRQSAQDLVSMDFPGYSI
                     GGLAVGESHEEMNAVLDFTTPMLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTR
                     IARNGTCMTSEGRLVVKNAQFEEDFTPLDHDCDCYTCSNYTRAYIRHLLKADETFGIR
                     LTSYHNLYFLVNLMKKVRQAIMDDNLLEFREDFIERYGYNKSSRNF"
     misc_feature    105742..106842
                     /gene="tgt"
                     /locus_tag="SSA_0104"
                     /note="queuine tRNA-ribosyltransferase; Provisional;
                     Region: tgt; PRK00112"
                     /db_xref="CDD:234642"
     misc_feature    105760..106863
                     /gene="tgt"
                     /locus_tag="SSA_0104"
                     /note="Queuine/archaeosine tRNA-ribosyltransferase
                     [Translation, ribosomal structure and biogenesis]; Region:
                     Tgt; COG0343"
                     /db_xref="CDD:223420"
     gene            106901..107539
                     /locus_tag="SSA_0105"
                     /db_xref="GeneID:4808019"
     CDS             106901..107539
                     /locus_tag="SSA_0105"
                     /EC_number="2.7.1.48"
                     /function="Nucleotide transport and metabolism"
                     /note="GC: 47.26%; Codon Adaptation Index (CAI): 0.723.
                     Curator(s): M. Serrano"
                     /codon_start=1
                     /transl_table=11
                     /product="uridine kinase"
                     /protein_id="YP_001034116.1"
                     /db_xref="GeneID:4808019"
                     /translation="MSDEEKLLNRLIAYLSDDQKHTLRIYGHGASGKSTFARKLQLAL
                     GEDRANLLKTDPYVITGEYRDLLSSKDFPHQKVTACLPAVHELGSLERDICALQSGLD
                     ILTIGTAWSSSLRLSARKPILIVEGMSAAFLPESLFDLSLCFYTDDQTELERRLARDV
                     AVRERRPEWIEQTHLARREQYRHFYQPYLAAADLVICQSGNSFRIEKNSPLL"
     misc_feature    106973..107503
                     /locus_tag="SSA_0105"
                     /note="Nucleoside/nucleotide kinase (NK) is a protein
                     superfamily consisting of multiple families of enzymes
                     that share structural similarity and are functionally
                     related to the catalysis of the reversible phosphate group
                     transfer from nucleoside triphosphates...; Region: NK;
                     cl17190"
                     /db_xref="CDD:302627"
     misc_feature    order(106979..106981,106994..107005)
                     /locus_tag="SSA_0105"
                     /note="active site"
                     /db_xref="CDD:238977"
     gene            107912..108220
                     /gene="rpsJ"
                     /locus_tag="SSA_0106"
                     /gene_synonym="nusE"
                     /db_xref="GeneID:4806854"
     CDS             107912..108220
                     /gene="rpsJ"
                     /locus_tag="SSA_0106"
                     /gene_synonym="nusE"
                     /function="Translation, ribosomal structure and
                     biogenesis"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="NusE; involved in assembly of the 30S subunit; in
                     the ribosome, this protein is involved in the binding of
                     tRNA; in Escherichia coli this protein was also found to
                     be involved in transcription antitermination; NusB/S10
                     heterodimers bind boxA sequences in the leader RNA of rrn
                     operons which is required for antitermination; binding of
                     NusB/S10 to boxA nucleates assembly of the antitermination
                     complex"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S10"
                     /protein_id="YP_001034117.1"
                     /db_xref="GeneID:4806854"
                     /translation="MANKKIRIRLKAYEHRTLDTAAAKIVETATRTGAEVAGPIPLPT
                     ERSLYTIIRATHKYKDSREQFEMRTHKRLIDIINPTQKTVDALMKLDLPSGVNVEIKL
                     "
     misc_feature    107912..108217
                     /gene="rpsJ"
                     /locus_tag="SSA_0106"
                     /gene_synonym="nusE"
                     /note="30S ribosomal protein S10; Reviewed; Region: rpsJ;
                     PRK00596"
                     /db_xref="CDD:179076"
     gene            108305..108931
                     /gene="rplC"
                     /locus_tag="SSA_0107"
                     /db_xref="GeneID:4806940"
     CDS             108305..108931
                     /gene="rplC"
                     /locus_tag="SSA_0107"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="binds directly near the 3' end of the 23S rRNA,
                     where it nucleates assembly of the 50S subunit; essential
                     for peptidyltransferase activity; mutations in this gene
                     confer resistance to tiamulin"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L3"
                     /protein_id="YP_001034118.1"
                     /db_xref="GeneID:4806940"
                     /translation="MTKGILGKKVGMTQIFTEAGELIPVTVVEAAPNVVLQVKTVETD
                     GYNAVQVGFDDLRDVLSNKPAKGHVAKANTAPKRFIREFKNIEGLEVGAEITVDTFEA
                     GDVVDVTGTSKGKGFQGVIKRHGQSRGPMAHGSRYHRRPGSMGPVAPNRVFKNKRLAG
                     RMGGNRVTIQNLEIVQVVPEKNVILIKGNVPGAKKSLITIKSAVKAGK"
     misc_feature    108305..108928
                     /gene="rplC"
                     /locus_tag="SSA_0107"
                     /note="50S ribosomal protein L3; Validated; Region: rplC;
                     PRK00001"
                     /db_xref="CDD:234564"
     gene            108956..109579
                     /gene="rplD"
                     /locus_tag="SSA_0108"
                     /db_xref="GeneID:4807241"
     CDS             108956..109579
                     /gene="rplD"
                     /locus_tag="SSA_0108"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="L4 is important during the early stages of 50S
                     assembly; it initially binds near the 5' end of the 23S
                     rRNA"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L4"
                     /protein_id="YP_001034119.1"
                     /db_xref="GeneID:4807241"
                     /translation="MANVKLFDQTGKEAGEVVLNDAVFGIEPNESVVFDVIISQRASL
                     RQGTHAVKNRSAVSGGGRKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYAYKLP
                     RKVRRLALKSVYSEKVAENKFVAVDSLSFTAPKTAEFAKVLAALSIDTKVLVILEEGN
                     EFAALSARNLPNVKVATATTASVLDIVNSDKLLVTQAAISKIEEVLA"
     misc_feature    108959..109576
                     /gene="rplD"
                     /locus_tag="SSA_0108"
                     /note="50S ribosomal protein L4; Provisional; Region:
                     rplD; PRK05319"
                     /db_xref="CDD:235404"
     gene            109579..109875
                     /gene="rplW"
                     /locus_tag="SSA_0109"
                     /db_xref="GeneID:4807229"
     CDS             109579..109875
                     /gene="rplW"
                     /locus_tag="SSA_0109"
                     /function="Translation, ribosomal structure and
                     biogenesis"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="binds third domain of 23S rRNA and protein L29;
                     part of exit tunnel"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L23"
                     /protein_id="YP_001034120.1"
                     /db_xref="GeneID:4807229"
                     /translation="MNLYDVIKKPVITEGSMAQYEAGKYVFEVDTRAHKLLIKQAVEA
                     AFEGVKVANVNTINVKPKAKRVGRYTGFTNKTKKAIVTLTADSKAIELFGAEEE"
     misc_feature    109591..109842
                     /gene="rplW"
                     /locus_tag="SSA_0109"
                     /note="Ribosomal protein L23; Region: Ribosomal_L23;
                     pfam00276"
                     /db_xref="CDD:306731"
     gene            109893..110726
                     /gene="rplB"
                     /locus_tag="SSA_0110"
                     /db_xref="GeneID:4806961"
     CDS             109893..110726
                     /gene="rplB"
                     /locus_tag="SSA_0110"
                     /function="Translation, ribosomal structure and
                     biogenesis"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="one of the primary rRNA-binding proteins; required
                     for association of the 30S and 50S subunits to form the
                     70S ribosome, for tRNA binding and peptide bond formation"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L2"
                     /protein_id="YP_001034121.1"
                     /db_xref="GeneID:4806961"
                     /translation="MGIRVYKPTTNGRRNMTSLDFAEFTTSTPEKSLLVSLKSKAGRN
                     NNGRITVRHQGGGHKRHYRLIDFKRNKDAVEAVVKTIEYDPNRSANIALVHYTDGVKA
                     YIIAPKGLEVGQRIVSGPEADIKVGNALPLANIPVGTLVHNIELKPGRGGELVRAAGA
                     SAQVLGQEGKYTLVRLQSGEVRMILGTCRATVGVVGNEQHGLVNLGKAGRSRWKGIRP
                     TVRGSVMNPNDHPHGGGEGKAPVGRKAPSTPWGKPALGLKTRNKKAKSDKLIVRRRNE
                     K"
     misc_feature    109893..110723
                     /gene="rplB"
                     /locus_tag="SSA_0110"
                     /note="50S ribosomal protein L2; Validated; Region: rplB;
                     PRK09374"
                     /db_xref="CDD:236488"
     misc_feature    110016..110246
                     /gene="rplB"
                     /locus_tag="SSA_0110"
                     /note="Ribosomal Proteins L2, RNA binding domain; Region:
                     Ribosomal_L2; pfam00181"
                     /db_xref="CDD:278605"
     misc_feature    110268..110645
                     /gene="rplB"
                     /locus_tag="SSA_0110"
                     /note="Ribosomal Proteins L2, C-terminal domain; Region:
                     Ribosomal_L2_C; pfam03947"
                     /db_xref="CDD:281880"
     gene            110812..111093
                     /gene="rpsS"
                     /locus_tag="SSA_0111"
                     /db_xref="GeneID:4806904"
     CDS             110812..111093
                     /gene="rpsS"
                     /locus_tag="SSA_0111"
                     /function="Translation, ribosomal structure and
                     biogenesis"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="protein S19 forms a complex with S13 that binds
                     strongly to the 16S ribosomal RNA"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S19"
                     /protein_id="YP_001034122.1"
                     /db_xref="GeneID:4806904"
                     /translation="MGRSLKKGPFVDEHLMKKVEAQANDEKKKVIKTWSRRSTIFPSF
                     IGYTIAVYDGRKHVPVYIQEDMVGHKLGEFAPTRTYKGHAADDKKTRRK"
     misc_feature    110812..111087
                     /gene="rpsS"
                     /locus_tag="SSA_0111"
                     /note="30S ribosomal protein S19; Reviewed; Region: rpsS;
                     PRK00357"
                     /db_xref="CDD:178985"
     gene            111105..111449
                     /gene="rplV"
                     /locus_tag="SSA_0112"
                     /db_xref="GeneID:4807615"
     CDS             111105..111449
                     /gene="rplV"
                     /locus_tag="SSA_0112"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="binds specifically to 23S rRNA during the early
                     stages of 50S assembly; makes contact with all 6 domains
                     of the 23S rRNA in the assembled 50S subunit and ribosome;
                     mutations in this gene result in erythromycin resistance;
                     located near peptidyl-transferase center"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L22"
                     /protein_id="YP_001034123.1"
                     /db_xref="GeneID:4807615"
                     /translation="MAEITSAKAMARTVRVSPRKSRLVLDNIRGKNVADAIAILKFTP
                     NKAAGIIEKVLNSAIANAENNFGLEKANLVVSEAFANEGPTMKRFRPRAKGSASPINK
                     RTSHITVVVAEK"
     misc_feature    111117..111446
                     /gene="rplV"
                     /locus_tag="SSA_0112"
                     /note="50S ribosomal protein L22; Reviewed; Region: rplV;
                     PRK00565"
                     /db_xref="CDD:234793"
     misc_feature    order(111123..111128,111192..111200,111204..111209,
                     111213..111218,111279..111296,111321..111338,
                     111432..111437)
                     /gene="rplV"
                     /locus_tag="SSA_0112"
                     /note="putative translocon binding site; other site"
                     /db_xref="CDD:238205"
     misc_feature    order(111132..111134,111138..111140,111147..111149,
                     111153..111161,111168..111170,111180..111182,
                     111189..111191,111273..111275,111285..111287,
                     111294..111296,111333..111335,111339..111347,
                     111351..111353,111360..111362,111396..111413)
                     /gene="rplV"
                     /locus_tag="SSA_0112"
                     /note="protein-rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238205"
     gene            111462..112115
                     /gene="rpsC"
                     /locus_tag="SSA_0113"
                     /db_xref="GeneID:4807537"
     CDS             111462..112115
                     /gene="rpsC"
                     /locus_tag="SSA_0113"
                     /function="Translation, ribosomal structure and
                     biogenesis"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="forms a complex with S10 and S14; binds the lower
                     part of the 30S subunit head and the mRNA in the complete
                     ribosome to position it for translation"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S3"
                     /protein_id="YP_001034124.1"
                     /db_xref="GeneID:4807537"
                     /translation="MGQKVHPIGMRVGIIRDWDAKWYAEKEYADYLHEDLAIRKFVQK
                     ELADAAISTIEIERAVNKVNVSLHTAKPGMVIGKGGANVDALRAKLNKLTGKQVHINI
                     IEIKRPDLDAHLVGEGIARQLEQRVAFRRAQKQAIQRTMRAGAKGIKTQVSGRLNGAD
                     IARSEGYSEGTVPLHTLRADIDYAWEEADTTYGKLGVKVWIYRGEVLPARKNTKGGK"
     misc_feature    111462..112112
                     /gene="rpsC"
                     /locus_tag="SSA_0113"
                     /note="30S ribosomal protein S3; Reviewed; Region: rpsC;
                     PRK00310"
                     /db_xref="CDD:234722"
     gene            112119..112532
                     /gene="rplP"
                     /locus_tag="SSA_0114"
                     /db_xref="GeneID:4807756"
     CDS             112119..112532
                     /gene="rplP"
                     /locus_tag="SSA_0114"
                     /function="Translation, ribosomal structure and
                     biogenesis"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="located in the peptidyl transferase center and may
                     be involved in peptidyl transferase activity; similar to
                     archaeal L10e"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L16"
                     /protein_id="YP_001034125.1"
                     /db_xref="GeneID:4807756"
                     /translation="MLVPKRVKHRREFRGKMRGEAKGGKEVAFGEYGLQATTSHWITN
                     RQIEAARIAMTRYMKRGGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKV
                     MFEVAGVSEEIAREALRLASHKLPVKCKFVKREAE"
     misc_feature    112119..112529
                     /gene="rplP"
                     /locus_tag="SSA_0114"
                     /note="50S ribosomal protein L16; Reviewed; Region: rplP;
                     PRK09203"
                     /db_xref="CDD:236411"
     misc_feature    order(112191..112196,112203..112205,112251..112256,
                     112263..112265,112272..112274,112284..112286,
                     112293..112295,112311..112319,112323..112325,
                     112329..112331,112341..112346,112365..112379,
                     112419..112421,112473..112478,112485..112490)
                     /gene="rplP"
                     /locus_tag="SSA_0114"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238714"
     misc_feature    112230..112235
                     /gene="rplP"
                     /locus_tag="SSA_0114"
                     /note="5S rRNA interface [nucleotide binding]; other site"
                     /db_xref="CDD:238714"
     misc_feature    order(112266..112274,112281..112286)
                     /gene="rplP"
                     /locus_tag="SSA_0114"
                     /note="putative antibiotic binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238714"
     misc_feature    order(112293..112295,112302..112307,112311..112313,
                     112437..112439)
                     /gene="rplP"
                     /locus_tag="SSA_0114"
                     /note="L25 interface [polypeptide binding]; other site"
                     /db_xref="CDD:238714"
     misc_feature    order(112359..112364,112371..112376)
                     /gene="rplP"
                     /locus_tag="SSA_0114"
                     /note="L27 interface [polypeptide binding]; other site"
                     /db_xref="CDD:238714"
     gene            112542..112748
                     /gene="rpmC"
                     /locus_tag="SSA_0115"
                     /db_xref="GeneID:4807556"
     CDS             112542..112748
                     /gene="rpmC"
                     /locus_tag="SSA_0115"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="one of the stabilizing components for the large
                     ribosomal subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L29"
                     /protein_id="YP_001034126.1"
                     /db_xref="GeneID:4807556"
                     /translation="MKLNEVKEFVKELRGLSQEELAKRENELKKELFDLRFQAAAGQL
                     EQTARLKEVKKQIARIKTVQSEVK"
     misc_feature    112572..112739
                     /gene="rpmC"
                     /locus_tag="SSA_0115"
                     /note="Ribosomal L29 protein; Region: Ribosomal_L29;
                     pfam00831"
                     /db_xref="CDD:307121"
     misc_feature    order(112572..112574,112581..112583,112683..112685,
                     112713..112718,112722..112727,112737..112739)
                     /gene="rpmC"
                     /locus_tag="SSA_0115"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238243"
     misc_feature    order(112572..112580,112584..112586,112596..112601,
                     112605..112610,112617..112622,112629..112634,
                     112641..112643,112650..112655,112677..112679,
                     112686..112688,112698..112700,112707..112712,
                     112719..112724,112731..112733)
                     /gene="rpmC"
                     /locus_tag="SSA_0115"
                     /note="putative translocon interaction site; other site"
                     /db_xref="CDD:238243"
     misc_feature    order(112620..112622,112632..112634,112641..112643,
                     112653..112655,112698..112700)
                     /gene="rpmC"
                     /locus_tag="SSA_0115"
                     /note="signal recognition particle (SRP54) interaction
                     site; other site"
                     /db_xref="CDD:238243"
     misc_feature    order(112638..112640,112647..112652)
                     /gene="rpmC"
                     /locus_tag="SSA_0115"
                     /note="L23 interface [polypeptide binding]; other site"
                     /db_xref="CDD:238243"
     misc_feature    112659..112664
                     /gene="rpmC"
                     /locus_tag="SSA_0115"
                     /note="trigger factor interaction site; other site"
                     /db_xref="CDD:238243"
     gene            112772..113032
                     /gene="rpsQ"
                     /locus_tag="SSA_0116"
                     /db_xref="GeneID:4807624"
     CDS             112772..113032
                     /gene="rpsQ"
                     /locus_tag="SSA_0116"
                     /function="Translation, ribosomal structure and
                     biogenesis"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="primary binding protein; helps mediate assembly;
                     involved in translation fidelity"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S17"
                     /protein_id="YP_001034127.1"
                     /db_xref="GeneID:4807624"
                     /translation="MERNNRKVLVGRVVSDKMDKTITVVVETKRNHPVYGKRINYSKK
                     YKAHDENNVAKEGDIVRIMETRPLSATKRFRLVEVVEEAVII"
     misc_feature    112772..113023
                     /gene="rpsQ"
                     /locus_tag="SSA_0116"
                     /note="30S ribosomal protein S17; Reviewed; Region: rpsQ;
                     PRK05610"
                     /db_xref="CDD:235532"
     gene            113058..113426
                     /gene="rplN"
                     /locus_tag="SSA_0117"
                     /db_xref="GeneID:4807570"
     CDS             113058..113426
                     /gene="rplN"
                     /locus_tag="SSA_0117"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="binds to the 23S rRNA between the centers for
                     peptidyl transferase and GTPase"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L14"
                     /protein_id="YP_001034128.1"
                     /db_xref="GeneID:4807570"
                     /translation="MIQTETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVK
                     QATPGGAVKKGDVVKAVIVRTKSGARRKDGSYIKFDENAAVIIREDKTPRGTRIFGPV
                     ARELRDGGFMKIVSLAPEVL"
     misc_feature    113058..113423
                     /gene="rplN"
                     /locus_tag="SSA_0117"
                     /note="50S ribosomal protein L14; Validated; Region: rplN;
                     PRK05483"
                     /db_xref="CDD:180117"
     gene            113503..113808
                     /gene="rplX"
                     /locus_tag="SSA_0118"
                     /db_xref="GeneID:4807943"
     CDS             113503..113808
                     /gene="rplX"
                     /locus_tag="SSA_0118"
                     /function="Translation, ribosomal structure and
                     biogenesis"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="assembly initiator protein; binds to 5' end of 23S
                     rRNA and nucleates assembly of the 50S; surrounds
                     polypeptide exit tunnel"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L24"
                     /protein_id="YP_001034129.1"
                     /db_xref="GeneID:4807943"
                     /translation="MFVKKGDKVRVIAGKDKGVEALVVTALPKVNKVVVEGVNIVKKH
                     QKPNNENPQGAIVEKEAPIHVSNVQVLDKNGVAGRVGYKFVDGKKVRYNKKSGEVLD"
     misc_feature    113503..113805
                     /gene="rplX"
                     /locus_tag="SSA_0118"
                     /note="50S ribosomal protein L24; Reviewed; Region: rplX;
                     PRK00004"
                     /db_xref="CDD:234566"
     misc_feature    order(113539..113547,113581..113583,113626..113631,
                     113695..113700)
                     /gene="rplX"
                     /locus_tag="SSA_0118"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:240513"
     gene            113832..114374
                     /gene="rplE"
                     /locus_tag="SSA_0119"
                     /db_xref="GeneID:4807532"
     CDS             113832..114374
                     /gene="rplE"
                     /locus_tag="SSA_0119"
                     /function="Translation, ribosomal structure and
                     biogenesis"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="part of 50S and 5S/L5/L18/L25 subcomplex; contacts
                     5S rRNA and P site tRNA; forms a bridge to the 30S subunit
                     in the ribosome by binding to S13"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L5"
                     /protein_id="YP_001034130.1"
                     /db_xref="GeneID:4807532"
                     /translation="MANRLKEKYLKEVVPSLTEKFNYSSVMAVPKVDKIVLNMGVGDA
                     VSNAKNLEKAAEELALISGQKPLITKAKKSIAGFRLREGVAIGAKVTLRGERMYEFLD
                     KLVSVSLPRVRDFHGVPTKSFDGRGNYTLGVKEQLIFPEINFDDVDKTRGLDIVIVTT
                     ANTDEESRELLTGLGMPFAK"
     misc_feature    113838..114371
                     /gene="rplE"
                     /locus_tag="SSA_0119"
                     /note="50S ribosomal protein L5; Validated; Region: rplE;
                     PRK00010"
                     /db_xref="CDD:178791"
     misc_feature    113919..114074
                     /gene="rplE"
                     /locus_tag="SSA_0119"
                     /note="Ribosomal protein L5; Region: Ribosomal_L5;
                     pfam00281"
                     /db_xref="CDD:278698"
     misc_feature    114087..114365
                     /gene="rplE"
                     /locus_tag="SSA_0119"
                     /note="ribosomal L5P family C-terminus; Region:
                     Ribosomal_L5_C; pfam00673"
                     /db_xref="CDD:279064"
     gene            114392..114577
                     /gene="rpsN"
                     /locus_tag="SSA_2391"
                     /db_xref="GeneID:4807279"
     CDS             114392..114577
                     /gene="rpsN"
                     /locus_tag="SSA_2391"
                     /function="Translation, ribosomal structure and
                     biogenesis"
                     /note="located in the peptidyl transferase center and
                     involved in assembly of 30S ribosome subunit; similar to
                     what is observed with proteins L31 and L33, some proteins
                     in this family contain CXXC motifs that are involved in
                     zinc binding; if two copies are present in a genome, then
                     the duplicated copy appears to have lost the zinc-binding
                     motif and is instead regulated by zinc; the proteins in
                     this group appear to contain the zinc-binding motif"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S14"
                     /protein_id="YP_001034131.1"
                     /db_xref="GeneID:4807279"
                     /translation="MAKKSMIAKNKRPAKFSTQAYTRCEKCGRPHSVYRKFKLCRVCF
                     RELAYKGQIPGVTKASW"
     misc_feature    114392..114574
                     /gene="rpsN"
                     /locus_tag="SSA_2391"
                     /note="30S ribosomal protein S14; Reviewed; Region: rpsN;
                     PRK08061"
                     /db_xref="CDD:181216"
     gene            114758..115156
                     /gene="rpsH"
                     /locus_tag="SSA_0120"
                     /db_xref="GeneID:4807518"
     CDS             114758..115156
                     /gene="rpsH"
                     /locus_tag="SSA_0120"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="binds directly to 16S rRNA central domain where it
                     helps coordinate assembly of the platform of the 30S
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S8"
                     /protein_id="YP_001034132.1"
                     /db_xref="GeneID:4807518"
                     /translation="MVMTDPIADFLTRIRNANQANHEVLEVPASNIKKGIAEILKREG
                     FVKNVEIIEDDKQGIIRVFLKYGQNGEKVITGLKRISKPGLRVYKKREDLPKVLNGLG
                     IAILSTSEGLLTDKEARQKNVGGEVIAYVW"
     misc_feature    114761..115153
                     /gene="rpsH"
                     /locus_tag="SSA_0120"
                     /note="30S ribosomal protein S8; Validated; Region: rpsH;
                     PRK00136"
                     /db_xref="CDD:234658"
     gene            115323..115502
                     /locus_tag="SSA_0121"
                     /db_xref="GeneID:4807805"
     CDS             115323..115502
                     /locus_tag="SSA_0121"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 34.44%; Codon Adaptation Index (CAI): 0.837.
                     Curator(s): M. Serrano"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034133.1"
                     /db_xref="GeneID:4807805"
                     /translation="MKATELNEKLIVAEDALAELSKDDLVSLLCEIGYSPAAIDVLTE
                     YQEFVKAFRKKLGLL"
     gene            115567..116103
                     /gene="rplF"
                     /locus_tag="SSA_0122"
                     /db_xref="GeneID:4808017"
     CDS             115567..116103
                     /gene="rplF"
                     /locus_tag="SSA_0122"
                     /function="Translation, ribosomal structure and
                     biogenesis"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="ribosomal protein L6 appears to have arisen as a
                     result of an ancient gene duplication as based on
                     structural comparison of the Bacillus stearothermophilus
                     protein; RNA-binding appears to be in the C-terminal
                     domain; mutations in the L6 gene confer resistance to
                     aminoglycoside antibiotics such as gentamicin and these
                     occur in truncations of the C-terminal domain; it has been
                     localized to a region between the base of the L7/L12 stalk
                     and the central protuberance"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L6"
                     /protein_id="YP_001034134.1"
                     /db_xref="GeneID:4808017"
                     /translation="MSRIGNKVIVLPAGVEISNKDNVVTVKGPKGELTREFSKDIEIR
                     VEGTEVTLHRPNDSKEMKTIHGTTRALLNNMVVGVSEGFKKELEMRGVGYRAQLQGKK
                     LVLSVGKSHPDEVEAPEGITFELPNPTTIVVSGISKEVVGQTAAYVRSLRAPEPYKGK
                     GIRYVGEFVRRKEGKTGK"
     misc_feature    115567..116100
                     /gene="rplF"
                     /locus_tag="SSA_0122"
                     /note="50S ribosomal protein L6; Validated; Region: rplF;
                     PRK05498"
                     /db_xref="CDD:235495"
     gene            116188..116544
                     /gene="rplR"
                     /locus_tag="SSA_0123"
                     /db_xref="GeneID:4807995"
     CDS             116188..116544
                     /gene="rplR"
                     /locus_tag="SSA_0123"
                     /function="Translation, ribosomal structure and
                     biogenesis"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="binds 5S rRNA along with protein L5 and L25"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L18"
                     /protein_id="YP_001034135.1"
                     /db_xref="GeneID:4807995"
                     /translation="MITKPDKNKIRQKRHRRVRGKLSGTADRPRLNVFRSNTGIYAQV
                     IDDVAGVTLASASTLDKEVSKGTKTEQAVVVGKLVAERAVAKGISEVVFDRGGYLYHG
                     RVKALADAARENGLKF"
     misc_feature    116203..116541
                     /gene="rplR"
                     /locus_tag="SSA_0123"
                     /note="50S ribosomal protein L18; Reviewed; Region: rplR;
                     PRK05593"
                     /db_xref="CDD:235524"
     misc_feature    order(116245..116247,116251..116256,116260..116262,
                     116275..116277,116287..116304,116308..116310,
                     116314..116316,116335..116343,116350..116352,
                     116461..116463,116494..116496)
                     /gene="rplR"
                     /locus_tag="SSA_0123"
                     /note="5S rRNA interface [nucleotide binding]; other site"
                     /db_xref="CDD:238246"
     misc_feature    order(116245..116247,116254..116259)
                     /gene="rplR"
                     /locus_tag="SSA_0123"
                     /note="L27 interface [polypeptide binding]; other site"
                     /db_xref="CDD:238246"
     misc_feature    order(116248..116253,116464..116466,116473..116475,
                     116521..116523)
                     /gene="rplR"
                     /locus_tag="SSA_0123"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238246"
     misc_feature    116479..116481
                     /gene="rplR"
                     /locus_tag="SSA_0123"
                     /note="L5 interface [polypeptide binding]; other site"
                     /db_xref="CDD:238246"
     gene            116562..117056
                     /gene="rpsE"
                     /locus_tag="SSA_0124"
                     /db_xref="GeneID:4806660"
     CDS             116562..117056
                     /gene="rpsE"
                     /locus_tag="SSA_0124"
                     /function="Translation, ribosomal structure and
                     biogenesis"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="located at the back of the 30S subunit body where
                     it stabilizes the conformation of the head with respect to
                     the body; contacts S4 and S8; with S4 and S12 plays a role
                     in translational accuracy; mutations in this gene result
                     in spectinomycin resistance"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S5"
                     /protein_id="YP_001034136.1"
                     /db_xref="GeneID:4806660"
                     /translation="MAFKDNAVELEERLVAINRVTKVVKGGRRLRFAALVVVGDRNGR
                     VGFGTGKAQEVPEAIRKAVEDAKKNLIEVPMVGTTIPHEVLSEFGGAKVLLKPAVEGS
                     GVAAGGAVRAVIELAGVADVTSKSLGSNTPINIVRATVEGLKQLKRAEEVAALRGISV
                     SDLA"
     misc_feature    116562..117053
                     /gene="rpsE"
                     /locus_tag="SSA_0124"
                     /note="30S ribosomal protein S5; Validated; Region: rpsE;
                     PRK00550"
                     /db_xref="CDD:234790"
     gene            117070..117252
                     /gene="rpmD"
                     /locus_tag="SSA_0125"
                     /db_xref="GeneID:4805990"
     CDS             117070..117252
                     /gene="rpmD"
                     /locus_tag="SSA_0125"
                     /function="Translation, ribosomal structure and
                     biogenesis"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="L30 binds domain II of the 23S rRNA and the 5S
                     rRNA; similar to eukaryotic protein L7"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L30"
                     /protein_id="YP_001034137.1"
                     /db_xref="GeneID:4805990"
                     /translation="MAQIKITLTKSPIGRIPSQRKTVVALGLGKLNSSVIKEDNPAVR
                     GMITAVSHLVTVEEVK"
     misc_feature    117070..117246
                     /gene="rpmD"
                     /locus_tag="SSA_0125"
                     /note="50S ribosomal protein L30; Reviewed; Region: rpmD;
                     PRK05611"
                     /db_xref="CDD:180163"
     misc_feature    order(117097..117102,117106..117111,117115..117123,
                     117130..117135,117142..117150,117154..117156,
                     117163..117165,117178..117183,117190..117198,
                     117202..117207)
                     /gene="rpmD"
                     /locus_tag="SSA_0125"
                     /note="23S rRNA binding site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:100100"
     gene            117407..117847
                     /gene="rplO"
                     /locus_tag="SSA_0126"
                     /db_xref="GeneID:4807733"
     CDS             117407..117847
                     /gene="rplO"
                     /locus_tag="SSA_0126"
                     /function="Translation, ribosomal structure and
                     biogenesis"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="late assembly protein"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L15"
                     /protein_id="YP_001034138.1"
                     /db_xref="GeneID:4807733"
                     /translation="MKLHELQPAAGSRKVRNRVGRGTSSGNGKTSGRGQKGQKARSGG
                     GVRLGFEGGQTPLFRRLPKRGFLNINRKEYAIVNLDQLNAFEDGAEVTPVVLIEAGIV
                     KAEKSGIKILGNGELTKKLTVKAAKFSKSAEEAITAKGGSVEVI"
     misc_feature    117407..117844
                     /gene="rplO"
                     /locus_tag="SSA_0126"
                     /note="50S ribosomal protein L15; Reviewed; Region: rplO;
                     PRK05592"
                     /db_xref="CDD:235523"
     gene            117860..119167
                     /gene="secY"
                     /locus_tag="SSA_0127"
                     /db_xref="GeneID:4807043"
     CDS             117860..119167
                     /gene="secY"
                     /locus_tag="SSA_0127"
                     /function="Intracellular trafficking and secretion"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="forms heterotrimeric complex in the membrane; in
                     bacteria the complex consists of SecY which forms the
                     channel pore and SecE and SecG; the SecG subunit is not
                     essential; in bacteria translocation is driven via the
                     SecA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecY"
                     /protein_id="YP_001034139.1"
                     /db_xref="GeneID:4807043"
                     /translation="MFFKLLKDAFKIKQVRSKILFTIFIILVFRIGTTITVPGINAKA
                     LSNLNDLPFLNMLSLVSGNAMRNFSVFALGVSPYITASIVVQLLQMDLLPKFVEWGKQ
                     GEVGRRKLNQATRYIALVLAFVQAIGITAGFDTLSRANLVANPNVQTYALICVLLATG
                     SMIVTWLGEQITDKGYGNGVSMIIFAGIVSAIPDMIKGIYEDYFVNIPSERLTSSFIF
                     VGILIVAVLLIIYFTTFVQQAEYKIPIQYTKVAKGAPSSSYLPLKVNPAGVIPVIFAS
                     SITAAPAAIFQVVSALGYDADWVKTAQSLLATTTISGMFMYAFLIVLFTFFYTFVQIN
                     PEKTAENLQKSGAYIPGVRPGKGTEDYMSKLLRRLATVGSLFLGFISILPILAKDVFG
                     LTDAVALGGTSLLIIISTGIEGMKQLEGYLLKRKYVGFMDTSE"
     misc_feature    117863..119152
                     /gene="secY"
                     /locus_tag="SSA_0127"
                     /note="preprotein translocase subunit SecY; Reviewed;
                     Region: secY; PRK09204"
                     /db_xref="CDD:236412"
     gene            119341..119979
                     /gene="adk"
                     /locus_tag="SSA_0128"
                     /db_xref="GeneID:4806703"
     CDS             119341..119979
                     /gene="adk"
                     /locus_tag="SSA_0128"
                     /EC_number="2.7.4.3"
                     /function="Nucleotide transport and metabolism"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="essential enzyme that recycles AMP in active cells;
                     converts ATP and AMP to two molecules of ADP"
                     /codon_start=1
                     /transl_table=11
                     /product="adenylate kinase"
                     /protein_id="YP_001034140.1"
                     /db_xref="GeneID:4806703"
                     /translation="MNLLIMGLPGAGKGTQAAKIVDHFNVAHISTGDMFRAAIANQTE
                     MGVLAKSYIDKGELVPDEVTNGIVKERLSQNDIKETGFLLDGYPRTIEQAHALDQTLT
                     ELDLALDGVINIEVDPNSLLERLSGRIIHRETGETFHKVFNPPADYKEEDYYQREDDK
                     PETVKRRLDVNIAQGQPIIDHYRRKGLVHDIQGNQDINDVFSAIEKVLTNLK"
     misc_feature    119341..119973
                     /gene="adk"
                     /locus_tag="SSA_0128"
                     /note="adenylate kinase; Reviewed; Region: adk; PRK00279"
                     /db_xref="CDD:234711"
     misc_feature    119344..119940
                     /gene="adk"
                     /locus_tag="SSA_0128"
                     /note="Adenylate kinase (ADK) catalyzes the reversible
                     phosphoryl transfer from adenosine triphosphates (ATP) to
                     adenosine monophosphates (AMP) and to yield adenosine
                     diphosphates (ADP). This enzyme is required for the
                     biosynthesis of ADP and is essential for...; Region: ADK;
                     cd01428"
                     /db_xref="CDD:238713"
     misc_feature    order(119431..119433,119446..119448,119515..119517,
                     119593..119598,119602..119607,119617..119619)
                     /gene="adk"
                     /locus_tag="SSA_0128"
                     /note="AMP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238713"
     misc_feature    order(119446..119448,119593..119595,119605..119607,
                     119722..119724,119839..119841,119851..119853)
                     /gene="adk"
                     /locus_tag="SSA_0128"
                     /note="ATP-AMP (Ap5A)-binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238713"
     gene            120097..120315
                     /gene="infA"
                     /locus_tag="SSA_0129"
                     /db_xref="GeneID:4807106"
     CDS             120097..120315
                     /gene="infA"
                     /locus_tag="SSA_0129"
                     /function="Translation, ribosomal structure and
                     biogenesis"
                     /note="stimulates the activities of the other two
                     initiation factors, IF-2 and IF-3"
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-1"
                     /protein_id="YP_001034141.1"
                     /db_xref="GeneID:4807106"
                     /translation="MAKDDVIEVEGKVVDTMPNAMFTVELENGHQILATVSGKIRKNY
                     IRILAGDRVTVEMSPYDLTRGRITYRFK"
     misc_feature    120097..120312
                     /gene="infA"
                     /locus_tag="SSA_0129"
                     /note="translation initiation factor IF-1; Validated;
                     Region: infA; PRK00276"
                     /db_xref="CDD:178954"
     misc_feature    order(120139..120147,120163..120165,120199..120201,
                     120208..120213,120226..120237,120286..120288,
                     120292..120294)
                     /gene="infA"
                     /locus_tag="SSA_0129"
                     /note="rRNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:239898"
     misc_feature    order(120199..120201,120211..120213,120304..120306)
                     /gene="infA"
                     /locus_tag="SSA_0129"
                     /note="predicted 30S ribosome binding site; other site"
                     /db_xref="CDD:239898"
     gene            120338..120454
                     /gene="rpmJ"
                     /locus_tag="SSA_2392"
                     /db_xref="GeneID:4807418"
     CDS             120338..120454
                     /gene="rpmJ"
                     /locus_tag="SSA_2392"
                     /function="Translation, ribosomal structure and
                     biogenesis"
                     /note="smallest protein in the large subunit; similar to
                     what is found with protein L31 and L33 several bacterial
                     genomes contain paralogs which may be regulated by zinc;
                     the protein from Thermus thermophilus has a zinc-binding
                     motif and contains a bound zinc ion; the proteins in this
                     group have the motif"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L36"
                     /protein_id="YP_001034142.1"
                     /db_xref="GeneID:4807418"
                     /translation="MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG"
     misc_feature    120338..120451
                     /gene="rpmJ"
                     /locus_tag="SSA_2392"
                     /note="Ribosomal protein L36; Region: Ribosomal_L36;
                     pfam00444"
                     /db_xref="CDD:334079"
     gene            120472..120837
                     /gene="rpsM"
                     /locus_tag="SSA_0130"
                     /db_xref="GeneID:4806962"
     CDS             120472..120837
                     /gene="rpsM"
                     /locus_tag="SSA_0130"
                     /function="Translation, ribosomal structure and
                     biogenesis"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="located at the top of the head of the 30S subunit,
                     it contacts several helices of the 16S rRNA; makes contact
                     with the large subunit via RNA-protein interactions and
                     via protein-protein interactions with L5; contacts P-site
                     tRNA"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S13"
                     /protein_id="YP_001034143.1"
                     /db_xref="GeneID:4806962"
                     /translation="MARIAGVDIPNDKRVVVSLTYVYGIGLPTSKKILAAAGVSEDIR
                     VKDLTIEQEDAIRREVDAIKVEGDLRREVNLNIKRLMEIGSYRGIRHRRGLPVRGQNT
                     KNNARTRKGKAVAIAGKKK"
     misc_feature    120472..120834
                     /gene="rpsM"
                     /locus_tag="SSA_0130"
                     /note="30S ribosomal protein S13; Validated; Region: rpsM;
                     PRK05179"
                     /db_xref="CDD:235358"
     gene            120857..121240
                     /gene="rpsK"
                     /locus_tag="SSA_0131"
                     /db_xref="GeneID:4807731"
     CDS             120857..121240
                     /gene="rpsK"
                     /locus_tag="SSA_0131"
                     /function="Translation, ribosomal structure and
                     biogenesis"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="located on the platform of the 30S subunit, it
                     bridges several disparate RNA helices of the 16S rRNA;
                     forms part of the Shine-Dalgarno cleft in the 70S
                     ribosome; interacts with S7 and S18 and IF-3"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S11"
                     /protein_id="YP_001034144.1"
                     /db_xref="GeneID:4807731"
                     /translation="MAKPTRKRRVKKNIESGIAHIHATFNNTIVMITDVHGNAIAWSS
                     AGALGFKGSRKSTPFAAQMASEAAAKSAQEHGLKSVEVTVKGPGSGRESAIRALAAAG
                     LEVTAIRDVTPVPHNGARPPKRRRV"
     misc_feature    120857..121237
                     /gene="rpsK"
                     /locus_tag="SSA_0131"
                     /note="30S ribosomal protein S11; Validated; Region:
                     PRK05309"
                     /db_xref="CDD:180007"
     gene            121286..122224
                     /gene="rpoA"
                     /locus_tag="SSA_0132"
                     /db_xref="GeneID:4807466"
     CDS             121286..122224
                     /gene="rpoA"
                     /locus_tag="SSA_0132"
                     /EC_number="2.7.7.6"
                     /function="Transcription"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="catalyzes the transcription of DNA into RNA using
                     the four ribonucleoside triphosphates as substrates.
                     Dimerization of the alpha subunit is the first step in the
                     sequential assembly of subunits to form the holoenzyme"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit alpha"
                     /protein_id="YP_001034145.1"
                     /db_xref="GeneID:4807466"
                     /translation="MIEFEKPNITKIDENKDYGKFVVEPLERGYGTTLGNSLRRVLLA
                     SLPGAAVTSINIEGVLHEFDTISGVREDVMQIILNVKGIAVKSYVQDEKIIELDVEGP
                     AEVTAGDILTDSDIEIINPDHYLFTIGEGASFKATMTVNSGRGYVPADENKKDDAPVG
                     TLAVDSIYTPVTKVNYQVEPARVGSNDGFDKLTLEILTNGTIIPEDALGLSARILTEH
                     LNLFTNLTEVAIAADVMKEAEKTSDDRILERTIEELDLSVRSYNCLKRAGINTVFDLT
                     EKSEPEMMKVRNLGRKSLEEVKVKLADLGLGLKNDK"
     misc_feature    121289..122212
                     /gene="rpoA"
                     /locus_tag="SSA_0132"
                     /note="DNA-directed RNA polymerase subunit alpha;
                     Provisional; Region: PRK05182"
                     /db_xref="CDD:235359"
     gene            122236..122622
                     /gene="rplQ"
                     /locus_tag="SSA_0133"
                     /db_xref="GeneID:4807664"
     CDS             122236..122622
                     /gene="rplQ"
                     /locus_tag="SSA_0133"
                     /function="Translation, ribosomal structure and
                     biogenesis"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="is a component of the macrolide binding site in the
                     peptidyl transferase center"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L17"
                     /protein_id="YP_001034146.1"
                     /db_xref="GeneID:4807664"
                     /translation="MAYRKLGRTSSQRKAMLRDLTTDLLINESIVTTEARAKEIRKTV
                     EKMITLGKRGDLHARRQAAAFVRNEIASENYDEATEKYTTTTALQKLFSEIAPRYAER
                     NGGYTRILKTEPRRGDAAPMAIIELV"
     misc_feature    122236..122619
                     /gene="rplQ"
                     /locus_tag="SSA_0133"
                     /note="50S ribosomal protein L17; Validated; Region: rplQ;
                     PRK05591"
                     /db_xref="CDD:235522"
     gene            124363..125913
                     /locus_tag="SSA_2401"
                     /db_xref="GeneID:4807718"
     rRNA            124363..125913
                     /locus_tag="SSA_2401"
                     /product="16S small subunit ribosomal RNA"
                     /inference="similar to RNA sequence, other
                     RNA:INSD:AF077835.1"
                     /note="rRNA_16S_2"
                     /db_xref="GeneID:4807718"
     gene            125975..126047
                     /locus_tag="SSA_2432"
                     /db_xref="GeneID:4807458"
     tRNA            125975..126047
                     /locus_tag="SSA_2432"
                     /product="tRNA-Ala"
                     /inference="profile:tRNAscan-SE:1.23"
                     /note="tRNA-Ala_2"
                     /db_xref="GeneID:4807458"
     gene            126174..129073
                     /locus_tag="SSA_2405"
                     /db_xref="GeneID:4807862"
     rRNA            126174..129073
                     /locus_tag="SSA_2405"
                     /product="23S large subunit ribosomal RNA"
                     /inference="similar to RNA sequence, other
                     RNA:INSD:AB168128.1"
                     /note="rRNA_23S_2"
                     /db_xref="GeneID:4807862"
     gene            129192..129307
                     /locus_tag="SSA_2409"
                     /db_xref="GeneID:4807937"
     rRNA            129192..129307
                     /locus_tag="SSA_2409"
                     /product="5S ribosomal RNA"
                     /inference="similar to RNA sequence, other
                     RNA:INSD:AF302131.1"
                     /note="rRNA_5S_2"
                     /db_xref="GeneID:4807937"
     gene            129311..129383
                     /locus_tag="SSA_2433"
                     /db_xref="GeneID:4807601"
     tRNA            129311..129383
                     /locus_tag="SSA_2433"
                     /product="tRNA-Val"
                     /inference="profile:tRNAscan-SE:1.23"
                     /note="tRNA-Val_2"
                     /db_xref="GeneID:4807601"
     gene            129391..129461
                     /locus_tag="SSA_2434"
                     /db_xref="GeneID:4808020"
     tRNA            129391..129461
                     /locus_tag="SSA_2434"
                     /product="tRNA-Gly"
                     /inference="profile:tRNAscan-SE:1.23"
                     /note="tRNA-Gly_3"
                     /db_xref="GeneID:4808020"
     gene            129495..129568
                     /locus_tag="SSA_2435"
                     /db_xref="GeneID:4807669"
     tRNA            129495..129568
                     /locus_tag="SSA_2435"
                     /product="tRNA-Ile"
                     /inference="profile:tRNAscan-SE:1.23"
                     /note="tRNA-Ile_2"
                     /db_xref="GeneID:4807669"
     gene            129584..129655
                     /locus_tag="SSA_2436"
                     /db_xref="GeneID:4807935"
     tRNA            129584..129655
                     /locus_tag="SSA_2436"
                     /product="tRNA-Glu"
                     /inference="profile:tRNAscan-SE:1.23"
                     /note="tRNA-Glu_2"
                     /db_xref="GeneID:4807935"
     gene            129663..129752
                     /locus_tag="SSA_2437"
                     /db_xref="GeneID:4807617"
     tRNA            129663..129752
                     /locus_tag="SSA_2437"
                     /product="tRNA-Ser"
                     /inference="profile:tRNAscan-SE:1.23"
                     /note="tRNA-Ser_3"
                     /db_xref="GeneID:4807617"
     gene            129772..129845
                     /locus_tag="SSA_2438"
                     /db_xref="GeneID:4807992"
     tRNA            129772..129845
                     /locus_tag="SSA_2438"
                     /product="tRNA-Met"
                     /inference="profile:tRNAscan-SE:1.23"
                     /note="tRNA-Met_4"
                     /db_xref="GeneID:4807992"
     gene            129851..129923
                     /locus_tag="SSA_2439"
                     /db_xref="GeneID:4807372"
     tRNA            129851..129923
                     /locus_tag="SSA_2439"
                     /product="tRNA-Phe"
                     /inference="profile:tRNAscan-SE:1.23"
                     /note="tRNA-Phe_2"
                     /db_xref="GeneID:4807372"
     gene            129937..130017
                     /locus_tag="SSA_2440"
                     /db_xref="GeneID:4808032"
     tRNA            129937..130017
                     /locus_tag="SSA_2440"
                     /product="tRNA-Tyr"
                     /inference="profile:tRNAscan-SE:1.23"
                     /db_xref="GeneID:4808032"
     gene            130026..130096
                     /locus_tag="SSA_2441"
                     /db_xref="GeneID:4807978"
     tRNA            130026..130096
                     /locus_tag="SSA_2441"
                     /product="tRNA-Trp"
                     /inference="profile:tRNAscan-SE:1.23"
                     /db_xref="GeneID:4807978"
     gene            130107..130179
                     /locus_tag="SSA_2442"
                     /db_xref="GeneID:4806012"
     tRNA            130107..130179
                     /locus_tag="SSA_2442"
                     /product="tRNA-His"
                     /inference="profile:tRNAscan-SE:1.23"
                     /db_xref="GeneID:4806012"
     gene            130193..130264
                     /locus_tag="SSA_2443"
                     /db_xref="GeneID:4806820"
     tRNA            130193..130264
                     /locus_tag="SSA_2443"
                     /product="tRNA-Gln"
                     /inference="profile:tRNAscan-SE:1.23"
                     /db_xref="GeneID:4806820"
     gene            130277..130360
                     /locus_tag="SSA_2444"
                     /db_xref="GeneID:4807593"
     tRNA            130277..130360
                     /locus_tag="SSA_2444"
                     /product="tRNA-Leu"
                     /inference="profile:tRNAscan-SE:1.23"
                     /note="tRNA-Leu_3"
                     /db_xref="GeneID:4807593"
     gene            130714..131157
                     /gene="adcR"
                     /locus_tag="SSA_0135"
                     /db_xref="GeneID:4806188"
     CDS             130714..131157
                     /gene="adcR"
                     /locus_tag="SSA_0135"
                     /function="Transcription"
                     /note="GC: 41.44%; Codon Adaptation Index (CAI): 0.796.
                     Helix-turn-helix prediction: LysR\AraC. Curator(s): M.
                     Serrano, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="multiple antibiotic resistance operon
                     transcription repressor MarR"
                     /protein_id="YP_001034147.1"
                     /db_xref="GeneID:4806188"
                     /translation="MTHLAQKIDQFLNEVILKAENQHEILIGSCTSDVPLTNTQEHIL
                     MLLSEESLTNSDLAKKLNVSQAAVTKAVKSLARQEMLQAFKDKRDARVTFYRLTELAQ
                     PIAKEHQHHHAHTLETYQKLAEQFSASEQAVIAKFLEALVGEIGK"
     misc_feature    130816..131106
                     /gene="adcR"
                     /locus_tag="SSA_0135"
                     /note="helix_turn_helix multiple antibiotic resistance
                     protein; Region: HTH_MARR; smart00347"
                     /db_xref="CDD:197670"
     misc_feature    130819..130992
                     /gene="adcR"
                     /locus_tag="SSA_0135"
                     /note="Helix-turn-helix domains; Region: HTH; cl21459"
                     /db_xref="CDD:304362"
     gene            131154..131864
                     /gene="adcC"
                     /locus_tag="SSA_0136"
                     /db_xref="GeneID:4807674"
     CDS             131154..131864
                     /gene="adcC"
                     /locus_tag="SSA_0136"
                     /function="Inorganic ion transport and metabolism"
                     /note="GC: 44.44%; Transporter classification
                     TC:3.A.1.15.3. Codon Adaptation Index (CAI): 0.809.
                     Curator(s): M. Serrano"
                     /codon_start=1
                     /transl_table=11
                     /product="zinc ABC transporter"
                     /protein_id="YP_001034148.1"
                     /db_xref="GeneID:4807674"
                     /translation="MRYITVDNLSFYYDKEPVLEHIHYFLDSGEFVTLTGENGAAKTT
                     LIKASLGILQPKHGEVKISKTNVRGKKLRIAYLPQQIASFNAGFPSTVYEFVKSGRYP
                     RKGWFRRLNEHDEEHIKASLESVGMWEHRDKRIGSLSGGQKQRAVIARMFASDPDIFV
                     LDEPTTGMDAGSKDEFYKLMHHSAHKHGKAVLMITHDPEEVRKYADRNIHLVRNQDSP
                     WRCFNVHENDNGQEVSHA"
     misc_feature    131163..131786
                     /gene="adcC"
                     /locus_tag="SSA_0136"
                     /note="ABC-type lipoprotein export system, ATPase
                     component [Cell wall/membrane/envelope biogenesis];
                     Region: LolD; COG1136"
                     /db_xref="CDD:224059"
     misc_feature    131169..131786
                     /gene="adcC"
                     /locus_tag="SSA_0136"
                     /note="ATP-binding cassette domain of the metal-type
                     transporters; Region: ABC_Metallic_Cations; cd03235"
                     /db_xref="CDD:213202"
     gene            131857..132663
                     /gene="adcB"
                     /locus_tag="SSA_0137"
                     /db_xref="GeneID:4807353"
     CDS             131857..132663
                     /gene="adcB"
                     /locus_tag="SSA_0137"
                     /function="Inorganic ion transport and metabolism"
                     /note="GC: 45.23%; Transporter classification
                     TC:3.A.1.15.3. Transmembrane domains: 7. Codon Adaptation
                     Index (CAI): 0.727. Curator(s): M. Serrano"
                     /codon_start=1
                     /transl_table=11
                     /product="zinc ABC transporter permease"
                     /protein_id="YP_001034149.1"
                     /db_xref="GeneID:4807353"
                     /translation="MLNLFSYDFMQRAFLAVIAMSLFSPILGTFLILRRQSLMSDTLS
                     HVSLAGVAFGLVLGLSPTLTTVLVVIVAAVFLEYLRTIYKNFMEIGTAILMSTGLAIS
                     LIVMSKGKSSSSMSLDQYLFGSIVTISREQVISLFVIAAVVLVLTFLFIRPMYILTFD
                     EDTAFVDGLPVRTMSILFNIVTGVAIALMIPAAGALLVSTIMVLPASIALRIGKNFKS
                     VILLANAIGFFGMIAGLYISYYAETPASASITIIFVGLFLLVNLVKKFMK"
     misc_feature    131857..132654
                     /gene="adcB"
                     /locus_tag="SSA_0137"
                     /note="ABC-type Mn2+/Zn2+ transport system, permease
                     component [Inorganic ion transport and metabolism];
                     Region: ZnuB; COG1108"
                     /db_xref="CDD:224033"
     misc_feature    131872..132648
                     /gene="adcB"
                     /locus_tag="SSA_0137"
                     /note="ABC 3 transport family; Region: ABC-3; pfam00950"
                     /db_xref="CDD:279318"
     misc_feature    order(131938..131940,131950..131958,132298..132303,
                     132307..132315,132319..132324,132328..132345,
                     132349..132357,132481..132483,132502..132504)
                     /gene="adcB"
                     /locus_tag="SSA_0137"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(131953..131955,131959..131961,131974..131976,
                     132115..132117,132121..132126,132133..132138,
                     132145..132150,132157..132159,132166..132171,
                     132175..132177,132208..132213,132220..132222,
                     132448..132450,132595..132597,132604..132609,
                     132616..132618,132625..132630)
                     /gene="adcB"
                     /locus_tag="SSA_0137"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(132175..132177,132250..132252,132424..132426,
                     132436..132438,132571..132573,132586..132588)
                     /gene="adcB"
                     /locus_tag="SSA_0137"
                     /note="putative PBP binding regions; other site"
                     /db_xref="CDD:119348"
     gene            132673..134175
                     /gene="adcA"
                     /locus_tag="SSA_0138"
                     /db_xref="GeneID:4807346"
     CDS             132673..134175
                     /gene="adcA"
                     /locus_tag="SSA_0138"
                     /function="General function prediction only"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 43.58%; Transporter classification
                     TC:3.A.1.15.3. Codon Adaptation Index (CAI): 0.806. LipoP
                     prediction: SpII. SignalP prediction: Yes (prob. 0.998);
                     Curator(s): M. Serrano"
                     /codon_start=1
                     /transl_table=11
                     /product="Zn-binding lipoprotein"
                     /protein_id="YP_001034150.1"
                     /db_xref="GeneID:4807346"
                     /translation="MKKISLLLAGLLSIFLVACSNQKKADGKLNIVTTFYPVYEFTKQ
                     VAGDEANVELLIGAGTEPHDYEPSAKAVATIQDADAFVYENENMETWVPELLKTLKNK
                     EETVIKATGDMLLLPGGEEEEDHDHGEEGHHHAYDPHVWLSPKRAIKMVEHIRDSLSK
                     SYPDKKAAFEKNAAAYIKKLEALDKEYEDGLANAKQKSFVTQHAAFNYLALDYGLKQV
                     PISGLSPDSEPSASRLAELTEYIKKNKIKYIYFEENASQALASTLAKETGVELDVLNP
                     LESLTEEQTKDGADYVSIMRANLKALKKTTDQEGAEIAAEKEEDDKTVQNGYFEDSAV
                     KDRTLSDYAGEWQSVYPYLKDGTLDQVFDYKAKLTGKMTAAEYKDYYDKGYKTDVSNI
                     NITDKTMEFVVDGKSKKYTYKYVGKHTLTYSKGNRGVRFMFEATDADAGEYKYVQFSD
                     HNIAPTKAAHFHIFYGGESQEALFDELENWPTYYPSKLTGQEIAQEMLAH"
     misc_feature    132673..133596
                     /gene="adcA"
                     /locus_tag="SSA_0138"
                     /note="ABC-type Zn uptake system ZnuABC, Zn-binding
                     component ZnuA [Inorganic ion transport and metabolism];
                     Region: ZnuA; COG0803"
                     /db_xref="CDD:223874"
     misc_feature    132748..133593
                     /gene="adcA"
                     /locus_tag="SSA_0138"
                     /note="Metal binding protein AcdA. These proteins have
                     been shown to function in the ABC uptake of Zn2+ and Mn2+
                     and in competence for genetic transformation and adhesion.
                     The AcdA proteins belong to the TroA superfamily of
                     helical backbone metal receptor...; Region: AdcA; cd01017"
                     /db_xref="CDD:238499"
     misc_feature    order(132859..132861,133087..133089,133279..133281,
                     133504..133506)
                     /gene="adcA"
                     /locus_tag="SSA_0138"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:238499"
     misc_feature    133630..134172
                     /gene="adcA"
                     /locus_tag="SSA_0138"
                     /note="ZinT (YodA) periplasmic lipocalin-like
                     zinc-recruitment; Region: ZinT; pfam09223"
                     /db_xref="CDD:286326"
     gene            134323..134766
                     /locus_tag="SSA_0139"
                     /db_xref="GeneID:4807886"
     CDS             134323..134766
                     /locus_tag="SSA_0139"
                     /function="Transcription"
                     /note="GC: 45.27%; Codon Adaptation Index (CAI): 0.756.
                     Curator(s): M. Serrano, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="copper transport operon or penicillinase
                     transcriptional repressor"
                     /protein_id="YP_001034151.1"
                     /db_xref="GeneID:4807886"
                     /translation="MEQQNISQAEWQVMRVLWAYPHSRSTEIIARLEADFSWKPATIK
                     TLLNRLKTKEFIAMEKIEGKFYYDARILEADHLESTWQALFDNICNTKHGDLLISMIE
                     RSQFSQGDLERLSQVIDKKRASAPLEIKCHCPQGQCRCGHGKETH"
     misc_feature    134338..134721
                     /locus_tag="SSA_0139"
                     /note="Helix-turn-helix domains; Region: HTH; cl21459"
                     /db_xref="CDD:304362"
     misc_feature    134338..134682
                     /locus_tag="SSA_0139"
                     /note="Penicillinase repressor; Region: Penicillinase_R;
                     pfam03965"
                     /db_xref="CDD:281898"
     gene            134766..137012
                     /gene="ctpA"
                     /locus_tag="SSA_0140"
                     /db_xref="GeneID:4806725"
     CDS             134766..137012
                     /gene="ctpA"
                     /locus_tag="SSA_0140"
                     /EC_number="3.6.3.4"
                     /function="Inorganic ion transport and metabolism"
                     /note="GC: 47.93%; Transporter classification
                     TC:3.A.3.5.1. Transmembrane domains: 8. Codon Adaptation
                     Index (CAI): 0.753. LipoP prediction: SpI.
                     Helix-turn-helix prediction: AraC. Curator(s): M. Serrano"
                     /codon_start=1
                     /transl_table=11
                     /product="copper-translocating P-type ATPase"
                     /protein_id="YP_001034152.1"
                     /db_xref="GeneID:4806725"
                     /translation="MSEKKEYKLSGMTCASCAMTVEMAVKDLETVEDVSVNLATERLS
                     LLPKAGFDSQQVLAAVAEAGYQAEEKGIAKPSDVNEEAVARTQALRRKKQELLILLLT
                     ALPLLYISMGSMVGLPLPSFLDHMAHPLVFVLSQLLLTLPAVWIGRGFYQRGFRNLIK
                     KHPNMDSLIAVGTSAAFLYSLYSVSQVFLGHHPFVHQLYFESVAVIIALVLLGKYLES
                     SAKGKTSQAIQSLLELVPSQATVIRYGEAVTIDTEDIRVGDIIRIKPGERMPVDGLVT
                     EGQTFVDESMMTGESVPIEKKVGDTITSATINQNGSIDYQATRVGSDTTLAQIVRLVE
                     EAQGSKAPIAALADKISLYFVPIVLSLATLSALGWYFLAGESLSFSLSIFVAVLVIAC
                     PCALGLATPTAIMVGTGKGAENGILIKSGQALEAAYQLNTIVLDKTGTITIGKPSLTD
                     LLPLSDFNRSDLLQLIASAEQHSEHPLAQAILEAAEEEGLDLLPVSHFEAIVGRGLSA
                     QVEGRQLLVGNESLMKEKSIDSSAFQEQLLELSQDGKTAMFVAIDGQLTGILAVADEM
                     KSSSLKAVQELQSMGLEVIMLTGDREETATAIAQKAGIQKVIAGVLPDGKATAIKNLQ
                     EAGKKLAMVGDGINDAPALVQADVGIAIGSGADVAIESADVVLMHSDLQDVVKAIKLS
                     QATIRNIKENLFWAFAYNTLGIPIAMGLLHLFGGPLLNPMLAGLAMSLSSVSVVANAL
                     RLGRFKMN"
     misc_feature    134772..137000
                     /gene="ctpA"
                     /locus_tag="SSA_0140"
                     /note="Cation transport ATPase [Inorganic ion transport
                     and metabolism]; Region: ZntA; COG2217"
                     /db_xref="CDD:225127"
     misc_feature    134781..134969
                     /gene="ctpA"
                     /locus_tag="SSA_0140"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     misc_feature    order(134799..134807,134814..134816)
                     /gene="ctpA"
                     /locus_tag="SSA_0140"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
     misc_feature    135375..136040
                     /gene="ctpA"
                     /locus_tag="SSA_0140"
                     /note="E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122"
                     /db_xref="CDD:278548"
     misc_feature    136347..>136442
                     /gene="ctpA"
                     /locus_tag="SSA_0140"
                     /note="CAF1 family ribonuclease; Region: CAF1; cl23804"
                     /db_xref="CDD:304961"
     misc_feature    136425..136826
                     /gene="ctpA"
                     /locus_tag="SSA_0140"
                     /note="Soluble P-type ATPase [General function prediction
                     only]; Region: COG4087"
                     /db_xref="CDD:226572"
     gene            137033..137251
                     /locus_tag="SSA_0141"
                     /db_xref="GeneID:4805910"
     CDS             137033..137251
                     /locus_tag="SSA_0141"
                     /function="Inorganic ion transport and metabolism"
                     /note="GC: 43.84%; Codon Adaptation Index (CAI): 0.758.
                     Curator(s): M. Serrano"
                     /codon_start=1
                     /transl_table=11
                     /product="copper chaperone"
                     /protein_id="YP_001034153.1"
                     /db_xref="GeneID:4805910"
                     /translation="MKQTVQLENLSCQNCVKHVTQHFLSMEGVSDVAVDLEKQTAQVT
                     TDKPYGASDYEAALAKTIYRVLDVAEAE"
     misc_feature    137042..137212
                     /locus_tag="SSA_0141"
                     /note="Heavy-metal-associated domain; Region: HMA;
                     pfam00403"
                     /db_xref="CDD:306833"
     misc_feature    order(137060..137068,137075..137077)
                     /locus_tag="SSA_0141"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
     gene            137370..137549
                     /locus_tag="SSA_0142"
                     /db_xref="GeneID:4806046"
     CDS             137370..137549
                     /locus_tag="SSA_0142"
                     /note="GC: 45.56%; Codon Adaptation Index (CAI): 0.721.
                     LipoP prediction: SpII. SignalP prediction: Yes (prob. 1);
                     Curator(s): M. Serrano"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034154.1"
                     /db_xref="GeneID:4806046"
                     /translation="MKKKALPFLLAGAALLAMTACSNGSATNQSETTTSSTGSVTSSG
                     GAGIQSINCSSIFSS"
     gene            137605..137940
                     /locus_tag="SSA_0143"
                     /db_xref="GeneID:4806217"
     CDS             137605..137940
                     /locus_tag="SSA_0143"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 46.13%; Codon Adaptation Index (CAI): 0.83.
                     Curator(s): M. Serrano; T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034155.1"
                     /db_xref="GeneID:4806217"
                     /translation="MDISALANGNYASVKGTWQDASGNQLVFDDKGLVSSGYELYGAS
                     LTDYGTAAGGVYGGESGGFLIEFLPKGVKVADKENFTDNSDAGQDRIWTGVGLNSFDE
                     QGSFYYRVD"
     gene            complement(138083..138655)
                     /locus_tag="SSA_0144"
                     /db_xref="GeneID:4806766"
     CDS             complement(138083..138655)
                     /locus_tag="SSA_0144"
                     /function="Transcription"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 38.74%; Codon Adaptation Index (CAI): 0.795.
                     Helix-turn-helix prediction: AraC. Curator(s): M. Serrano,
                     J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="YP_001034156.1"
                     /db_xref="GeneID:4806766"
                     /translation="MPQDTRDKVVNALIELAEQNPEKSYFTFSEIAKQAGLSRQAIYK
                     KHFSNVEDIIQYIRQTIMTPFLPLYESYEEGNGENPFCFFAQHMIPTLYEHRKWMKVL
                     YTTAIDPFWSDYLSTFFTQWVVQNLEIDSKKLGIPKEMATEIVVRWINSLIEIWIIKE
                     DPMPAEDFAKLFLNVISTPMDQFITPHSES"
     misc_feature    complement(138128..138652)
                     /locus_tag="SSA_0144"
                     /note="DNA-binding transcriptional regulator, AcrR family
                     [Transcription]; Region: AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    complement(138485..138622)
                     /locus_tag="SSA_0144"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:278848"
     misc_feature    complement(138185..138409)
                     /locus_tag="SSA_0144"
                     /note="Transcriptional regulator C-terminal region;
                     Region: TetR_C_8; pfam14278"
                     /db_xref="CDD:290976"
     gene            complement(138868..139470)
                     /locus_tag="SSA_0145"
                     /db_xref="GeneID:4807990"
     CDS             complement(138868..139470)
                     /locus_tag="SSA_0145"
                     /function="Transcription"
                     /note="GC: 40.8%; Codon Adaptation Index (CAI): 0.764.
                     Helix-turn-helix prediction: AraC. Curator(s): M. Serrano,
                     J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="YP_001034157.1"
                     /db_xref="GeneID:4807990"
                     /translation="MALNTRDRILDAFFELADKQPDRSRFTFTEIAKEAGLSRQAIYK
                     RHFNNTTEIIEYIRQDMVKQAFAPNWNSNNAEADLDPFTFLAQTILPAIYEQRQRIKI
                     LYTSSVDPLWSDFITASYKDWIEQNLNLDHQKLGIPEDLANQLLAGWISSLIENWITQ
                     DDPVPCKQFSKTFLNLVSSPLTSFAAYDSPAGPSNKIVIA"
     misc_feature    complement(138988..139458)
                     /locus_tag="SSA_0145"
                     /note="DNA-binding transcriptional regulator, AcrR family
                     [Transcription]; Region: AcrR; COG1309"
                     /db_xref="CDD:224228"
     gene            139826..142219
                     /locus_tag="SSA_0146"
                     /db_xref="GeneID:4808086"
     CDS             139826..142219
                     /locus_tag="SSA_0146"
                     /function="General function prediction only"
                     /GO_component="GO:0016020 - membrane"
                     /note="GC: 44.57%; Transmembrane domains: 1. Codon
                     Adaptation Index (CAI): 0.772. LipoP prediction: SpI.
                     SignalP prediction: Yes (prob. 1); Possible ATPase
                     involved in DNA repair, contains Gram-positive anchor.
                     Curator(s): M. Serrano, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair ATPase"
                     /protein_id="YP_001034158.1"
                     /db_xref="GeneID:4808086"
                     /translation="MKRTEKVLRYSIRKSVLGVGSVLICALFLGHSMVAADEEQPVAN
                     AVETPAAASPVNQDLTTVREAANTEVGTFLAEKVTDLGNNPNLSDEELAAAKEEVNQT
                     AAKAQNEIAAAEDKERIDQAKEDGLADINSVNPVGKDLLLDEIQNGKAEFDKLVDSSD
                     LLPEEQKKSFQESVRKKAAEAEDAIQKLDVNAATAEQAEVIQEQAVTEEDKFFKFIAS
                     STVDFTLAAKLADLEANPNLSEAEKKAVRGEIEQVVEAAKKAIEGADSQEVYDREKET
                     AIARLAKIHPIGKEQFLKEIQEEKTATIEAVEKSQSLSVEEKTAAKKKIEDAAAIAQK
                     AIAAYNAWVESPDDAEKIQEQVAAEKQGLLKATTGLKLDLALSDKLADLRSNPNLSDA
                     ERATAKAEAEATLADAKTALEKADAEEELERIEEAGIASLDTIHPVGKDLVLDELEEE
                     VDKQIEAIEHHQRLSELDKKQAKEKIRAVLKTVTDAIAQLDDSVDSAEKAEKLQEQIA
                     AEQTKALENLEAIVKNAAKAKTASSIPSDSPQETRKEFSGGVSDSEPAIATASEYDLS
                     SHEVGTHPDTAPQSSVQPEFSGNVNDSEAPTATWPEFTGGVNDSETITATESEYDLSS
                     HGVGTHPDTAPQSSVQPEFSGNVNDSEASTATRPEFSGGVNDSEPTMTENNTYDAGVQ
                     PSVRSAHPDSAPQMAALPEFTGGVNAADAAVADALPAYQVTSGILPAVDGAKSVQEQS
                     SSAKVTQPAQLKNKEGKSDASVLPHTGQASNALLTVAGVISALGTAGLSLRSRKKED"
     misc_feature    139841..139915
                     /locus_tag="SSA_0146"
                     /note="YSIRK type signal peptide; Region: YSIRK_signal;
                     pfam04650"
                     /db_xref="CDD:282500"
     misc_feature    140054..140239
                     /locus_tag="SSA_0146"
                     /note="Domain of Unknown Function (DUF1542); Region:
                     DUF1542; pfam07564"
                     /db_xref="CDD:284892"
     misc_feature    140507..140692
                     /locus_tag="SSA_0146"
                     /note="Domain of Unknown Function (DUF1542); Region:
                     DUF1542; pfam07564"
                     /db_xref="CDD:284892"
     misc_feature    <141146..141448
                     /locus_tag="SSA_0146"
                     /note="Uncharacterized protein conserved in bacteria
                     (DUF2317); Region: DUF2317; cl19511"
                     /db_xref="CDD:302887"
     misc_feature    142094..142198
                     /locus_tag="SSA_0146"
                     /note="Gram positive anchor; Region: Gram_pos_anchor;
                     pfam00746"
                     /db_xref="CDD:279132"
     gene            142397..143527
                     /locus_tag="SSA_0148"
                     /db_xref="GeneID:4806538"
     CDS             142397..143527
                     /locus_tag="SSA_0148"
                     /function="Carbohydrate transport and metabolism"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 47.21%; Transporter classification
                     TC:3.A.1.1.2. Codon Adaptation Index (CAI): 0.77.
                     Curator(s): M. Serrano"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="YP_001034159.1"
                     /db_xref="GeneID:4806538"
                     /translation="MVELNLKNIYKKYPNSDHYSVEDFNLDIKDKEFIVFVGPSGCGK
                     STTLRMIAGLEDITEGTASIDGTVVNDVAPKDRDIAMVFQNYALYPHMTVYDNMAFGL
                     KLRKYSKEDIDKRVNEAAEILGLKEFLQRKPADLSGGQRQRVAMGRAIVRDAKVFLMD
                     EPLSNLDAKLRVSMRAEIAKIHRRIGATTIYVTHDQTEAMTLADRIVIMSATKNPAGT
                     GTIGRVEQIGTPQEVYNNPVNKFVAGFIGSPAMNFIPVKLEGNEIVAEGLRLTVPEGA
                     LKVLREKGYEGKELIFGIRPEDINAEAAFLETFPNSVVHAKISVSELLGAESHLYCQV
                     GSSEFVARVDSRDYLETGAGIDLGFDLNKAHFFDPETEKTVY"
     misc_feature    142397..143515
                     /locus_tag="SSA_0148"
                     /note="ATPases associated with a variety of cellular
                     activities; Region: AAA; cl28181"
                     /db_xref="CDD:333001"
     gene            143714..143893
                     /locus_tag="SSA_0149"
                     /db_xref="GeneID:4806504"
     CDS             143714..143893
                     /locus_tag="SSA_0149"
                     /note="GC: 41.11%; Transmembrane domains: 2. Codon
                     Adaptation Index (CAI): 0.82. Curator(s): M. Serrano"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034160.1"
                     /db_xref="GeneID:4806504"
                     /translation="MGSSWYHLLGNDYVRLLILDLVFTFYVLLGIRKKHFPYWALLVP
                     SLTLFLGYQIWRLLW"
     gene            144076..145287
                     /locus_tag="SSA_0150"
                     /db_xref="GeneID:4806261"
     CDS             144076..145287
                     /locus_tag="SSA_0150"
                     /note="GC: 43.23%; Codon Adaptation Index (CAI): 0.777.
                     Curator(s): M. Serrano"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034161.1"
                     /db_xref="GeneID:4806261"
                     /translation="MKRIKEIERTHPDVKKVVKNGLTIDSKYVASLLETDKDWLETAD
                     RIPRSLEGYANAVGRNFNRHDIGNKAKETAALSSIISCRAVGIIDSAKHVSESQGQVF
                     FEDIVICRPTKKEYQGLTIYVPQHIAGFYQPTDLRRMVGQVFPVKIIDLKQVVFAKRY
                     DALKKQEDQPLENEYVALGDINIAEYLLNSQVLQELEEGGEHSPIHDVQKGMINYISD
                     NGVFVLTANLERVFIPNKLFSYRYHSRVLKTEDYAAIGELVDFKFLRGRYEQADDKRQ
                     RLGIEGNSPNLVGERLSLEKDPEAVVRDFIDAGPGTVASGYITDFNEIKGHYFEMDGA
                     YGYPVRLVANERLTPQLFQRKQKISVVLRQGSYETVTDKAGKSYLKIRATVVYNSTFS
                     EHAGLEDFFDR"
     gene            145494..145931
                     /locus_tag="SSA_0151"
                     /db_xref="GeneID:4805883"
     CDS             145494..145931
                     /locus_tag="SSA_0151"
                     /note="GC: 40.87%; Transmembrane domains: 4. Codon
                     Adaptation Index (CAI): 0.79. Curator(s): M. Serrano"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034162.1"
                     /db_xref="GeneID:4805883"
                     /translation="MYYVIIVAEIIIGLAIIISGIGWVVGDQTNNVERKRKSGLAFLI
                     SVSLFYIFRFGSIAVLALLFSKGSLPGMEEKSLVYLLRILQVLILALVPTFSIIQHYI
                     YRYQYLIIEREESRQRQRLYFYVAFAMTAGIVGLLEIMIGLVK"
     gene            145939..148791
                     /locus_tag="SSA_0152"
                     /db_xref="GeneID:4806723"
     CDS             145939..148791
                     /locus_tag="SSA_0152"
                     /note="GC: 42.87%; Transmembrane domains: 4. Codon
                     Adaptation Index (CAI): 0.786. Curator(s): M. Serrano, J.
                     Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034163.1"
                     /db_xref="GeneID:4806723"
                     /translation="MLFLLSKLPYKLKGHRSIDYVIFLLRKVIWALFLFGTASLTGVM
                     LLAVMRKQVSFGLFLFLFIVLFLSVFLSLYLGLWHTNLTSRQRYLLFKERKDFKENDR
                     SQTMRRYIFLSFLSALISSIDIIVLTLNNYIIAMLNQMYVAASDFLKEGNTYFDYKTL
                     SPLIGNQFWNTLLLIAPVFLFVYLLYNSYSSEIVVYDDMMKRWLKKRFFKHKKVTHLF
                     NDLDRDGDAYIRLGRNSDIGDDVILKTDVRRLHTAGFGPIGSGKSVAIAKPTIVQDAR
                     NVTVYLREYAKFIQEQDQQIAALGISDEQTLLETKRDFYEKWYEKGLGKQLINGFYVN
                     EPSGDLIHDAVNIIKRTGFPEEMIWLVDPTKEDTDGINIFDAETNTAAGLTSDLIRNF
                     ADEGGSSGGNTFFKNAEQAYVRNLVFMLKSTSRIENSYLDVNLNGGSPTLSEFYDLLE
                     IPSLVIKRLKLFKVYRDASEREFQRLYERPYQELYNLEKEEFVKQGGLPSRFDSHMSP
                     KLRKAFNQKRDAESKNKIINTTYHYFADAYKEDPRTGVEYITHDANIEGMKNTIRKLA
                     SSDLVRRIFFSQSTKDIDILLKTGGFLLVNTARGPVDDDSSRMIGQITDMIVQKGVLR
                     RNSSTLDPFFSIIEDEYGWVTTPNTERFLNQCRKYNTAVLGLYQNYEQIEASLGASDT
                     AALLNSYRNIFVFQGSSNKSTETIVERAGTEKKVSRMTNKGSVDMLAGNDNNASSYRE
                     EIAEEDVTNSSELFRLEKFQFAGVHVIDDEESELVKVTPTPSFELPIFKDPNYKAPFN
                     IEENEEDRRAYEIWKEQVERYYVERHSEGVIPFDRFTPEEQRIILGLDEEHESLEKPR
                     KNKAKRSSEGGKQSAASKSIDHKGKSRPAVQKSSQESGLSDRPVEPASAQPSSSEPVT
                     NSILDAQSKDDAPSIKASSEAAKAHVSKKYNPMMDD"
     misc_feature    <147877..148218
                     /locus_tag="SSA_0152"
                     /note="P-loop containing Nucleoside Triphosphate
                     Hydrolases; Region: P-loop_NTPase; cl21455"
                     /db_xref="CDD:304359"
     gene            148817..149563
                     /locus_tag="SSA_0153"
                     /db_xref="GeneID:4806541"
     CDS             148817..149563
                     /locus_tag="SSA_0153"
                     /note="GC: 42.7%; Transmembrane domains: 3. Codon
                     Adaptation Index (CAI): 0.737. Curator(s): M. Serrano"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034164.1"
                     /db_xref="GeneID:4806541"
                     /translation="MTTEPQSSLTKKDDIAVLGGFILTLCFAWFLWQYRINIGHRLIW
                     SSVLSLSFPFFYLIFAYHYLVSRTSARLPLLFGKKYRQASDMKLSLACLCFVFLLLLL
                     GGVVSSFFSNQFSFDKTIFIRKDSQQAKQIFSMEAGSYPELLEKIESKDKRVILFYKL
                     ACRKCQRAVPELLAQVQDQDKLLFIDISSEAGGKAAQRYGVDQAATAMVWGDRGYKLY
                     SLATKEDDERITLNQAELDYVVQILNIDNK"
     gene            149976..151010
                     /locus_tag="SSA_0154"
                     /db_xref="GeneID:4806584"
     CDS             149976..151010
                     /locus_tag="SSA_0154"
                     /GO_component="GO:0016459 - myosin"
                     /note="GC: 38.94%; Transmembrane domains: 1. Codon
                     Adaptation Index (CAI): 0.811. Curator(s): M. Serrano, J.
                     Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034165.1"
                     /db_xref="GeneID:4806584"
                     /translation="MDNKKNNNDALDVFVEKYIVGNVVVQTLKRRAILRKFLTFLVLI
                     SMWLFLLINAYLSPQRIEYTEAQLATSRDFENDSGRIMLTKQVYSEKNGILLLEFETS
                     DYTSSIAKGINAKNLEWMLYAKKQGEDTKMEVIPLANHKIDVIVRNVPEDFEAIALNI
                     TNKTMANKDVDVDIEEYNDITSSETRYSSNKKKKKTDTAELSNEVQFMVAAQSDKLKH
                     AYLQDLSREKFALNAFEEEKKFQMKQIEKLQKAIEKLEASIEENRTTLEDLERSGQYL
                     VGSNLTENQEKIENVEKEINGKQMKINQAKDNISTLQNAVDALDRSMQEVHDGTYQFN
                     APITSVEMDF"
     misc_feature    <150531..>150959
                     /locus_tag="SSA_0154"
                     /note="RecF/RecN/SMC N terminal domain; Region: SMC_N;
                     cl25732"
                     /db_xref="CDD:330553"
     gene            151101..151466
                     /locus_tag="SSA_0155"
                     /db_xref="GeneID:4806120"
     CDS             151101..151466
                     /locus_tag="SSA_0155"
                     /note="GC: 40.98%; Transmembrane domains: 2. Codon
                     Adaptation Index (CAI): 0.721. Curator(s): M. Serrano, J.
                     Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034166.1"
                     /db_xref="GeneID:4806120"
                     /translation="MSEENNYENRPYGFPRDLFASVKLYGIRLFSLLFVFGAPILAMQ
                     FTGSGKVFPKQQAVEYISFVVLTFIIALYLMFPFNGGKNNLHAIRIFLTRRRKRYQSI
                     DRMRSKEVAKTEKRGIGRR"
     gene            151466..153382
                     /locus_tag="SSA_0156"
                     /db_xref="GeneID:4806040"
     CDS             151466..153382
                     /locus_tag="SSA_0156"
                     /function="Posttranslational modification, protein
                     turnover, chaperones"
                     /note="GC: 44.5%; Codon Adaptation Index (CAI): 0.78.
                     Helix-turn-helix prediction: AraC. Curator(s): M. Serrano,
                     J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="chaperone ATPase"
                     /protein_id="YP_001034167.1"
                     /db_xref="GeneID:4806040"
                     /translation="MLQTEKLQQKEEYQEEIMPDTLKFQDPVSIEEEESLTPYLDKYT
                     ENVTEKIRKKIDNFTVFGRDKEVEQVIVSLLRQTKNSPILVGEAGTGKTAIVDGLVVE
                     ILKGNVPDEFKHVTVRSLELSNISSKSDGEDMVSRLKRIIEELKVTKGENILFIDEVH
                     TIVGAGGDGSMLDAGNVIKPPLARGEIQMISATTYEEYQSSIETDKALERRVQMVPVE
                     EPTEDQAIFILGNIRRRFEKERNITITDDAVEQAVRLAVRYIPERFLPDKAIDLLDDA
                     TAQAYFEKRKVVDIEDIARVIQKMKKIPVTTILKDDSERLMNFTDELKKYVKGQDFAV
                     SQVANTIYISKEGFQRPNKPLGSFLFLGTTGVGKTELAKALAKILFDNVDAMIRIDCS
                     EYSSKGDKDKLIGKNIVGSKGLLTEPVKNNPYSVVLLDELEKAHPDIYDILLQVLDEG
                     HLTTGTGRKINFKNTIVIATTNSGADEIKKTYANEGNFGEMTDLAYEGFMNRIVEELS
                     LTFRPEFINRFGNKVVFNMLTADIIEAIVDLAWKKEEKRLAEQKVYLQYEDKAEFYDF
                     LRSKGTSVENGARPLERLIQDRVTGPIAEKLFLLQRRGAKYNVLIKVIGEAPDGIFHH
                     IDKRTLDFEATKVE"
     misc_feature    151556..153256
                     /locus_tag="SSA_0156"
                     /note="ATP-dependent Clp protease ATP-binding subunit ClpA
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: ClpA; COG0542"
                     /db_xref="CDD:223616"
     gene            153653..153937
                     /locus_tag="SSA_0157"
                     /db_xref="GeneID:4806661"
     CDS             153653..153937
                     /locus_tag="SSA_0157"
                     /note="GC: 44.56%; Transmembrane domains: 2. Codon
                     Adaptation Index (CAI): 0.807. LipoP prediction: SpI.
                     Curator(s): M. Serrano"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034168.1"
                     /db_xref="GeneID:4806661"
                     /translation="MTALAAFLTSSPVFAGGKNPFDSVNQGADKATQNFTALGFTIAV
                     AMLVVAGIGLMLSQKMREWAKGHIVYVIIGVVVIVLASQAVPFIQQMFGG"
     gene            153941..155134
                     /locus_tag="SSA_0158"
                     /db_xref="GeneID:4806548"
     CDS             153941..155134
                     /locus_tag="SSA_0158"
                     /note="GC: 42.04%; Transmembrane domains: 1. Codon
                     Adaptation Index (CAI): 0.795. Curator(s): M. Serrano, J.
                     Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034169.1"
                     /db_xref="GeneID:4806548"
                     /translation="MAGFGLGKGGVIKDSSFVYIEWEGKDSPKHNAAIKDLIEDLDEE
                     HFLDTGTMEDSLPYLTFLQAEVLFRALRDQFGDFTFAKVSLANNESGKPSIEDEPSIS
                     PFLIDHTYDNLMTKLMEASLRDPRFKEYTYDDLALYFTDKENGILRTYAESLGLSQAD
                     LPYFPIESDVQGALQRASSKKIRNKGVSEMGEQNPLLSKIALGLGIAGLLIGLVGVVI
                     GIMGNNKRAELEAQTAYLYQEQQNIQKLQAKEHAADVFGRFFIPNYYSGNKEALNPFL
                     SSGDAKYTQPEQAQVISNLLESVKLEKDGSFTLTYVITFSTAEGVNKIKRLSFGIKED
                     SKAEYGFLITSEPVTSIYISEKKADEENSEKQSEEGDKKPETEGSSDKSQPSESSQAS
                     SEEGK"
     misc_feature    154670..154996
                     /locus_tag="SSA_0158"
                     /note="C-terminal domain of transfer protein TraM; Region:
                     TraM-like; cd16427"
                     /db_xref="CDD:319758"
     misc_feature    order(154691..154696,154703..154708,154712..154717,
                     154763..154765,154823..154834,154868..154870,
                     154874..154876,154880..154882,154910..154912,
                     154955..154963)
                     /locus_tag="SSA_0158"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:319758"
     gene            155140..157116
                     /locus_tag="SSA_0159"
                     /db_xref="GeneID:4806771"
     CDS             155140..157116
                     /locus_tag="SSA_0159"
                     /function="Intracellular trafficking and secretion"
                     /note="GC: 40.92%; Transmembrane domains: 7. Codon
                     Adaptation Index (CAI): 0.785. Curator(s): M. Serrano, J.
                     Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034170.1"
                     /db_xref="GeneID:4806771"
                     /translation="MGTRYENLQDLFSKAPPIRAGGVGDKWTYNAPETQAGANFYVQW
                     SNYLSSIPQVFAYFLYLPGWITKALYSISLSLETIYNNLFKLFGFFDYLEKNDTFIGQ
                     IFDGLQKLGIVVFVLLLIMFVTANFVTGLARYKDIISHFLLVTAVVGLLPQAIKQFSG
                     FLARDAQTVRTMSDDGKSGFTSLSLKPYEKNVVDLYVVIQNKFDINVLGMDSKGFLNP
                     SETKLNNLSDDNLLQTDFAAWYGGTDQEVLKEFDNNSELKGVGHLLSSVLISNEPDNV
                     RIAEVKPGFWSDLENVFSAVYLRYNVNWIGLIVQQIILIALLISMSIKFVQSVFQVIV
                     AGMIAPIVGYTSVENSDKFKELLQTIFGTITGIFFEVILLRVAMSILRDFPTILVKGI
                     SGLSEDGFSTGLGYWENIMASIIIYAGVYFALTSGNSAVERWLGVSPSQGGGSKLAGM
                     AGAGMAAGAAASRSGMKMAKAAPGVAKKSARGVGTAARKAVGGAKGAARGAGAAVKGI
                     GAGAARTVGGAKGAMEGIKQAGGVGKAAANLGSHAKAGIDSAYDSAKNSVKGTAEGVK
                     NSVKNVGSAARENYNAGRTAVSNTLASGANSKAGTKSEASGVGNAATNANKPNQAKQG
                     IGGASGSQISNNTNNKPSSSSNNGGINKNDSGKK"
     misc_feature    156760..>157029
                     /locus_tag="SSA_0159"
                     /note="Synuclein; Region: Synuclein; pfam01387"
                     /db_xref="CDD:279696"
     gene            158875..159579
                     /locus_tag="SSA_0160"
                     /db_xref="GeneID:4806384"
     CDS             158875..159579
                     /locus_tag="SSA_0160"
                     /note="GC: 40.57%; Codon Adaptation Index (CAI): 0.785.
                     Curator(s): M. Serrano, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034171.1"
                     /db_xref="GeneID:4806384"
                     /translation="MALKKPSSSKKMGKKKKQETTGNGNSRLGKIAENQFSYDTKEFE
                     NRDFLSTVELLDTKAILNNVKGQPIALENGYSGYLQIMEVRGKDLNSLSDNERQRTIQ
                     NFRKWNSEITFDYMFESTTLPTDTSEQIIESRRILNEVRREMSKTGISENRMEQLKDR
                     ESILMQNILSEEAVEQELYNAEFLIWLYGDTIEDLHRQVRKAQTSGNGDFVPVIVSAS
                     KKEQILKQYNNQNEKV"
     gene            159585..161522
                     /locus_tag="SSA_0161"
                     /db_xref="GeneID:4805991"
     CDS             159585..161522
                     /locus_tag="SSA_0161"
                     /note="GC: 43.5%; Codon Adaptation Index (CAI): 0.788.
                     Curator(s): M. Serrano, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034172.1"
                     /db_xref="GeneID:4805991"
                     /translation="MFLKKRKVKKLIARGYDLPFISRIQPQGNIDFKSDDRYWKSGDG
                     YHATLFVTGYPTGGLNDYWGTELMQVQGTRAFMHVTHLDNKLVQEKASKAVEEKSSRI
                     DENQKATKNQAELDEVQDLMLLEQDIRHNNSGVKGIWTRIYASGNTEKELFEKMSEIK
                     NGAPKFSMTSFIGEQDIEYHSPFVPPLRQKDLPNHRQPQPVPVRDLSGGYWFNHTKLA
                     DPHGTYFGYTPTSGAVNLDFLQNDDIRTRPFMFVAGAPKMYQKKFVLKHTDSLYARGH
                     KIINIDLDGTFHDLTKFQYGKVLSMSGGANKINIMQVLPTMTKENGVEVDEIGSFRLH
                     VAKLKSIAQVLNQEITSDDLLRLEDLITDFYVSIGLWQHNAEKNAEKIHITTIVNDEH
                     PRLSQFCSFLEQRYRAAGKAGNDHDTRSVGRISKTFSSLNKNYGPIFDVYTNFEDLSE
                     EQVVTIDLSELTKTPMLLNLQLTQVLSLISSYVVNNGKIQRQKRKQNLSLTHDQLTHY
                     VINISSAQMVLDIRYSQSVTFLADMIEEMGTNYAGVVLEMSSLQNVLVASGNTTLDIY
                     ASSIRRIFSLMQYRVFANTDETTVHLLADALRESMTESELETLPNLVQGQLFLNIAGH
                     GNVVFNQEFLGNELERYASVD"
     gene            161531..162199
                     /locus_tag="SSA_0162"
                     /db_xref="GeneID:4805871"
     CDS             161531..162199
                     /locus_tag="SSA_0162"
                     /note="GC: 41.7%; Transmembrane domains: 3. Codon
                     Adaptation Index (CAI): 0.785. SignalP prediction: Yes
                     (prob. 0.496); Curator(s): M. Serrano, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034173.1"
                     /db_xref="GeneID:4805871"
                     /translation="MLVLRFNNWFYSTKTLKTFFWLRWIATVAFGAAFLLGFGLNLAY
                     LMALSGGRLVTMTFSVSLIVGAVVLCFLLAQGKYQAIVPVLLLTFLPSTLLTEFGVTA
                     DLYLLLLLFICYLESVHRRFVVSVIAKLSKEFSPIYSKRLNNKKQYRAYRHAYMVLEL
                     LNPDDFRLTKEVTKTVSDKVTGLNEKEITRTFKIKGVWGSTTITDELYTSPQKGRFSV
                     RRKI"
     gene            162267..162602
                     /locus_tag="SSA_0163"
                     /db_xref="GeneID:4806191"
     CDS             162267..162602
                     /locus_tag="SSA_0163"
                     /note="GC: 41.37%; Transmembrane domains: 1. Codon
                     Adaptation Index (CAI): 0.743. Curator(s): M. Serrano, J.
                     Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034174.1"
                     /db_xref="GeneID:4806191"
                     /translation="MVKYRLVRPDVKKAERHEEREAESSHSTKRRIRGPISLYKDTVE
                     SYRAKKESVSNYYQNMVDEQKTYYDHGDDWQIQEQYKRDREFIKKLLKYGLVVAVLVV
                     LYWLLRTFF"
     gene            162618..164057
                     /locus_tag="SSA_0164"
                     /db_xref="GeneID:4806280"
     CDS             162618..164057
                     /locus_tag="SSA_0164"
                     /function="Cell motility and secretion / Intracellular
                     trafficking and secretion"
                     /note="GC: 45.49%; Transmembrane domains: 1. Codon
                     Adaptation Index (CAI): 0.777. SignalP prediction: Yes
                     (prob. 0.993); Curator(s): M. Serrano, J. Alves; possible
                     function in cell wall glycoprotein metabolism"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034175.1"
                     /db_xref="GeneID:4806280"
                     /translation="MVSETAKKAAKKAVKGAVKKAIFLKVFLWIGIPVLLILLIMFLL
                     AAILMGGGAESSGGSSDCNPSGQTSPNTTEETTSANSSIEEFVKQHEKAYLDSWKVGG
                     FLPSASIVQTQIETSFDQSVPSFGKAHNMGGVKWNKRSDFTQTISLYGNSSVAESGPG
                     TNVGDGTGGEYAFFSTFDSGIVGKAEFMKNQTLYKGAINNTDGISTLSAIADGGWATD
                     PSYKTKLHDLYNSLGSKFKWLDEKAISQYGSSPVAATSSGGDSSGSETDSGSPSSSRP
                     KKKGCNDGSSTGTNGDAVDGSGKVPEDITAAIYTPSTLPASLNPYLLDPRAFGMEYGG
                     SGANWEHPDEFYLAGQCVNLTISFGNILWGHKGVVIGNGIDQADAWARIFGNSTKKAP
                     KKGAIFSCLSDSGNPAGHTGIVCHVFEDGSILTCEQNSMVSGTNAGKPFTWHYCVIRP
                     AEQAEKHYEFAYPDDREPNLGGNKTGASN"
     misc_feature    162891..163316
                     /locus_tag="SSA_0164"
                     /note="Mannosyl-glycoprotein
                     endo-beta-N-acetylglucosaminidase; Region:
                     Glucosaminidase; pfam01832"
                     /db_xref="CDD:280078"
     misc_feature    163653..163904
                     /locus_tag="SSA_0164"
                     /note="CHAP domain; Region: CHAP; pfam05257"
                     /db_xref="CDD:283032"
     gene            164078..164683
                     /locus_tag="SSA_0165"
                     /db_xref="GeneID:4806299"
     CDS             164078..164683
                     /locus_tag="SSA_0165"
                     /note="GC: 41.58%; Transmembrane domains: 1. Codon
                     Adaptation Index (CAI): 0.725. LipoP prediction: SpI.
                     SignalP prediction: Yes (prob. 0.999); Curator(s): M.
                     Serrano, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034176.1"
                     /db_xref="GeneID:4806299"
                     /translation="MNPRKKRKLMITLICLGTVLFIAMLVTVFLNRQARKKAREAEIS
                     QTSSTDGSSESYSSQSYREPTPNEKNYQHARATLERPESVVTEEKKNKVAEALKIAIE
                     DIKKHPDTANISGNMDNRLASTSSPMVLTFAMAINLAGYNIDESKTEVFKSYSDDVLQ
                     FLCVMTKEGKENSYFVGNYNDYTGQLQIASYHGGNIRVRGD"
     gene            164781..165206
                     /locus_tag="SSA_0166"
                     /db_xref="GeneID:4806553"
     CDS             164781..165206
                     /locus_tag="SSA_0166"
                     /note="GC: 39.67%; Transmembrane domains: 2. Codon
                     Adaptation Index (CAI): 0.748. Curator(s): M. Serrano, J.
                     Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034177.1"
                     /db_xref="GeneID:4806553"
                     /translation="MHSHLNAIELDHLIEQCQSGELNAADLDPLLVYEMELRINERLA
                     EDQEPLMFTFHEVAYNGFVPEAHSVWVRDRDYVRLFGFLFFTVALILLSLWIFSGGSL
                     FSGKNFQSILNLLFLSIVTFLMLLLVSNKPEDDLEKEDQ"
     gene            165394..166395
                     /locus_tag="SSA_0167"
                     /db_xref="GeneID:4807682"
     CDS             165394..166395
                     /locus_tag="SSA_0167"
                     /note="GC: 50.2%; Transmembrane domains: 2. Codon
                     Adaptation Index (CAI): 0.764. LipoP prediction: SpI.
                     SignalP prediction: Yes (prob. 1); Curator(s): M. Serrano,
                     J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034178.1"
                     /db_xref="GeneID:4807682"
                     /translation="MKKNKIILLSASVLLAASIGVNLVYADDPNPVTPPSDERPVQPT
                     PPVDNNGNNNQPTPPPADNNGGNDNGGNNGGNNNGGGNNQPTPPSDDGNPVQPTPPVD
                     NNGNNNQPTPPPADNNGGNGGNNNGGGNNQPTPPSDDGNPVQPTPPVDNNGNNNQPTP
                     PPADNNGGNDNGGNNGGNGGNNNGNNNQPAPPPADNGGNNGGGNNQPTPPSDDGGPIQ
                     PNRPGQPKQPDPKPAVPDPSDQQPAPKAPSKPKASQKPADQVAKGNGAEPNAADPTIS
                     VQGSAENSNNKAKENKPVATPAAPVLPATGTNQSFLALIGTVMLSVLAFVGFKRKKN"
     misc_feature    166294..166392
                     /locus_tag="SSA_0167"
                     /note="LPXTG-motif cell wall anchor domain; Region:
                     LPXTG_anchor; TIGR01167"
                     /db_xref="CDD:273478"
     gene            166597..167577
                     /locus_tag="SSA_0168"
                     /db_xref="GeneID:4806563"
     CDS             166597..167577
                     /locus_tag="SSA_0168"
                     /note="GC: 40.37%; Codon Adaptation Index (CAI): 0.801.
                     Curator(s): M. Serrano, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034179.1"
                     /db_xref="GeneID:4806563"
                     /translation="MAIVPSCFSKDYYQSFYMSRLHPSRSFPFRLNGLYEISYQNEAD
                     FLLVGRELSQLEKDILVFIARFRNVQKLHIQKEMGSNVSGKRIEKAVQKLCQYFLIET
                     WEFPRQDKPEVSAAAYSISQNGYRLLRYFQLIEQQEYYKQENLFEDDLYQPLRFWKIV
                     DTYQIFKLSAHYKGFLPQKMLAPQPYTIKQTKKKTNSLGEEKKTQTERQIFLRQALLQ
                     GELLFENPRLQYVFDLYPLVTEADLEELLLILQHWSVLEDPYRYLVLIVDSWDRVEEV
                     SHKYDLSAYEANILFFDLDSAQHEDLQSSLYQFDADSRSYSLLPFKLRIQ"
     gene            167881..168075
                     /locus_tag="SSA_0169"
                     /db_xref="GeneID:4807822"
     CDS             167881..168075
                     /locus_tag="SSA_0169"
                     /note="GC: 33.85%; Codon Adaptation Index (CAI): 0.743.
                     Curator(s): M. Serrano, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034180.1"
                     /db_xref="GeneID:4807822"
                     /translation="MKQKPDDKKYLVIHGEKLIQEIAQDFPVVIQEYDGTKVGLVKID
                     NPEQLPEKLKVLFEDGIEIL"
     gene            complement(168220..168798)
                     /locus_tag="SSA_0170"
                     /db_xref="GeneID:4806515"
     CDS             complement(168220..168798)
                     /locus_tag="SSA_0170"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 37.65%; Codon Adaptation Index (CAI): 0.777.
                     Curator(s): M. Serrano, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034181.1"
                     /db_xref="GeneID:4806515"
                     /translation="MEIKIIFLEDKLKYFRKQSKDEQNQEIINCMLLGYSPYNMCLEI
                     GINVYGGQRPISKSLSKEFSEEEVDEIFETYYRLLYFPLLQFEEGLMTKRFIDKCNDF
                     LKSLTYQNFINYLKDPAIIIAEHLIDTDILARFFSREMQQKQIKKVEAELGIEFNVRD
                     KITSWLRKANVMYYKGQYIDMKTQEPLTFVYE"
     gene            complement(168855..169046)
                     /locus_tag="SSA_0171"
                     /db_xref="GeneID:4807649"
     CDS             complement(168855..169046)
                     /locus_tag="SSA_0171"
                     /function="Transcription"
                     /note="GC: 37.5%; Codon Adaptation Index (CAI): 0.711.
                     Helix-turn-helix prediction: AraC. Curator(s): M. Serrano,
                     J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="Cro family transcriptional regulator"
                     /protein_id="YP_001034182.1"
                     /db_xref="GeneID:4807649"
                     /translation="MVTIAELRARNNKMTQAQLAKLLGVSQMTVSHMERNQLNIRGDK
                     LIKLAKIFNVNTDELLKID"
     misc_feature    complement(168870..169037)
                     /locus_tag="SSA_0171"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(168942..168944,169020..169022,
                     169032..169034))
                     /locus_tag="SSA_0171"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(168945..168947,169023..169025))
                     /locus_tag="SSA_0171"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(168939..168944,168954..168956,
                     168963..168965,168996..169001))
                     /locus_tag="SSA_0171"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            169280..169732
                     /locus_tag="SSA_0172"
                     /db_xref="GeneID:4806677"
     CDS             169280..169732
                     /locus_tag="SSA_0172"
                     /function="Transcription"
                     /note="GC: 41.5%; Codon Adaptation Index (CAI): 0.745.
                     Curator(s): M. Serrano, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="YP_001034183.1"
                     /db_xref="GeneID:4806677"
                     /translation="MATVGERIKKLRIAQGFTQARLAEILHVSKAAVCKWESNTNLPK
                     VMELKNMNSPFHVSADYLLGLANRSAIEQLGSEKKLKAMAGYLHQLESPERKQACIDF
                     VISQFNEQEAVKIEAEKIQRALDEPAEAVLDMNIIVDSSLDFQGMDKS"
     misc_feature    169292..169465
                     /locus_tag="SSA_0172"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(169304..169306,169316..169318,169391..169393)
                     /locus_tag="SSA_0172"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(169313..169315,169388..169390)
                     /locus_tag="SSA_0172"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(169334..169339,169370..169372,169379..169381,
                     169391..169396)
                     /locus_tag="SSA_0172"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            complement(169786..170625)
                     /gene="rrmA"
                     /locus_tag="SSA_0173"
                     /db_xref="GeneID:4806054"
     CDS             complement(169786..170625)
                     /gene="rrmA"
                     /locus_tag="SSA_0173"
                     /EC_number="2.1.1.51"
                     /function="Coenzyme metabolism"
                     /note="GC: 42.62%; Codon Adaptation Index (CAI): 0.774.
                     LipoP prediction: SpI. SignalP prediction: Yes (prob.
                     0.57); Curator(s): M. Serrano"
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA m(1)G745 methyltransferase"
                     /protein_id="YP_001034184.1"
                     /db_xref="GeneID:4806054"
                     /translation="MKPKLARFAQAPALACPLCQQSLAMEENSLKCANRHSYDISKFG
                     YVNLAPQARQAKDYDKTSFQNRQVILEAGFYQHILDELQDLLQTLPEEQTILDVACGE
                     GYYARKIQEKFPNKEIYAFDLSRDSIQLAAKSDHSLAVKWFVGDLAHLPVQDQSIDVL
                     LDIFSPANYHEFQRVLKKEGLIIKVIPTENHLKEIRAKVADQLRQKDYSNQQVIQHLE
                     ENFQIIHEKDTQALVSLTPKTKEAILKMTPLLFHVYQNKIDWSNLNQVTIAAKILLAK
                     RRV"
     misc_feature    complement(169882..170580)
                     /gene="rrmA"
                     /locus_tag="SSA_0173"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cl17173"
                     /db_xref="CDD:302624"
     misc_feature    complement(order(170137..170139,170185..170193,
                     170257..170262,170314..170334))
                     /gene="rrmA"
                     /locus_tag="SSA_0173"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(170719..171978)
                     /gene="tyrS"
                     /locus_tag="SSA_0174"
                     /db_xref="GeneID:4806704"
     CDS             complement(170719..171978)
                     /gene="tyrS"
                     /locus_tag="SSA_0174"
                     /EC_number="6.1.1.1"
                     /function="Translation, ribosomal structure and
                     biogenesis"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="catalyzes the formation of tyrosyl-tRNA(Tyr) from
                     tyrosine and tRNA(Tyr)"
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosyl-tRNA synthetase"
                     /protein_id="YP_001034185.1"
                     /db_xref="GeneID:4806704"
                     /translation="MMHIFDELKERGLVFQTTDEAALRKALEEGQVSYYTGYDPTADS
                     LHLGHLVAILTSRRLQLAGHKPYALVGGATGLIGDPSFKDAERSLQTKETVEGWVKSI
                     QNQLSRFLDFEKGDNKAEMVNNYDWFSSISFIDFLRDVGKYFTVNYMMSKDSVKSRIE
                     TGISYTEFAYQIMQGYDFYILNQNHGVTLQIGGSDQWGNMTAGTELLRRKADKTGHVM
                     TVPLITDATGKKFGKSEGNAVWLNPDKTSPYEMYQFWMNVMDADAIRFLKIFTFLSLD
                     EIEEIRQQFEAAPHERLAQKVLAREVVSLVHGQEAYQEALNITEQLFAGNIKNLSVKE
                     LKQGLRGVPNYQVQVEDNLNIVELLVTAGVVNSKRQAREDVQNGAIYLNGERIQDLDY
                     VLSDSDKLEDELTVIRRGKKKYFVLTY"
     misc_feature    complement(170722..171978)
                     /gene="tyrS"
                     /locus_tag="SSA_0174"
                     /note="tyrosyl-tRNA synthetase; Validated; Region:
                     PRK05912"
                     /db_xref="CDD:235645"
     misc_feature    complement(171064..171885)
                     /gene="tyrS"
                     /locus_tag="SSA_0174"
                     /note="catalytic core domain of tyrosinyl-tRNA synthetase;
                     Region: TyrRS_core; cd00805"
                     /db_xref="CDD:173902"
     misc_feature    complement(order(171280..171291,171310..171315,
                     171391..171393,171400..171405,171409..171411,
                     171448..171450,171457..171459,171469..171471,
                     171832..171837,171841..171843,171862..171870,
                     171874..171876))
                     /gene="tyrS"
                     /locus_tag="SSA_0174"
                     /note="active site"
                     /db_xref="CDD:173902"
     misc_feature    complement(171832..171843)
                     /gene="tyrS"
                     /locus_tag="SSA_0174"
                     /note="HIGH motif; other site"
                     /db_xref="CDD:173902"
     misc_feature    complement(order(171460..171465,171472..171477,
                     171481..171483,171529..171534,171538..171549,
                     171553..171558,171565..171573,171577..171582,
                     171748..171753,171760..171762))
                     /gene="tyrS"
                     /locus_tag="SSA_0174"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:173902"
     misc_feature    complement(171277..171291)
                     /gene="tyrS"
                     /locus_tag="SSA_0174"
                     /note="KMSKS motif; other site"
                     /db_xref="CDD:173902"
     misc_feature    complement(170728..170916)
                     /gene="tyrS"
                     /locus_tag="SSA_0174"
                     /note="S4/Hsp/ tRNA synthetase RNA-binding domain; The
                     domain surface is populated by conserved, charged residues
                     that define a likely RNA-binding site; Found in stress
                     proteins, ribosomal proteins and tRNA synthetases; This
                     may imply a hitherto unrecognized...; Region: S4; cd00165"
                     /db_xref="CDD:238095"
     misc_feature    complement(order(170794..170796,170800..170823,
                     170842..170844,170848..170853,170860..170865,
                     170869..170874,170878..170883))
                     /gene="tyrS"
                     /locus_tag="SSA_0174"
                     /note="RNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238095"
     gene            172130..174544
                     /gene="mrcB"
                     /locus_tag="SSA_0134"
                     /db_xref="GeneID:4806508"
     CDS             172130..174544
                     /gene="mrcB"
                     /locus_tag="SSA_0134"
                     /function="Cell envelope biogenesis, outer membrane"
                     /note="GC: 46.63%; Transmembrane domains: 1. Codon
                     Adaptation Index (CAI): 0.778. Curator(s): M. Serrano, J.
                     Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane carboxypeptidase"
                     /protein_id="YP_001034186.1"
                     /db_xref="GeneID:4806508"
                     /translation="MEQLIEKLKEFWGKAQQFIKKIHLPEWSKKIGSGNNGWSISDVF
                     AVFLRTFKLLMNMAFVFIFFGAVIGAGIGIGYAASLFSKVEVPKQEELVKQVNNISGI
                     SKLTYADGSLIAEVDNDLLRIPVKSDAISENVKKAVIATEDENFETHNGVVPKAVLRA
                     TLGSVVGVGSSSGGSTITQQLIKQQVVGDAPTFKRKAAEIVDALALERYMSKDDILTT
                     YLNVSPFGRNNKGQNIAGVEEAAQGIFGVSAKDLTVPQSAFIAGLPQSPIVYSPYAAD
                     GSLKSEGDMALGLERAKDVLYNMYRTGHLSEKEYKEYKDYDLTKDFKPSESSEKSSHG
                     YLYYTAIEEAQQTMYEYLIQRDNVSQQELKNNDTVKAYKELAAKELSDGGYTVTTTIN
                     KNIHTAMQNAVANYGGILDDGTGAVEVGNVLLDNKTGAVIGFVGGRDYASNQNNHAFD
                     TERSPGSTIKPILAYGIAIDQGLMGSASVLSNYPTNFSSGDPIMHVDSRGTAMMDLQE
                     ALNTSWNIPAYWTYRGLREKGVNVRGYMEKMGYYIDDYSIESLPMGGGIEVSVAQHTN
                     GFQTLANNGTYQKKYMVEKITDRDGKVIYQHKANPVQIYSPAAATIMQELMRGVINSG
                     ATTTYKSRISQVNGTLAGADWIGKTGTTNTNGDMWLMLSTPKMTLGGWIGHDDNSSMA
                     ALTGYNNNASYMAYMADAIYQADPNAWGVGDKFTLDPSVIKSDVLKSTGEKPGTVTVN
                     GRSVNLSGPTVPSYWAKNGAPTTTYRFGIGASDSDYQKAWSAILGGSTSNSNSSSNSN
                     NNRQGN"
     misc_feature    172271..174388
                     /gene="mrcB"
                     /locus_tag="SSA_0134"
                     /note="Membrane carboxypeptidase (penicillin-binding
                     protein) [Cell wall/membrane/envelope biogenesis]; Region:
                     MrcB; COG0744"
                     /db_xref="CDD:223815"
     misc_feature    <172271..172588
                     /gene="mrcB"
                     /locus_tag="SSA_0134"
                     /note="Protein of unknown function (DUF677); Region:
                     DUF677; cl21731"
                     /db_xref="CDD:304525"
     misc_feature    172454..173029
                     /gene="mrcB"
                     /locus_tag="SSA_0134"
                     /note="Transglycosylase; Region: Transgly; pfam00912"
                     /db_xref="CDD:279281"
     misc_feature    173393..174214
                     /gene="mrcB"
                     /locus_tag="SSA_0134"
                     /note="Penicillin binding protein transpeptidase domain;
                     Region: Transpeptidase; cl21491"
                     /db_xref="CDD:304385"
     gene            172292..174544
                     /gene="pbp1b"
                     /locus_tag="SSA_0175"
                     /db_xref="GeneID:4806392"
     CDS             172292..174544
                     /gene="pbp1b"
                     /locus_tag="SSA_0175"
                     /function="Cell envelope biogenesis, outer membrane"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 47.36%; Transmembrane domains: 1. Codon
                     Adaptation Index (CAI): 0.778. LipoP prediction: SpI.
                     SignalP prediction: Yes (prob. 0.925); Curator(s): M.
                     Serrano"
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin-binding protein 1B"
                     /protein_id="YP_001034187.1"
                     /db_xref="GeneID:4806392"
                     /translation="MNMAFVFIFFGAVIGAGIGIGYAASLFSKVEVPKQEELVKQVNN
                     ISGISKLTYADGSLIAEVDNDLLRIPVKSDAISENVKKAVIATEDENFETHNGVVPKA
                     VLRATLGSVVGVGSSSGGSTITQQLIKQQVVGDAPTFKRKAAEIVDALALERYMSKDD
                     ILTTYLNVSPFGRNNKGQNIAGVEEAAQGIFGVSAKDLTVPQSAFIAGLPQSPIVYSP
                     YAADGSLKSEGDMALGLERAKDVLYNMYRTGHLSEKEYKEYKDYDLTKDFKPSESSEK
                     SSHGYLYYTAIEEAQQTMYEYLIQRDNVSQQELKNNDTVKAYKELAAKELSDGGYTVT
                     TTINKNIHTAMQNAVANYGGILDDGTGAVEVGNVLLDNKTGAVIGFVGGRDYASNQNN
                     HAFDTERSPGSTIKPILAYGIAIDQGLMGSASVLSNYPTNFSSGDPIMHVDSRGTAMM
                     DLQEALNTSWNIPAYWTYRGLREKGVNVRGYMEKMGYYIDDYSIESLPMGGGIEVSVA
                     QHTNGFQTLANNGTYQKKYMVEKITDRDGKVIYQHKANPVQIYSPAAATIMQELMRGV
                     INSGATTTYKSRISQVNGTLAGADWIGKTGTTNTNGDMWLMLSTPKMTLGGWIGHDDN
                     SSMAALTGYNNNASYMAYMADAIYQADPNAWGVGDKFTLDPSVIKSDVLKSTGEKPGT
                     VTVNGRSVNLSGPTVPSYWAKNGAPTTTYRFGIGASDSDYQKAWSAILGGSTSNSNSS
                     SNSNNNRQGN"
     misc_feature    172295..174388
                     /gene="pbp1b"
                     /locus_tag="SSA_0175"
                     /note="Membrane carboxypeptidase (penicillin-binding
                     protein) [Cell wall/membrane/envelope biogenesis]; Region:
                     MrcB; COG0744"
                     /db_xref="CDD:223815"
     misc_feature    172454..173029
                     /gene="pbp1b"
                     /locus_tag="SSA_0175"
                     /note="Transglycosylase; Region: Transgly; pfam00912"
                     /db_xref="CDD:279281"
     misc_feature    173393..174214
                     /gene="pbp1b"
                     /locus_tag="SSA_0175"
                     /note="Penicillin binding protein transpeptidase domain;
                     Region: Transpeptidase; cl21491"
                     /db_xref="CDD:304385"
     gene            175121..178504
                     /gene="rpoB"
                     /locus_tag="SSA_0176"
                     /db_xref="GeneID:4807834"
     CDS             175121..178504
                     /gene="rpoB"
                     /locus_tag="SSA_0176"
                     /EC_number="2.7.7.6"
                     /function="Transcription"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="DNA-dependent RNA polymerase catalyzes the
                     transcription of DNA into RNA using the four
                     ribonucleoside triphosphates as substrates; beta subunit
                     is part of the catalytic core which binds with a sigma
                     factor to produce the holoenzyme"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta"
                     /protein_id="YP_001034188.1"
                     /db_xref="GeneID:4807834"
                     /translation="MELEFVGYEIREPKYTLEEARIHDASYSAPIFVTFRLINKETGE
                     IKTQEVFFGDFPIMTEMGTFIINGGERIIVSQLVRSPGVYFNDKVDKNGKVGYGSTVI
                     PNRGAWLELETDSKDIAYTRIDRTRKIPFTTLVRALGFSGDDEILDIFGDSDLVRNTI
                     EKDIHKNPMDSRTDEALKEIYERLRPGEPKTAESSRSLLEARFFDPHRYDLAAVGRYK
                     INKKLSVKTRLLNQTIAEPLVDAETGEILVEAGTVMTRSVIDSIAEQLDNGLNKITYI
                     PNDSAVLTAPVDLQKFKVVAPTDPDRVVTIIGNANPSDKVRIVTPADILAEMSYFLNL
                     AEGIGRVDDIDHLGNRRIRAVGELLANQVRLGLSRMERNVRERMSVQDNEVLTPQQII
                     NIRPVTAAIKEFFGSSQLSQFMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRDVH
                     YTHYGRMCPIETPEGPNIGLINNLSSYGHLNKYGFIQTPYRKVDREAGVVTNEIVWLT
                     ADEEDEFIVAQANSKLNEKGGFAEPIVMGRHQGNNQEFPSDQVDYMDVSPKQVVAVAT
                     ACIPFLENDDSNRALMGANMQRQAVPLIDPKAPYVGTGMEYQAAHDSGAAVIAQHDGK
                     VTYADADKVEVRREDGSLDVYQIQKFRRSNSGTAYNQRTLVKVGDVVEKGDFIADGPS
                     MENGEMALGQNPIVAYMTWEGYNFEDAVIMSERLVKDDVYTSVHLEEYESETRDTKLG
                     PEEITREIPNVGEDALRNLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLLHA
                     IFGDKSREVRDTSLRVPHGADGVVRDVKIFTRANGDELQSGVNMLVRVYIAQKRKIKV
                     GDKMAGRHGNKGVVSRIVPVEDMPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLGMA
                     ARNLGIHIATPVFDGASSEDLWDTVREAGMDSDAKTILYDGRTGEPFDNRVSVGVMYM
                     IKLHHMVDDKLHARSVGPYSMVTQQPLGGKAQFGGQRFGEMEVWALEAYGASNVLQEI
                     LTYKSDDVNGRLKAYEAITKGKPIPKPGVPESFRVLVKELQSLGLDMRVLDEDDNEVE
                     LRDLDEGEDDDVIHVDDLEKAREKAAQEAKAAFEAEGKE"
     misc_feature    175121..178378
                     /gene="rpoB"
                     /locus_tag="SSA_0176"
                     /note="DNA-directed RNA polymerase subunit beta; Reviewed;
                     Region: rpoB; PRK00405"
                     /db_xref="CDD:234749"
     misc_feature    175121..178357
                     /gene="rpoB"
                     /locus_tag="SSA_0176"
                     /note="RNA polymerase beta subunit. RNA polymerases
                     catalyse the DNA dependent polymerization of RNA.
                     Prokaryotes contain a single RNA polymerase compared to
                     three in eukaryotes (not including mitochondrial. and
                     chloroplast polymerases). Each RNA polymerase...; Region:
                     RNA_pol_B_RPB2; cd00653"
                     /db_xref="CDD:238353"
     misc_feature    order(175187..175189,177287..177289,177398..177400,
                     177404..177406,177416..177424,177428..177430)
                     /gene="rpoB"
                     /locus_tag="SSA_0176"
                     /note="RPB12 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    order(176453..176455,176459..176467,176471..176473,
                     176480..176482,176495..176497,176783..176785,
                     176837..176845,176849..176851,177212..177223,
                     177230..177232,177236..177244,177719..177721,
                     177725..177727,177731..177733,177797..177799,
                     177803..177805,177812..177814,177821..177823,
                     177836..177838,177848..177850,177899..177901,
                     177980..177982,178004..178012,178016..178018,
                     178055..178057,178064..178072,178076..178081,
                     178142..178150,178160..178162,178166..178171,
                     178175..178177,178181..178198,178202..178219,
                     178229..178231,178298..178300,178310..178312,
                     178316..178318,178322..178327,178331..178333,
                     178337..178348,178352..178354)
                     /gene="rpoB"
                     /locus_tag="SSA_0176"
                     /note="RPB1 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    176588..176791
                     /gene="rpoB"
                     /locus_tag="SSA_0176"
                     /note="RNA polymerase beta subunit external 1 domain;
                     Region: RNA_pol_Rpb2_45; pfam10385"
                     /db_xref="CDD:287371"
     misc_feature    order(176909..176914,177197..177199,177203..177205,
                     177266..177268,177275..177277,177746..177748,
                     177785..177787,177866..177871,177875..177877,
                     177968..177970,178019..178021)
                     /gene="rpoB"
                     /locus_tag="SSA_0176"
                     /note="RPB10 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    176927..>177154
                     /gene="rpoB"
                     /locus_tag="SSA_0176"
                     /note="Peptidase family M23; Region: Peptidase_M23;
                     pfam01551"
                     /db_xref="CDD:279839"
     misc_feature    order(177230..177232,177272..177274,177743..177745,
                     177986..177988)
                     /gene="rpoB"
                     /locus_tag="SSA_0176"
                     /note="RPB11 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    order(177272..177277,177287..177289,177665..177667,
                     177671..177673,177746..177754,177761..177763,
                     177767..177772,177983..178006,178010..178012)
                     /gene="rpoB"
                     /locus_tag="SSA_0176"
                     /note="RPB3 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     gene            178545..182192
                     /gene="rpoC"
                     /locus_tag="SSA_0177"
                     /db_xref="GeneID:4806145"
     CDS             178545..182192
                     /gene="rpoC"
                     /locus_tag="SSA_0177"
                     /EC_number="2.7.7.6"
                     /function="Transcription"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="DNA-dependent RNA polymerase catalyzes the
                     transcription of DNA into RNA using the four
                     ribonucleoside triphosphates as substrates. Subunit beta'
                     binds to sigma factor allowing it to bind to the -10
                     region of the promoter"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta'"
                     /protein_id="YP_001034189.1"
                     /db_xref="GeneID:4806145"
                     /translation="MVDVNRFKSMQITLASPNKVRSWSYGEVKKPETINYRTLKPERE
                     GLFDEVIFGPTKDWECACGKYKRIRYKGIVCDRCGVEVTRAKVRRERMGHIELKAPVS
                     HIWYFKGIPSRMGLTLDMSPRALEEVIYFAAYVVIDPKDTPLEHKSIMTEREYRERLR
                     EYGAGSFVAKMGAEAIQDLLKQVDLEAEIAVLKEELKTASGQKRIKAVRRLDVLDAFY
                     KSGNKPEWMVLNILPVIPPDLRPMVQLDGGRFAASDLNDLYRRVINRNNRLARLLELN
                     APGIIVQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLG
                     KRVDFSGRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVARDIVQNVKAAKRLVE
                     RGDERIWDILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNAD
                     FDGDQMAIHVPLSEEAQAEARILMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEEA
                     GREGEGMIFKDMDEAVMALRNGYVHLHTRVGIATDSLNKPWTEDQKHKILITTVGKIL
                     FNAIMPEELPYLQEPTNANLTEGVPAKYFLESGQDIKEVIEQLEINVPFKKKNLGNII
                     AEIFKRFRTTETSALLDRLKNLGYHHSTLAGLTVGIADIPVVEDKAEIIEESHKRVEQ
                     ITKQFRRGMITDDERYNAVTAEWRAAREKLEKRLVANQDPKNPIVMMMDSGARGNISN
                     FSQLAGMRGLMAAPNGRIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSG
                     YLTRRLVDVAQDVIIREDDCGTDRGLLITSITEGKEMIESLEERLNGRYTKKTVKHPE
                     TGAVIIGPNELITEDKAREIVNAGVEEVTIRSVFTCNTRHGVCRHCYGINLATGDAVE
                     VGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASNTDITQGLPRVQEIFEARNPKGEAVI
                     TEVKGEVTAIEEDASTRTKKVFVKGQTGEGEYVVPFTARMKVEVGDQVSRGAALTEGS
                     IQPKHLLAVRDVLSVETYLLAEVQKVYRSQGVEIGDKHIEVMVRQMIRKVRVMDPGDT
                     DLLMGTLMDITDFTDANRDVVISGGVPATARPVLMGITKASLETNSFLSAASFQETTR
                     VLTDAAIRGKKDHLLGLKENVIIGKIIPAGTGMARYRNLEPQAVNEVEIIDEVTELPD
                     GFETEENIVLK"
     misc_feature    178551..182138
                     /gene="rpoC"
                     /locus_tag="SSA_0177"
                     /note="DNA-directed RNA polymerase subunit beta';
                     Provisional; Region: PRK00566"
                     /db_xref="CDD:234794"
     misc_feature    178563..180995
                     /gene="rpoC"
                     /locus_tag="SSA_0177"
                     /note="Largest subunit (beta') of bacterial DNA-dependent
                     RNA polymerase (RNAP), N-terminal domain; Region:
                     RNAP_beta'_N; cd01609"
                     /db_xref="CDD:259845"
     misc_feature    order(178563..178583,178587..178589,178599..178601,
                     178608..178619,178653..178655,178659..178661,
                     178710..178712,178743..178745,178800..178805,
                     178809..178820,178851..178853,178857..178859,
                     179229..179231,179241..179243,179247..179249,
                     179256..179261,179265..179267,179271..179273,
                     179280..179285,179433..179435,179493..179495,
                     179502..179507,179523..179585,179589..179591,
                     179625..179630,179637..179642,179649..179654,
                     179658..179663,179706..179708,179784..179786,
                     179796..179798,179805..179810,179814..179819,
                     179847..179852,179865..179867,179892..179900,
                     179907..179909,179919..179942,179949..179951,
                     179961..179966,179979..179981,180021..180029,
                     180036..180038,180048..180050,180063..180065,
                     180486..180491,180495..180530,180711..180713,
                     180729..180731,180747..180749,180762..180764,
                     180771..180776,180786..180788,180801..180806,
                     180825..180827,180843..180866,180870..180875,
                     180882..180887,180891..180899,180903..180911,
                     180915..180920,180948..180950,180957..180959)
                     /gene="rpoC"
                     /locus_tag="SSA_0177"
                     /note="beta and beta' interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:259845"
     misc_feature    order(178638..178646,178650..178652,178707..178709,
                     178713..178715,178743..178745,178749..178751,
                     178797..178799,178932..178937,179265..179270,
                     179277..179279,179289..179306,179313..179315,
                     179322..179324,179334..179339,179346..179348,
                     179352..179363,179373..179399,179403..179408,
                     179415..179417,179448..179450,179478..179480,
                     179487..179489,179514..179519,179703..179705,
                     179709..179714)
                     /gene="rpoC"
                     /locus_tag="SSA_0177"
                     /note="beta' and sigma factor interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:259845"
     misc_feature    order(178722..178724,178728..178730,178767..178769,
                     178776..178778)
                     /gene="rpoC"
                     /locus_tag="SSA_0177"
                     /note="Zn-binding [ion binding]; other site"
                     /db_xref="CDD:259845"
     misc_feature    order(178875..178877,179445..179447,179514..179516,
                     179529..179531,179550..179552,179568..179570,
                     179787..179795,179892..179894,179898..179900,
                     179904..179906,180924..180929,180936..180941)
                     /gene="rpoC"
                     /locus_tag="SSA_0177"
                     /note="active site region [active]"
                     /db_xref="CDD:259845"
     misc_feature    order(179892..179894,179898..179900,179904..179906)
                     /gene="rpoC"
                     /locus_tag="SSA_0177"
                     /note="catalytic site [active]"
                     /db_xref="CDD:259845"
     misc_feature    181281..182081
                     /gene="rpoC"
                     /locus_tag="SSA_0177"
                     /note="Largest subunit (beta') of Bacterial DNA-dependent
                     RNA polymerase (RNAP), C-terminal domain; Region:
                     RNAP_beta'_C; cd02655"
                     /db_xref="CDD:132721"
     misc_feature    order(181284..181289,181293..181295,182073..182075)
                     /gene="rpoC"
                     /locus_tag="SSA_0177"
                     /note="Rpb1 (beta') - Rpb6 (omega) interaction site
                     [polypeptide binding]; other site"
                     /db_xref="CDD:132721"
     misc_feature    order(181305..181307,181317..181319,182013..182015,
                     182031..182033,182049..182051,182058..182063,
                     182073..182075)
                     /gene="rpoC"
                     /locus_tag="SSA_0177"
                     /note="Rpb1 (beta') - Rpb2 (beta) interaction site
                     [polypeptide binding]; other site"
                     /db_xref="CDD:132721"
     misc_feature    181350..181376
                     /gene="rpoC"
                     /locus_tag="SSA_0177"
                     /note="G-loop; other site"
                     /db_xref="CDD:132721"
     misc_feature    order(181434..181436,181923..181925,181968..181973)
                     /gene="rpoC"
                     /locus_tag="SSA_0177"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:132721"
     gene            182956..184113
                     /gene="epsC"
                     /locus_tag="SSA_0178"
                     /db_xref="GeneID:4805975"
     CDS             182956..184113
                     /gene="epsC"
                     /locus_tag="SSA_0178"
                     /EC_number="5.1.3.14"
                     /function="Cell envelope biogenesis, outer membrane"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 44.73%; Codon Adaptation Index (CAI): 0.809.
                     Curator(s): M. Serrano"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine 2-epimerase"
                     /protein_id="YP_001034190.1"
                     /db_xref="GeneID:4805975"
                     /translation="MKKIKVMVVFGTRPEAIKMAPLVIELKKQADLFETTTVVTAQHR
                     QMLDQVLETFKIKPDYDLDIMGKNQTLTDITVKILHKLDDILKENKPDIMLVHGDTTT
                     TFAASLAAFYNQVRIGHVEAGLRTWNKYSPFPEEMNRQMTDSLTDLYFAPTDQSKANL
                     LKENHPAETVFVTGNTAIDALKLTVQADYQHEVLDRIDPARKMILVTMHRRENQGEPM
                     RRVFRTLRQIVDAHDDVEIVYPVHLSPAVQEAAREILSDNEKIHLIEPLDVLDFHNIA
                     AKSYFIMSDSGGVQEEAPSLGKPVLVLRDTTERPEGVEAGTLKLVGTETQAVAEAMEA
                     LLTDESLYQEMAQASNPYGDGKASERIAQAIAHYFKQTARPEEFKTGVKNV"
     misc_feature    182956..184062
                     /gene="epsC"
                     /locus_tag="SSA_0178"
                     /note="UDP-N-acetylglucosamine 2-epimerase [Cell
                     wall/membrane/envelope biogenesis]; Region: WecB; COG0381"
                     /db_xref="CDD:223458"
     gene            184106..184894
                     /locus_tag="SSA_0179"
                     /db_xref="GeneID:4806922"
     CDS             184106..184894
                     /locus_tag="SSA_0179"
                     /note="GC: 40.18%; Transmembrane domains: 3. Codon
                     Adaptation Index (CAI): 0.761. Curator(s): M. Serrano, J.
                     Alves; possibly membrane-associated"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034191.1"
                     /db_xref="GeneID:4806922"
                     /translation="MFRKKGLEKSLAVFVLAIGLILFYSWNFAANIFYIGIALILLGI
                     FSVFVLSDLLVTWAMILGVVIATLILLFDVTYLPDNQVLFLLYVFPVSAWLTSRVNFY
                     LHQRLGLVQDDSEDAAEAYEEMVQKVNQKQAPAFQALLVHWAHNHHFYQIHSREYKRM
                     LKRILRLLNWDFQNVETVYYVSNGNFLVLVEDLDQEVKEYFQEKVRDDLTMMHFENKK
                     TDQKIQFQSGSLKLNAQNIDKFHNFDDALSNLERQLETDIIVEY"
     gene            184906..185049
                     /locus_tag="SSA_0180"
                     /db_xref="GeneID:4807208"
     CDS             184906..185049
                     /locus_tag="SSA_0180"
                     /note="GC: 31.94%; Transmembrane domains: 1. Codon
                     Adaptation Index (CAI): 0.772. Curator(s): M. Serrano, J.
                     Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034192.1"
                     /db_xref="GeneID:4807208"
                     /translation="MSLTEVFFIISMVLSIFFAISFLVLFIYYLVIYNRVNKNFRAVT
                     RHD"
     gene            185042..186352
                     /locus_tag="SSA_0181"
                     /db_xref="GeneID:4806889"
     CDS             185042..186352
                     /locus_tag="SSA_0181"
                     /function="Cell envelope biogenesis, outer membrane"
                     /note="GC: 43.94%; Transporter classification
                     TC:9.B.32.1.3. Transmembrane domains: 4. Codon Adaptation
                     Index (CAI): 0.79. LipoP prediction: SpI. SignalP
                     prediction: Yes (prob. 0.585); Helix-turn-helix
                     prediction: AraC. Curator(s): M. Serrano"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family protein"
                     /protein_id="YP_001034193.1"
                     /db_xref="GeneID:4806889"
                     /translation="MISQLIMIVTLFSIWMSLAWALVILCSSVHFWMKRSDFNVDTSP
                     LEHYPMVTVVVPAHNEDVVIAQTTKAILDLDYPHDRVEVLLFADNCSDDTYQEMLKVQ
                     AMPEYAGRNITITDRTGTGGKAGVLNDALKMAKGEYICVYDADAMPEKNALYFLVKKV
                     LEDPERHVASFGRNKTRNANQNFLTRCINQEIVVTQRVYHVGMWHLFKIGRIPGTNFL
                     INTEFVKSIGGWKNGALTEDTEISFKIMQSGKLIALAYNSEAFQQEPETLKSYYMQRK
                     RWAKGNYEVVLANFKHLFSGGNWRVKLEVFNYSCIFFWFNLAIVLSDLVFFANVAAMI
                     TQLFVPDVRIPFAFDAQNIYIVQLMLFNWLLMILLYLLQINIALASQFGQATTKQIWL
                     ALVSYLTYSQLFIVVSLDAVGSVILDKILKRKETKWVKTKRFAG"
     misc_feature    185054..186340
                     /locus_tag="SSA_0181"
                     /note="Glycosyltransferase like family 2; Region:
                     Glyco_tranf_2_3; cl26112"
                     /db_xref="CDD:330933"
     misc_feature    185198..185755
                     /locus_tag="SSA_0181"
                     /note="CESA_like is the cellulose synthase superfamily;
                     Region: CESA_like; cd06423"
                     /db_xref="CDD:133045"
     misc_feature    185468..185476
                     /locus_tag="SSA_0181"
                     /note="DXD motif; other site"
                     /db_xref="CDD:133045"
     gene            186439..187467
                     /locus_tag="SSA_0182"
                     /db_xref="GeneID:4807011"
     CDS             186439..187467
                     /locus_tag="SSA_0182"
                     /EC_number="3.2.1.73"
                     /note="GC: 42.37%; Codon Adaptation Index (CAI): 0.795.
                     Curator(s): M. Serrano"
                     /codon_start=1
                     /transl_table=11
                     /product="endoglucanase"
                     /protein_id="YP_001034194.1"
                     /db_xref="GeneID:4807011"
                     /translation="MGSTPNIKKKIYSQWAKEYVVTKDKLSYIRTTNSKTEDVVLSEA
                     QGYGMVIAVDAAKQGDASSADFEKLYQYYLAHRLKDTQLMSWKQTIKDGKSNHEDENN
                     ATDGDLYIAYALIQAAKQWPDKAKEYQDQAQAILKDVLAYNYNESNGVLTVGNWANAE
                     SKFYNLMRTSDTLPQQFQAFYELTKDKQWLTIRDNMLSKLEAISADNKTGLIPDFIWV
                     EGDKVRAADADTVESANDGYYSYNACRLPYNLAQSKDEKSQKMLKKMLNFFLSQEKIY
                     AGYTLKGKALNSNQAGSFTAPVFYAANNNMEFRKLVQQNKYLFMQGLPSDNYYDAAVT
                     TMIALETL"
     misc_feature    186466..187440
                     /locus_tag="SSA_0182"
                     /note="Glycosyl hydrolases family 8; Region:
                     Glyco_hydro_8; cl01351"
                     /db_xref="CDD:294813"
     gene            187786..188166
                     /locus_tag="SSA_0183"
                     /db_xref="GeneID:4807274"
     CDS             187786..188166
                     /locus_tag="SSA_0183"
                     /note="GC: 45.41%; Codon Adaptation Index (CAI): 0.814.
                     Curator(s): M. Serrano"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034195.1"
                     /db_xref="GeneID:4807274"
                     /translation="MYCVIEMYGDYEPWWFLDGWEEDIVAKKQFDDYYEALKYYKNRW
                     LQMADQSPLYKSRSDLMTIFWDPEDQRWCEECDENVQQYHSLFLLENDCQIPKSKYRP
                     GYTKQNGLEKHRACSVKLKTTKPL"
     misc_feature    187786..188136
                     /locus_tag="SSA_0183"
                     /note="Protein of unknown function (DUF1033); Region:
                     DUF1033; pfam06279"
                     /db_xref="CDD:283850"
     gene            188296..189237
                     /gene="comYA"
                     /locus_tag="SSA_0184"
                     /db_xref="GeneID:4807575"
     CDS             188296..189237
                     /gene="comYA"
                     /locus_tag="SSA_0184"
                     /function="Cell motility and secretion / Intracellular
                     trafficking and secretion"
                     /note="GC: 47.24%; Transporter classification
                     TC:3.A.14.1.1. Codon Adaptation Index (CAI): 0.79.
                     Curator(s): M. Serrano, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="competence protein ComYA"
                     /protein_id="YP_001034196.1"
                     /db_xref="GeneID:4807575"
                     /translation="MVQEIAKEMIRQARQEGAQDIYLIPKSTCYELYMRIGDERRFIK
                     TYDFELLSAVISHFKFVAGMNVGEKRRSQLGSCDYDCGEAKVSIRLSTVGDYRGFESL
                     VIRLLHDEDRELRFWFEQLPELRKKIQARGLYLFSGPVGSGKTTLMYHLAQLKFSGQQ
                     VMSIEDPVEIKQEAMLQLQLNETIGMTYDSLIKLSLRHRPDLLIIGEIRDRETARAVV
                     RASLTGATVFSTIHAKSVRGVYERLLELGVSEDELRMVLQGVCYQRLIGGGGVVDFVS
                     QNYQEHEAAVWNQQIDQLFAEGHISAEQRQTEKIVYA"
     misc_feature    188464..189093
                     /gene="comYA"
                     /locus_tag="SSA_0184"
                     /note="P-loop containing Nucleoside Triphosphate
                     Hydrolases; Region: P-loop_NTPase; cl21455"
                     /db_xref="CDD:304359"
     misc_feature    order(188707..188712,188722..188730)
                     /gene="comYA"
                     /locus_tag="SSA_0184"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238540"
     misc_feature    order(188710..188712,188722..188730,188782..188784,
                     188788..188793,188911..188916)
                     /gene="comYA"
                     /locus_tag="SSA_0184"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238540"
     misc_feature    188899..188913
                     /gene="comYA"
                     /locus_tag="SSA_0184"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238540"
     gene            189197..190201
                     /gene="comYB"
                     /locus_tag="SSA_0185"
                     /db_xref="GeneID:4806874"
     CDS             189197..190201
                     /gene="comYB"
                     /locus_tag="SSA_0185"
                     /function="Cell motility and secretion / Intracellular
                     trafficking and secretion"
                     /note="GC: 44.18%; Transporter classification
                     TC:3.A.14.1.1. Transmembrane domains: 3. Codon Adaptation
                     Index (CAI): 0.788. Curator(s): M. Serrano, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="competence protein ComYB"
                     /protein_id="YP_001034197.1"
                     /db_xref="GeneID:4806874"
                     /translation="MLSKGRPKKLSTPKQKKIIELFHNLFSSGFHLAEIVDFLRRSAL
                     LEEVYVTEMRAGLSAGQSFSEIVSRLGFSDSVVTQLSLSELHGNLTLSLGKIEAYLEN
                     LSKVKKKLIEVGTYPLMLLGFLVLIMLGLRNYLLPQLDSQNLATQLINHLPQIFLWSS
                     LVLAILVSLAVFYYRKSSKIRFFSKLAALPFFGRLVQAYLTAYYAREWGNMIGQGLEL
                     SQIFAIMQEQPSQLFQEIGEDMAAALQGGQGYADKVASYPFFKKELSLMIEYGEVKSK
                     LGSELEVYAEKTWEEFFLRINRAMNFIQPLVFIFVALVIVLLYAAMLLPIYQNMEVHL
                     "
     misc_feature    189233..190192
                     /gene="comYB"
                     /locus_tag="SSA_0185"
                     /note="Type II secretory pathway, component PulF [Cell
                     motility, Intracellular trafficking, secretion, and
                     vesicular transport, Extracellular structures]; Region:
                     PulF; COG1459"
                     /db_xref="CDD:224376"
     misc_feature    189275..189604
                     /gene="comYB"
                     /locus_tag="SSA_0185"
                     /note="Type II secretion system (T2SS), protein F; Region:
                     T2SSF; pfam00482"
                     /db_xref="CDD:278885"
     misc_feature    189839..190168
                     /gene="comYB"
                     /locus_tag="SSA_0185"
                     /note="Type II secretion system (T2SS), protein F; Region:
                     T2SSF; pfam00482"
                     /db_xref="CDD:278885"
     gene            190201..190518
                     /gene="comYC"
                     /locus_tag="SSA_0186"
                     /db_xref="GeneID:4807050"
     CDS             190201..190518
                     /gene="comYC"
                     /locus_tag="SSA_0186"
                     /function="Intracellular trafficking and secretion"
                     /note="GC: 42.45%; Transmembrane domains: 1. Codon
                     Adaptation Index (CAI): 0.818. LipoP prediction: SpI.
                     SignalP prediction: Yes (prob. 0.982); Curator(s): M.
                     Serrano, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="competence protein ComYC"
                     /protein_id="YP_001034198.1"
                     /db_xref="GeneID:4807050"
                     /translation="MKKFNTLKVQAFTLVEMLIVLLVISVLLLLFVPNLTKQKDAVSD
                     TGTAAVVKVVESQAELYELKNTNEKASLSKLVSAGNISQKQADSYKAYYGKHSGETQA
                     VAN"
     misc_feature    190201..190515
                     /gene="comYC"
                     /locus_tag="SSA_0186"
                     /note="Competence protein ComGC [Mobilome: prophages,
                     transposons]; Region: ComGC; COG4537"
                     /db_xref="CDD:226912"
     gene            190490..190912
                     /gene="comYD"
                     /locus_tag="SSA_0187"
                     /db_xref="GeneID:4807087"
     CDS             190490..190912
                     /gene="comYD"
                     /locus_tag="SSA_0187"
                     /function="Cell motility and secretion / Intracellular
                     trafficking and secretion"
                     /note="GC: 45.86%; Transmembrane domains: 1. Codon
                     Adaptation Index (CAI): 0.741. LipoP prediction: SpI.
                     SignalP prediction: Yes (prob. 0.999); Curator(s): M.
                     Serrano, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="competence protein ComYD"
                     /protein_id="YP_001034199.1"
                     /db_xref="GeneID:4807087"
                     /translation="MAKLKRLPIKAFTLLESLLVLFVVSFLLLGLSGSVRAGFNQVQE
                     QLFFLEFERLYQETQRLSLAGHEKLSLKISGRQISNGYQELDFPQTLQEHEQQVIQFD
                     RAGGNSSLGKIIFQTEDRTVVYQLYMGNGKFKKTTASS"
     misc_feature    190517..190870
                     /gene="comYD"
                     /locus_tag="SSA_0187"
                     /note="Type II secretory pathway, pseudopilin PulG [Cell
                     motility, Intracellular trafficking, secretion, and
                     vesicular transport, Extracellular structures]; Region:
                     PulG; COG2165"
                     /db_xref="CDD:225076"
     gene            190938..191171
                     /locus_tag="SSA_0188"
                     /db_xref="GeneID:4807697"
     CDS             190938..191171
                     /locus_tag="SSA_0188"
                     /note="GC: 48.72%; Codon Adaptation Index (CAI): 0.797.
                     Curator(s): M. Serrano, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034200.1"
                     /db_xref="GeneID:4807697"
                     /translation="MAVFATIASLLLGQISRSRKGQQILLQQEEVLRVARMALQTGQE
                     ELHINGIAVRQLKTDKQLLVYHEGEVVIRVQKP"
     misc_feature    190938..191159
                     /locus_tag="SSA_0188"
                     /note="Type II secretory pathway pseudopilin; Region:
                     PulG; pfam11773"
                     /db_xref="CDD:288606"
     gene            191155..191583
                     /locus_tag="SSA_0189"
                     /db_xref="GeneID:4806963"
     CDS             191155..191583
                     /locus_tag="SSA_0189"
                     /function="Intracellular trafficking and secretion"
                     /note="GC: 46.39%; Codon Adaptation Index (CAI): 0.776.
                     Curator(s): M. Serrano, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="competence protein ComGF"
                     /protein_id="YP_001034201.1"
                     /db_xref="GeneID:4806963"
                     /translation="MSKNLKVKAFTLLEALVALLVLSGGVLVFQAMTQLLSSELHQQE
                     NNQQQEWLLFADQLETELSRSQFDKVEDNKIYIRQDGRDLALGKSKGDDFRKTDKSGR
                     GYQPMIYGLEAADVRQDGKLIHLHFRFEKGLEREFVYRVE"
     misc_feature    191257..191556
                     /locus_tag="SSA_0189"
                     /note="Putative Competence protein ComGF; Region: ComGF;
                     pfam15980"
                     /db_xref="CDD:292602"
     gene            191621..191965
                     /locus_tag="SSA_0190"
                     /db_xref="GeneID:4807444"
     CDS             191621..191965
                     /locus_tag="SSA_0190"
                     /note="GC: 47.54%; Codon Adaptation Index (CAI): 0.765.
                     Curator(s): M. Serrano, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034202.1"
                     /db_xref="GeneID:4807444"
                     /translation="MAAVFSLLLQFYLNRQVSSQRLQLFNRERTEAYAMAVLTKATAK
                     DDSGEMEFEQGKAAYRKEGKELEISSRLSSGHSYSFTFVISKKDEDKAKEDKKATEKK
                     EKAVSDEAGKSD"
     gene            192047..193012
                     /locus_tag="SSA_0191"
                     /db_xref="GeneID:4807497"
     CDS             192047..193012
                     /locus_tag="SSA_0191"
                     /function="DNA replication, recombination, and repair"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 41.82%; Codon Adaptation Index (CAI): 0.783.
                     Curator(s): M. Serrano, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="adenine-specific DNA methylase"
                     /protein_id="YP_001034203.1"
                     /db_xref="GeneID:4807497"
                     /translation="MNFEKIEQAYTLILENVQNIQNALSTNFYDALIEQNGIYLDGDT
                     DLQEVLANDEKIRALHLNKEEWRRAYQFILMKAAQTEPMQVNHQFTPDTIGFLITFLL
                     DQLAHGEEADVLEIGSGTGNLAETILNHTQKKIDYLGLELDDLLIDLSASIAEVMNSK
                     AHFAQGDAVRPQVLKESDIIISDLPVGYYPDDSIASRYEVASPDEHTYAHHLLMEQSL
                     KYLKPGGYAIFLAPNDLLTSAQAPLLKKWLLAKAQFIAMITLPESIFSSSKHAKTLFV
                     LRKQEANNIQPFIYPLRDLQDHDEMFKFRQSFQNWYKDSEIQTKF"
     misc_feature    192047..192991
                     /locus_tag="SSA_0191"
                     /note="Adenine-specific DNA methylase [Replication,
                     recombination and repair]; Region: YtxK; COG0827"
                     /db_xref="CDD:223897"
     misc_feature    192383..192745
                     /locus_tag="SSA_0191"
                     /note="Methyltransferase domain; Region: Methyltransf_26;
                     pfam13659"
                     /db_xref="CDD:290385"
     gene            193049..194242
                     /gene="ackA"
                     /locus_tag="SSA_0192"
                     /db_xref="GeneID:4807938"
     CDS             193049..194242
                     /gene="ackA"
                     /locus_tag="SSA_0192"
                     /EC_number="2.7.2.1"
                     /function="Energy production and conversion"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="AckA utilizes acetate and can acetylate CheY which
                     increases signal strength during flagellar rotation;
                     utilizes magnesium and ATP; also involved in conversion of
                     acetate to aceyl-CoA"
                     /codon_start=1
                     /transl_table=11
                     /product="acetate kinase"
                     /protein_id="YP_001034204.1"
                     /db_xref="GeneID:4807938"
                     /translation="MSKTISINAGSSSLKWQLYLMPEEKVLAKGLLERIGLKDSISTV
                     KFDGRSEKQVLDIADHTQAVKILLDDLKRFNIIESYDEITGVGHRVVAGGEHFKDSAL
                     VDEEVIQKVEELSLLAPLHNPANAAGIRAFREILPDITSVVVFDTSFHTTMPEKAYRY
                     PIPTKYYTENKVRKYGAHGTSHEYVAKEAAKILGRPIEELKLITCHIGNGASITAVDK
                     GVSVDTSMGFTPLGGVMMGTRTGDIDPAIIPYLMQYTDDFNTPEDISRVLNRESGLLG
                     VSEKSSDMRDIHEAMRAGDAKAQLANDIFVDRIQKYIGQYLAVLNGADAIIFTAGIGE
                     NSVTIRELVINGISWFGCNVDPEKNVRGAEGVISSPDAKVKVLVIPTDEELVIARDVE
                     RFKNQ"
     misc_feature    193055..194239
                     /gene="ackA"
                     /locus_tag="SSA_0192"
                     /note="acetate kinase A/propionate kinase 2; Reviewed;
                     Region: PRK00180"
                     /db_xref="CDD:234680"
     gene            194458..195135
                     /locus_tag="SSA_0193"
                     /db_xref="GeneID:4807462"
     CDS             194458..195135
                     /locus_tag="SSA_0193"
                     /note="GC: 39.23%; Transmembrane domains: 7. Codon
                     Adaptation Index (CAI): 0.758. SignalP prediction: Yes
                     (prob. 0.652); Curator(s): M. Serrano, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="CAAX amino terminal protease family protein"
                     /protein_id="YP_001034205.1"
                     /db_xref="GeneID:4807462"
                     /translation="MKAILKKLEYILLTLFVLFLSQIPFIFIRQMTSSEKSFSAGQTI
                     FVLVIYLLIIFFVLRMAKQEELLSLDFSFFKWSSFGWLAVSNVVMIGVNMLGAIIMLL
                     EGQAISTANQDALNALFQHVPKILLVVGAVIQAPILEEVVFRGLIPQKIFTKHYVWGL
                     VVGVILFGLFHGPTNIGSFVIYAGMGAVLAAVAYIFKRLEMSILAHMLRNGVAVLIMI
                     LTGLVNK"
     misc_feature    194458..195129
                     /locus_tag="SSA_0193"
                     /note="Membrane protease YdiL, CAAX protease family
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: YdiL; COG1266"
                     /db_xref="CDD:224185"
     misc_feature    194830..195093
                     /locus_tag="SSA_0193"
                     /note="CAAX protease self-immunity; Region: Abi;
                     pfam02517"
                     /db_xref="CDD:280650"
     gene            195253..195891
                     /locus_tag="SSA_0195"
                     /db_xref="GeneID:4807777"
     CDS             195253..195891
                     /locus_tag="SSA_0195"
                     /note="GC: 45.54%; Transmembrane domains: 5. Codon
                     Adaptation Index (CAI): 0.762. Curator(s): M. Serrano"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034206.1"
                     /db_xref="GeneID:4807777"
                     /translation="MLKLEKIIQLLLLAMLTQTGLLLMLHPMPHRLVFSQANLLFMVG
                     LLGLLFCCAFYFARELQEIKGSLRQSSNYRHLLFLYFLMILVNAAGVLLLCGKEAQSG
                     QAVEQMLTESFLSSSLLLLGIDIAVLSPAAPKFIDRAFSLRYRKSWGIALGLLCFSLA
                     KNPQETLCFLSYLVLGLVFAHLLRPYFQRLELSMLAHILRNMIILSLLPFCF"
     gene            196086..197039
                     /gene="folP"
                     /locus_tag="SSA_0197"
                     /db_xref="GeneID:4807709"
     CDS             196086..197039
                     /gene="folP"
                     /locus_tag="SSA_0197"
                     /EC_number="2.5.1.15"
                     /function="Coenzyme metabolism"
                     /note="GC: 48.11%; Codon Adaptation Index (CAI): 0.78.
                     Curator(s): M. Serrano"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydropteroate synthase"
                     /protein_id="YP_001034207.1"
                     /db_xref="GeneID:4807709"
                     /translation="MVNLKAIAPDGRTGLCGIINATPDSFSDGGRYNTVETALAQARK
                     LISEGAHMLDIGGESTRPGSHFVAIQEEIERVVPVIEAIRRESDIVISVDTWKSEVAA
                     AALSAGADIINDITGLLGDEKMAETAAKYGSPVIVMFNPVMARPQHASSKIFPEFGFG
                     PAFTKEELSLFAELPIAELMWKCFEKSLKVAENAGLSRDNIMLDPGIGFGLTKRENLL
                     ILQELDSLHQAGFPIFLGVSRKRFLVSILEENGFEVNPETQEGFENRDTASAHLTSLA
                     ASRGVEVVRVHEVAKHRMAAAVGDAIRLAQQTEDLNLGQYK"
     misc_feature    196113..197006
                     /gene="folP"
                     /locus_tag="SSA_0197"
                     /note="Dihydropteroate synthase [Coenzyme transport and
                     metabolism]; Region: FolP; COG0294"
                     /db_xref="CDD:223371"
     misc_feature    196134..196985
                     /gene="folP"
                     /locus_tag="SSA_0197"
                     /note="DHPS subgroup of Pterin binding enzymes. DHPS
                     (dihydropteroate synthase), a functional homodimer,
                     catalyzes the condensation of p-aminobenzoic acid (pABA)
                     in the de novo biosynthesis of folate, which is an
                     essential cofactor in both nucleic acid and...; Region:
                     DHPS; cd00739"
                     /db_xref="CDD:238380"
     misc_feature    order(196143..196145,196365..196367,196422..196424,
                     196428..196430,196497..196499,196695..196697,
                     196791..196793,196803..196805,196938..196940,
                     196944..196946)
                     /gene="folP"
                     /locus_tag="SSA_0197"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238380"
     misc_feature    order(196734..196736,196746..196751,196896..196898,
                     196908..196910,196920..196922,196965..196970)
                     /gene="folP"
                     /locus_tag="SSA_0197"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238380"
     misc_feature    196797..196805
                     /gene="folP"
                     /locus_tag="SSA_0197"
                     /note="inhibitor binding site; inhibition site"
                     /db_xref="CDD:238380"
     gene            197041..198435
                     /locus_tag="SSA_0198"
                     /db_xref="GeneID:4807900"
     CDS             197041..198435
                     /locus_tag="SSA_0198"
                     /EC_number="6.3.2.12"
                     /EC_number="6.3.2.17"
                     /function="Coenzyme metabolism"
                     /note="GC: 48.24%; Codon Adaptation Index (CAI): 0.749.
                     Curator(s): M. Serrano"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrofolate synthetase"
                     /protein_id="YP_001034208.1"
                     /db_xref="GeneID:4807900"
                     /translation="MKKQELPDLSWLEAYRTASPNFGLERMERLLELRGDPHLQLPVI
                     HIAGTNGKGSTIAHLRQLLEVRGLRVGTFTSPYLVSYNEQIAINGNAISDQDLQRLLS
                     LYQDLLAQHATDSGLQGVTEFEIVTALAYDYFVQQQVDVAIIEVGMGGLLDSTNVCQP
                     LLTAITTVGLDHVALLGDSLEAIAQQKAGIIKHGVPIVTGRLEPEALAVVEQKAAEKD
                     SPLFSWSQAYQVEPQESEEGECFSFSNAYRAKDSYQTALMGLHQADNAGLALHLCDLY
                     CQLQSLSLLTKAEVERALLTAEWPGRLERISDQPLILLDGAHNPHALRSLAATLDQHY
                     PTYKKHILFACIQTKALDDMVELLQKIPKAAISLTAFADPRSFSKESMQSLAEQQGLS
                     YKEWPDYVADYLAVEHEPDELLLITGSLYFLAQVRKSILENCKLDFAERPSQSSQLSK
                     NKNEHRSIYGHEEN"
     misc_feature    197041..198342
                     /locus_tag="SSA_0198"
                     /note="Folylpolyglutamate synthase/Dihydropteroate
                     synthase [Coenzyme transport and metabolism]; Region:
                     FolC; COG0285"
                     /db_xref="CDD:223362"
     misc_feature    197176..197850
                     /locus_tag="SSA_0198"
                     /note="Mur ligase middle domain; Region: Mur_ligase_M;
                     pfam08245"
                     /db_xref="CDD:285457"
     misc_feature    197935..198186
                     /locus_tag="SSA_0198"
                     /note="Mur ligase family, glutamate ligase domain; Region:
                     Mur_ligase_C; pfam02875"
                     /db_xref="CDD:280948"
     gene            198416..198970
                     /gene="folE"
                     /locus_tag="SSA_0199"
                     /db_xref="GeneID:4807670"
     CDS             198416..198970
                     /gene="folE"
                     /locus_tag="SSA_0199"
                     /EC_number="3.5.4.16"
                     /function="Coenzyme metabolism"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="involved in the first step of tetrahydrofolate
                     biosynthesis; catalyzes the formation of formate and
                     2-amino-4-hydroxy-6-(erythro-1,2,
                     3-trihydroxypropyl)dihydropteridine triphosphate from GTP
                     and water; forms a homopolymer"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP cyclohydrolase I"
                     /protein_id="YP_001034209.1"
                     /db_xref="GeneID:4807670"
                     /translation="MDTKKIEAAVAQIIEAVGEDGSREGLQETPQRIAKMYQEIFAGL
                     GETAEEHLAKSFEIIDNNMVVEKDIFFHSMCEHHFLPFYGKVHIAYVPNGRVAGLSKL
                     ARTVEVYAKKPQIQERLTVEIAEALMDYLGAQGALVWVEAEHMCMNMRGVRKPGTATV
                     TTAARGVLATDKDLKNEAYKLMGH"
     misc_feature    198416..198967
                     /gene="folE"
                     /locus_tag="SSA_0199"
                     /note="GTP cyclohydrolase I; Provisional; Region: folE;
                     PRK09347"
                     /db_xref="CDD:236472"
     misc_feature    order(198416..198421,198428..198433,198440..198442,
                     198452..198454,198461..198466,198470..198472,
                     198476..198478,198482..198484,198488..198496,
                     198500..198505,198509..198511,198521..198523,
                     198530..198532,198545..198547,198575..198577,
                     198581..198583,198593..198604,198608..198619,
                     198623..198625,198629..198631,198641..198646,
                     198653..198658,198662..198664,198668..198670,
                     198689..198694,198698..198700,198710..198718,
                     198725..198727,198755..198763,198767..198769,
                     198776..198778,198806..198808,198845..198853,
                     198860..198865,198878..198883,198887..198895,
                     198899..198907,198920..198925,198932..198934,
                     198938..198946)
                     /gene="folE"
                     /locus_tag="SSA_0199"
                     /note="homodecamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238349"
     misc_feature    order(198509..198511,198518..198520,198638..198640,
                     198644..198649,198704..198706,198710..198715,
                     198725..198727,198758..198766,198845..198847,
                     198851..198853,198863..198865)
                     /gene="folE"
                     /locus_tag="SSA_0199"
                     /note="active site"
                     /db_xref="CDD:238349"
     misc_feature    order(198638..198640,198644..198649,198845..198847,
                     198851..198853)
                     /gene="folE"
                     /locus_tag="SSA_0199"
                     /note="putative catalytic site residues [active]"
                     /db_xref="CDD:238349"
     misc_feature    order(198638..198640,198644..198649,198851..198853)
                     /gene="folE"
                     /locus_tag="SSA_0199"
                     /note="zinc binding site [ion binding]; other site"
                     /db_xref="CDD:238349"
     misc_feature    order(198788..198790,198797..198799,198815..198817,
                     198821..198823,198908..198916,198920..198934)
                     /gene="folE"
                     /locus_tag="SSA_0199"
                     /note="GTP-CH-I/GFRP interaction surface; other site"
                     /db_xref="CDD:238349"
     gene            199058..199870
                     /gene="folK"
                     /locus_tag="SSA_0200"
                     /db_xref="GeneID:4808018"
     CDS             199058..199870
                     /gene="folK"
                     /locus_tag="SSA_0200"
                     /EC_number="2.7.6.3"
                     /EC_number="4.1.2.25"
                     /function="Coenzyme metabolism"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 48.59%; Codon Adaptation Index (CAI): 0.8.
                     Curator(s): M. Serrano"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional folate synthesis protein"
                     /protein_id="YP_001034210.1"
                     /db_xref="GeneID:4808018"
                     /translation="MDQLRIKDLEVYAYHGLFGAEKELGQRFVLDLILDYDMTRAAKT
                     GDLTASIHYGELAQDLTYWCQESKEDLIETLAYKLIDRIFLTHPLVQKVSLEVKKPWA
                     PVPLPLETCSVKLVRQKRKAFIALGSNQGSPTANLDAALEKMAEQNIRVLQASSRIET
                     EPWGGVEQDPFLNQVVEVETWLNPEELMQTLLAIESDLGRVREIKWGPRVIDLDILYI
                     GQEELYSPNLIVPHPYVAERAFVLQSLVEIAPHFVDPVQKKSIRQLWDAVEK"
     misc_feature    199061..199408
                     /gene="folK"
                     /locus_tag="SSA_0200"
                     /note="dihydroneopterin aldolase; Region: folB; TIGR00525"
                     /db_xref="CDD:213537"
     misc_feature    order(199061..199093,199109..199135,199358..199363,
                     199376..199402)
                     /gene="folK"
                     /locus_tag="SSA_0200"
                     /note="homooctamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238298"
     misc_feature    order(199103..199111,199118..199120,199265..199276,
                     199352..199354,199394..199396)
                     /gene="folK"
                     /locus_tag="SSA_0200"
                     /note="active site"
                     /db_xref="CDD:238298"
     misc_feature    199424..199801
                     /gene="folK"
                     /locus_tag="SSA_0200"
                     /note="7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
                     (HPPK); Region: HPPK; pfam01288"
                     /db_xref="CDD:279612"
     misc_feature    order(199436..199438,199535..199540,199544..199546,
                     199568..199570,199574..199576,199619..199621,
                     199631..199633,199640..199642,199655..199657,
                     199661..199663,199673..199675,199682..199684,
                     199691..199693,199697..199702,199742..199744,
                     199751..199756,199769..199771,199775..199777)
                     /gene="folK"
                     /locus_tag="SSA_0200"
                     /note="catalytic center binding site [active]"
                     /db_xref="CDD:238269"
     misc_feature    order(199619..199621,199631..199633,199640..199642,
                     199655..199657,199661..199663,199682..199684,
                     199697..199702,199742..199744,199751..199756,
                     199769..199771)
                     /gene="folK"
                     /locus_tag="SSA_0200"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238269"
     gene            199965..200672
                     /locus_tag="SSA_0201"
                     /db_xref="GeneID:4807830"
     CDS             199965..200672
                     /locus_tag="SSA_0201"
                     /function="Defense mechanisms"
                     /note="GC: 46.75%; Transporter classification
                     TC:3.A.1.124.2. Codon Adaptation Index (CAI): 0.74.
                     Curator(s): M. Serrano, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug ABC transporter"
                     /protein_id="YP_001034211.1"
                     /db_xref="GeneID:4807830"
                     /translation="MEHMVKIEGVCKKHGSKQILEDISFTARSGRITAFLGPNGAGKS
                     STLRILLGLDRATAGTATFDGQTYQSMTYPLRTVGAAFDGIGGLPNRKVYDHLRIIAA
                     SNAIPKSRIDEVLEMTGIAHKRKDLLSSLSLGEGQRLGLAAALLGDPQFLILDEPTNG
                     LDPSGIKWFRKFIRQQADLGKTVLLSSHILSEVQMVTDDVVLIHHGRIIEQGQLEEVL
                     QDSDSLEDLFFDLTEEV"
     misc_feature    199977..200600
                     /locus_tag="SSA_0201"
                     /note="P-loop containing Nucleoside Triphosphate
                     Hydrolases; Region: P-loop_NTPase; cl21455"
                     /db_xref="CDD:304359"
     misc_feature    199980..200660
                     /locus_tag="SSA_0201"
                     /note="gallidermin-class lantibiotic protection ABC
                     transporter, ATP-binding subunit; Region: galliderm_ABC;
                     TIGR03740"
                     /db_xref="CDD:163452"
     misc_feature    200073..200096
                     /locus_tag="SSA_0201"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(200082..200087,200091..200099,200211..200213,
                     200427..200432,200526..200528)
                     /locus_tag="SSA_0201"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    200202..200213
                     /locus_tag="SSA_0201"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    200355..200384
                     /locus_tag="SSA_0201"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    200415..200432
                     /locus_tag="SSA_0201"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    200439..200450
                     /locus_tag="SSA_0201"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    200514..200534
                     /locus_tag="SSA_0201"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            200674..201462
                     /locus_tag="SSA_0202"
                     /db_xref="GeneID:4807607"
     CDS             200674..201462
                     /locus_tag="SSA_0202"
                     /note="GC: 46.51%; Transmembrane domains: 6. Codon
                     Adaptation Index (CAI): 0.752. Curator(s): P. Manque, J.
                     Alves; possible transmembrane"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034212.1"
                     /db_xref="GeneID:4807607"
                     /translation="MKETMSLLHSEWLKICSTKAFKVSMAFMLLLVPVVSWLEGRQYL
                     SVGLDATPETVPGLAEAIDPLEYLGLNGASMAGMVLVILAGILGAMEFQSHSLRTSLL
                     TCNNRLKLLVGKLMTFACFSLASSFLSIYFSYMVMHLALGKEGLDPILLNQTAWSLIL
                     WKTLSLTLLGILSFLLGLLARTMLVPLLFLVPQIYNLGNYLAAHTSWGAYLPQPAGEL
                     FAATPTSQYANNPLQGLLILSAWLLVIGGMTSLRFLKTDLGGRY"
     gene            201462..202184
                     /locus_tag="SSA_0203"
                     /db_xref="GeneID:4807913"
     CDS             201462..202184
                     /locus_tag="SSA_0203"
                     /note="GC: 44.54%; Transmembrane domains: 6. Codon
                     Adaptation Index (CAI): 0.728. SignalP prediction: Yes
                     (prob. 0.63); Curator(s): P. Manque, J. Alves; possible
                     transmembrane"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034213.1"
                     /db_xref="GeneID:4807913"
                     /translation="MIKALLGSEWIKFRSYYLALGAALVALVIVPFFLMNLDYSQTAV
                     GQTKALSEVLHALYLAQPVIVIFTSLYFAQEFVKSGMRTNFLTVSNRKAWLAGKILFL
                     AMLLLILYSIMIGSCFLVMLARFGLDFSWSLLGKFLYYSFFGLLSNLFLAFLTAGLAL
                     LFQSWVVPVSVLFPLLIGLSRLLATFIKEAKYLPDLATLNLFEYEGLQHSIDLSGLGI
                     QLFWLALVWSSAIFLSLKRDVR"
     gene            202197..202895
                     /gene="nisR"
                     /locus_tag="SSA_0204"
                     /db_xref="GeneID:4807348"
     CDS             202197..202895
                     /gene="nisR"
                     /locus_tag="SSA_0204"
                     /function="Signal transduction mechanisms / Transcription"
                     /note="GC: 44.35%; Codon Adaptation Index (CAI): 0.765.
                     Curator(s): P. Manque, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="nisin biosynthesis two-component response
                     transcriptional regulator nisR"
                     /protein_id="YP_001034214.1"
                     /db_xref="GeneID:4807348"
                     /translation="MEIMRQYRILVVDDDRSILKLVKNVLELDAYDVTTLDRIEELEL
                     TNFVGYDLILLDVMMEPVNGFELCSYIRPHISCPIIFLTAKELEADKVEGLFRGADDY
                     IVKPFGTKELLARVRAHLRREERREERYSEIASCQFYPERYEVACFGKVLKFSEREFK
                     LLHLLASNPKQTFSAERLHTLLYPESSETQLRSISEYVYQIRQKCKQEGLQAIATVRG
                     VGYRWQLEPEISKA"
     misc_feature    202215..202877
                     /gene="nisR"
                     /locus_tag="SSA_0204"
                     /note="DNA-binding response regulator, OmpR family,
                     contains REC and winged-helix (wHTH) domain [Signal
                     transduction mechanisms, Transcription]; Region: OmpR;
                     COG0745"
                     /db_xref="CDD:223816"
     gene            202862..203899
                     /gene="nisK"
                     /locus_tag="SSA_0205"
                     /db_xref="GeneID:4808004"
     CDS             202862..203899
                     /gene="nisK"
                     /locus_tag="SSA_0205"
                     /EC_number="2.7.3.-"
                     /function="Signal transduction mechanisms"
                     /note="GC: 42.58%; Transporter classification
                     TC:2.A.21.9.2. Transmembrane domains: 2. Codon Adaptation
                     Index (CAI): 0.784. Curator(s): P. Manque, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="sensor-receptor histidine kinase NisK"
                     /protein_id="YP_001034215.1"
                     /db_xref="GeneID:4808004"
                     /translation="MAIRTRNFKSLVWTTSLKIVFFHVLIFVLIGYEFTQGSNHVLFT
                     LFFWAGSLLLITFYHILKLLRKIDREIKMLTSKKFLEENQSQLFRIEEMLEVYSDLRS
                     SHQENARLLEKEQQHNQELILQLSATSHDLKTPLTVIKGNAELLELAQLGQPQADYAA
                     EILQASHKMEEYCGSLIDYAKTFQIDSNQFSQLSLEDFLAYLQDDWALFSKQESYHFY
                     LQEDCDLSLRLSIHLDYLKRALLNILLNALEHANQDQKEVKLMVSVQQDQLVFAIWNN
                     GPAFSEEMLLGAEQLFYQSDQSRNSANPHHGIGLAFSKQVALLHGGRLTLLNPDQGGA
                     CVELTVALESK"
     misc_feature    202898..203893
                     /gene="nisK"
                     /locus_tag="SSA_0205"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    order(203231..203233,203243..203245,203255..203257,
                     203264..203266,203276..203278,203285..203287,
                     203333..203335,203345..203347,203354..203356,
                     203366..203368,203375..203377,203387..203389)
                     /gene="nisK"
                     /locus_tag="SSA_0205"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    203234..203404
                     /gene="nisK"
                     /locus_tag="SSA_0205"
                     /note="His Kinase A (phosphoacceptor) domain; Region:
                     HisKA; smart00388"
                     /db_xref="CDD:214644"
     misc_feature    203249..203251
                     /gene="nisK"
                     /locus_tag="SSA_0205"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    order(203597..203599,203606..203608,203678..203680,
                     203684..203686,203690..203692,203696..203701,
                     203780..203791,203837..203839,203843..203845,
                     203858..203863,203867..203869)
                     /gene="nisK"
                     /locus_tag="SSA_0205"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    203597..203599
                     /gene="nisK"
                     /locus_tag="SSA_0205"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    203609..203890
                     /gene="nisK"
                     /locus_tag="SSA_0205"
                     /note="Histidine kinase-like ATPases; Region: HATPase_c;
                     smart00387"
                     /db_xref="CDD:214643"
     misc_feature    order(203690..203692,203696..203698,203780..203782,
                     203786..203788)
                     /gene="nisK"
                     /locus_tag="SSA_0205"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            204196..204399
                     /locus_tag="SSA_2393"
                     /db_xref="GeneID:4807922"
     CDS             204196..204399
                     /locus_tag="SSA_2393"
                     /function="Transcription"
                     /note="GC: 39.22%; Codon Adaptation Index (CAI): 0.741.
                     Curator(s): J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="YP_001034216.1"
                     /db_xref="GeneID:4807922"
                     /translation="MENRIQELRKRKKLSQEELAEKLEVTRQTIISLEKGRYNASLLL
                     AHRIASFFNLRIEEVFLFEEDES"
     misc_feature    204196..204393
                     /locus_tag="SSA_2393"
                     /note="DNA-binding transcriptional regulator, XRE-family
                     HTH domain [Transcription]; Region: XRE; COG1476"
                     /db_xref="CDD:224393"
     misc_feature    order(204211..204213,204223..204225,204298..204300)
                     /locus_tag="SSA_2393"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(204220..204222,204295..204297)
                     /locus_tag="SSA_2393"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(204241..204246,204277..204279,204286..204288,
                     204298..204303)
                     /locus_tag="SSA_2393"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            204396..204560
                     /locus_tag="SSA_0206"
                     /db_xref="GeneID:4807801"
     CDS             204396..204560
                     /locus_tag="SSA_0206"
                     /note="GC: 34.55%; Transmembrane domains: 2. Codon
                     Adaptation Index (CAI): 0.817. Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034217.1"
                     /db_xref="GeneID:4807801"
                     /translation="MKWTYLCKWILAILVVVGLAYLHLQANFIPKEILPFVGVILIVV
                     ILKIFQAYEK"
     gene            204570..205004
                     /locus_tag="SSA_0207"
                     /db_xref="GeneID:4807319"
     CDS             204570..205004
                     /locus_tag="SSA_0207"
                     /note="GC: 42.07%; Transmembrane domains: 4. Codon
                     Adaptation Index (CAI): 0.785. Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034218.1"
                     /db_xref="GeneID:4807319"
                     /translation="METLTKQEFRKKLQRKVIVGRILTLIILAGLAWSHFHSLDDQQE
                     GVMVGILLGLSLMTIRYNLALRREENFDKLYIQVTDERNRMIDEKTRTLLFNILLLLA
                     ACLSVLSMIFPIILSLNQFLTVTIILVLGLYYLLRFLLSKRY"
     gene            complement(205058..206542)
                     /locus_tag="SSA_0208"
                     /db_xref="GeneID:4807591"
     CDS             complement(205058..206542)
                     /locus_tag="SSA_0208"
                     /function="Function unknown"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 46.94%; Codon Adaptation Index (CAI): 0.774.
                     Curator(s): P. Manque, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034219.1"
                     /db_xref="GeneID:4807591"
                     /translation="MKKIAFDSEKYLNLQRDHILERINQFEGKLYMEFGGKMLEDFHA
                     ARVLPGYEPDNKIRLLKELKDQVEIVIAINANNIEHSKARGDLGISYDQEVLRLIDTF
                     NELDIYVGSVVITQYSGQPAADLFRSQLEKNGIASYIHYPIKGYPTDMDHIISPEGMG
                     KNDYIKTSRNLVVVTAPGPGSGKLATCLSNMYHDQINGIKSGYAKFETFPVWNLPLHH
                     PVNLAYEAATADLDDVNMIDPFHLQTYGKTTVNYNRDIEIFPVLKRMLERILGKSPYA
                     SPTDMGVNMVGFAIVDNDAAIEASQQEIIRRYYQTILDFKAERVSESAVKKIELLMND
                     LGITPLDRKVTVVARDKAESTGEPALALELPNGEIVTGKTSELFGPTAAVLINAIKKL
                     AHIAKETKLIEPEYVKPIQGLKINHLGSRNPRLHSNEILMALAITAMENQDAANAMQQ
                     LGNLKGSEAHSTVTLTDEDKNVLRKLGIHVTMDPVYQYDRLYRK"
     misc_feature    complement(205061..206539)
                     /locus_tag="SSA_0208"
                     /note="hypothetical protein; Provisional; Region:
                     PRK13663"
                     /db_xref="CDD:184220"
     gene            complement(206662..207726)
                     /gene="pepA"
                     /locus_tag="SSA_0209"
                     /db_xref="GeneID:4807327"
     CDS             complement(206662..207726)
                     /gene="pepA"
                     /locus_tag="SSA_0209"
                     /EC_number="3.4.11.7"
                     /function="Carbohydrate transport and metabolism"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 52.58%; Codon Adaptation Index (CAI): 0.759.
                     Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl aminopeptidase"
                     /protein_id="YP_001034220.1"
                     /db_xref="GeneID:4807327"
                     /translation="MTTLFSKIKEVTELSAISGHEAPVRSYLREKITPHVDEIVTDGL
                     GGIFGVRHAEAENAPRVLVAAHMDEVGFMVSEIKPDGTFRVVEIGGWNPLVVSSQRFK
                     LFTREGREIPVISGSVPPHLTRGSGGPVMPQIADIVFDGGFADKAEAESYGIRPGDTI
                     VPDSSAILTANGKNIISKAWDNRYGVLMVSELAQALSGQPLDSQLYVGANVQEEVGLR
                     GAHASTTKFAPEVFLAVDCSPAGDIYGGQGAIGDGTLIRFFDPGHLMLPAMKDFLLTT
                     AEEAGIKYQYYCGKGGTDAGAAHLQSGGVPSTTIGVCARYIHSHQTLYAMDDFLQAQA
                     FLQALVKKLDRSTVDTITNY"
     misc_feature    complement(206674..207714)
                     /gene="pepA"
                     /locus_tag="SSA_0209"
                     /note="glutamyl aminopeptidase; Region: glu_aminopep;
                     TIGR03107"
                     /db_xref="CDD:132151"
     misc_feature    complement(order(206758..206760,206770..206772,
                     206779..206784,206830..206832,206863..206865,
                     206905..206907,206953..206955,206971..206979,
                     207061..207066,207073..207075,207199..207201,
                     207205..207207,207220..207222,207226..207228,
                     207256..207261,207301..207309,207313..207315,
                     207385..207387,207391..207396,207427..207435,
                     207469..207471,207502..207510,207592..207594,
                     207601..207606,207640..207642,207652..207654,
                     207667..207675))
                     /gene="pepA"
                     /locus_tag="SSA_0209"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:193517"
     misc_feature    complement(order(206773..206778,206851..206856,
                     206860..206862,207010..207021,207076..207078,
                     207085..207090,207184..207186,207529..207531))
                     /gene="pepA"
                     /locus_tag="SSA_0209"
                     /note="active site"
                     /db_xref="CDD:193517"
     misc_feature    complement(order(206773..206775,207019..207021,
                     207085..207090,207184..207186,207529..207531))
                     /gene="pepA"
                     /locus_tag="SSA_0209"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:193517"
     gene            207897..208184
                     /locus_tag="SSA_0210"
                     /db_xref="GeneID:4807596"
     CDS             207897..208184
                     /locus_tag="SSA_0210"
                     /note="GC: 47.57%; Transmembrane domains: 1. Codon
                     Adaptation Index (CAI): 0.751. LipoP prediction: SpI.
                     SignalP prediction: Yes (prob. 0.999); Curator(s): P.
                     Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034221.1"
                     /db_xref="GeneID:4807596"
                     /translation="MKAKKIILTTTALLGAGALAFGAAKVVQEQKRLRNREEIVELVR
                     DFFSSQGTISCLYVKLYESTDDRLVGGLVLEDDRHFAFVYENGQLSYEEEA"
     misc_feature    207996..208175
                     /locus_tag="SSA_0210"
                     /note="Domain of unknown function (DUF4651); Region:
                     DUF4651; pfam15513"
                     /db_xref="CDD:317862"
     gene            208181..208516
                     /gene="trxA2"
                     /locus_tag="SSA_0211"
                     /db_xref="GeneID:4806152"
     CDS             208181..208516
                     /gene="trxA2"
                     /locus_tag="SSA_0211"
                     /function="Posttranslational modification, protein
                     turnover, chaperones / Energy production and conversion"
                     /note="GC: 43.75%; Codon Adaptation Index (CAI): 0.757.
                     Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034222.1"
                     /db_xref="GeneID:4806152"
                     /translation="MIIPTNLEGLASYVNDGEKTVFFFTAEWCGDCRFIQPFLPEIEG
                     ENPDYRFIQVDRDAYLDLAKEWDIYGIPSLVVLEKGQEIGRLVNRDRKTKSQINEFLA
                     SIREKGSVK"
     misc_feature    208202..208486
                     /gene="trxA2"
                     /locus_tag="SSA_0211"
                     /note="TRX family; composed of two groups: Group I, which
                     includes proteins that exclusively encode a TRX domain;
                     and Group II, which are composed of fusion proteins of TRX
                     and additional domains. Group I TRX is a small ancient
                     protein that alter the redox...; Region: TRX_family;
                     cd02947"
                     /db_xref="CDD:239245"
     misc_feature    order(208265..208267,208274..208276)
                     /gene="trxA2"
                     /locus_tag="SSA_0211"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239245"
     gene            208513..209139
                     /locus_tag="SSA_0212"
                     /db_xref="GeneID:4807246"
     CDS             208513..209139
                     /locus_tag="SSA_0212"
                     /function="General function prediction only"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 47.85%; Codon Adaptation Index (CAI): 0.802.
                     Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="phenylalanyl-tRNA synthetase subunit beta"
                     /protein_id="YP_001034223.1"
                     /db_xref="GeneID:4807246"
                     /translation="MIFTYNKEYVGDVLMIIAADNQGAKLAAERKGRVARVYREDNGQ
                     TVAWNIFEQSDLFEIAERGQVFLTDEQVVILNQELSKEGFPADLVNDSQPKFVVGEIV
                     DMVAHPDSDHLNICQVQVAADKTVQIVAGAPNAKVGLKTIVALPGAMMPKGNLIFPGE
                     LRGEKSFGMMCSPRELQLPNAPQKRGIIELADSELVGTAFDPAKHWQG"
     misc_feature    208576..208785
                     /locus_tag="SSA_0212"
                     /note="Domain of unknown function (DUF4479); Region:
                     DUF4479; pfam14794"
                     /db_xref="CDD:317231"
     misc_feature    208798..209112
                     /locus_tag="SSA_0212"
                     /note="tRNA-binding-domain-containing prokaryotic
                     phenylalanly tRNA synthetase (PheRS) beta chain. PheRS
                     aminoacylate phenylalanine transfer RNAs (tRNAphe). PheRSs
                     belong structurally to class II aminoacyl tRNA synthetases
                     (aaRSs) but, as they aminoacylate...; Region:
                     tRNA_bind_bactPheRS; cd02796"
                     /db_xref="CDD:239196"
     misc_feature    order(208846..208848,208885..208887,208948..208950,
                     208987..208989,209008..209010,209017..209019)
                     /locus_tag="SSA_0212"
                     /note="putative tRNA-binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:239196"
     gene            complement(209638..210225)
                     /locus_tag="SSA_0213"
                     /db_xref="GeneID:4807316"
     CDS             complement(209638..210225)
                     /locus_tag="SSA_0213"
                     /note="GC: 45.75%; Transmembrane domains: 2. Codon
                     Adaptation Index (CAI): 0.713. SignalP prediction: Yes
                     (prob. 0.927); Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034224.1"
                     /db_xref="GeneID:4807316"
                     /translation="MAIKHSPVKNLIFILISLWFGGFSAWAAVDYLTSSNPYKDTSFF
                     VLSLLVAAFFLLLLIFAIRRLTIHATILSFDHENVTYYYSGLLSAATYCIPMQQISHA
                     RYSRDSEESEISLWMEDGFHDFAAFNHPHHKIYAYPDSQLIGIVFKRRRLKALEDHSL
                     NSLIYQYKYSTPSQIPTATPQSSTDSQSNSDCVFF"
     gene            210355..210750
                     /gene="ssb2"
                     /locus_tag="SSA_0214"
                     /db_xref="GeneID:4806023"
     CDS             210355..210750
                     /gene="ssb2"
                     /locus_tag="SSA_0214"
                     /function="DNA replication, recombination, and repair"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="binds to single stranded DNA and may facilitate the
                     binding and interaction of other proteins to DNA"
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded DNA-binding protein"
                     /protein_id="YP_001034225.1"
                     /db_xref="GeneID:4806023"
                     /translation="MYNKVIVIGRLTATPELHKTANEKSVARATVAVNRRYKSQSGER
                     EADFANVVVWGRLAETLASYASKGSLISLDGELRTRRYEKEGATHYVTEVLCHSFQLL
                     ESRAQRALRENNSGADLADLVLEEEELPF"
     misc_feature    210355..210747
                     /gene="ssb2"
                     /locus_tag="SSA_0214"
                     /note="single-stranded DNA-binding protein; Provisional;
                     Region: PRK07274"
                     /db_xref="CDD:180914"
     misc_feature    210355..>210675
                     /gene="ssb2"
                     /locus_tag="SSA_0214"
                     /note="Single-stranded DNA-binding protein [Replication,
                     recombination and repair]; Region: Ssb; COG0629"
                     /db_xref="CDD:223702"
     misc_feature    order(210367..210378,210451..210459,210493..210495,
                     210499..210501,210562..210564,210589..210591,
                     210619..210621,210628..210630)
                     /gene="ssb2"
                     /locus_tag="SSA_0214"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239942"
     misc_feature    order(210382..210390,210406..210408,210436..210438,
                     210457..210462,210487..210492,210496..210498,
                     210502..210504,210508..210510,210514..210516,
                     210553..210558,210580..210582,210586..210588,
                     210592..210597,210631..210633,210637..210639)
                     /gene="ssb2"
                     /locus_tag="SSA_0214"
                     /note="ssDNA binding site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:239942"
     misc_feature    order(210562..210564,210568..210570,210574..210576,
                     210652..210654)
                     /gene="ssb2"
                     /locus_tag="SSA_0214"
                     /note="tetramer (dimer of dimers) interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239942"
     gene            211031..212017
                     /gene="rbsB"
                     /locus_tag="SSA_0215"
                     /db_xref="GeneID:4806590"
     CDS             211031..212017
                     /gene="rbsB"
                     /locus_tag="SSA_0215"
                     /function="Carbohydrate transport and metabolism"
                     /note="GC: 45.49%; Transporter classification
                     TC:3.A.1.2.1. Transmembrane domains: 1. Codon Adaptation
                     Index (CAI): 0.762. LipoP prediction: SpI. SignalP
                     prediction: Yes (prob. 0.516); Curator(s): P. Manque, J.
                     Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic sugar-binding protein (ribose
                     porter)"
                     /protein_id="YP_001034226.1"
                     /db_xref="GeneID:4806590"
                     /translation="MVSTKVKKRIQHYQKKALWPLFILLILVLLFVYFKGVLPDEKQV
                     KIGVTYMTMNNDFYKTLNAELEKKTNQQGSRLYVRDPELDEGKQSQQIDFFVREKVDV
                     IVINPVKSNSPSIISSLQKAKKAGIKIIVVDAPISQDVKVDTTIVSDNYQAGVLIAQD
                     MMKRLPSANILLLEHRNAVSAMDRIQGFIDTIEKQPSYKIISQKETLGQTEETMPQVK
                     GALDEGLDFNVVMALNDRAAIGALAAIKNQGLDKKISIYGVDGSPDIKNFLATTSDIE
                     GTVAQSPIQMGRKVAQVIELMQEGKSYDSQYLIPVHLVNRDNISQYTVTGWQ"
     misc_feature    211163..211969
                     /gene="rbsB"
                     /locus_tag="SSA_0215"
                     /note="Periplasmic sugar-binding domain of active
                     transport systems that are members of the type I
                     periplasmic binding protein (PBP1) superfamily; Region:
                     PBP1_ABC_sugar_binding_like; cd01536"
                     /db_xref="CDD:107249"
     misc_feature    211166..211936
                     /gene="rbsB"
                     /locus_tag="SSA_0215"
                     /note="Periplasmic binding protein domain; Region:
                     Peripla_BP_4; pfam13407"
                     /db_xref="CDD:290143"
     misc_feature    order(211199..211201,211427..211429,211580..211582,
                     211808..211810,211871..211873)
                     /gene="rbsB"
                     /locus_tag="SSA_0215"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107249"
     gene            212017..213330
                     /locus_tag="SSA_0216"
                     /db_xref="GeneID:4806442"
     CDS             212017..213330
                     /locus_tag="SSA_0216"
                     /function="Signal transduction mechanisms"
                     /note="GC: 44.98%; Transmembrane domains: 5. Codon
                     Adaptation Index (CAI): 0.745. Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="YP_001034227.1"
                     /db_xref="GeneID:4806442"
                     /translation="MRPQKSIFYSKIALMVINLVAIVYNASIYLFATNYVAAKGFSHS
                     LLERLDAIPGSPSLIFWVSISLYACLLLVMYYRERHPNQLSVYDKATIIEILLMLVIF
                     SVLHSSYNGLILLVFADIFYGSKEFNSSKDKKYWFSFIILSFGMLLLSNYDLMSLFIK
                     LPSLDTYIRFYPESVRLLLLFGKNFLYSLNIVVFMISLLFYILSAITERHRIEEELRM
                     ASQANRELNSYLALSEKIAEDRERKRIAREIHDTLGHALTGISAGIDAVKVLVDIDTN
                     RAKEQLNNVSVVVRDGIRDVRGSLNKMRPGALENNTLKEALIKIIREYEAISNLEIHL
                     RYEWDNIDLDIAKEDIVFRVIQESITNSVRHGHAKTIWIELLEEESYVMTIQDDGVGF
                     DELHYGYGLKQMQERLMIIGGSVRFENRDGFYTHIEIPKIGGRHD"
     misc_feature    212275..213303
                     /locus_tag="SSA_0216"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: COG4585"
                     /db_xref="CDD:226951"
     misc_feature    212737..212940
                     /locus_tag="SSA_0216"
                     /note="Histidine kinase; Region: HisKA_3; pfam07730"
                     /db_xref="CDD:285031"
     misc_feature    213058..213303
                     /locus_tag="SSA_0216"
                     /note="Histidine kinase-, DNA gyrase B-, and HSP90-like
                     ATPase; Region: HATPase_c; pfam02518"
                     /db_xref="CDD:280651"
     misc_feature    order(213085..213087,213097..213099,213106..213108,
                     213169..213171,213175..213177,213181..213183,
                     213187..213192,213208..213219,213265..213267,
                     213271..213273,213286..213291,213295..213297)
                     /locus_tag="SSA_0216"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    213097..213099
                     /locus_tag="SSA_0216"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(213181..213183,213187..213189,213208..213210,
                     213214..213216)
                     /locus_tag="SSA_0216"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            213323..214006
                     /locus_tag="SSA_0217"
                     /db_xref="GeneID:4806830"
     CDS             213323..214006
                     /locus_tag="SSA_0217"
                     /function="Signal transduction mechanisms / Transcription"
                     /note="GC: 46.93%; Codon Adaptation Index (CAI): 0.765.
                     Curator(s): P. Manque, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="two-component response transcriptional
                     regulator"
                     /protein_id="YP_001034228.1"
                     /db_xref="GeneID:4806830"
                     /translation="MIKVLIADDQALIRESLQIILSAHADIEVVGTVGDGKEVLEKLH
                     RVRPDVILMDIRMPVMDGVLCTKAVKEQYPDVKIIILTTFDDDEFIFSALKYGASGYI
                     LKGVSTEELHEAIQTVYRGGAMINPNIATKVFKIFSQMAQSNFAITVTEENIEDMSRT
                     EWKIIQQIGFGISNKEIAAKLFLSEGTVRNYLSGILAKLNLRDRTQLAIWAVQTGVTQ
                     RDFSKESDK"
     misc_feature    213326..213976
                     /locus_tag="SSA_0217"
                     /note="DNA-binding response regulator, NarL/FixJ family,
                     contains REC and HTH domains [Signal transduction
                     mechanisms, Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     gene            214003..215286
                     /locus_tag="SSA_0218"
                     /db_xref="GeneID:4806647"
     CDS             214003..215286
                     /locus_tag="SSA_0218"
                     /function="Carbohydrate transport and metabolism"
                     /note="GC: 46.65%; Transporter classification
                     TC:3.A.1.1.16. Transmembrane domains: 1. Codon Adaptation
                     Index (CAI): 0.787. LipoP prediction: SpI. SignalP
                     prediction: Yes (prob. 1); Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter periplasmic protein"
                     /protein_id="YP_001034229.1"
                     /db_xref="GeneID:4806647"
                     /translation="MKWRLRHLALLVVLIISVALAFVFWASAQEKVLRIGVYAGSSWD
                     VPNSRENKVLDSLIKKFEKTHPHVKVVYESGIPKDDYADWLAEQVLKGEQPDLFMVPE
                     NDFSMLASTGALKSLDTLLTDDERKAFYPVAYEAGQYQGVSYALPVESNPIMMCVNKD
                     LLEKEGISIPESGWTLADFYEICKKVTKDTNGDGVVDQYGITDYTWQQALVAYGGHLT
                     DKSGINVDSSEMHQALAFMSKLDMLSQHYKVTSNDFDEGRVAFYPMSLAQYRTYKPYP
                     YHVAKYSSFSWTCIPMPTANSQVMGTQVKTSLFAMSSNSKQEKLAWEFMLLLSQDKES
                     QQALFEKSQGTSVLPSVVKSQQAREILQADDFGLDSLTSERLDHMMNRSIIDISLEVD
                     RHTMDRMDYLIQNAMQNQEIDSALPSIQREIESGK"
     misc_feature    214129..215271
                     /locus_tag="SSA_0218"
                     /note="The periplasmic-binding component of ABC transport
                     systems specific for trehalose/maltose and similar
                     oligosaccharides; possess type 2 periplasmic binding fold;
                     Region: PBP2_TMBP_like; cd13585"
                     /db_xref="CDD:270303"
     misc_feature    order(214447..214449,214453..214455,214795..214797,
                     214801..214803,214915..214923,215047..215049)
                     /locus_tag="SSA_0218"
                     /note="chemical substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:270303"
     gene            215507..215944
                     /locus_tag="SSA_0219"
                     /db_xref="GeneID:4808080"
     CDS             215507..215944
                     /locus_tag="SSA_0219"
                     /EC_number="2.7.1.69"
                     /function="Carbohydrate transport and metabolism"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 49.54%; Transporter classification
                     TC:4.A.6.1.4. Codon Adaptation Index (CAI): 0.79.
                     Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system sugar-specific transporter subunit
                     IIA"
                     /protein_id="YP_001034230.1"
                     /db_xref="GeneID:4808080"
                     /translation="MKYLVLVSHGGLAAGVQSSLKMFAGDKTDQVIAVGLQEGKSVDD
                     FAVDFTQALSGLSADDSVLVLADIVGGSPLTTAASVLADMGKLDSAVILGGLNLTMGL
                     TGLVMKDILDGKELAQAILSEATAALQEFEVVSDAADEDEDDI"
     misc_feature    215516..215869
                     /locus_tag="SSA_0219"
                     /note="PTS_IIA, PTS system, mannose/sorbose specific IIA
                     subunit. The bacterial phosphoenolpyruvate: sugar
                     phosphotransferase system (PTS) is a multi-protein system
                     involved in the regulation of a variety of metabolic and
                     transcriptional processes. This family...; Region:
                     PTS_IIA_man; cl00025"
                     /db_xref="CDD:294028"
     misc_feature    order(215531..215533,215573..215578,215612..215614,
                     215720..215722,215822..215824)
                     /locus_tag="SSA_0219"
                     /note="active pocket/dimerization site"
                     /db_xref="CDD:237978"
     misc_feature    order(215531..215533,215705..215707,215720..215722)
                     /locus_tag="SSA_0219"
                     /note="active site"
                     /db_xref="CDD:237978"
     misc_feature    215531..215533
                     /locus_tag="SSA_0219"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:237978"
     gene            215988..216482
                     /locus_tag="SSA_0220"
                     /db_xref="GeneID:4805972"
     CDS             215988..216482
                     /locus_tag="SSA_0220"
                     /EC_number="2.7.1.69"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 45.45%; Transporter classification
                     TC:4.A.6.1.2. Codon Adaptation Index (CAI): 0.79.
                     Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system mannose-specific transporter subunit
                     IIB"
                     /protein_id="YP_001034231.1"
                     /db_xref="GeneID:4805972"
                     /translation="MTVSFVRIDDRMIHGQTVTRWAKEYPCDGLIAVNNAAAGNKVLI
                     QAYKGASDKKTFVWTKEAFKEKSGKVTESDSRYFLITKNPVDMKEILVDQGFVPGDVK
                     EIIVGPANDRPGAVKLGNNQSITQEEAEAIEAIEKAGYKVKFQLLPDVSIGYWSDFKS
                     KFGF"
     misc_feature    215994..216434
                     /locus_tag="SSA_0220"
                     /note="PTS system sorbose subfamily IIB component; Region:
                     PTSIIB_sorb; pfam03830"
                     /db_xref="CDD:309091"
     misc_feature    order(216006..216008,216018..216020,216027..216029)
                     /locus_tag="SSA_0220"
                     /note="active site"
                     /db_xref="CDD:237975"
     misc_feature    216027..216029
                     /locus_tag="SSA_0220"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:237975"
     gene            216510..217355
                     /locus_tag="SSA_0221"
                     /db_xref="GeneID:4806632"
     CDS             216510..217355
                     /locus_tag="SSA_0221"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 44.92%; Transporter classification
                     TC:4.A.6.1.1. Transmembrane domains: 7. Codon Adaptation
                     Index (CAI): 0.793. SignalP prediction: Yes (prob. 0.878);
                     Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system mannose-specific transporter subunit
                     IIC"
                     /protein_id="YP_001034232.1"
                     /db_xref="GeneID:4806632"
                     /translation="MTISWLQAALLGLFASLASMPGMGGSSIGNYTLGRPLVGGLISG
                     LILGDLKTGIMVGVALQVLYIALVTPGGTVSADVRAISYIGIPLAILFVHSKGITSES
                     AIAAAAAPIGAAVGTIGTVLFYGTATTNLLWQHIGWKAVEKGEFKKLYAVDWVYPWIS
                     HFVFSFLPTMIITKFGPNMVELMKTHLPMDGFIMKSLFTVGALLPCVGIAILLKQIVT
                     KAADFIPFFVGFTLAKSLGLNLVASAVVSLIFAVIYYELEVIKSARVTAPAGGADFDD
                     DEEDI"
     misc_feature    216522..217268
                     /locus_tag="SSA_0221"
                     /note="PTS system sorbose-specific iic component; Region:
                     EII-Sor; pfam03609"
                     /db_xref="CDD:308933"
     gene            217357..218193
                     /locus_tag="SSA_0222"
                     /db_xref="GeneID:4806263"
     CDS             217357..218193
                     /locus_tag="SSA_0222"
                     /note="GC: 45.64%; Transporter classification
                     TC:4.A.6.1.2. Transmembrane domains: 5. Codon Adaptation
                     Index (CAI): 0.779. Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system mannose-specific transporter subunit
                     IID"
                     /protein_id="YP_001034233.1"
                     /db_xref="GeneID:4806263"
                     /translation="MAERKKITKKTLAKSFHHWYYGHLTCFSQEHMQTFGYLTSMLPI
                     VEELYKDKAEQKEAMQTYTAFFNTEPQLGALVVGITAGLEEARANGDAVDGETINGMR
                     AGLMGPIAGIGDSLVVGTLIPVLLGIALGLSKGGNPIGALFYILVWNVLIYGGMRFAY
                     FKGYELGDKAVEFLVGPKGQALRKAISVIGGMVIGAVAATWVSVTTSLELKNADGEAF
                     LKLQEKIDGVYPGLLTAGFITLCWWLMAKKKVSPNLVMLLLVVIALIGVALGIFDPQL
                     KY"
     misc_feature    217375..218169
                     /locus_tag="SSA_0222"
                     /note="PTS system mannose/fructose/sorbose family IID
                     component; Region: EIID-AGA; pfam03613"
                     /db_xref="CDD:308937"
     gene            218288..218578
                     /locus_tag="SSA_0224"
                     /db_xref="GeneID:4806554"
     CDS             218288..218578
                     /locus_tag="SSA_0224"
                     /note="GC: 39.86%; Transmembrane domains: 2. Codon
                     Adaptation Index (CAI): 0.736. Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034234.1"
                     /db_xref="GeneID:4806554"
                     /translation="MTEQELIQGYETEIHYQKHMIENLGRWFSLFFAIASIGLVLIYL
                     FHETNLLALIAGIVLALLGILSMLVFGYGIYRGRLNLQKVIDDFEAKLKLAR"
     gene            218782..219063
                     /gene="groES"
                     /locus_tag="SSA_0225"
                     /db_xref="GeneID:4806471"
     CDS             218782..219063
                     /gene="groES"
                     /locus_tag="SSA_0225"
                     /function="Posttranslational modification, protein
                     turnover, chaperones"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="10 kDa chaperonin; Cpn10; GroES; forms
                     homoheptameric ring; binds to one or both ends of the
                     GroEL double barrel in the presence of adenine nucleotides
                     capping it; folding of unfolded substrates initiates in a
                     GroEL-substrate bound and capped by GroES; release of the
                     folded substrate is dependent on ATP binding and
                     hydrolysis in the trans ring"
                     /codon_start=1
                     /transl_table=11
                     /product="co-chaperonin GroES"
                     /protein_id="YP_001034235.1"
                     /db_xref="GeneID:4806471"
                     /translation="MLKPLGDRVVLKVEEKEQKVGGFVIAGNGQAATKTAEVVAVGQG
                     IRTLNGELVALSVKEGDKVLVENHAGVEVKDGEEAYLLVSEANILAVVE"
     misc_feature    218782..219060
                     /gene="groES"
                     /locus_tag="SSA_0225"
                     /note="co-chaperonin GroES; Reviewed; Region: groES;
                     PRK00364"
                     /db_xref="CDD:178988"
     misc_feature    order(218782..218784,218788..218790,218794..218796,
                     218803..218805,218881..218886,218947..218949,
                     218977..218979,218992..218994,218998..219000,
                     219046..219054)
                     /gene="groES"
                     /locus_tag="SSA_0225"
                     /note="oligomerisation interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238197"
     misc_feature    order(218830..218838,218839..218868)
                     /gene="groES"
                     /locus_tag="SSA_0225"
                     /note="mobile loop; other site"
                     /db_xref="CDD:238197"
     misc_feature    order(218908..218910,218941..218943)
                     /gene="groES"
                     /locus_tag="SSA_0225"
                     /note="roof hairpin; other site"
                     /db_xref="CDD:238197"
     gene            219087..220709
                     /gene="groEL"
                     /locus_tag="SSA_0226"
                     /db_xref="GeneID:4806269"
     CDS             219087..220709
                     /gene="groEL"
                     /locus_tag="SSA_0226"
                     /function="Posttranslational modification, protein
                     turnover, chaperones"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="60 kDa chaperone family; promotes refolding of
                     misfolded polypeptides especially under stressful
                     conditions; forms two stacked rings of heptamers to form a
                     barrel-shaped 14mer; ends can be capped by GroES;
                     misfolded proteins enter the barrel where they are
                     refolded when GroES binds; many bacteria have multiple
                     copies of the groEL gene which are active under different
                     environmental conditions; the B.japonicum protein in this
                     cluster is expressed constitutively; in Rhodobacter,
                     Corynebacterium and Rhizobium this protein is essential
                     for growth"
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone GroEL"
                     /protein_id="YP_001034236.1"
                     /db_xref="GeneID:4806269"
                     /translation="MAKDIKFSADARSSMVRGVDILANTVKVTLGPKGRNVVLEKSFG
                     SPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREG
                     IKNVTAGANPIGIRRGIEAAVATAVEALKSNSVPVSNKEAIAQVAAVSSRSEKVGEYI
                     SEAMEKVGNDGVITIEESKGMETELDVVEGMQFDRGYLSQYMVTDNEKMVAELDNPYI
                     LITDKKISNIQEILPLLENILKTNRPLLIVADDVDGEALPTLVLNKIRGTFNVVAVKA
                     PGFGDRRKAMLEDIAILTGGTVITDDLGLELKDATIEALGQASKVTVDKDSTVIVEGS
                     GNPEAIANRVAVIKSQIESSTSEFDREKLQERLAKLSGGVAVIKVGAATETELKEMKL
                     RIEDALNATRAAVEEGIVSGGGTAYINVLDAVAGLELAGDEGTGRNIVLRALEEPVRQ
                     IALNAGFEGSIVIDRLKNSEVGTGFNAATGEWVNMIEAGIIDPVKVTRSALQNAASVA
                     SLILTTEAVVANQPEPASPAPAMDPGMMGGMM"
     misc_feature    219087..220679
                     /gene="groEL"
                     /locus_tag="SSA_0226"
                     /note="chaperonin GroEL; Reviewed; Region: groEL;
                     PRK00013"
                     /db_xref="CDD:234573"
     misc_feature    order(219093..219095,219105..219107,219156..219158,
                     219189..219200,219204..219206,219219..219224,
                     219228..219230,219258..219260,219264..219266,
                     219288..219290,219300..219302,219309..219311,
                     219669..219671,219765..219767,219849..219851,
                     220230..220232,220236..220238,220452..220454,
                     220614..220616,220623..220643)
                     /gene="groEL"
                     /locus_tag="SSA_0226"
                     /note="ring oligomerisation interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239460"
     misc_feature    order(219174..219182,219342..219344,219354..219356,
                     219531..219533,220272..220274,220323..220325,
                     220437..220439,220554..220556,220560..220562)
                     /gene="groEL"
                     /locus_tag="SSA_0226"
                     /note="ATP/Mg binding site [chemical binding]; other site"
                     /db_xref="CDD:239460"
     misc_feature    order(219408..219410,220377..220379,220431..220433,
                     220458..220460,220464..220469,220476..220478)
                     /gene="groEL"
                     /locus_tag="SSA_0226"
                     /note="stacking interactions; other site"
                     /db_xref="CDD:239460"
     misc_feature    order(219504..219506,219636..219638,219657..219659,
                     220203..220205,220305..220310)
                     /gene="groEL"
                     /locus_tag="SSA_0226"
                     /note="hinge regions; other site"
                     /db_xref="CDD:239460"
     gene            221177..223030
                     /locus_tag="SSA_0227"
                     /db_xref="GeneID:4807853"
     CDS             221177..223030
                     /locus_tag="SSA_0227"
                     /function="Cell envelope biogenesis, outer membrane"
                     /note="GC: 43.58%; Transmembrane domains: 2. Codon
                     Adaptation Index (CAI): 0.797. LipoP prediction: SpI.
                     SignalP prediction: Yes (prob. 1); Curator(s): P. Manque,
                     T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="collagen-binding surface protein"
                     /protein_id="YP_001034237.1"
                     /db_xref="GeneID:4807853"
                     /translation="MKRISQTIARFFSVAFVLLFSLFSSSQSARANTVDDVITSVNVY
                     NQKGEELTDGLSPWEKFQIDANFAFNYGKVQPGDTTTIGLPAEFALEGADFEVKDDDG
                     NLVATAVVDASSKQLTLTYTDYVLTRSHIEGKVHLLARVDHTVARDKGSIPLKLIVGK
                     KIVEYGKIDYKGLPGQATPYTFIKYGWNNADNIKSITYSLNINQQNQELDNVVISDTL
                     GFNTGEIDLNSFQILKGSWVVDPADNSYRLSQQREDVTANYTINLAADKRSFTINMGH
                     IGANEGFYVRYRVNFPTVPADGTLFPNEAIMRADNIEEQKSSVAVRYQRANGYAHGDV
                     YGVQVTKKDEAGKALAGAEFTLYDEDGVTIVQKATSDANGIASFSNLIKEHYLIKETK
                     APEGYQLSDEEIQVNAAQLKNYGSGIIYKDFTNRKALITASGTKTWNDDNDKDGKRPD
                     KITVRLYANGTEVAHKEVGPNDKGEWKYEFTDLPATGEDGKDIVYSVTEDRVYGYTAT
                     VDGMNITNTPVPGVPQPPKPSSDNSSKSSSSSSSSSSSSSSTTSSSSSTTGSTVVIIE
                     SDNGTGGGNASNVGTKKVLPKAGENASWIMIAAGVALVGLVGFIVFRAKKK"
     misc_feature    221717..222127
                     /locus_tag="SSA_0227"
                     /note="Collagen binding domain; Region: Collagen_bind;
                     pfam05737"
                     /db_xref="CDD:283410"
     misc_feature    222221..222397
                     /locus_tag="SSA_0227"
                     /note="Cna protein B-type domain; Region: Cna_B;
                     pfam05738"
                     /db_xref="CDD:283411"
     misc_feature    222464..222727
                     /locus_tag="SSA_0227"
                     /note="Repeat unit of collagen-binding protein domain B;
                     Region: CollagenBindB; cd00222"
                     /db_xref="CDD:212461"
     misc_feature    order(222467..222469,222473..222475,222479..222481,
                     222551..222556,222605..222607,222611..222613,
                     222617..222619,222656..222658,222662..222664,
                     222668..222670,222677..222679,222692..222694,
                     222698..222703)
                     /locus_tag="SSA_0227"
                     /note="domain interaction interfaces [polypeptide
                     binding]; other site"
                     /db_xref="CDD:212461"
     misc_feature    222926..223027
                     /locus_tag="SSA_0227"
                     /note="LPXTG-motif cell wall anchor domain; Region:
                     LPXTG_anchor; TIGR01167"
                     /db_xref="CDD:273478"
     gene            223503..223634
                     /locus_tag="SSA_0228"
                     /db_xref="GeneID:4807565"
     CDS             223503..223634
                     /locus_tag="SSA_0228"
                     /note="GC: 31.06%; Codon Adaptation Index (CAI): 0.805.
                     Curator(s): P. Manque, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034238.1"
                     /db_xref="GeneID:4807565"
                     /translation="MIELKKAGLNKQKSPETKAFSYLFLCPLHEFVRTFHIENKQKC"
     gene            223675..223773
                     /locus_tag="SSA_0229"
                     /db_xref="GeneID:4805903"
     CDS             223675..223773
                     /locus_tag="SSA_0229"
                     /note="GC: 31.31%; Codon Adaptation Index (CAI): 0.774.
                     Curator(s): P. Manque, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034239.1"
                     /db_xref="GeneID:4805903"
                     /translation="MSGFKNGAKVGQKQINEKNIEFVHQVNDKLQE"
     gene            complement(223902..225047)
                     /locus_tag="SSA_0230"
                     /db_xref="GeneID:4807135"
     CDS             complement(223902..225047)
                     /locus_tag="SSA_0230"
                     /note="GC: 33.16%; Transmembrane domains: 12. Codon
                     Adaptation Index (CAI): 0.75. Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034240.1"
                     /db_xref="GeneID:4807135"
                     /translation="MTTLIKHKRVEFSELFYDLVFVFAISKATTLIDHLHNGILTWNS
                     FLDFFIATLFLIDSWMIQTDYTNRYGKNSLFNIVIMFIKMGILLFIANMIGPDWQQYF
                     HYLCWAIGTLTLTLFFQYLVEFFRKSTDDANRESIKGFLWITGLGSLGFYLAALLPIY
                     LRVYILFASILLTFIMPSILLNKDKHYQVNLPHLIERISLLVIITFGEMITELANFFT
                     IENFSIYSVLYFIIMISLFLFYFGQFDHAIDEKSNQKGLFLIYSHYPIFIGLLMMTVS
                     MSFLLNPEANRLFATSFSYIGFGLFQAAVLVNGPYNKHYLRYSKSYYCVQATLYLAAL
                     ILSLIFASNPIIVVSITTILALAIAIHFIYFYVTQNKKYSKSNWGFF"
     misc_feature    complement(223968..225014)
                     /locus_tag="SSA_0230"
                     /note="Bacterial low temperature requirement A protein
                     (LtrA); Region: LtrA; pfam06772"
                     /db_xref="CDD:284241"
     gene            225853..227142
                     /locus_tag="SSA_0231"
                     /db_xref="GeneID:4806787"
     CDS             225853..227142
                     /locus_tag="SSA_0231"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 39.61%; Transmembrane domains: 7. Codon
                     Adaptation Index (CAI): 0.76. Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034241.1"
                     /db_xref="GeneID:4806787"
                     /translation="MAKILSLGLTGKKLLAQGFLFVLLGLILMVTGTWLPVTVIRLVL
                     FLAWIATVVDLLLRVFKKSQSTDTLGVALVKLLVLGYLLGSNLATDIPIYVLALVIGV
                     YQIFRATINLVTYVLYRKNNIRPRFRLLLDGILLVFLGGASLLSSTGNSVFQLFVLGA
                     YFFLYGLSNIRDGFLFEGEIGKNHLKRRIRISLPIVLAALIPARTLAKINKFMLENAD
                     EEEDIHLGIVKSGKTAELEIFVHTAETSLFSAIGHVDICYQGRVISYGNYDPSSETLF
                     GMVGDGVLYFCDRDKYIDLCKRESQKTLFGYGIDLTPEMEKAVQKKLAELKQLTIPWE
                     PSADKIMTGDGKEDYTYAYKIRHETDGELYKFIKSKFKSYFVLSTNCVLLADTIVGQA
                     GTDILSPKGFIAPGTYQAYLDREFEKPNSIVVSKHVY"
     gene            227152..227337
                     /locus_tag="SSA_0232"
                     /db_xref="GeneID:4806140"
     CDS             227152..227337
                     /locus_tag="SSA_0232"
                     /note="GC: 33.87%; Transmembrane domains: 2. Codon
                     Adaptation Index (CAI): 0.705. SignalP prediction: Yes
                     (prob. 0.995); Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034242.1"
                     /db_xref="GeneID:4806140"
                     /translation="MNLVKKYTPLILFIGLVTLVILNASSFISGAVSLFEVTSTLIYG
                     AVIAFVLNVPMKKLKNS"
     gene            227343..228239
                     /locus_tag="SSA_0233"
                     /db_xref="GeneID:4806315"
     CDS             227343..228239
                     /locus_tag="SSA_0233"
                     /function="General function prediction only"
                     /note="GC: 39.58%; Transporter classification
                     TC:9.B.22.1.1. Transmembrane domains: 6. Codon Adaptation
                     Index (CAI): 0.709. SignalP prediction: Yes (prob. 1);
                     Curator(s): P. Manque, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="YP_001034243.1"
                     /db_xref="GeneID:4806315"
                     /translation="MKVKAGLRRPIAMVLVFLSLILIVICLLVLVLPTLAQTISQLGA
                     VLSTVLTQLGKLLDSSEFVTKDMLSTIVSGIQGQSSSISQALITFLSGLTSNIGNIFS
                     SIMNAFLIIVFTFLFLSSKEHLAAMTSRLLKVIFPEKVVTKLTYIGQVALETYDQFLM
                     SQLIEAVIIGVMIAVGYSLFGLPYGVMTGIFAGVLSFIPYVGPMIACVVGAIFIFTVS
                     PTQALLSLLLYQVIQLIEGNLIYPRVVGQSIGLPAIFTLAAASIGGNLFGLLGMIFFT
                     PIFAVIYRLVKEFVVAKENQLD"
     misc_feature    227352..228212
                     /locus_tag="SSA_0233"
                     /note="Predicted PurR-regulated permease PerM [General
                     function prediction only]; Region: PerM; COG0628"
                     /db_xref="CDD:223701"
     gene            complement(228378..228450)
                     /locus_tag="SSA_2472"
                     /db_xref="GeneID:4806576"
     tRNA            complement(228378..228450)
                     /locus_tag="SSA_2472"
                     /product="tRNA-Lys"
                     /inference="profile:tRNAscan-SE:1.23"
                     /note="tRNA-Lys_4"
                     /db_xref="GeneID:4806576"
     gene            complement(228513..229028)
                     /locus_tag="SSA_0234"
                     /db_xref="GeneID:4806637"
     CDS             complement(228513..229028)
                     /locus_tag="SSA_0234"
                     /note="GC: 37.6%; Transmembrane domains: 6. Codon
                     Adaptation Index (CAI): 0.737. SignalP prediction: Yes
                     (prob. 1); Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034244.1"
                     /db_xref="GeneID:4806637"
                     /translation="MKFSNRLLLFLAGVIFVLLALFLFIDPVANLVAYSWWIAFGLLV
                     ASIAAILSYFSAPKELRSPVYLFQGFVSLLLALYLVAYGFVTLPVVIPTIVGIWLIVE
                     AIIVFFKGNRLGLIFPIIGNHIMWIALLAFLLGLVILFNPVATSVFVVYVVAFAFLIV
                     GFTYILDAFRK"
     gene            229701..230840
                     /gene="int"
                     /locus_tag="SSA_0235"
                     /db_xref="GeneID:4806209"
     CDS             229701..230840
                     /gene="int"
                     /locus_tag="SSA_0235"
                     /function="DNA replication, recombination, and repair"
                     /note="GC: 33.07%; Codon Adaptation Index (CAI): 0.77.
                     Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase/recombinase, phage associated"
                     /protein_id="YP_001034245.1"
                     /db_xref="GeneID:4806209"
                     /translation="MASVRYRKRGDSNLWTYEIRSEGKTVVHNSGFKTKKLAESEAEP
                     ILQELRLGKRISRDISLVDLYQEWLELKILPSSRSEETKKKYLLRKNTIERLFGNKKV
                     TQIRASEYQRIMNKYGQTVGRNFLGRLNTGIHQSIQMAIADKVLIDDFTQHVELFSSK
                     EQQMTEEKYLHTEKDYLDLLLAVKRKFDYQRSIVPYIVYFLLKTGMRFGELIALTWNE
                     VDFDRGLLKTYRRFNTLSHKFVPPKNKTSIRMVPIDEECIKILQVLKIEQEKANKELG
                     IKNRYKMIFQHYGYIHLVPDIASVNKALSVLLNELDIYPIITTKGARHTYGSYLWHKG
                     FDLGVIAKILGHRDISMLVEVYGHTLEEKIFEEFNQIRDVWKDCS"
     misc_feature    229896..230789
                     /gene="int"
                     /locus_tag="SSA_0235"
                     /note="Integrase [Replication, recombination and repair,
                     Mobilome: prophages, transposons]; Region: XerC; COG0582"
                     /db_xref="CDD:223655"
     misc_feature    230286..230774
                     /gene="int"
                     /locus_tag="SSA_0235"
                     /note="C-terminal catalytic domain of integrases from
                     bacterial phages and conjugate transposons; Region:
                     INT_ICEBs1_C_like; cd01189"
                     /db_xref="CDD:271189"
     misc_feature    order(230319..230321,230658..230660,230667..230672,
                     230766..230768)
                     /gene="int"
                     /locus_tag="SSA_0235"
                     /note="active site"
                     /db_xref="CDD:271189"
     gene            complement(230927..230999)
                     /locus_tag="SSA_2471"
                     /db_xref="GeneID:4806776"
     tRNA            complement(230927..230999)
                     /locus_tag="SSA_2471"
                     /product="tRNA-Lys"
                     /inference="profile:tRNAscan-SE:1.23"
                     /note="tRNA-Lys_3"
                     /db_xref="GeneID:4806776"
     gene            complement(231265..232533)
                     /gene="cshA"
                     /locus_tag="SSA_0236"
                     /db_xref="GeneID:4805932"
     CDS             complement(231265..232533)
                     /gene="cshA"
                     /locus_tag="SSA_0236"
                     /function="DNA replication, recombination, and repair"
                     /note="GC: 50.91%; Codon Adaptation Index (CAI): 0.734.
                     Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="recombination factor protein RarA"
                     /protein_id="YP_001034246.1"
                     /db_xref="GeneID:4805932"
                     /translation="MPENLALRMRPTDIDQIIGQQHLVGPGKIIRRMVEANRLSSMIL
                     YGPPGIGKTSIASAIAGTTKFAFRTFNATVDSKKRLQEVAEEAKFSGGLVLLLDEIHR
                     LDKTKQDFLLPLLESGLVIMIGATTENPFFSVTPAIRSRVQIFELEPLSNDDIRTAIQ
                     LALTDKERGFDFPVELDDEALDFIAISTNGDLRSAYNSLDLAVLSTPEDSKGIRHITL
                     DVMENSLQKSYITMDKDGDGHYDVLSALQKSIRGSDVNASLHYAARLVEAGDLPSLAR
                     RLTVIAYEDIGLANPDAQVHTVTALEAAQRIGFPEARILIANIVIDLALSPKSNSAYL
                     AMDKALADLRKNGNLPIPRHLRDGHYAGSKELGNAQDYLYPHSYSGNWVKQDYLPDKI
                     KDANYFTPNENGKYERALGMTKDKIDDLKK"
     misc_feature    complement(231268..232524)
                     /gene="cshA"
                     /locus_tag="SSA_0236"
                     /note="recombination factor protein RarA; Reviewed;
                     Region: PRK13342"
                     /db_xref="CDD:237355"
     misc_feature    complement(<232354..232470)
                     /gene="cshA"
                     /locus_tag="SSA_0236"
                     /note="AAA ATPase domain; Region: AAA_16; pfam13191"
                     /db_xref="CDD:289934"
     misc_feature    complement(232084..232410)
                     /gene="cshA"
                     /locus_tag="SSA_0236"
                     /note="ATPase family associated with various cellular
                     activities (AAA); Region: AAA; pfam00004"
                     /db_xref="CDD:278434"
     misc_feature    complement(232375..232398)
                     /gene="cshA"
                     /locus_tag="SSA_0236"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(232153..232155,232240..232242,
                     232372..232395))
                     /gene="cshA"
                     /locus_tag="SSA_0236"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(232237..232254)
                     /gene="cshA"
                     /locus_tag="SSA_0236"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(232111..232113)
                     /gene="cshA"
                     /locus_tag="SSA_0236"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(231781..232017)
                     /gene="cshA"
                     /locus_tag="SSA_0236"
                     /note="AAA C-terminal domain; Region: AAA_assoc_2;
                     pfam16193"
                     /db_xref="CDD:292811"
     misc_feature    complement(231307..231780)
                     /gene="cshA"
                     /locus_tag="SSA_0236"
                     /note="MgsA AAA+ ATPase C terminal; Region: MgsA_C;
                     pfam12002"
                     /db_xref="CDD:288826"
     gene            232621..233091
                     /locus_tag="SSA_0238"
                     /db_xref="GeneID:4806726"
     CDS             232621..233091
                     /locus_tag="SSA_0238"
                     /note="GC: 45.65%; Codon Adaptation Index (CAI): 0.727.
                     Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034247.1"
                     /db_xref="GeneID:4806726"
                     /translation="MAKYGFLEILDEEMGKSFPFDYEINWDKKNHAVEVAFLLEVQNP
                     GGIETVDAEGNASAEDIYFEEAVLFYNPVKSRFEAEDYLAVLPYEPKKGLSREFLAYF
                     VDFLTQTAESGLDALMDFLADSEAAEFEMAWNAEAFENGRADLIETDFYSYPRY"
     misc_feature    232624..233085
                     /locus_tag="SSA_0238"
                     /note="Protein of unknown function (DUF3013); Region:
                     DUF3013; pfam11217"
                     /db_xref="CDD:288115"
     gene            233101..233553
                     /locus_tag="SSA_0239"
                     /db_xref="GeneID:4806014"
     CDS             233101..233553
                     /locus_tag="SSA_0239"
                     /EC_number="3.6.1.-"
                     /function="Nucleotide transport and metabolism"
                     /note="GC: 45.7%; Codon Adaptation Index (CAI): 0.811.
                     Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="7,8-dihydro-8-oxoguanine-triphosphatase"
                     /protein_id="YP_001034248.1"
                     /db_xref="GeneID:4806014"
                     /translation="MTDEEGLDLLHKQMEFSGCKIALLCDDKLLTILRDDISTIPWPN
                     MWELPGGGREGEETPFECVQREIFEELGLKLEEAAIDWAKEYQGMLDPEKTFIFMVGT
                     ITQEEFASIIFGDEGQAYQMMDVSQFLADEKVIPQLQDRLRDYLEVRA"
     misc_feature    233149..233517
                     /locus_tag="SSA_0239"
                     /note="Members of the Nudix hydrolase superfamily catalyze
                     the hydrolysis of NUcleoside DIphosphates linked to other
                     moieties, X. Enzymes belonging to this superfamily require
                     a divalent cation, such as Mg2+ or Mn2+, for their
                     activity and contain a highly...; Region:
                     Nudix_Hydrolase_23; cd04682"
                     /db_xref="CDD:240038"
     misc_feature    233251..233319
                     /locus_tag="SSA_0239"
                     /note="nudix motif; other site"
                     /db_xref="CDD:240038"
     gene            233550..234020
                     /locus_tag="SSA_0240"
                     /db_xref="GeneID:4807389"
     CDS             233550..234020
                     /locus_tag="SSA_0240"
                     /note="GC: 45.65%; Codon Adaptation Index (CAI): 0.774.
                     Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="YP_001034249.1"
                     /db_xref="GeneID:4807389"
                     /translation="MIHIERAGAEDLETIIAIQRASFKAVYEKYQDQYDPYLEERERI
                     RWKLVERPNSFYYFVKDGEKILGFIRLNTNDEQTAGWIGTVAILPEHQNKGYGSEGLG
                     LIEETFSTIRQWDLCTVFQDKGMVAFYEKNGYHQTHTEPEKSGMDMVYMTKTMK"
     misc_feature    233553..233954
                     /locus_tag="SSA_0240"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_3; pfam13302"
                     /db_xref="CDD:290041"
     misc_feature    233727..233954
                     /locus_tag="SSA_0240"
                     /note="Acetyltransferase (GNAT) family; Region:
                     Acetyltransf_1; pfam00583"
                     /db_xref="CDD:278980"
     misc_feature    order(233802..233810,233838..233843)
                     /locus_tag="SSA_0240"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            234161..235117
                     /gene="prmA"
                     /locus_tag="SSA_0241"
                     /db_xref="GeneID:4806844"
     CDS             234161..235117
                     /gene="prmA"
                     /locus_tag="SSA_0241"
                     /EC_number="2.1.1.-"
                     /function="Translation, ribosomal structure and
                     biogenesis"
                     /note="methylates ribosomal protein L11 at multiple amino
                     acid positions; mutations of these genes in Escherichia
                     coli or Thermus thermophilus has no apparent phenotype"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L11 methyltransferase"
                     /protein_id="YP_001034250.1"
                     /db_xref="GeneID:4806844"
                     /translation="MMDTWQELTIEVKREAEEAASNILIELGSQGVAIDDSADYLGQV
                     DQYGELFPEVEQSERVKVTGYYPDSVDIEAIAAQANERLAELDGFGLETGDIQLTRQE
                     LAEEDWADNWKKYFEPARITHDLTIVPSWTEYEATAGEKIIKLDPGMAFGTGTHPTTK
                     MSLFALEQVLRGGETVLDVGTGSGVLSIASSLLGAKDIYAYDLDEVAVRVVQENIELN
                     PGMENIHVAPGDLLRGVEIKADVIVANILADILVHLTEDAYRLVKDEGYLIMSGIISE
                     KWEMVRESAEAAGFFLETHMIQGEWNACVFKKTQDISGVIGG"
     misc_feature    234170..235084
                     /gene="prmA"
                     /locus_tag="SSA_0241"
                     /note="Ribosomal protein L11 methyltransferase (PrmA);
                     Region: PrmA; pfam06325"
                     /db_xref="CDD:283886"
     misc_feature    234683..234973
                     /gene="prmA"
                     /locus_tag="SSA_0241"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(234695..234715,234764..234769,234845..234853,
                     234893..234895)
                     /gene="prmA"
                     /locus_tag="SSA_0241"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            235118..235870
                     /locus_tag="SSA_0242"
                     /db_xref="GeneID:4806848"
     CDS             235118..235870
                     /locus_tag="SSA_0242"
                     /function="Function unknown"
                     /note="in Escherichia coli RsmE methylates the N3 position
                     of the U1498 base in 16S rRNA; cells lacking this function
                     can grow, but are outcompeted by wild-type; SAM-dependent
                     m(3)U1498 methyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA (uracil(1498)-N(3))-methyltransferase"
                     /protein_id="YP_001034251.1"
                     /db_xref="GeneID:4806848"
                     /translation="MQQYFIKGNPQSPLEVTDKDTAKHMFSVMRLKAGDQVILVFDDG
                     VKRLARVLDPSQQSLEIVEELADNTELLVQVTIASGFPKGDKLEFITQKATELGACAL
                     WGFPADWSVAKWDGKKLAKKSEKLEKIAQGAAEQSRRNLIPEIRLFDKKADFLAALTD
                     FDRIIVAYEEAAKVGEAATLVQAVRGLSKGDKLLFIFGPEGGLSPEEIVAFGQAGAVS
                     AGLGPRILRAETAPLYALTAVSVLLELSNDSL"
     misc_feature    235118..235852
                     /locus_tag="SSA_0242"
                     /note="16S rRNA U1498 N3-methylase RsmE [Translation,
                     ribosomal structure and biogenesis]; Region: RsmE;
                     COG1385"
                     /db_xref="CDD:224303"
     gene            complement(235914..238325)
                     /gene="yfkN"
                     /locus_tag="SSA_0243"
                     /gene_synonym="cpdB"
                     /db_xref="GeneID:4808057"
     CDS             complement(235914..238325)
                     /gene="yfkN"
                     /locus_tag="SSA_0243"
                     /gene_synonym="cpdB"
                     /EC_number="3.1.3.6"
                     /EC_number="3.1.4.16"
                     /function="Nucleotide transport and metabolism"
                     /note="in Escherichia coli this is a periplasmic enzyme
                     while in gram positive organisms it may be anchored at the
                     cell surface; functions during ribonucleic acid
                     degradation; 2',3'-cyclic nucleotides are first converted
                     to 3'-nucleotide and then cleaved to yield a
                     ribonucleotide and a phosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional 2',3'-cyclic nucleotide
                     2'-phosphodiesterase/3'-nucleotidase precursor protein"
                     /protein_id="YP_001034252.1"
                     /db_xref="GeneID:4808057"
                     /translation="MSKSSLQKTVALLSAAALAATVNAVQADENTPAVTANLAPVESS
                     AAEAKPTTAASPTEATATTESTDPSSAISPENAIGDTDALMAMARNVAATEDTKPVEG
                     QTVDVRILATTDLHTNLVNYDYYQDKPVETLGLAKTAVLIEKAKKENPNVLLVDNGDT
                     IQGTPLGTYKAIVDPVEKGEQHPMYAALQALGFEAGTLGNHEFNYGLDYLNRVIETAG
                     MPLVNANVLDPATGKFIYQPYKIIEKTFTDTQGRLTTVKIGVTGIVPPQILNWDKANL
                     EGKVVVRDSVEAIRDIIPEMRKAGADITLVLSHSGIGDDKYEKGEENEGYQIASLPGV
                     DAVVTGHSHAEFPSGNGTGFYEKYPGVDGINGKINGTPVTMAGKYGDHLGVIDLKLNY
                     TDGKWKVTDSKGSIRKVDTKSNVADQRVIDIAKESHQGTINYVRQQVGITTAPITSYF
                     SLVKDDPSVQIVNNAQLWYAKQELAGTPEANLPILSAAAPFKAGTRGDATAYTDIPAG
                     PIAIKNVADLYLYDNVTAILKVNGAQLKEWLEMSAGQFNTIDPNNNQPQNLVNTDYRT
                     YNFDVIDGVTYEFDITQPNKYDREGKLANPNASRVRNLKYQGKEIDPNQEFIVVTNNY
                     RSNGNFPGVREASLNRLLNLENRQAIINYILAVKNINPSADQNWHFADTIKGLDLRFL
                     TADKAKNLIGTDGDIVYLAASAQEGFGEYKFVYVAPKTEPVPIEQPSSPTIAVEAANL
                     QHSKVDFPVLTAVDPSTNKQASHRQAGAESLPVTGEKTSSLGLLGLVMTGLAGIFTFK
                     KRERQ"
     misc_feature    complement(235923..238325)
                     /gene="yfkN"
                     /locus_tag="SSA_0243"
                     /gene_synonym="cpdB"
                     /note="bifunctional 2',3'-cyclic nucleotide
                     2'-phosphodiesterase/3'-nucleotidase precursor protein;
                     Reviewed; Region: PRK11907"
                     /db_xref="CDD:237019"
     misc_feature    complement(237099..238007)
                     /gene="yfkN"
                     /locus_tag="SSA_0243"
                     /gene_synonym="cpdB"
                     /note="Escherichia coli CpdB and related proteins,
                     N-terminal metallophosphatase domain; Region: MPP_CpdB_N;
                     cd07410"
                     /db_xref="CDD:277355"
     misc_feature    complement(order(237297..237299,237303..237305,
                     237399..237401,237723..237728,237849..237851,
                     237978..237980,237984..237986))
                     /gene="yfkN"
                     /locus_tag="SSA_0243"
                     /gene_synonym="cpdB"
                     /note="active site"
                     /db_xref="CDD:277355"
     misc_feature    complement(order(237297..237299,237303..237305,
                     237399..237401,237726..237728,237849..237851,
                     237978..237980,237984..237986))
                     /gene="yfkN"
                     /locus_tag="SSA_0243"
                     /gene_synonym="cpdB"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:277355"
     misc_feature    complement(236439..237014)
                     /gene="yfkN"
                     /locus_tag="SSA_0243"
                     /gene_synonym="cpdB"
                     /note="5'-nucleotidase, C-terminal domain; Region:
                     5_nucleotid_C; pfam02872"
                     /db_xref="CDD:280945"
     misc_feature    complement(235920..236018)
                     /gene="yfkN"
                     /locus_tag="SSA_0243"
                     /gene_synonym="cpdB"
                     /note="LPXTG-motif cell wall anchor domain; Region:
                     LPXTG_anchor; TIGR01167"
                     /db_xref="CDD:273478"
     gene            238838..239230
                     /locus_tag="SSA_0244"
                     /db_xref="GeneID:4806849"
     CDS             238838..239230
                     /locus_tag="SSA_0244"
                     /note="GC: 35.62%; Transmembrane domains: 1. Codon
                     Adaptation Index (CAI): 0.756. SignalP prediction: Yes
                     (prob. 0.67); Curator(s): P. Manque, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034253.1"
                     /db_xref="GeneID:4806849"
                     /translation="MSKRRKMFMGFIGLSVLILLGGGLYLAHKNHEFQNEMTRIVHSK
                     EVKNLIEKKLKKLDPHALTDKGKIRSYKIDDKSIRHNPMGGIMFDIVINDDPDIVGST
                     GLRKYGENEDVRTVGMDRSKGLQKLLEE"
     misc_feature    238919..239215
                     /locus_tag="SSA_0244"
                     /note="Protein of unknown function (DUF1310); Region:
                     DUF1310; pfam07006"
                     /db_xref="CDD:284435"
     gene            239276..239668
                     /locus_tag="SSA_0245"
                     /db_xref="GeneID:4807411"
     CDS             239276..239668
                     /locus_tag="SSA_0245"
                     /note="GC: 34.86%; Transmembrane domains: 1. Codon
                     Adaptation Index (CAI): 0.774. LipoP prediction: SpII.
                     SignalP prediction: Yes (prob. 0.734); Curator(s): P.
                     Manque, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034254.1"
                     /db_xref="GeneID:4807411"
                     /translation="MKKKHKIILIIVSLFVAVCLGGGMYMAHKNQEFQNEMTRIVHSE
                     EVKKLIVEELKAIDPNALTEKGKIRSYKIDDSTIRHNPMGGIMFDIIINDSISMVGKM
                     GIQKDGGSEQLSSVGMDESVGLQALVGE"
     misc_feature    239309..239650
                     /locus_tag="SSA_0245"
                     /note="Protein of unknown function (DUF1310); Region:
                     DUF1310; pfam07006"
                     /db_xref="CDD:284435"
     gene            239843..240166
                     /locus_tag="SSA_0246"
                     /db_xref="GeneID:4806847"
     CDS             239843..240166
                     /locus_tag="SSA_0246"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 37.65%; Codon Adaptation Index (CAI): 0.775.
                     Curator(s): P. Manque, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034255.1"
                     /db_xref="GeneID:4806847"
                     /translation="MYMAHKNQEFHNEMTRIVHSEEVRKLLEEDLKRKDPNALTDKGK
                     IRSYKIDDSSIKHNPMGGIMFNIIINDSISMVGKTGLQMDGENGKIRTDGMTESAGLR
                     ALLSE"
     misc_feature    239843..240145
                     /locus_tag="SSA_0246"
                     /note="Protein of unknown function (DUF1310); Region:
                     DUF1310; pfam07006"
                     /db_xref="CDD:284435"
     gene            240172..241515
                     /locus_tag="SSA_0247"
                     /db_xref="GeneID:4807967"
     CDS             240172..241515
                     /locus_tag="SSA_0247"
                     /note="GC: 39.81%; Codon Adaptation Index (CAI): 0.769.
                     Curator(s): P. Manque, J. Alves; possible lipase class 3"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034256.1"
                     /db_xref="GeneID:4807967"
                     /translation="MINYNEQERNEIARLEYKDLSHGEGAKIKSSDGSEITVGYVSDI
                     LGKKIEVGDLSVFPTQKKRVKDNEVGLDGYVLTDRWMSESDSPEDVKEITVLFEGSLV
                     DPEHNMTGTLNDWGRTDAQMAAKILMGQWAGIRGAKPKQLALAGDRLKEIMDKYPNAR
                     VSLYAHSLGSMDGQVALASLEDSYLQRIDGAYLYEGPNTYPILTDKERRQVDKIKYKI
                     FNYIDRKDIVTIGYPEKGSEGAVGTVVNINSKDRKNIGTQHMWGGYEYDSGHLNVSES
                     DLQDYRLARAKQAMEQLDIKKKALSERYQKMVTAGYTRTEMIYLDSEQATTFASSLQN
                     LAVISTEAIMAFCDYGVSKVSGRWDALLAQAQAMPNVSRLLSEAEVIDALSQVGATKD
                     TVETSIITELKDMRNKAVKTKEEFDGLSSKLLNGIQELVKKDEGLAREYKRWGNI"
     gene            241500..241904
                     /locus_tag="SSA_0248"
                     /db_xref="GeneID:4807882"
     CDS             241500..241904
                     /locus_tag="SSA_0248"
                     /note="GC: 36.3%; Codon Adaptation Index (CAI): 0.754.
                     Curator(s): P. Manque, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034257.1"
                     /db_xref="GeneID:4807882"
                     /translation="MGQHIENKKDKLYEQLRSTQERYNAEYDKYLDEKRNFEEVMTET
                     DDLYHSARQQIQDMEDYTVSCLRRSTEGAQLIHEFYDKVFQVQDNLEIEYRREREGVE
                     EECSLLDKRFRKKSDKYDEELAHIRRDIYGEK"
     gene            241891..242175
                     /locus_tag="SSA_0249"
                     /db_xref="GeneID:4807637"
     CDS             241891..242175
                     /locus_tag="SSA_0249"
                     /note="GC: 39.3%; Codon Adaptation Index (CAI): 0.777.
                     Curator(s): P. Manque, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034258.1"
                     /db_xref="GeneID:4807637"
                     /translation="MGKSKIAAKLDIDAYLKTLALGTIKTLGKAALAEVQKERDDVKK
                     NVSTVATDWDRSVGQIIGGLNQVLVGQFSNQVKESAQQKRSGIQELQDNK"
     gene            242307..244526
                     /gene="relA"
                     /locus_tag="SSA_0250"
                     /db_xref="GeneID:4807254"
     CDS             242307..244526
                     /gene="relA"
                     /locus_tag="SSA_0250"
                     /EC_number="2.7.6.5"
                     /function="Signal transduction mechanisms / Transcription"
                     /note="GC: 48.6%; Codon Adaptation Index (CAI): 0.773.
                     Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP pyrophosphokinase"
                     /protein_id="YP_001034259.1"
                     /db_xref="GeneID:4807254"
                     /translation="MPKEVNLTGDQVLALTRKYLAAEDVAFIQKALIYAIDCHSGQFR
                     RSGEPYIVHPIQVAGILAKLKLDAVTVACGFLHDVVEDTRATLDDLEREFGTDVRVIV
                     DGVTKLGKVKYKSHEEQLAENHRKMLMAMSEDIRVILVKLADRLHNMRTLKHLRKDKQ
                     ERISRETMEIYAPLAHRLGISSVKWELEDLSFRYLNEVEFYKISHMMKEKRREREELV
                     EEVVQKIETYAGERNLHGKIYGRPKHIYSIYRKMQDKKKRFDEIYDLIAIRCILDTQS
                     DVYAMLGYIHELWRPMPGRFKDYIANRKANGYQSIHTTVYGPKGPIEFQIRTKEMHEV
                     AEYGVAAHWAYKKGVKGQVDSKESAIGMNWIKELMELQDQSNNAKDFVDSVKESYLAE
                     EIYVFTPDGAVRSLPKDSGPIDFAYEIHTKVGEKATGAKVNGRMVPLTTKLRTGDQVE
                     IITNANSFGPSRDWLNIVKTSKARNKIRQFFKNQDKELSISKGRELLQAQFQEHGYVA
                     NKYMDKKHMEEVLQKTSYKTEEALFAAIGFGEIGAISIFNRLTEKERREEERAKARAE
                     AEELVKGGEVKVENKKDTLKVKHEGGVVIQGASGLLIRIAKCCNPVPGDDIVGYITKG
                     RGVAIHRQDCMNLKAQENYEQRLIDVEWEDNNTTKEYTAHIDIYGLNRSGLLNDVLQV
                     LSNTTKNISTVNAQPTKDMKFANIHVSFGIANLSMLTTVVDKIKSVPEVYSVKRTNG"
     misc_feature    242307..244517
                     /gene="relA"
                     /locus_tag="SSA_0250"
                     /note="(p)ppGpp synthase/hydrolase, HD superfamily [Signal
                     transduction mechanisms, Transcription]; Region: SpoT;
                     COG0317"
                     /db_xref="CDD:223394"
     misc_feature    242397..242846
                     /gene="relA"
                     /locus_tag="SSA_0250"
                     /note="HD domain; Region: HD_4; pfam13328"
                     /db_xref="CDD:290067"
     misc_feature    order(242463..242465,242535..242540,242736..242738)
                     /gene="relA"
                     /locus_tag="SSA_0250"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    242538..242540
                     /gene="relA"
                     /locus_tag="SSA_0250"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    243024..243356
                     /gene="relA"
                     /locus_tag="SSA_0250"
                     /note="Region found in RelA / SpoT proteins; Region:
                     RelA_SpoT; pfam04607"
                     /db_xref="CDD:282463"
     misc_feature    order(243027..243029,243033..243035,243096..243101,
                     243111..243113,243195..243197,243201..243203,
                     243216..243218,243222..243224,243228..243230,
                     243240..243242,243273..243275,243279..243281,
                     243285..243287,243309..243314)
                     /gene="relA"
                     /locus_tag="SSA_0250"
                     /note="synthetase active site [active]"
                     /db_xref="CDD:143389"
     misc_feature    order(243027..243029,243195..243197,243201..243203,
                     243216..243218,243222..243224,243228..243230,
                     243240..243242,243273..243275,243279..243281,
                     243309..243311)
                     /gene="relA"
                     /locus_tag="SSA_0250"
                     /note="NTP binding site [chemical binding]; other site"
                     /db_xref="CDD:143389"
     misc_feature    order(243096..243098,243273..243275)
                     /gene="relA"
                     /locus_tag="SSA_0250"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143389"
     misc_feature    243486..243665
                     /gene="relA"
                     /locus_tag="SSA_0250"
                     /note="TGS_RelA_SpoT: The RelA (SpoT) protein, also
                     referred to as ppGpp hydrolase/synthetase, is a
                     ribosome-associated protein that is activated during amino
                     acid starvation and thought to mediate the stringent
                     response. RelA contains a TGS domain, named after...;
                     Region: TGS_RelA_SpoT; cd01668"
                     /db_xref="CDD:133438"
     misc_feature    244278..244514
                     /gene="relA"
                     /locus_tag="SSA_0250"
                     /note="ACT domain; Region: ACT_4; pfam13291"
                     /db_xref="CDD:290030"
     gene            244595..245038
                     /gene="dtd"
                     /locus_tag="SSA_0251"
                     /db_xref="GeneID:4807474"
     CDS             244595..245038
                     /gene="dtd"
                     /locus_tag="SSA_0251"
                     /EC_number="3.1.-.-"
                     /note="hydrolyzes D-tyrosyl-tRNA(Tyr) into D-tyrosine and
                     free tRNA(Tyr); possible defense mechanism against a
                     harmful effect of D-tyrosine"
                     /codon_start=1
                     /transl_table=11
                     /product="D-tyrosyl-tRNA(Tyr) deacylase"
                     /protein_id="YP_001034260.1"
                     /db_xref="GeneID:4807474"
                     /translation="MKIVIQRVKRAQVSIDQQLRSSIGQGLLLLVGVGPDDSQEDMDY
                     AVRKIVNMRIFSDAEGKMNLSIKDIDGEILSISQFTLHADTKKGNRPAFVKAAPPEMA
                     SNFYDAFNLALQQEVPTRTGIFGADMQVELVNDGPVTIILDTKNR"
     misc_feature    244595..245032
                     /gene="dtd"
                     /locus_tag="SSA_0251"
                     /note="D-tyrosyl-tRNA(Tyr) deacylase; Provisional; Region:
                     PRK05273"
                     /db_xref="CDD:235383"
     misc_feature    order(244613..244615,244823..244837,244871..244873,
                     245012..245014)
                     /gene="dtd"
                     /locus_tag="SSA_0251"
                     /note="putative active site [active]"
                     /db_xref="CDD:238316"
     misc_feature    order(244724..244726,244733..244741,244745..244756,
                     244823..244828,244832..244837,244841..244849,
                     244853..244867,244871..244873,244970..245023)
                     /gene="dtd"
                     /locus_tag="SSA_0251"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238316"
     misc_feature    order(244736..244738,244751..244753,244853..244855,
                     244862..244864)
                     /gene="dtd"
                     /locus_tag="SSA_0251"
                     /note="putative tRNAtyr binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238316"
     gene            complement(245132..245929)
                     /locus_tag="SSA_0252"
                     /db_xref="GeneID:4806846"
     CDS             complement(245132..245929)
                     /locus_tag="SSA_0252"
                     /note="GC: 43.36%; Codon Adaptation Index (CAI): 0.753.
                     Curator(s): P. Manque, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034261.1"
                     /db_xref="GeneID:4806846"
                     /translation="MPQQLFKEFAQLDQVEAIVLGGSRAGQHFDKDSDYDVYIYLTDS
                     IAPLTRRDILSKYCSYMEIGNQFWELEDDCVLKSDIEIELIYRTLDSFDKDLQTVVLD
                     HQAQNAYTTCMWHNLLHSKIIYDRNGRYEALQNKYRLPYPAELKKNIIKKQLLLLDQA
                     MPAFSKQIEKALKRQDLLSINHRSSEFFASYFDLLFALNEQTHPGEKRMLEFAKTNCT
                     LLPQHFEENIQTYFQKLYTEPAEAIKLINQLVTTIKQIIPQEMIDGF"
     misc_feature    complement(<245768..245920)
                     /locus_tag="SSA_0252"
                     /note="Nucleotidyltransferase (NT) domain of
                     Staphylococcus aureus kanamycin nucleotidyltransferase,
                     and similar proteins; Region: NT_KNTase_like; cd05403"
                     /db_xref="CDD:143393"
     misc_feature    complement(order(245822..245824,245828..245833,
                     245852..245854,245861..245869))
                     /locus_tag="SSA_0252"
                     /note="NTP binding site [chemical binding]; other site"
                     /db_xref="CDD:143393"
     misc_feature    complement(245318..245587)
                     /locus_tag="SSA_0252"
                     /note="Domain of unknown function (DUF4037); Region:
                     DUF4037; pfam13228"
                     /db_xref="CDD:289970"
     gene            246429..247043
                     /locus_tag="SSA_0253"
                     /db_xref="GeneID:4807927"
     CDS             246429..247043
                     /locus_tag="SSA_0253"
                     /note="GC: 39.51%; Transmembrane domains: 6. Codon
                     Adaptation Index (CAI): 0.752. Curator(s): P. Manque, J.
                     Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="CAAX amino terminal protease family protein"
                     /protein_id="YP_001034262.1"
                     /db_xref="GeneID:4807927"
                     /translation="MENLVQQMLNALIQIALFAFLPFVWWLISARRKSPFLEWLGLKP
                     LKDTGNRKIWLWILLGSLFFLLLSFLLVYPAVKNLDTATSNFSGLGFQALPAVLIYGI
                     FQTSLSEELLFRGFLLKRLASRLSFVVANTIQAALFGLLHGLMFITVLSWQQTLLIIL
                     CTGGIAAYMGFVNEKKSDGSILASWIIHALVNVITGSLFAFMLI"
     misc_feature    246450..247031
                     /locus_tag="SSA_0253"
                     /note="Membrane protease YdiL, CAAX protease family
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: YdiL; COG1266"
                     /db_xref="CDD:224185"
     misc_feature    246708..247010
                     /locus_tag="SSA_0253"
                     /note="CAAX protease self-immunity; Region: Abi;
                     pfam02517"
                     /db_xref="CDD:280650"
     gene            complement(247157..247582)
                     /locus_tag="SSA_0254"
                     /db_xref="GeneID:4808039"
     CDS             complement(247157..247582)
                     /locus_tag="SSA_0254"
                     /note="GC: 43.43%; Codon Adaptation Index (CAI): 0.751.
                     Curator(s): P. Manque, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034263.1"
                     /db_xref="GeneID:4808039"
                     /translation="MTRFWIGVVSKEHVLRGVEGGFCQVCHGKKAPLNRMKKGDYLLY
                     YSPKYQLNGQEKLQAFTAVGKILDDTAYQVEMFEGFVPFRRDVSYYQPVKDCPIEQVR
                     QHPQWRQYASQIRYGHFEVSKDFFLYVFEQMKLDSPANQ"
     misc_feature    complement(247169..247582)
                     /locus_tag="SSA_0254"
                     /note="hypothetical protein; Provisional; Region:
                     PRK02268"
                     /db_xref="CDD:235021"
     gene            complement(247575..248036)
                     /locus_tag="SSA_0255"
                     /db_xref="GeneID:4807441"
     CDS             complement(247575..248036)
                     /locus_tag="SSA_0255"
                     /function="Transcription"
                     /note="GC: 43.72%; Codon Adaptation Index (CAI): 0.739.
                     Curator(s): P. Manque, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="multiple antibiotic resistance operon
                     transcription repressor MarR"
                     /protein_id="YP_001034264.1"
                     /db_xref="GeneID:4807441"
                     /translation="MEKSQFNSIYKDEYKKSTGLLFIRTYHKWHGLIKNKLRTIDLTH
                     PQFVVLTTLAALLRQQEWVSQTDIARFSDMDVMTVSQIIRLLVKKGLIMREVHPKDSR
                     ANIILLTDTGLQKVNQALPLVEGIDQAFFGKLGNKTEILNQLLMELEAEND"
     misc_feature    complement(247635..247928)
                     /locus_tag="SSA_0255"
                     /note="helix_turn_helix multiple antibiotic resistance
                     protein; Region: HTH_MARR; smart00347"
                     /db_xref="CDD:197670"
     misc_feature    complement(247728..247916)
                     /locus_tag="SSA_0255"
                     /note="MarR family; Region: MarR_2; pfam12802"
                     /db_xref="CDD:289566"
     gene            complement(248142..248789)
                     /locus_tag="SSA_0256"
                     /db_xref="GeneID:4806865"
     CDS             complement(248142..248789)
                     /locus_tag="SSA_0256"
                     /function="Transcription"
                     /note="GC: 46.6%; Codon Adaptation Index (CAI): 0.768.
                     Curator(s): P. Manque, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="Fe/Mn-dependent transcriptional repressor ScaR"
                     /protein_id="YP_001034265.1"
                     /db_xref="GeneID:4806865"
                     /translation="MTPNKEDYLKCIYEIGSRHKKITNKEIAQLMQVSPPAVTEMMKK
                     MLAEELLVKDKKAGYLLTDLGLRLVSDLYRKHRLIEVFLVNHLGYSTDEIHEEAEVLE
                     HTVSERFVERLDAMLQYPKTCPHGGTIPAKGELLDEENQLTLEEASAPGDYIIKRVHD
                     DFDLLKYLEKYNLQIGQTITFIQYDSFAQAYLLKTETQEIQINPIIAQQIYVEKL"
     misc_feature    complement(248340..248789)
                     /locus_tag="SSA_0256"
                     /note="Mn-dependent transcriptional regulator, DtxR family
                     [Transcription]; Region: MntR; COG1321"
                     /db_xref="CDD:224240"
     misc_feature    complement(248616..248786)
                     /locus_tag="SSA_0256"
                     /note="Helix-turn-helix domains; Region: HTH; cl21459"
                     /db_xref="CDD:304362"
     misc_feature    complement(248400..248606)
                     /locus_tag="SSA_0256"
                     /note="Iron dependent repressor, metal binding and
                     dimerization domain; Region: Fe_dep_repr_C; pfam02742"
                     /db_xref="CDD:280838"
     misc_feature    complement(248148..248363)
                     /locus_tag="SSA_0256"
                     /note="FeoA domain; Region: FeoA; pfam04023"
                     /db_xref="CDD:281952"
     gene            249018..251900
                     /locus_tag="SSA_0257"
                     /db_xref="GeneID:4807054"
     CDS             249018..251900
                     /locus_tag="SSA_0257"
                     /note="GC: 48.35%; Transmembrane domains: 1. Codon
                     Adaptation Index (CAI): 0.782. LipoP prediction: SpI.
                     SignalP prediction: Yes (prob. 1); Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmuramidase/lysin"
                     /protein_id="YP_001034266.1"
                     /db_xref="GeneID:4807054"
                     /translation="MKKRQMMASQAEKFTRFGIRKCSLGAVSVAIATGLAFLGSGAVQ
                     ADQLAPSQTADSVAISQAVENQASTAATPTVTETSLSSMDKAAPAPEAVSPAASQEPT
                     SSRTSTQSTSSVPVENAQPKSDVVASTENQPAVAENSEKSDASNQPAQPASAAEHPLA
                     AAEVKKPQGKITIQNNNPQTGEFDIVVSDIVAPDGLKSVYLPTWSVANDQDDVQWYTA
                     ERRADGTYFKHVSYRNHKNSLGEYNVHLYFVNDAGQLQGAGSAKTEVTRAQPQGKITI
                     HNNNPQTGEFDIVVSDIVAPDGLKSVSLPTWSTANDQDDVQWYTAERRADGTYFKHVS
                     YRNHKNSLGEYNVHLYFVNNAGQLQGAGSSKTVVTRAQPQGKITIQNNNPQTGEFDIV
                     VSDIVAPDGLKAVYLPTWSAANDQDDVQWYTAERRVDGTYFKHVSYRNHKNSLGEYNV
                     HLYFVNDAGQLQGAGSTKTVVTRAQPQGKITIQNNNPQTGEFDIIVSDIVAPDGLKAV
                     YLPTWSAANDQDDVQWYTAERRADGTYFKHVSYRNHKNSLGEYNVHLYFVNDAGQLQG
                     AGSTKTVVTRAQPQGKITIQNNNPQTGEFDIIVSDIVAPDGLKAVYLPTWSSKDDQDD
                     VQWYTAERQADGTYKKHVRAQDHKFSVGEYKVHLYYLNEDGQMQGAGGEKLMVSVAPE
                     NIRATGKINIQNNNARTGTFDVVVTNVSNPGGIQAVYLPTWSTDKDQDDVKWYLAQKQ
                     ANGTYKITVRASDHKLSTGEYKIHLYYKQDNGQLIAVDATTTQVSKAVYNTPYYSQRD
                     GRWGGRKYGPYSMDATGCVPTTLAMVISGITGTEVLPTTVADYLYNHTNEFNKDGFGT
                     SSRGIVRAAQHWDLTTETLFTASAVKEVLSQGHHVLGAVGTSIFAHYPVTHELVLKGY
                     DNGKTYVRDPYNAANNGWYPVDYLFGVKSVDPTDNTEGSPFIAIKG"
     misc_feature    249051..249158
                     /locus_tag="SSA_0257"
                     /note="Gram-positive signal peptide, YSIRK family; Region:
                     YSIRK_signal; TIGR01168"
                     /db_xref="CDD:273479"
     misc_feature    249534..249797
                     /locus_tag="SSA_0257"
                     /note="GBS Bsp-like repeat; Region: GBS_Bsp-like;
                     pfam08481"
                     /db_xref="CDD:285655"
     misc_feature    249843..250106
                     /locus_tag="SSA_0257"
                     /note="GBS Bsp-like repeat; Region: GBS_Bsp-like;
                     pfam08481"
                     /db_xref="CDD:285655"
     misc_feature    250152..250418
                     /locus_tag="SSA_0257"
                     /note="GBS Bsp-like repeat; Region: GBS_Bsp-like;
                     pfam08481"
                     /db_xref="CDD:285655"
     misc_feature    250461..250727
                     /locus_tag="SSA_0257"
                     /note="GBS Bsp-like repeat; Region: GBS_Bsp-like;
                     pfam08481"
                     /db_xref="CDD:285655"
     misc_feature    250770..251033
                     /locus_tag="SSA_0257"
                     /note="GBS Bsp-like repeat; Region: GBS_Bsp-like;
                     pfam08481"
                     /db_xref="CDD:285655"
     misc_feature    251091..251357
                     /locus_tag="SSA_0257"
                     /note="GBS Bsp-like repeat; Region: GBS_Bsp-like;
                     pfam08481"
                     /db_xref="CDD:285655"
     misc_feature    251385..251792
                     /locus_tag="SSA_0257"
                     /note="Peptidase_C39 like family; Region: Peptidase_C39_2;
                     pfam13529"
                     /db_xref="CDD:290263"
     gene            251985..253082
                     /locus_tag="SSA_0258"
                     /db_xref="GeneID:4806226"
     CDS             251985..253082
                     /locus_tag="SSA_0258"
                     /note="GC: 47.27%; Codon Adaptation Index (CAI): 0.787.
                     Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034267.1"
                     /db_xref="GeneID:4806226"
                     /translation="MYPKEEKEQFFQQLQSIGWSQTALEQVFAEISVQGKTVPEEGYY
                     LQEAQLFGSPFFQELWLAEDAQNSRLGAQELLVLAMNLVNMPEELSGDKSETDFLLAR
                     IAPDLTPHDRFWKIFSRTLRQAFPADDFSQRDGNQKLKRQLHQFRYVISCQQAQWVRD
                     HYRQAGMTDAEALTSYLKDWPALPYSFQESSRLHNKAYIDKRSGQAIYPDGQASQANI
                     KILIDFHTEFILDQAGRFLNIINPEGASQNGIVNGASFNYGERNRPVNQASHTRYDVK
                     TPAVWDPRFRRLAIENSGRKFKSPQNNRGPLGYRSAKSPYARKGRSAYKQVKAEIARF
                     KKLLNRPSILLRSWAWFRQFWQKFFAQKNTD"
     misc_feature    252135..252932
                     /locus_tag="SSA_0258"
                     /note="Protein of unknown function (DUF3114); Region:
                     DUF3114; pfam11311"
                     /db_xref="CDD:288204"
     gene            complement(253103..253633)
                     /gene="tpx"
                     /locus_tag="SSA_0259"
                     /db_xref="GeneID:4806834"
     CDS             complement(253103..253633)
                     /gene="tpx"
                     /locus_tag="SSA_0259"
                     /EC_number="1.11.1.-"
                     /function="Posttranslational modification, protein
                     turnover, chaperones"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="antioxidant activity; thioredoxin-dependent thiol
                     peroxidase; forms homodimers in solution; shows substrate
                     specificity to alkyl hydroperoxides; periplasmic protein"
                     /codon_start=1
                     /transl_table=11
                     /product="2-Cys peroxiredoxin"
                     /protein_id="YP_001034268.1"
                     /db_xref="GeneID:4806834"
                     /translation="MYNEAIKHEWRLPMTTFLGNPVTFTGKQLQVGDTAHDFSLTATD
                     LSKKTLADFAGKKKVLSIIPSIDTGVCSTQTRRFNQELSDLDNTVVITVSVDLPFAQG
                     KWCAAEGIENAVMLSDYFDHSFGRDYAVLINEWHLLARAVLVLDENNTVTYAEYVDNI
                     NTEPDYDAAIAAVKSL"
     misc_feature    complement(253109..253594)
                     /gene="tpx"
                     /locus_tag="SSA_0259"
                     /note="lipid hydroperoxide peroxidase; Provisional;
                     Region: tpx; PRK00522"
                     /db_xref="CDD:179055"
     misc_feature    complement(253172..253543)
                     /gene="tpx"
                     /locus_tag="SSA_0259"
                     /note="AhpC/TSA family; Region: AhpC-TSA; pfam00578"
                     /db_xref="CDD:278975"
     misc_feature    complement(order(253226..253231,253277..253279,
                     253325..253327,253343..253348,253433..253435,
                     253439..253441))
                     /gene="tpx"
                     /locus_tag="SSA_0259"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239312"
     misc_feature    complement(order(253214..253216,253421..253423,
                     253430..253432))
                     /gene="tpx"
                     /locus_tag="SSA_0259"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:239312"
     misc_feature    complement(order(253319..253321,253421..253423))
                     /gene="tpx"
                     /locus_tag="SSA_0259"
                     /note="peroxidatic and resolving cysteines [active]"
                     /db_xref="CDD:239312"
     gene            complement(253746..254675)
                     /gene="ssaB"
                     /locus_tag="SSA_0260"
                     /db_xref="GeneID:4806835"
     CDS             complement(253746..254675)
                     /gene="ssaB"
                     /locus_tag="SSA_0260"
                     /function="Inorganic ion transport and metabolism"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 42.37%; Transporter classification
                     TC:3.A.1.15.2. Codon Adaptation Index (CAI): 0.786. LipoP
                     prediction: SpII. SignalP prediction: Yes (prob. 1);
                     Curator(s): P. Manque, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="Mn/Zn ABC transporter substrate-binding protein"
                     /protein_id="YP_001034269.1"
                     /db_xref="GeneID:4806835"
                     /translation="MKKLGFLSLLLLAVCTLFACSGQKNASSDSSKLKVVATNSIIAD
                     ITKNIAGDKIDLHSIVPVGKDPHEYEPLPEDVKKTSQADLIFYNGINLETGGNAWFTK
                     LVKNANKEENKDYYAVSDGVDVIYLEGQSEKGKEDPHAWLNLENGIIYAQNIAKRLIE
                     KDPDNKATYEKNLKAYVEKLTALDKEAKEKFNNIPEEKKMIVTSEGCFKYFSKAYNVP
                     SAYIWEINTEEEGTPDQIKSLVEKLRETKVPSLFVESSVDDRPMKTVSKDTNIPIHAK
                     IFTDSIAEKGEEGDSYYSMMKYNLDKISEGLAK"
     misc_feature    complement(253749..254630)
                     /gene="ssaB"
                     /locus_tag="SSA_0260"
                     /note="ABC-type Zn uptake system ZnuABC, Zn-binding
                     component ZnuA [Inorganic ion transport and metabolism];
                     Region: ZnuA; COG0803"
                     /db_xref="CDD:223874"
     misc_feature    complement(253752..254627)
                     /gene="ssaB"
                     /locus_tag="SSA_0260"
                     /note="Metal binding protein PsaA. These proteins have
                     been shown to function as initial receptors in ABC
                     transport of Mn2+ and as surface adhesins in some
                     eubacterial species. They belong to the TroA superfamily
                     of periplasmic metal binding proteins that...; Region:
                     PsaA; cd01137"
                     /db_xref="CDD:238557"
     misc_feature    complement(order(253836..253838,254061..254063,
                     254259..254261,254475..254477))
                     /gene="ssaB"
                     /locus_tag="SSA_0260"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:238557"
     gene            complement(254695..255558)
                     /gene="ssaC"
                     /locus_tag="SSA_0261"
                     /db_xref="GeneID:4807896"
     CDS             complement(254695..255558)
                     /gene="ssaC"
                     /locus_tag="SSA_0261"
                     /function="Inorganic ion transport and metabolism"
                     /note="GC: 46.88%; Transporter classification
                     TC:3.A.1.15.2. Transmembrane domains: 8. Codon Adaptation
                     Index (CAI): 0.729. Curator(s): P. Manque, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="Mn/Zn ABC transporter permease"
                     /protein_id="YP_001034270.1"
                     /db_xref="GeneID:4807896"
                     /translation="MEVPRMILEFFQGLRDFHFLQNALITAIVIGIVAGAVGCFIILR
                     GMSLMGDAISHAVLPGVALSYILGINFFIGAITFGLLASIIITYIKGNSIIKSDTAIG
                     ITFSSFLALGVILIGVANSSTDLFHILFGNILAVQDIDMWISIGVGIAVLLIIILFFK
                     QLLITSFDPLLAQAMGMPVSFYHYLLMILLTLVSVTAMQSVGTILIVALLITPAATAY
                     LYANSLKTMILLSSGLGALASVLGLFIGYSFNVAAGSSIVLTSALIFLISFFIAPKQR
                     YLKLKNRPKLK"
     misc_feature    complement(254722..255540)
                     /gene="ssaC"
                     /locus_tag="SSA_0261"
                     /note="ABC-type Mn2+/Zn2+ transport system, permease
                     component [Inorganic ion transport and metabolism];
                     Region: ZnuB; COG1108"
                     /db_xref="CDD:224033"
     misc_feature    complement(254743..255513)
                     /gene="ssaC"
                     /locus_tag="SSA_0261"
                     /note="ABC 3 transport family; Region: ABC-3; pfam00950"
                     /db_xref="CDD:279318"
     misc_feature    complement(order(254887..254889,254908..254910,
                     255034..255042,255046..255063,255067..255072,
                     255076..255084,255088..255093,255427..255435,
                     255445..255447))
                     /gene="ssaC"
                     /locus_tag="SSA_0261"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119348"
     misc_feature    complement(order(254752..254754,254761..254766,
                     254773..254775,254782..254787,254794..254796,
                     254938..254940,255169..255171,255178..255183,
                     255208..255210,255214..255219,255226..255228,
                     255235..255240,255247..255252,255259..255264,
                     255268..255270,255409..255411,255424..255426,
                     255430..255432))
                     /gene="ssaC"
                     /locus_tag="SSA_0261"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119348"
     misc_feature    complement(order(254803..254805,254818..254820,
                     254953..254955,254965..254967,255139..255141,
                     255208..255210))
                     /gene="ssaC"
                     /locus_tag="SSA_0261"
                     /note="putative PBP binding regions; other site"
                     /db_xref="CDD:119348"
     gene            complement(255545..256294)
                     /gene="ssaA"
                     /locus_tag="SSA_0262"
                     /db_xref="GeneID:4807020"
     CDS             complement(255545..256294)
                     /gene="ssaA"
                     /locus_tag="SSA_0262"
                     /function="Inorganic ion transport and metabolism"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 45.47%; Transporter classification
                     TC:3.A.1.15.2. Codon Adaptation Index (CAI): 0.783.
                     Curator(s): P. Manque, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="Mn/Zn ABC transporter ATPase"
                     /protein_id="YP_001034271.1"
                     /db_xref="GeneID:4807020"
                     /translation="MYIKTIEVYEMITIKDLTVSYQDMLALEPLSLTIKEPTITGIVG
                     PNGAGKSTLLKGMLGIIDHQGQTLLDQKPLQHSLQRVAYVEQKINIDYHFPIKVKECV
                     SLGLYPQLKLFQGLKNSHWDKVAEALKIVGLEDLAERQISQLSGGQFQRVLIARCLVQ
                     EADCIFLDEPFVGIDSVSEEIIMSTLRSLKAAGKIILIVHHDLSKVVDYFDQVILLNR
                     KLIAFGPTETSFTKDNMKKTYGSQIFMNGGA"
     misc_feature    complement(255566..256264)
                     /gene="ssaA"
                     /locus_tag="SSA_0262"
                     /note="ABC-type Mn2+/Zn2+ transport system, ATPase
                     component [Inorganic ion transport and metabolism];
                     Region: ZnuC; COG1121"
                     /db_xref="CDD:224046"
     misc_feature    complement(255623..256255)
                     /gene="ssaA"
                     /locus_tag="SSA_0262"
                     /note="ATP-binding cassette domain of the metal-type
                     transporters; Region: ABC_Metallic_Cations; cd03235"
                     /db_xref="CDD:213202"
     gene            256414..258306
                     /gene="pepO"
                     /locus_tag="SSA_0263"
                     /db_xref="GeneID:4807413"
     CDS             256414..258306
                     /gene="pepO"
                     /locus_tag="SSA_0263"
                     /EC_number="3.4.24.-"
                     /function="Posttranslational modification, protein
                     turnover, chaperones"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 48.44%; Codon Adaptation Index (CAI): 0.785.
                     Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="Zinc metalloproteinase in scaA 5'region"
                     /protein_id="YP_001034272.1"
                     /db_xref="GeneID:4807413"
                     /translation="MTRLQDDFYDAVNGEWAKTAVIPDDKPVTGGFMDLADEIEDLML
                     ATTDKWLAGDGVPEDIILQNFVAYHRLAADYDKREAAGIEPARAYIDEIRNLASFEDY
                     ASKIADFELAGKPTYFPFGVAPDFMDARINVLWADGPGTILPDTTYYAEDHPQKADLL
                     AKWRKTQEDLLAKFDFAEEEIKDLLDKVLELDAVFAQYVLSSEESSEYAKLYHPYKWD
                     DFKALVPELPLADIFTKLIGQEPDQVIVPEERFWKAAKDIYTAANWDKLHALLILSAV
                     RNTTPYLTDDIRVLAGAYHRALSGTPQAQDKKKAAFYLAQGPFNQAVGLWYAGQKFSP
                     EAKADVEQKVATMIEVYKNRLAQNDWLTPETRDKAIVKLNVIKPYIGYPDELPERYSR
                     KVVDENLTLFENAQKLSQIDIAYSWSKWNQPVDYKEWGMPAHMVNAYYNPQKNLIVFP
                     AAILQAPFYDLHQSSSANYGGIGAVIAHEISHAFDTNGASFDENGSLNNWWTEHDYQA
                     FTERTQKVIDQFEGQDSYGAKVNGKLTVSENVADLGGIAAALEAAKKEADFSTEEFFT
                     NFARIWRMKGREEYMKLLASVDVHAPAKLRTNVQLPNFDDFFTTFDVQEGDGMWRSPE
                     ERVVIW"
     misc_feature    256414..258303
                     /gene="pepO"
                     /locus_tag="SSA_0263"
                     /note="Peptidase family M13; Region: Peptidase_M13_N;
                     cl27010"
                     /db_xref="CDD:331831"
     gene            258540..259436
                     /locus_tag="SSA_0264"
                     /db_xref="GeneID:4807603"
     CDS             258540..259436
                     /locus_tag="SSA_0264"
                     /note="GC: 49.16%; Codon Adaptation Index (CAI): 0.779.
                     Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="PEP phosphonomutase-like protein"
                     /protein_id="YP_001034273.1"
                     /db_xref="GeneID:4807603"
                     /translation="MVKRFISSNASEILSMTAPELKQSIKASEGRVILSENVAFKESY
                     IGDVTNAEIARSFGADLILLNGIDIFQPFVAGLDAKEDFVKELHRLVGRPIGINLEPV
                     DSQAQMAGERLIIDEGRQASLATVQRAEELGVDFICLTGNPGTGVTNQAIIDTIRVVK
                     ENFSGLLIAGKMHASGVDEPVADLEAIAQFIEAGVDIVLAPAVGSVPGFDEQDLKQIV
                     RLAHQKGALVMSAIGTSQESADEDIVKQMAIRNKICGVDIQHIGDSGYGCLAPVENIF
                     AMSKALRGQRHTISMISRSINR"
     misc_feature    <259077..>259226
                     /locus_tag="SSA_0264"
                     /note="Aspartate aminotransferase (AAT) superfamily (fold
                     type I) of pyridoxal phosphate (PLP)-dependent enzymes.
                     PLP combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine intermediate, which
                     depending on the reaction, is the...; Region: AAT_I;
                     cl18945"
                     /db_xref="CDD:302748"
     gene            259531..260067
                     /locus_tag="SSA_0265"
                     /db_xref="GeneID:4806619"
     CDS             259531..260067
                     /locus_tag="SSA_0265"
                     /function="DNA replication, recombination, and repair"
                     /note="GC: 38.18%; Codon Adaptation Index (CAI): 0.728.
                     Helix-turn-helix prediction: AraC. Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="ORFA, transposon ISSsa1"
                     /protein_id="YP_001034274.1"
                     /db_xref="GeneID:4806619"
                     /translation="MKLTYEDKVRIYELRKQGISLKRLSDKYGMNLSNLKYLVRLIDR
                     YGIENVKKGKNRYYSPELKQEIINKVLIEGRSQLSVSLDYALPSSGLLPNWLAQYKKN
                     GYTIVEKTRGRPARMGRKRKKTWEEMTELERLQEENERLRTEVAYLKKLKELEDRDEA
                     LERERQRQLEKWFQEDFD"
     misc_feature    259531..259854
                     /locus_tag="SSA_0265"
                     /note="Transposase and inactivated derivatives [Mobilome:
                     prophages, transposons]; Region: InsE; COG2963"
                     /db_xref="CDD:225511"
     misc_feature    259687..260040
                     /locus_tag="SSA_0265"
                     /note="Transposase and inactivated derivatives [Mobilome:
                     prophages, transposons]; Region: InsE; COG2963"
                     /db_xref="CDD:225511"
     misc_feature    259873..>260031
                     /locus_tag="SSA_0265"
                     /note="rod shape-determining protein MreC; Region: MreC;
                     cl19252"
                     /db_xref="CDD:302802"
     gene            260274..260882
                     /locus_tag="SSA_0266"
                     /db_xref="GeneID:4806883"
     CDS             260274..260882
                     /locus_tag="SSA_0266"
                     /function="DNA replication, recombination, and repair"
                     /note="GC: 39.74%; Codon Adaptation Index (CAI): 0.767.
                     Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="ORFB, transposon ISSsa1"
                     /protein_id="YP_001034275.1"
                     /db_xref="GeneID:4806883"
                     /translation="MKVLGLADRIRRKRKYSSYQGAIGKKAKNLIQRQFEASKPMEKC
                     YTDVTEFAIPASSQKLYLSPVLDGFNSEIIAFNLSCSPNLEQVKTMLEQAFTEKHYEN
                     TILHSDQGWQYQHDSYHRFLESKGIQPSMSRKGNSPDNGMMESFFGILKSEMFYGYEK
                     TFQSLKQLEQAIVDYIDYYNNKRIKVKLKGLSPVQYRTKSFQ"
     misc_feature    260391..260732
                     /locus_tag="SSA_0266"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:279057"
     misc_feature    260703..260876
                     /locus_tag="SSA_0266"
                     /note="Integrase core domain; Region: rve_2; pfam13333"
                     /db_xref="CDD:290072"
     gene            complement(260963..262159)
                     /locus_tag="SSA_0267"
                     /db_xref="GeneID:4806447"
     CDS             complement(260963..262159)
                     /locus_tag="SSA_0267"
                     /function="Transcription / Carbohydrate transport and
                     metabolism"
                     /note="GC: 46.78%; Codon Adaptation Index (CAI): 0.767.
                     Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="ROK family protein"
                     /protein_id="YP_001034276.1"
                     /db_xref="GeneID:4806447"
                     /translation="MTRTRKQNELRATVLDQLYAKRPISRIDISKETQITPATTGSII
                     NELIKEGLVLELGELNDESVGRKKTLLDIAPRSRYYLGFEISEKQLAIVIADNTGEIA
                     ESSIRTYQIEVTGGPSDQEIIRLIQDFLKKNSQYPISAIALGLPGHVNLSESDFIISK
                     NPHWGQINLQTIQEAFDLPVYFANKSHCLTMAERLFSYHPTDSNFIVYHVARGIHCSY
                     MYKGSIYSQENYLIGEVGHTVINPEGERCPCGKHGCLQVYASESALIDKAAILYRASQ
                     TSLLKTLVEDANDIDLTSLMTAYRLGDLGSIELIHTACRYLAISISNLCQLIDSERIY
                     LDGQLFSYPVIAEQVLAQLEQEVPLFPKQKQAEIVIIPYSKYSIARSAVSLCVYHEFL
                     DKKGNL"
     misc_feature    complement(261062..261943)
                     /locus_tag="SSA_0267"
                     /note="Sugar kinase of the NBD/HSP70 family, may contain
                     an N-terminal HTH domain [Transcription, Carbohydrate
                     transport and metabolism]; Region: NagC; COG1940"
                     /db_xref="CDD:224851"
     misc_feature    complement(order(261524..261535,261599..261601,
                     261887..261889,261893..261895,261899..261910))
                     /locus_tag="SSA_0267"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212657"
     misc_feature    complement(261086..261796)
                     /locus_tag="SSA_0267"
                     /note="Nucleotide-Binding Domain of the sugar
                     kinase/HSP70/actin superfamily; Region:
                     NBD_sugar-kinase_HSP70_actin; cl17037"
                     /db_xref="CDD:302596"
     gene            262364..262681
                     /gene="ptcB"
                     /locus_tag="SSA_0268"
                     /db_xref="GeneID:4807810"
     CDS             262364..262681
                     /gene="ptcB"
                     /locus_tag="SSA_0268"
                     /EC_number="2.7.1.69"
                     /function="Carbohydrate transport and metabolism"
                     /note="GC: 48.43%; Transporter classification
                     TC:4.A.3.2.2. Codon Adaptation Index (CAI): 0.765.
                     Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system cellobiose-specific transporter
                     subunit IIB"
                     /protein_id="YP_001034277.1"
                     /db_xref="GeneID:4807810"
                     /translation="METKQIMLVCAAGMSTSLMVNKMQKAAEERGLAATIFAVPVSEA
                     EDYLSEKKVDVLLLGPQVRYLLEDLQEKLASKGIPVDVIPMTDYGMMKGDKVLELAES
                     LMK"
     misc_feature    262379..262669
                     /gene="ptcB"
                     /locus_tag="SSA_0268"
                     /note="PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme
                     II (EII) of the N,N-diacetylchitobiose-specific and
                     lichenan-specific phosphoenolpyruvate:carbohydrate
                     phosphotransferase system (PTS). In these systems, EII is
                     either a lichenan- or an N; Region:
                     PTS_IIB_chitobiose_lichenan; cd05564"
                     /db_xref="CDD:99906"
     misc_feature    order(262391..262393,262397..262402,262406..262411,
                     262544..262546,262625..262627)
                     /gene="ptcB"
                     /locus_tag="SSA_0268"
                     /note="active site"
                     /db_xref="CDD:99906"
     misc_feature    262391..262411
                     /gene="ptcB"
                     /locus_tag="SSA_0268"
                     /note="P-loop; other site"
                     /db_xref="CDD:99906"
     misc_feature    262391..262393
                     /gene="ptcB"
                     /locus_tag="SSA_0268"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:99906"
     gene            262690..263007
                     /locus_tag="SSA_0269"
                     /db_xref="GeneID:4807257"
     CDS             262690..263007
                     /locus_tag="SSA_0269"
                     /EC_number="2.7.1.69"
                     /note="GC: 44.34%; Transporter classification
                     TC:4.A.3.2.2. Codon Adaptation Index (CAI): 0.8.
                     Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system cellobiose-specific transporter
                     subunit IIA"
                     /protein_id="YP_001034278.1"
                     /db_xref="GeneID:4807257"
                     /translation="MENKDSLEVAMTFIMYGGEAKSCAIEAIAAAKKQDFDRAQERLS
                     QAQKALLQAHHAQAEMLTKEAQGEKTELSLFMVHGQDHLMTSIAFVDLAKEIVDLHKK
                     FDE"
     misc_feature    262711..262992
                     /locus_tag="SSA_0269"
                     /note="PTS system, Lactose/Cellobiose specific IIA
                     subunit; Region: PTS_IIA; pfam02255"
                     /db_xref="CDD:280425"
     misc_feature    order(262750..262752,262921..262923,262927..262935)
                     /locus_tag="SSA_0269"
                     /note="active site"
                     /db_xref="CDD:238133"
     misc_feature    order(262867..262869,262915..262920,262939..262941)
                     /locus_tag="SSA_0269"
                     /note="methionine cluster; other site"
                     /db_xref="CDD:238133"
     misc_feature    262921..262923
                     /locus_tag="SSA_0269"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238133"
     misc_feature    262930..262932
                     /locus_tag="SSA_0269"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:238133"
     gene            263013..264374
                     /locus_tag="SSA_0270"
                     /db_xref="GeneID:4807107"
     CDS             263013..264374
                     /locus_tag="SSA_0270"
                     /EC_number="2.7.1.69"
                     /function="Carbohydrate transport and metabolism"
                     /note="GC: 46.11%; Transporter classification
                     TC:4.A.3.2.2. Transmembrane domains: 12. Codon Adaptation
                     Index (CAI): 0.774. Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system cellobiose-specific transporter
                     subunit IIC"
                     /protein_id="YP_001034279.1"
                     /db_xref="GeneID:4807107"
                     /translation="MQMSSLVDKWQARLMPIANKIGNQKFLVALRDSFIGTMPVIMTG
                     SFALMVNAFLSDLPGQFGWTWISSTFQWLIDINWLVFKGSIPIVTLLFLFTFGVNIAK
                     IYNTDKVSAGLVAVASYIITIGGSVTKTFELAGKTPGLSKAISKLPELKLDGSNLSVT
                     INSVIPGDQISARGYFTAILIGFVSVIIFCKVMNRNWTIKLPDSVPPAIMKPFLSIIP
                     AAIAMYVVGIATYLFNLVTGELLIDWIYKILQAPLLSLSQSFWAVLLIVFLNKIFWFF
                     GLHGGNVLAPVMASLFGVTMLANLEAYQAGHAIPYMWTDNSFGAFVWFDAIGVAIAIL
                     WQSRNKHYREVAKLGIFPMVFNIGEPVMYGLPIVLNPIMFIPYVLTPMVMVTVAYFAT
                     SMGLVAPVTQNVTWVMPPILYGFFATAFDWRAIILSLVNIAISTAIYLPFVKMADKQE
                     ELG"
     misc_feature    263019..264368
                     /locus_tag="SSA_0270"
                     /note="Phosphotransferase system cellobiose-specific
                     component IIC [Carbohydrate transport and metabolism];
                     Region: CelB; COG1455"
                     /db_xref="CDD:224372"
     gene            264375..266153
                     /locus_tag="SSA_0271"
                     /db_xref="GeneID:4807748"
     CDS             264375..266153
                     /locus_tag="SSA_0271"
                     /EC_number="3.2.1.23"
                     /function="Carbohydrate transport and metabolism"
                     /note="GC: 47.61%; Codon Adaptation Index (CAI): 0.773.
                     Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl hydrolase family protein"
                     /protein_id="YP_001034280.1"
                     /db_xref="GeneID:4807748"
                     /translation="MAKFEIKEEFYLDGKPFKILSGAIQYFRLHPDQWRDTLYNLKAL
                     GFNTVETYIPWALHEPQEGQFKAEGMLDFEAYFKLVKEMGLYLIVRPTPYICAEFDFG
                     GLPAWLLRYPSMRLRVNHPLFLEKVSHFYDWLFPKLLPYQSDQGGPILMMQVENEYGS
                     YAEDKAYMRSIAQMMKVRGVTVPLFTSDGTWIEALESGTLIEDDIFVTGNFGSQPKEN
                     TDNLRAFMERYGKKWPLMCTEFWDGWFSRWSEEIVRREAEDLAQDVKEMLQLGSMNLF
                     LLRGGTNFGFISGCSARKTKDLPQITSYDFDAPITEWGQPTEKYYAVQRVTHEVFPEL
                     EQMEPISRQAKAYGSFPLLGTANLLDVAADITEEILLDYPQPMEQIGQNYGYILYRSD
                     IKNQYHEERLKALETHDRCHFYVNQEHLTTQYREEIGDEMLFSADTERIQIDVLVENM
                     GRVNYGYKLGAPSQSKGVKGGIMINHQFRKGWKHYALKFDQEMLAKLDCYSDPPEKVK
                     APTFYRFEAELDDIADTFIDCSKYGKGCISVNGFNLGRYWNEGPIHYLYVPSSLLKEK
                     NEFIVFETENVKIEELTLLDHPVYKK"
     misc_feature    264399..265352
                     /locus_tag="SSA_0271"
                     /note="Glycosyl hydrolases family 35; Region:
                     Glyco_hydro_35; pfam01301"
                     /db_xref="CDD:279624"
     gene            266163..267092
                     /locus_tag="SSA_0272"
                     /db_xref="GeneID:4806966"
     CDS             266163..267092
                     /locus_tag="SSA_0272"
                     /function="General function prediction only"
                     /GO_function="GO:0016491 - oxidoreductase activity"
                     /note="GC: 48.92%; Transporter classification
                     TC:8.A.5.1.3. Codon Adaptation Index (CAI): 0.785.
                     Possible K+ ion channel beta chain regulatory protein.
                     Curator(s): P. Manque, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="aldo/keto reductase"
                     /protein_id="YP_001034281.1"
                     /db_xref="GeneID:4806966"
                     /translation="MKYMTVGNELEGASQLVLGCMRLAEHDPKEVVSVLETALEVGIN
                     FFDHSDVYAGGQSEAKFAQALRSAKIPRERVLIQSKCGLRDVHTNYHFDFSKDYIISS
                     VEGSLERLQTDYLDVLLLHRPDALVEPEEVAEAFSQLHQAGKVRYFGVSNQNPYQMEL
                     LQKSVEQPLIANQLQFGPAHTPMLDAGLNANMLNPLAIVRDGSVLDYCRLHHITIQPW
                     SPFQVDLNQGLFMEHPKYAQLTETLHAFASDYKVSFEALVLAWILRHPAQMQPIVGSM
                     NPQRIRSMVAAFDIELSRADWYKIYKSAGNPLP"
     misc_feature    266163..267089
                     /locus_tag="SSA_0272"
                     /note="Aldo-keto reductases (AKRs) are a superfamily of
                     soluble NAD(P)(H) oxidoreductases whose chief purpose is
                     to reduce aldehydes and ketones to primary and secondary
                     alcohols. AKRs are present in all phyla and are of
                     importance to both health and industrial...; Region:
                     Aldo_ket_red; cl00470"
                     /db_xref="CDD:294321"
     misc_feature    266163..267089
                     /locus_tag="SSA_0272"
                     /note="Predicted oxidoreductase (related to aryl-alcohol
                     dehydrogenase) [General function prediction only]; Region:
                     Tas; COG0667"
                     /db_xref="CDD:223739"
     misc_feature    order(266217..266225,266301..266303,266316..266318,
                     266400..266402,266523..266528,266613..266618,
                     266679..266681,266814..266822,266835..266843,
                     266925..266927,266976..266987,267000..267002,
                     267009..267014)
                     /locus_tag="SSA_0272"
                     /note="active site"
                     /db_xref="CDD:119408"
     misc_feature    order(266301..266303,266316..266318,266400..266402,
                     266523..266525)
                     /locus_tag="SSA_0272"
                     /note="catalytic tetrad [active]"
                     /db_xref="CDD:119408"
     gene            267211..268626
                     /locus_tag="SSA_0273"
                     /db_xref="GeneID:4807587"
     CDS             267211..268626
                     /locus_tag="SSA_0273"
                     /note="GC: 50.99%; Transmembrane domains: 1. Codon
                     Adaptation Index (CAI): 0.79. LipoP prediction: SpI.
                     SignalP prediction: Yes (prob. 1); Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034282.1"
                     /db_xref="GeneID:4807587"
                     /translation="MNNKFSWQALAKSTSAAKYGSSLLLCASLLSLAALTAVSRVEAE
                     DVAPAPAAVAETPASPAAQASPEAENPAVAEPQAAPANQAESAAAASELPASQVMSDE
                     QKQRAIAQMGANQGDVWVWSEENVVEENGERQKRGPNGGPGQFNGGAVVLGGRPTYDP
                     AADWYYLAYKGEGMTDEEAKAVFDKERGKWMNEFDPWGVVMEMTDNKASNAWADIRNM
                     QAFVLRKDSNVWEKIVDHPQGVQWVSQFKGNMSSNVGDARQEALAGGGTAIEVLPKQD
                     RVAHWGSDQARDIPNPQTIRAVLVSVEARISKKSDPDAKLGIQVGGDWKFAEEVSKPL
                     WYPGAGLAGIQRLTKDWARYYFVSLTGIQDAVEERAISQDVFMKSIVPLADMEQVAQN
                     QAQQQTPASPDPKSSQAENLTYKTSGQTDPQEASQESTLQQASSKQLPKTGSQSSLLT
                     NLLGLGLLGLGAGFLGLKKKS"
     gene            complement(268670..269647)
                     /locus_tag="SSA_0274"
                     /db_xref="GeneID:4808002"
     CDS             complement(268670..269647)
                     /locus_tag="SSA_0274"
                     /note="GC: 44.99%; Transmembrane domains: 1. Codon
                     Adaptation Index (CAI): 0.765. SignalP prediction: Yes
                     (prob. 0.515); Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034283.1"
                     /db_xref="GeneID:4808002"
                     /translation="MFGFFFVAFVAVFGIVFFISYKLLEDREDTDSDWPSSQSQEPDY
                     FQQTQTAPWELKYNKGKQGEYQLGQVLNQLYGYKKILYNLYIFKEDGTTTEIDALLIH
                     PSGIYIFESKNYKGWIFGSENQQYWTQVLSGGRGKSYKHSFFNPIIQNKVHLKWLSYY
                     LNQYTPNLYSYIVFGNDCQLKEIHLNSDRHKVIQTWQVIGAIDQQACQSPVYLSPEQI
                     DDLYRMLLPLTKRKQVIKERHINSIAQNKQRREAEKICPRCQHRLVLRTASKGSRAGQ
                     QFWGCSNFPRCRFTQKYQEPVCSPPAAQAPNFGQPVVQNLNQTQSNSRF"
     misc_feature    complement(269126..269473)
                     /locus_tag="SSA_0274"
                     /note="Nuclease-related domain; Region: NERD; pfam08378"
                     /db_xref="CDD:285566"
     misc_feature    complement(268772..268885)
                     /locus_tag="SSA_0274"
                     /note="Topoisomerase DNA binding C4 zinc finger; Region:
                     zf-C4_Topoisom; pfam01396"
                     /db_xref="CDD:279704"
     gene            269858..270727
                     /locus_tag="SSA_0276"
                     /db_xref="GeneID:4807508"
     CDS             269858..270727
                     /locus_tag="SSA_0276"
                     /function="Cell envelope biogenesis, outer membrane"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 47.01%; Transporter classification
                     TC:9.B.32.1.3. Codon Adaptation Index (CAI): 0.759.
                     Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family protein"
                     /protein_id="YP_001034284.1"
                     /db_xref="GeneID:4807508"
                     /translation="MSQELISVIIPVYNVEQYLAECVNSVCRQTYQNLEIILVNDGST
                     DASGQICQELADQDARIRLIHQDNQGLSGARNTGIEHSSADYLIFVDSDDWLPEQHVA
                     RLYEKLKEYDADIAIGHHCSFRAEDSAFLYYSTEHFETLYTREEIIEEYPRRRMLDGV
                     FLCAWAKLYKRELFDTVRYPVGRVAEDAFTTYKLYLQSEKIIYLNEPLYYYRLRPNSI
                     SMTWNEQWFRDLIVGFEEQLAILGKLGYDLSFYYKYYTFLLQYCRDSAAAVGMQSSRV
                     CQEIESKLQLFGE"
     misc_feature    269861..270682
                     /locus_tag="SSA_0276"
                     /note="Glycosyltransferase involved in cell wall
                     bisynthesis [Cell wall/membrane/envelope biogenesis];
                     Region: WcaA; COG0463"
                     /db_xref="CDD:223539"
     misc_feature    269876..270382
                     /locus_tag="SSA_0276"
                     /note="Glycosyl transferase family 2; Region:
                     Glycos_transf_2; pfam00535"
                     /db_xref="CDD:278936"
     misc_feature    order(269888..269890,269894..269896,269972..269974,
                     270128..270130,270134..270136)
                     /locus_tag="SSA_0276"
                     /note="active site"
                     /db_xref="CDD:132997"
     gene            complement(270798..271601)
                     /locus_tag="SSA_0277"
                     /db_xref="GeneID:4807425"
     CDS             complement(270798..271601)
                     /locus_tag="SSA_0277"
                     /EC_number="1.97.1.4"
                     /function="Posttranslational modification, protein
                     turnover, chaperones"
                     /note="GC: 41.29%; Codon Adaptation Index (CAI): 0.775.
                     Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate formate-lyase 3-activating protein"
                     /protein_id="YP_001034285.1"
                     /db_xref="GeneID:4807425"
                     /translation="MIVSKGGLSMETTKGIIFNIQHFSIHDGPGIRTTVFLKGCPLRC
                     PWCSNPESQQFRPEPMLDATTKKSITMGEERSVEEIINEVLKDRDFYEESGGGLTLSG
                     GEIFAQFEFAKAILKAAKEKGIHTAIETTAFVEHEKFVDLIQYVDFIYTDLKHYNSVN
                     HRKVTGVKNELIVQNIHYAFTHQKTIVLRIPVIPDFNDSLEDAERFATLFNELSINQV
                     QLLPFHQFGENKYKLLGRKYAMEDVKALHPEDLFEYQDVFLKHDINCYF"
     misc_feature    complement(270816..271553)
                     /locus_tag="SSA_0277"
                     /note="glycyl-radical enzyme activating protein; Region:
                     PFLE_PFLC; TIGR02494"
                     /db_xref="CDD:274163"
     misc_feature    complement(order(270933..270938,271029..271031,
                     271152..271154,271209..271217,271290..271295,
                     271299..271301,271458..271466,271470..271472,
                     271476..271478,271482..271484))
                     /locus_tag="SSA_0277"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     misc_feature    complement(270837..271391)
                     /locus_tag="SSA_0277"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cl18962"
                     /db_xref="CDD:302752"
     gene            271699..272442
                     /locus_tag="SSA_0278"
                     /db_xref="GeneID:4807920"
     CDS             271699..272442
                     /locus_tag="SSA_0278"
                     /function="Transcription / Carbohydrate transport and
                     metabolism"
                     /note="GC: 41.4%; Codon Adaptation Index (CAI): 0.792.
                     Helix-turn-helix prediction: AraC. Curator(s): P. Manque,
                     J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar metabolism transcriptional repressor"
                     /protein_id="YP_001034286.1"
                     /db_xref="GeneID:4807920"
                     /translation="MERLDEIVKLVSEFERIDVNTLSDRLKVSKVTIRKDLDKLETKG
                     LLRREHGYAVLNSGDDLNVRLSFHYDTKRRIAQEAAKIVQDNETIMIESGSTCALLAE
                     EICRTKKNVKIITNSYFIADYIKQTDSCKIILLGGEFQKDSQVTVGPLLKEMIRFFHV
                     EHAFVGTDGYDENLGFTGKDLMRSEVVQYMSEASDQMIVLTDSSKFTRKGIVKRFGFK
                     QIAQVVTDKAIPKEAVERLKAADIKLTLI"
     misc_feature    271702..272439
                     /locus_tag="SSA_0278"
                     /note="DNA-binding transcriptional regulator of sugar
                     metabolism, DeoR/GlpR family [Transcription, Carbohydrate
                     transport and metabolism]; Region: GlpR; COG1349"
                     /db_xref="CDD:224268"
     gene            272459..273430
                     /locus_tag="SSA_0279"
                     /db_xref="GeneID:4807711"
     CDS             272459..273430
                     /locus_tag="SSA_0279"
                     /function="Transcription"
                     /note="GC: 42.28%; Codon Adaptation Index (CAI): 0.772.
                     Helix-turn-helix prediction: AraC. Curator(s): P. Manque,
                     J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar-binding transcriptional repressor (DeoR)"
                     /protein_id="YP_001034287.1"
                     /db_xref="GeneID:4807711"
                     /translation="MKNERKKLLAKIAYLYYIEERSQSDIAAETGIYRTTISRMLAEA
                     KKEGIVKIEIEDFDTRLFHLENYVKEKYGLKGIEIVSNLVDESPADLEERLAQAAAGM
                     LRGLIKDNDKVGFSWGKSLSLLVEHSSSKHLTNVHFFPLAGGPSHIHARYHVNTLIYS
                     MAGKYHGDCRFMNSTIIQEDEQLANGILDSKYFEDLKSSWQELDVAVVGIGGQVDTRN
                     RQWLDMLTSEDFLALESQDAVGEICCRFFNKKGDMVYQHLQNRTIAISLENLKKVPLS
                     LAFAYGSQKSAAILAVLRAGYVNHLVTDEATILKMLDLDGDRSFFTS"
     misc_feature    272459..273406
                     /locus_tag="SSA_0279"
                     /note="DNA-binding transcriptional regulator LsrR, DeoR
                     family [Transcription]; Region: DeoR; COG2390"
                     /db_xref="CDD:225263"
     gene            273544..274023
                     /locus_tag="SSA_0281"
                     /db_xref="GeneID:4807884"
     CDS             273544..274023
                     /locus_tag="SSA_0281"
                     /note="GC: 35%; Transmembrane domains: 4. Codon Adaptation
                     Index (CAI): 0.726. Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034288.1"
                     /db_xref="GeneID:4807884"
                     /translation="MKQKLTSLATGELVAVLVFWMNFFLLKKWILTTGALISISFSLF
                     VLSFILIQGSVFWWILIKRISNPRFAERYTGKIYRVLKILDLILLGVGTLIIIFNSSD
                     FSTFIISVAIWFFAVIEWINYFKWQLSYSLNPAVLLKYNLQRKLRKSKIAKEIEKAV"
     gene            274355..274678
                     /locus_tag="SSA_0282"
                     /db_xref="GeneID:4807746"
     CDS             274355..274678
                     /locus_tag="SSA_0282"
                     /EC_number="2.7.1.69"
                     /note="GC: 40.43%; Transporter classification
                     TC:4.A.3.2.1. Codon Adaptation Index (CAI): 0.772.
                     Helix-turn-helix prediction: AraC. Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system cellobiose-specific transporter
                     subunit IIA"
                     /protein_id="YP_001034289.1"
                     /db_xref="GeneID:4807746"
                     /translation="MEMIVADQIIMGLILDAGDAKQHIYQALSLAKDGKFSECDEQIE
                     LADKALLEAHNLQTKFLAQEAGGTKTEITALFVHSQDHLMTSITEINLIKEIIDLRRE
                     LQGEK"
     misc_feature    274358..274672
                     /locus_tag="SSA_0282"
                     /note="Phosphotransferase system cellobiose-specific
                     component IIA [Carbohydrate transport and metabolism];
                     Region: CelC; COG1447"
                     /db_xref="CDD:224364"
     misc_feature    order(274415..274417,274586..274588,274592..274600)
                     /locus_tag="SSA_0282"
                     /note="active site"
                     /db_xref="CDD:238133"
     misc_feature    order(274532..274534,274580..274585,274604..274606)
                     /locus_tag="SSA_0282"
                     /note="methionine cluster; other site"
                     /db_xref="CDD:238133"
     misc_feature    274586..274588
                     /locus_tag="SSA_0282"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238133"
     misc_feature    274595..274597
                     /locus_tag="SSA_0282"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:238133"
     gene            274699..275010
                     /locus_tag="SSA_0283"
                     /db_xref="GeneID:4806648"
     CDS             274699..275010
                     /locus_tag="SSA_0283"
                     /EC_number="2.7.1.69"
                     /function="Carbohydrate transport and metabolism"
                     /note="GC: 42.95%; Transporter classification
                     TC:4.A.3.2.3. Codon Adaptation Index (CAI): 0.807. SignalP
                     prediction: Yes (prob. 0.996); Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system cellobiose-specific transporter
                     subunit IIB"
                     /protein_id="YP_001034290.1"
                     /db_xref="GeneID:4806648"
                     /translation="MVKIGLFCAAGFSTGMLVNNMKIAAAEKGLEAEIEAYSQAKLAD
                     YAADLDVALLGPQVAYTLDKSTAICDSCHTPIAVIPMADYGMLDGEKVLNLALSLLDK
                     H"
     misc_feature    274699..275004
                     /locus_tag="SSA_0283"
                     /note="Phosphotransferase system cellobiose-specific
                     component IIB [Carbohydrate transport and metabolism];
                     Region: CelA; COG1440"
                     /db_xref="CDD:224357"
     misc_feature    order(274720..274722,274726..274731,274735..274740,
                     274867..274869,274948..274950)
                     /locus_tag="SSA_0283"
                     /note="active site"
                     /db_xref="CDD:99906"
     misc_feature    274720..274740
                     /locus_tag="SSA_0283"
                     /note="P-loop; other site"
                     /db_xref="CDD:99906"
     misc_feature    274720..274722
                     /locus_tag="SSA_0283"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:99906"
     gene            275028..276329
                     /gene="ptcC"
                     /locus_tag="SSA_0284"
                     /db_xref="GeneID:4806112"
     CDS             275028..276329
                     /gene="ptcC"
                     /locus_tag="SSA_0284"
                     /function="Carbohydrate transport and metabolism"
                     /note="GC: 45.16%; Transporter classification
                     TC:4.A.3.2.2. Transmembrane domains: 10. Codon Adaptation
                     Index (CAI): 0.776. Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system cellobiose-specific transporter
                     subunit IIC"
                     /protein_id="YP_001034291.1"
                     /db_xref="GeneID:4806112"
                     /translation="MSKVDTQKIIAPIMKFVNMRGIIALKDGMLAILPLTVVGSLFLI
                     VGQLPFEGLNQAIAGVFGADWTEPFMQVYSGTFAIMGLISCFSIGYSYAKNSGVEPLP
                     AGVLSLSSFFILLKSSYIPEKGEAIADAIAKVWFGGQGIIGAILIGLAVGSIYTIFIQ
                     KHIVIKMPEQVPQAIAKQFEAMIPAFVIFLLSMLVYIIAKIATGGGTFIEMIYDVIQV
                     PLQGLTGSLYGAIGIAFFISFLWWFGVHGQSVVNGVVTALLLSNLDANKALLAADKLS
                     VSQGAHIVTQQFLDSFLILSGSGITFGVVVAMLFAAKSKQYKALGKVAAFPAIFNVNE
                     PVVFGFPIVMNPVMFLPFVLVPVLAALIVYMAIAVGFMQPFAGVTLPWSTPAIISGFM
                     VAGWQGAVIQIVILAMSAFAYFPFVKFQDKIAYNNELKNEE"
     misc_feature    275028..276326
                     /gene="ptcC"
                     /locus_tag="SSA_0284"
                     /note="Phosphotransferase system cellobiose-specific
                     component IIC [Carbohydrate transport and metabolism];
                     Region: CelB; COG1455"
                     /db_xref="CDD:224372"
     gene            276498..278939
                     /locus_tag="SSA_0285"
                     /db_xref="GeneID:4806460"
     CDS             276498..278939
                     /locus_tag="SSA_0285"
                     /EC_number="2.3.1.54"
                     /function="Energy production and conversion"
                     /note="GC: 44.84%; Codon Adaptation Index (CAI): 0.792.
                     Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="formate acetyltransferase 3"
                     /protein_id="YP_001034292.1"
                     /db_xref="GeneID:4806460"
                     /translation="MIQVKEVEKTTIKTDYFGSLTERMDKYREDVLNKKPYIDAERAV
                     LATKAYDKHKEKPNVLKRAYMLKEILENMTLYIEDETMIVGNQASSNKDAPIFPEYTL
                     EFVLNELDLFEKRDGDVFYITEETKEQLRSIAPFWENNNLRARAGALLPEEVQVYMET
                     GFFGMEGKMNSGDAHLAVNYQKLLAYGLKGFEEKARAAKEALDLTDPASIDKYHFYDS
                     IFIVVDAVKAYAERFVALANQMAEKADPKRRQELLEIARICSKVPYEPASTFAEAVQS
                     VWFIQCILQIESNGHSLSYGRFDQYMYPYVKADLEAGRETEASIVERLTNLWIKTITI
                     NKVRSQAHTFSSAGSPLYQNVTIGGQTRDKRDAVNPLSYLVLKSVAQTHLPQPNLTVR
                     YHAGLDARFMNECIEVMKLGFGMPAFNNDEIIIPSFIAKGVLEEDAYDYSAIGCVETA
                     VPGKWGYRCTGMSYMNFPKVLLITMNDGIDPASGKRFAPSFGHFKDMKSFAELQTAWD
                     KTLRHLTRMSVIVENSIDLSLEREVPDILCSALTDDCIGRGKHLKEGGAVYDYISGLQ
                     VGIANLSDSLAAIKKLVFEEGRLTPAELWHALETDYAGERGKEIQEMLIHDAPKYGND
                     DDYADKLVTDAYDIYVDEIAKYPNTRYGRGPIGGIRYSGTSSISANVGQGRGTLATPD
                     GRNAGTPLAEGCSPSHNMDKNGPTSVLKSVSKLPTDEIVGGVLLNQKVNPQTLSKEED
                     KVKLIALLRTFFNRLHGYHIQYNVVSRETLIDAQKHPEKHRDLIVRVAGYSAFFNVLS
                     KATQDDIIGRTEHTL"
     misc_feature    276552..278936
                     /locus_tag="SSA_0285"
                     /note="Pyruvate-formate lyase [Energy production and
                     conversion]; Region: PflD; COG1882"
                     /db_xref="CDD:224794"
     misc_feature    276558..278927
                     /locus_tag="SSA_0285"
                     /note="Pyruvate formate lyase 2 and related enzymes;
                     Region: PFL2_DhaB_BssA; cd01677"
                     /db_xref="CDD:153086"
     misc_feature    order(276657..276668,276909..276917,276927..276932,
                     276939..276950,277125..277130,277134..277139,
                     278064..278066,278076..278078,278091..278093,
                     278430..278438,278460..278462)
                     /locus_tag="SSA_0285"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:153086"
     misc_feature    order(277020..277022,277368..277373,277533..277535,
                     277551..277553,277830..277835,277839..277841,
                     277878..277880,278490..278492,278496..278498)
                     /locus_tag="SSA_0285"
                     /note="active site"
                     /db_xref="CDD:153086"
     misc_feature    278853..278867
                     /locus_tag="SSA_0285"
                     /note="glycine loop; other site"
                     /db_xref="CDD:153086"
     gene            278954..279622
                     /locus_tag="SSA_0286"
                     /db_xref="GeneID:4806680"
     CDS             278954..279622
                     /locus_tag="SSA_0286"
                     /EC_number="2.2.1.2"
                     /EC_number="4.1.2.-"
                     /note="similar to transaldolase from Escherichia coli;
                     many organisms have multiple copies"
                     /codon_start=1
                     /transl_table=11
                     /product="fructose-6-phosphate aldolase"
                     /protein_id="YP_001034293.1"
                     /db_xref="GeneID:4806680"
                     /translation="MEFMLDTLNLEEIKKWSEVLPLAGVTSNPTIAKKEGKINFFERI
                     RAVREIIGEGPSIHVQVVAKDYEGILKDAAEIRKKCGNAVYIKVPVTPAGLAAIKTLK
                     PEGYKITATAIYTTFQGLLAIEAGADYLAPYYNRMENLNIDSDAVISQLAQAIERDHS
                     TSKILAASFKNVGQINRAFADGAQAITAGPDIFAAAFAMPSIAKAVDDFATDWSAIHN
                     QEYI"
     misc_feature    278954..279619
                     /locus_tag="SSA_0286"
                     /note="fructose-6-phosphate aldolase; Reviewed; Region:
                     PRK12656"
                     /db_xref="CDD:183656"
     misc_feature    order(278969..278971,279032..279037,279212..279214,
                     279350..279352,279452..279454)
                     /locus_tag="SSA_0286"
                     /note="active site"
                     /db_xref="CDD:188643"
     misc_feature    order(279002..279004,279011..279013,279038..279043,
                     279050..279052,279059..279061,279071..279073,
                     279131..279133,279149..279151,279167..279169,
                     279230..279232,279236..279241,279248..279250,
                     279305..279307,279350..279352,279356..279358,
                     279365..279367,279371..279373,279422..279427,
                     279464..279466,279470..279472,279488..279493,
                     279500..279502,279548..279550,279554..279559,
                     279566..279568,279578..279583,279587..279592)
                     /locus_tag="SSA_0286"
                     /note="intersubunit interactions; other site"
                     /db_xref="CDD:188643"
     misc_feature    279212..279214
                     /locus_tag="SSA_0286"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:188643"
     gene            279668..280762
                     /gene="gldA"
                     /locus_tag="SSA_0287"
                     /db_xref="GeneID:4806770"
     CDS             279668..280762
                     /gene="gldA"
                     /locus_tag="SSA_0287"
                     /EC_number="1.1.1.6"
                     /function="Energy production and conversion"
                     /note="forms dimers and octamers; involved in conversion
                     of glycerol to dihydroxy-acetone"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol dehydrogenase"
                     /protein_id="YP_001034294.1"
                     /db_xref="GeneID:4806770"
                     /translation="MRIFASPSRYIQGENALFENAKQILQLGSHPVLLCDDVVYQIVG
                     EKFHDYLTRYGFHVLHVAFNGEASDAEIERVVALAEKDGADLVIGLGGGKTIDSAKAI
                     ADILGRPVVIAPTIASTDAPTSALSVIYTEDGAFEKYIFYSKNPELVLVDTKVIAGAP
                     KRLLASGIADGLATWVEARAVQQKNGTTMLGQRQSLAGVAIAKKCEETLFADGLQAIA
                     ACEAKVVTPALENIIEANTLLSGVGFESGGLAAAHAIHNGFTALTGDIHHLTHGEKVA
                     YGTLTQLFLENRSKEELEKYIRFYQKIGMPTTLKEMHLENASYEDLLKVGQQATIEGE
                     TIHQMPFEISASDIAGAILAVDQYVRDLDK"
     misc_feature    279668..280759
                     /gene="gldA"
                     /locus_tag="SSA_0287"
                     /note="glycerol dehydrogenase; Provisional; Region: gldA;
                     PRK09423"
                     /db_xref="CDD:181843"
     misc_feature    order(279689..279697,279701..279706,280277..280279,
                     280286..280288,280355..280360,280367..280369)
                     /gene="gldA"
                     /locus_tag="SSA_0287"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:173929"
     misc_feature    order(279773..279775,279941..279949,279956..279958,
                     279965..279967,280010..280015,280019..280021,
                     280076..280081,280130..280132,280154..280156,
                     280175..280177,280187..280189,280424..280426,
                     280436..280438,280478..280480)
                     /gene="gldA"
                     /locus_tag="SSA_0287"
                     /note="active site"
                     /db_xref="CDD:173929"
     misc_feature    order(280175..280177,280424..280426,280478..280480)
                     /gene="gldA"
                     /locus_tag="SSA_0287"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:173929"
     gene            complement(280830..281393)
                     /locus_tag="SSA_0288"
                     /db_xref="GeneID:4806801"
     CDS             complement(280830..281393)
                     /locus_tag="SSA_0288"
                     /function="Posttranslational modification, protein
                     turnover, chaperones"
                     /note="GC: 37.06%; Transmembrane domains: 4. Codon
                     Adaptation Index (CAI): 0.727. Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034295.1"
                     /db_xref="GeneID:4806801"
                     /translation="MNLQTIFTYIFFVIFISTEMWIKNKTKSNNVNDSADKGSRYIII
                     GSVISCLFLINGQFLDFVPHLPSLTIYLGILISLAGFALRVYAVNYLGKNFTLAVQTT
                     DSQQLVDHGPYSIVRNPAYTGSILSILGLSITSLNPLTIIISLILLVLGYSIRLRVEE
                     KALGNHFGKNYEAYCQKVRYRVFPYIW"
     misc_feature    complement(280833..281378)
                     /locus_tag="SSA_0288"
                     /note="Protein-S-isoprenylcysteine O-methyltransferase
                     Ste14 [Posttranslational modification, protein turnover,
                     chaperones]; Region: STE14; COG2020"
                     /db_xref="CDD:224931"
     gene            281546..284059
                     /gene="leuS"
                     /locus_tag="SSA_0289"
                     /db_xref="GeneID:4806757"
     CDS             281546..284059
                     /gene="leuS"
                     /locus_tag="SSA_0289"
                     /EC_number="6.1.1.4"
                     /function="Translation, ribosomal structure and
                     biogenesis"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="leucine--tRNA ligase; LeuRS; class-I aminoacyl-tRNA
                     synthetase; charges leucine by linking carboxyl group to
                     alpha-phosphate of ATP and then transfers
                     aminoacyl-adenylate to its tRNA; due to the large number
                     of codons that tRNA(Leu) recognizes, the leucyl-tRNA
                     synthetase does not recognize the anticodon loop of the
                     tRNA, but instead recognition is dependent on a conserved
                     discriminator base A37 and a long arm; an editing domain
                     hydrolyzes misformed products; in Methanothermobacter
                     thermautotrophicus this enzyme associates with prolyl-tRNA
                     synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="leucyl-tRNA synthetase"
                     /protein_id="YP_001034296.1"
                     /db_xref="GeneID:4806757"
                     /translation="MEKRMAYYNHKEIEPKWQKYWAEHHTFKTGTDKDKPNFYALDMF
                     PYPSGAGLHVGHPEGYTATDILSRYKRTQGYNVLHPMGWDAFGLPAEQYAMDTGNDPA
                     DFTAENIANFKRQINALGFSYDWDREINTTDPNYYKWTQWIFTKLYEKGLAYEAEVPV
                     NWVEELGTAIANEEVLPDGTSERGGYPVVRKPMRQWMLKITAYAERLLNDLEELDWPE
                     SIKDMQRNWIGKSTGANVTFKIKDTDKDFTVFTTRPDTLFGATYAVLAPEHALVDAIT
                     SAEQAQAVADYKHAASLKSDLARTDLAKDKTGVWTGAYAINPVNGKEIPIWIADYVLA
                     SYGTGAIMAVPAHDERDWEFAKQFDLEIIPVLEGGNVAEAAYTEDGPHINSGFLDGLD
                     KAAAIDKMVAWLEAEGVGNEKVTYRLRDWLFSRQRYWGEPIPIIHWEDGTSTAVPENE
                     LPLVLPVTKDIRPSGTGESPLANLTDWLEVTREDGVKGRRETNTMPQWAGSSWYYLRY
                     IDPHNNEKLADEELLKAWLPVDIYIGGAEHAVLHLLYARFWHKFLYDIGVVPTKEPFQ
                     KLFNQGMILGTSYRDSRCALVATDKVEKRDGSFFNIETGEELEQAPAKMSKSLKNVVN
                     PDDVVEQYGADTLRVYEMFMGPLDASIAWSEEGLEGSRKFLDRVYRLFNSKELVTENS
                     GALDKVYHETVKSVTEQIEELKFNTAIAQLMIFVNAANKEEKLYVEYAKGFIQLLAPF
                     APHLAEELWQAVAQTGESISYVTWPTYDESKLVEAEVEIVVQIKGKVRAKLVVAKDLS
                     REELQEIALSDEKIKSEIAGKEIVKVISVPNKLVNIVVK"
     misc_feature    281555..284056
                     /gene="leuS"
                     /locus_tag="SSA_0289"
                     /note="leucyl-tRNA synthetase; Validated; Region: leuS;
                     PRK00390"
                     /db_xref="CDD:234743"
     misc_feature    281657..283504
                     /gene="leuS"
                     /locus_tag="SSA_0289"
                     /note="catalytic core domain of leucyl-tRNA synthetases;
                     Region: LeuRS_core; cd00812"
                     /db_xref="CDD:173906"
     misc_feature    order(281675..281677,281681..281683,281702..281704,
                     281711..281713,281795..281797,281819..281821,
                     283148..283150,283154..283159,283169..283171,
                     283256..283258,283265..283267,283388..283390,
                     283394..283396)
                     /gene="leuS"
                     /locus_tag="SSA_0289"
                     /note="active site"
                     /db_xref="CDD:173906"
     misc_feature    281702..281713
                     /gene="leuS"
                     /locus_tag="SSA_0289"
                     /note="HIGH motif; other site"
                     /db_xref="CDD:173906"
     misc_feature    282218..282760
                     /gene="leuS"
                     /locus_tag="SSA_0289"
                     /note="Leucyl-tRNA synthetase, Domain 2; Region:
                     tRNA-synt_1_2; pfam13603"
                     /db_xref="CDD:290334"
     misc_feature    283385..283399
                     /gene="leuS"
                     /locus_tag="SSA_0289"
                     /note="KMSKS motif; other site"
                     /db_xref="CDD:173906"
     misc_feature    283502..283798
                     /gene="leuS"
                     /locus_tag="SSA_0289"
                     /note="Anticodon-binding domain of bacterial and
                     eukaryotic mitochondrial leucyl tRNA synthetases; Region:
                     Anticodon_Ia_Leu_BEm; cd07958"
                     /db_xref="CDD:153412"
     misc_feature    order(283511..283513,283520..283525,283532..283534,
                     283544..283546,283661..283663,283673..283675,
                     283682..283687,283694..283696,283703..283705,
                     283715..283717)
                     /gene="leuS"
                     /locus_tag="SSA_0289"
                     /note="tRNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:153412"
     gene            complement(284174..285319)
                     /locus_tag="SSA_0290"
                     /db_xref="GeneID:4806617"
     CDS             complement(284174..285319)
                     /locus_tag="SSA_0290"
                     /note="GC: 40.84%; Transmembrane domains: 12. Codon
                     Adaptation Index (CAI): 0.756. Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034297.1"
                     /db_xref="GeneID:4806617"
                     /translation="MTNLIKHKRVEFSELFYDLVFVYAISKTTALIHHLHHGVLSLDA
                     IFGFLMTLLVLVNSWMIQTVYTNRYGKNSLFNMVVMFVNMAMLLLISNMITNDWQSYF
                     HAFCWTIGTLTLTLFSQYLVEYLRKSTTPANRKSIKGFLWMTGLRTVLVYLAALLPIH
                     LGIHVYMTGILLTFIMPVLLTRKVSHFQINLPHLIERISLLVIITFGEMIMGLADFFT
                     LEHFSIHSILYFIIMVNLFMNYFGQFDHAIDEKGENKGIFLIYSHYPIFIGLIMVTVS
                     MSFLVNPEAHHLFATSFFYAGIGLFQAAVLSNGRFNKSYLRYNKFFYGFQAGIFLVGL
                     ILSLLFSAYPTVVISIATLMTLAMEIHFTHFYMAQTKKFSTPNWELF"
     misc_feature    complement(284246..285286)
                     /locus_tag="SSA_0290"
                     /note="Bacterial low temperature requirement A protein
                     (LtrA); Region: LtrA; pfam06772"
                     /db_xref="CDD:284241"
     gene            285502..286329
                     /locus_tag="SSA_0291"
                     /db_xref="GeneID:4805877"
     CDS             285502..286329
                     /locus_tag="SSA_0291"
                     /function="General function prediction only"
                     /note="GC: 42.63%; Codon Adaptation Index (CAI): 0.829.
                     LipoP prediction: SpI. Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="short chain dehydrogenase"
                     /protein_id="YP_001034298.1"
                     /db_xref="GeneID:4805877"
                     /translation="MNMSNKKVILVTGASSGIGYQTAEQLAKEGHIVYGAARRVDAMK
                     PLEAFGVTPVSLDITDEASIKEALNLIIKKENRIDVLVNNAGYGSYGAVEDVRIEEAK
                     MQFEVNIFGLARLTQLVLPYMRKQKSGRIINVGSMGGRLTSYFGAWYHATKYALEAFS
                     DGLRMEVADFGIDVSIIEPGGIKTDWGFIAADKLAESAKGGAYEAAATKAAEGMRKQY
                     SGNMMSNPKVISNAISKAVNSRCPKTRYLVGMGAKPLVFLHAILPDRWFDALMKRAS"
     misc_feature    285511..286326
                     /locus_tag="SSA_0291"
                     /note="short chain dehydrogenase; Validated; Region:
                     PRK06182"
                     /db_xref="CDD:180448"
     misc_feature    285520..286248
                     /locus_tag="SSA_0291"
                     /note="17beta hydroxysteroid dehydrogenase-like, classical
                     (c) SDRs; Region: 17beta-HSD-like_SDR_c; cd05374"
                     /db_xref="CDD:187632"
     misc_feature    order(285538..285540,285544..285555,285613..285615,
                     285667..285675,285751..285762,285820..285822,
                     285901..285909,285946..285948,285958..285960,
                     286045..286047,286051..286059)
                     /locus_tag="SSA_0291"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:187632"
     misc_feature    order(285823..285825,285907..285909,285946..285948,
                     285958..285960)
                     /locus_tag="SSA_0291"
                     /note="active site"
                     /db_xref="CDD:187632"
     misc_feature    order(285907..285915,285928..285930,285946..285948,
                     286039..286044,286072..286074,286120..286122,
                     286129..286131)
                     /locus_tag="SSA_0291"
                     /note="steroid binding site; other site"
                     /db_xref="CDD:187632"
     gene            286348..287322
                     /locus_tag="SSA_0292"
                     /db_xref="GeneID:4806736"
     CDS             286348..287322
                     /locus_tag="SSA_0292"
                     /function="Transcription"
                     /note="GC: 43.59%; Codon Adaptation Index (CAI): 0.77.
                     Helix-turn-helix prediction: AraC. Curator(s): P. Manque,
                     J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_001034299.1"
                     /db_xref="GeneID:4806736"
                     /translation="MRLSLSQQYIDNLKLIGLDLNMILELTNLPDTTWKEELNLSTLD
                     YYHLLTAFDKVATDEQIIAMSRIKDIQMFMPPFFAALSSKTGLAAMEHFAKYKKITGP
                     IVVSIETFEDLVRVSYRYDYPGFDLPRFALLNEQLLLVDLIRTGTGETITPVHVGTPY
                     TYEEASLTVFGCHVEQMEGNEVVFKKADLEKPFLTANNVMLDYLEPQLKERLAEATTS
                     ESFTGLVQQKLYQAIPSGAFGIEDIAATLGISSRTLQRNLMAEGTKFNQELQNVQKIL
                     AFGYFKNPDMTTDDVAYLLGYSEVSSFSRAFKKWTGKTISEYREGIHK"
     misc_feature    <286579..286926
                     /locus_tag="SSA_0292"
                     /note="Arabinose-binding domain of AraC transcription
                     regulator, N-term; Region: Arabinose_bd; pfam12625"
                     /db_xref="CDD:289397"
     misc_feature    287065..287304
                     /locus_tag="SSA_0292"
                     /note="helix_turn_helix, arabinose operon control protein;
                     Region: HTH_ARAC; smart00342"
                     /db_xref="CDD:197666"
     misc_feature    287200..287304
                     /locus_tag="SSA_0292"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:278590"
     gene            complement(287446..287703)
                     /locus_tag="SSA_0293"
                     /db_xref="GeneID:4808013"
     CDS             complement(287446..287703)
                     /locus_tag="SSA_0293"
                     /function="Amino acid transport and metabolism"
                     /note="GC: 39.53%; Codon Adaptation Index (CAI): 0.752.
                     Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034300.1"
                     /db_xref="GeneID:4808013"
                     /translation="MTTIIKHHVALLAKGRLLGIQFDELFKDKLYQTIGKDAIPYANQ
                     IRLACKNASLPLYFENPTNQVFCIANDDQMKKLAQKVIFSY"
     misc_feature    complement(287449..>287703)
                     /locus_tag="SSA_0293"
                     /note="Aspartate aminotransferase (AAT) superfamily (fold
                     type I) of pyridoxal phosphate (PLP)-dependent enzymes.
                     PLP combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine intermediate, which
                     depending on the reaction, is the...; Region: AAT_I;
                     cl18945"
                     /db_xref="CDD:302748"
     gene            complement(287862..287966)
                     /locus_tag="SSA_0294"
                     /db_xref="GeneID:4806137"
     CDS             complement(287862..287966)
                     /locus_tag="SSA_0294"
                     /function="Amino acid transport and metabolism"
                     /note="GC: 36.19%; Codon Adaptation Index (CAI): 0.776.
                     Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034301.1"
                     /db_xref="GeneID:4806137"
                     /translation="MVYLSQPTELGTLYSKAELEAISHVCKEKMSNFS"
     misc_feature    complement(<287880..>287966)
                     /locus_tag="SSA_0294"
                     /note="Aspartate aminotransferase (AAT) superfamily (fold
                     type I) of pyridoxal phosphate (PLP)-dependent enzymes.
                     PLP combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine intermediate, which
                     depending on the reaction, is the...; Region: AAT_I;
                     cl18945"
                     /db_xref="CDD:302748"
     gene            complement(288116..288991)
                     /gene="mleR"
                     /locus_tag="SSA_0295"
                     /db_xref="GeneID:4806411"
     CDS             complement(288116..288991)
                     /gene="mleR"
                     /locus_tag="SSA_0295"
                     /function="Transcription"
                     /GO_process="GO:0006355 - regulation of transcription,
                     DNA-dependent"
                     /note="GC: 38.81%; Codon Adaptation Index (CAI): 0.742.
                     Helix-turn-helix prediction: LysR. Similar to malolactic
                     fermentation system activator. Curator(s): P. Manque, J.
                     Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_001034302.1"
                     /db_xref="GeneID:4806411"
                     /translation="MNLKDFYYFLDLSQQQSFTGVAQKHGISQPSVSYAIKRLEKEFH
                     CQLIVHDPSHRTFKLTPQGDILLRHIQKVLPEIQGAKKEILRSLSQFNTIGFPPIIID
                     YLVRKQPAFISNVAALQSIHPIQEGSVELLELLSKGELDASFLGSLEPIKDHRFQVRE
                     MAKRDLFYILHHNHPLASKKVLQFSDVIDEDFIIPDEHFVHLKAFEQLNERYHHKATP
                     FFQTDDIQLLKQLLRKQVGISLLADLVLTDGEEDLITIPMAENERISLYVSLVEPKES
                     NLKPEVIQFFEKLLN"
     misc_feature    complement(288122..288991)
                     /gene="mleR"
                     /locus_tag="SSA_0295"
                     /note="DNA-binding transcriptional regulator, LysR family
                     [Transcription]; Region: LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(288803..288985)
                     /gene="mleR"
                     /locus_tag="SSA_0295"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:278552"
     misc_feature    complement(288152..288709)
                     /gene="mleR"
                     /locus_tag="SSA_0295"
                     /note="Type 2 periplasmic binding fold superfamily;
                     Region: Periplasmic_Binding_Protein_Type_2; cl21456"
                     /db_xref="CDD:304360"
     misc_feature    complement(order(288290..288295,288299..288304,
                     288320..288337,288617..288631,288635..288640,
                     288644..288646,288656..288658,288665..288670,
                     288671..288676))
                     /gene="mleR"
                     /locus_tag="SSA_0295"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            complement(289103..289453)
                     /locus_tag="SSA_0296"
                     /db_xref="GeneID:4806582"
     CDS             complement(289103..289453)
                     /locus_tag="SSA_0296"
                     /function="Transcription"
                     /note="GC: 33.9%; Codon Adaptation Index (CAI): 0.727.
                     Curator(s): P. Manque, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="YP_001034303.1"
                     /db_xref="GeneID:4806582"
                     /translation="MKTKHYLQRYIAQKVKYLRKKQNMSQEELSERADLGLKYINQLE
                     NQNVNLTIHSLEKVISALELTPEEFFNFDSLEASSDPTDSLSLKRVNMKIKQLPVGKR
                     EKFLKIFEDLLDSL"
     misc_feature    complement(289247..289420)
                     /locus_tag="SSA_0296"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(289319..289321,289394..289396,
                     289406..289408))
                     /locus_tag="SSA_0296"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(289322..289324,289397..289399))
                     /locus_tag="SSA_0296"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(289316..289321,289331..289333,
                     289340..289342,289373..289378))
                     /locus_tag="SSA_0296"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            289846..291471
                     /gene="mleS"
                     /locus_tag="SSA_0297"
                     /db_xref="GeneID:4805803"
     CDS             289846..291471
                     /gene="mleS"
                     /locus_tag="SSA_0297"
                     /EC_number="1.1.1.38"
                     /function="Energy production and conversion"
                     /note="malic enzyme; oxaloacetate-decarboxylating;
                     NAD-dependent; catalyzes the formation of pyruvate form
                     malate"
                     /codon_start=1
                     /transl_table=11
                     /product="malate dehydrogenase"
                     /protein_id="YP_001034304.1"
                     /db_xref="GeneID:4805803"
                     /translation="MTAHDILNNPFLNKGTAFTLEERQKLGLIGLLPPYVQTIEEQAT
                     QTYAQMQTKVNDLEKRLFLMEIFNTNRTLFYYLFAQHLEEFNPIVYDPTIADTIEGYS
                     DLFVDPQYAAYLDINHPENIEATLKNAAGDREIRLIVVTDAEGILGIGDWGTNGVDIS
                     VGKLMVYTGAAGIDPSTVLPLVIDAGTNREELRNNPNYLGNRHERVRGDRYYDFIDQF
                     VQTAERLFPKLYLHWEDFGRLNAADILEKYRKQIPTFNDDIQGTGIVTLGGIFGSLDI
                     TGEKLTDQVYLCYGGGTAGAGIASRVLREMVSEGLPEEEAYKRFFMVDKQGLLFDDMD
                     DLTPEQKLFAKKRSDFANADKLTDLLEVVKTVKPTILVGTSTQPNTFTKEIVEAMCEN
                     TERPMIFPLSNPTKLAEASAKDLIEWSDGKAFVATGIPAGTVSYKGVDYVIGQANNAL
                     IYPGLGLGMLASEASLLSDEMIGAAAHSLSGIVNPGQPGAPVLPPFKYVADVSIKVAE
                     AVAKKAQEQGLARAQETDMAKAVRDLKWYPEYK"
     misc_feature    289846..291468
                     /gene="mleS"
                     /locus_tag="SSA_0297"
                     /note="malate dehydrogenase; Provisional; Region:
                     PRK13529"
                     /db_xref="CDD:237414"
     misc_feature    290044..290592
                     /gene="mleS"
                     /locus_tag="SSA_0297"
                     /note="Malic enzyme, N-terminal domain; Region: malic;
                     pfam00390"
                     /db_xref="CDD:278802"
     misc_feature    290620..291387
                     /gene="mleS"
                     /locus_tag="SSA_0297"
                     /note="Malic enzyme, NAD binding domain; Region: Malic_M;
                     pfam03949"
                     /db_xref="CDD:281882"
     misc_feature    order(290719..290727,290815..290820,290965..290970,
                     291046..291048)
                     /gene="mleS"
                     /locus_tag="SSA_0297"
                     /note="NAD(P) binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:133449"
     gene            291476..292507
                     /locus_tag="SSA_0298"
                     /db_xref="GeneID:4807187"
     CDS             291476..292507
                     /locus_tag="SSA_0298"
                     /function="General function prediction only"
                     /note="GC: 40.5%; Transporter classification
                     TC:2.A.69.3.1. Transmembrane domains: 9. Codon Adaptation
                     Index (CAI): 0.761. Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="malate permease"
                     /protein_id="YP_001034305.1"
                     /db_xref="GeneID:4807187"
                     /translation="MEMGWGVRVRLDASYAFYCMSCYIERETMEIFLTSIQSIVPIIV
                     IIILGYVLQVRGWFQESFGNDLSKLIMNVAMPVAIFTSVLKYLTLDKLISLSGGLLYT
                     FIAFILGYLAAFIAVQVFKVRPGRRGTMINTFVNANTIFIGLPLNIALFGNQSLPYFL
                     VYYITNTVSTWTLGVYLMTSDSKEGASKQAQKFNWKKLFPAPLLGFLVALAFLVLRLP
                     VPSFAESTLTYIGSLTTPLSLVYIGIVLAKAGLKTIRFDKDTIITLVGRFILAPVIML
                     LVLKFFSPNMVAPEFRTFMIQSATPALAVLPILANQGRGDVEFSTNVVTLSTVLFVIV
                     VPILQTLLG"
     misc_feature    291566..292504
                     /locus_tag="SSA_0298"
                     /note="Membrane transport protein; Region: Mem_trans;
                     cl22894"
                     /db_xref="CDD:304621"
     gene            292899..293402
                     /locus_tag="SSA_0299"
                     /db_xref="GeneID:4807207"
     CDS             292899..293402
                     /locus_tag="SSA_0299"
                     /function="Function unknown"
                     /note="GC: 47.02%; Transmembrane domains: 3. Codon
                     Adaptation Index (CAI): 0.76. Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034306.1"
                     /db_xref="GeneID:4807207"
                     /translation="MAGGEYVSVSTQKDTEEAAVARERELLEKNPDIARQSLYAAYVQ
                     NGECETSAQLMTNRAFLQNPLEALVAEKYGIEIEEFTNPWHAAISSFLAFAVGALFPM
                     ITIILLPASVRIWATVLIVALALLGTGYTSARLGKAPLKNAMIRNLVIGLLTMAVTYV
                     VGQAFAI"
     misc_feature    <292899..293393
                     /locus_tag="SSA_0299"
                     /note="CCC1-related family of proteins; Region: CCC1_like;
                     cl00278"
                     /db_xref="CDD:294198"
     gene            293559..294203
                     /locus_tag="SSA_0300"
                     /db_xref="GeneID:4806979"
     CDS             293559..294203
                     /locus_tag="SSA_0300"
                     /note="GC: 33.33%; Transmembrane domains: 1. Codon
                     Adaptation Index (CAI): 0.803. Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034307.1"
                     /db_xref="GeneID:4806979"
                     /translation="MAKKIKDVNGKVYVQKNPFYKKWWFILIVILIGYGAIKGGETST
                     ESPQTTSSSEKSEVVKASSSTEEASSVETSSEDKVEVNYKIGDLVKVGDVEYIVNSKT
                     TAQNIGGEFGKNANGTYLILNVTVKNNGSKSITVTDSFFTLLKGKAEYEADSTAGVYA
                     NEDTKFFLTDLNPENTVTGNVVFDLNPETANDPNLQLQVQTGYWGTQKGIINLN"
     misc_feature    293805..294182
                     /locus_tag="SSA_0300"
                     /note="Domain of unknown function (DUF4352); Region:
                     DUF4352; pfam11611"
                     /db_xref="CDD:288464"
     gene            294238..294813
                     /locus_tag="SSA_0301"
                     /db_xref="GeneID:4807165"
     CDS             294238..294813
                     /locus_tag="SSA_0301"
                     /note="GC: 33.33%; Transmembrane domains: 1. Codon
                     Adaptation Index (CAI): 0.775. LipoP prediction: SpI.
                     SignalP prediction: Yes (prob. 1); Curator(s): P. Manque"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034308.1"
                     /db_xref="GeneID:4807165"
                     /translation="MKKKNINKISVILFAVVVFMVSGEIILSSAPVLANHKTEHVQLH
                     RKKKKKKNKKKQTPIYKIGETFKVGDVEYTINSKETAQNIGGEFGENANGTYLILNVT
                     VKNNGSKSITITDSFFKLLKGKAKYETDSAAGIFANEDGDFFYSDLNPENSVTGNVVF
                     DLNPETVSDPNLQLQVQTGYWGTQKGLVSIN"
     misc_feature    294415..294792
                     /locus_tag="SSA_0301"
                     /note="Domain of unknown function (DUF4352); Region:
                     DUF4352; pfam11611"
                     /db_xref="CDD:288464"
     gene            295030..296226
                     /gene="pgk"
                     /locus_tag="SSA_0302"
                     /db_xref="GeneID:4806895"
     CDS             295030..296226
                     /gene="pgk"
                     /locus_tag="SSA_0302"
                     /EC_number="2.7.2.3"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="Converts 3-phospho-D-glycerate to
                     3-phospho-D-glyceroyl phosphate during the glycolysis
                     pathway"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate kinase"
                     /protein_id="YP_001034309.1"
                     /db_xref="GeneID:4806895"
                     /translation="MAKLTVKDVDLKGKKVLVRVDFNVPLKDGVITNDNRITAALPTI
                     KYIIEQGGRAILFSHLGRVKEEADKEGKSLAPVAADLAAKLGQDVVFPGVTRGAELEA
                     AINALEDGQVLLVENTRFEDVDGKKESKNDPELGKYWASLGDGIFVNDAFGTAHRAHA
                     SNVGISGNVEKAVAGFLLENEIAYIQEAVETPERPFVAILGGSKVSDKIGVIENLLEK
                     ADKVLIGGGMTYTFYKAQGIEIGNSLVEEDKLDVAKALLEKANGKLVLPVDSKEANAF
                     ADYTEVKDTEGEAVDPGFLGLDIGPKSIAKFDEALTGAKTVVWNGPMGVFENPDFQAG
                     TIGVMDAIVKQPGVKSIIGGGDSAAAAINLGRADKFSWISTGGGASMELLEGKVLPGL
                     AALTEK"
     misc_feature    295036..296220
                     /gene="pgk"
                     /locus_tag="SSA_0302"
                     /note="phosphoglycerate kinase; Provisional; Region: pgk;
                     PRK00073"
                     /db_xref="CDD:234613"
     misc_feature    order(295090..295092,295096..295098,295135..295137,
                     295204..295206,295384..295386)
                     /gene="pgk"
                     /locus_tag="SSA_0302"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238195"
     misc_feature    order(295594..295605,296146..296154)
                     /gene="pgk"
                     /locus_tag="SSA_0302"
                     /note="hinge regions; other site"
                     /db_xref="CDD:238195"
     misc_feature    order(295708..295710,295915..295917,295987..295989,
                     295993..295995,295999..296010,296092..296100)
                     /gene="pgk"
                     /locus_tag="SSA_0302"
                     /note="ADP binding site [chemical binding]; other site"
                     /db_xref="CDD:238195"
     misc_feature    296095..296097
                     /gene="pgk"
                     /locus_tag="SSA_0302"
                     /note="catalytic site [active]"
                     /db_xref="CDD:238195"
     gene            296591..301111
                     /gene="sspC"
                     /locus_tag="SSA_0303"
                     /db_xref="GeneID:4807391"
     CDS             296591..301111
                     /gene="sspC"
                     /locus_tag="SSA_0303"
                     /function="Cell division and chromosome partitioning"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="Streptococcal surface protein C; GC: 44.59%; Codon
                     Adaptation Index (CAI): 0.792. LipoP prediction: SpI.
                     SignalP prediction: Yes (prob. 1); Curator(s): P. Manque,
                     T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="surface protein C"
                     /protein_id="YP_001034310.1"
                     /db_xref="GeneID:4807391"
                     /translation="MKKKEVFGFRKNKAVKTLCGAVLGAAFLTSTMQVRADEVVTDTN
                     GPVNTEMVGTGNAATNLPQAQGPASQASKESQAQAGQADGGVTVTVPTAGLDESAKKA
                     QEAGLTVVKDPAVDKGVAQTDQDTADKKAEIAADYQAQVTEIDAKVKEYKEKVSAYEA
                     EVVRITAENKATAEQYAKDLVAHQAEVARITAENAQLKADYEAALSKYKTDLAMVQKT
                     NAENTAAYQAAKAAYDAELARVQKLNAETKANYDVALAAYASELDRVQKANAAAKARY
                     EKALADTEAANAKIAADNEAIKQRNAAAKAAYEAALAQYQTDLATVRKTNTDNEAAYQ
                     AAQANYQAELARIQKENQDKKAQYEADLAAYEAKKTQIEAENAAAQKEYEQKLAENQA
                     KNATIAAENEEIKKRNAQAQANYQAQLAQYNADLAVYNTKLAKYQQDKAKYDAEQAKI
                     KAGLALAEAKKTEDGHLSRPIAQSLVFKSEPNADLSLTTTGEFVSYAGMEAAVKNTAE
                     FSKKLFQFDNFKVTDIQNANYQTNQQESFGTVGKYADYSSNVTSGKGPTEWSSVLLSR
                     GQSATATYTNLQGTYYRGKKVSKIVYTYTLDPSSQFRNDKAWLGIFKDPTMGVFASAY
                     TGNFEDATSLFVKTEFVFYDDKGQPINFDQALMSVASLNREANSIEMAKDYTGTFNKI
                     SGSSIGEKNGQIYATESENFKKGVGGSRFTMYKNAQPDSGWDTTDAPNSWYGAGAVEI
                     SGTTNSMTIGTISSSEVLGQPEATDPRRADKLAPKKPNIWFAINGDVRATDLPIITVE
                     EPEAPVAPTAPAVPSEEALKPLDPAPTAPTPKALPTPPAAPTYEKEPTPPTRTPDTPE
                     PSKPSEPSYEVEKAVRPAVVEPTYEKEPTPPAAPTYEKEPEAPTPTPDTPEPNKPVEP
                     TYSPLPTSPAEPVYQKEPAAPVAPTVRYHYHLLQSQPQINKEIQNDQGTNIDKTLVAK
                     QSVVQFALKTEALPAGRSETTSFVITDPLPSGYEVDLAATKAASAGFDISYDKASHTV
                     TFKANAATLATYNADTTKEVATLFPTVVGRVLNDGATYTNNFTLTVNDAYGVRSNVVR
                     VTTPGKPDDSDNPSNNYIKPTKVNKNKAGLVIDGKEVLAGSTNYYELTWDLDQYKGDK
                     SSKSTIQKGFYYVDDYPEEALELRPELVKLVDADGKAVAGVTVTHYESLETAPAAVRE
                     LLQKANITVKGSFQFFAADDAQAFYDQYVVTGKSLTITSPMAVKEGMGRTGGKFENKA
                     YQIDFGNGYATDVVVNNVPKISPEKDITLSLDPTSAENLDGKELTLGRHFNYRLIGGL
                     IPANHSEGLTDYSFVDDYDQRGDEYTGAYKTFAKVDITIKDGKVIKAGTDLTEYTAAN
                     VDLEKGLISIRFKEEFLETISLDSAFQAETYLQMKRIAAGTFENTYINTVNHVVYASN
                     TVTTVTPKAQHLLVSDVNDPRRANPTSAAKKIPVSLLPETGAKDAVYLPYLGLAAIIG
                     ALGLGKLKGKED"
     misc_feature    296609..296704
                     /gene="sspC"
                     /locus_tag="SSA_0303"
                     /note="putative cross-wall-targeting lipoprotein signal;
                     Region: strep_RK_lipo; TIGR03726"
                     /db_xref="CDD:274751"
     misc_feature    296957..>297229
                     /gene="sspC"
                     /locus_tag="SSA_0303"
                     /note="Hyaluronan mediated motility receptor C-terminal;
                     Region: HMMR_C; pfam15908"
                     /db_xref="CDD:292530"
     misc_feature    297962..298942
                     /gene="sspC"
                     /locus_tag="SSA_0303"
                     /note="Glucan-binding protein C; Region: GbpC; pfam08363"
                     /db_xref="CDD:285552"
     misc_feature    299453..299842
                     /gene="sspC"
                     /locus_tag="SSA_0303"
                     /note="Cell surface antigen C-terminus; Region: Antigen_C;
                     pfam16364"
                     /db_xref="CDD:292974"
     misc_feature    299912..300433
                     /gene="sspC"
                     /locus_tag="SSA_0303"
                     /note="adhesin isopeptide-forming domain, sspB-C2 type;
                     Region: isopep_sspB_C2; TIGR04228"
                     /db_xref="CDD:275068"
     misc_feature    300443..300895
                     /gene="sspC"
                     /locus_tag="SSA_0303"
                     /note="Cell surface antigen C-terminus; Region: Antigen_C;
                     pfam16364"
                     /db_xref="CDD:292974"
     misc_feature    <301007..301096
                     /gene="sspC"
                     /locus_tag="SSA_0303"
                     /note="Gram positive anchor; Region: Gram_pos_anchor;
                     pfam00746"
                     /db_xref="CDD:279132"
     gene            301283..301948
                     /locus_tag="SSA_0304"
                     /db_xref="GeneID:4807396"
     CDS             301283..301948
                     /locus_tag="SSA_0304"
                     /function="General function prediction only"
                     /note="GC: 42.94%; Codon Adaptation Index (CAI): 0.819.
                     LipoP prediction: SpI. SignalP prediction: Yes (prob. 1);
                     Curator(s): T. Kitten, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="cell wall degradation protein"
                     /protein_id="YP_001034311.1"
                     /db_xref="GeneID:4807396"
                     /translation="MKKTFAKATLGLTSTAFLATIGAQAVHADSYVVQQGDSFFAIAS
                     ANGMNPYELAANNGKTIFDTINPGDVLQVNGTALAQTYNPYSAPAYEATSDAALVSDT
                     EDVVLNTPTDYGNSYPIGQCTWGVKEMAPWASNWWGNANTWAINAGAQGYATGNVPVP
                     GAIAVWDGGEYGHVAYVTDVQSDSSIQVLEANYNRQKQINNYRGYFNPNEFMGGVTYI
                     YPN"
     misc_feature    301370..301501
                     /locus_tag="SSA_0304"
                     /note="Lysine Motif is a small domain involved in binding
                     peptidoglycan; Region: LysM; cd00118"
                     /db_xref="CDD:212030"
     misc_feature    301418..301942
                     /locus_tag="SSA_0304"
                     /note="Surface antigen [Cell wall/membrane/envelope
                     biogenesis]; Region: COG3942"
                     /db_xref="CDD:226451"
     misc_feature    301619..301858
                     /locus_tag="SSA_0304"
                     /note="CHAP domain; Region: CHAP; pfam05257"
                     /db_xref="CDD:283032"
     gene            302125..302649
                     /locus_tag="SSA_0305"
                     /db_xref="GeneID:4807243"
     CDS             302125..302649
                     /locus_tag="SSA_0305"
                     /function="Function unknown"
                     /note="GC: 42.67%; Transmembrane domains: 4. Codon
                     Adaptation Index (CAI): 0.777. SignalP prediction: Yes
                     (prob. 0.963); Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034312.1"
                     /db_xref="GeneID:4807243"
                     /translation="MSYFNKYKFDKSKFRLGMRTFKTGLAVFIILLLFGLFGWKGLQI
                     GALTAVFSLREDFDKSVHFGTSRILGNSIGGFYALLFFIANSVFKEQYWVTLLLVPVC
                     TMLTIMTNVAMNNKAGVIGGVSAMLIITLSIRPEDTILYVFARIFETFMGVFVAILVN
                     SDIDRLRTIFEKKK"
     misc_feature    302146..>302646
                     /locus_tag="SSA_0305"
                     /note="Uncharacterized membrane protein YgaE,
                     UPF0421/DUF939 family [Function unknown]; Region: YgaE;
                     COG4129"
                     /db_xref="CDD:226614"
     gene            302730..303095
                     /gene="glnR"
                     /locus_tag="SSA_0306"
                     /db_xref="GeneID:4808089"
     CDS             302730..303095
                     /gene="glnR"
                     /locus_tag="SSA_0306"
                     /function="Transcription"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 43.99%; Codon Adaptation Index (CAI): 0.836.
                     Curator(s): T. Kitten, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription regulator (glutamine synthetase
                     repressor)"
                     /protein_id="YP_001034313.1"
                     /db_xref="GeneID:4808089"
                     /translation="MKEKEFRRNMAVFPIGSVMKLTDLSARQIRYYEDQNLITPARNE
                     GNRRMYSLNDMDRLLEIKDYISEGYNIAAIKRKYAEREAKSHKTISEKDVRRALHHDI
                     LQQGRFASSLPTFGQMRRP"
     misc_feature    302763..303044
                     /gene="glnR"
                     /locus_tag="SSA_0306"
                     /note="Helix-Turn-Helix DNA binding domain of GlnR-like
                     transcription regulators; Region: HTH_GlnR-like; cd01105"
                     /db_xref="CDD:133380"
     misc_feature    order(302769..302777,302817..302819,302868..302873)
                     /gene="glnR"
                     /locus_tag="SSA_0306"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:133380"
     misc_feature    order(302907..302909,302916..302918,302928..302933,
                     302958..302960,302967..302969,302979..302981,
                     303018..303020,303030..303032,303039..303044)
                     /gene="glnR"
                     /locus_tag="SSA_0306"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:133380"
     gene            303127..304473
                     /gene="glnA"
                     /locus_tag="SSA_0307"
                     /db_xref="GeneID:4807442"
     CDS             303127..304473
                     /gene="glnA"
                     /locus_tag="SSA_0307"
                     /EC_number="6.3.1.2"
                     /function="General function prediction only"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 45.06%; Codon Adaptation Index (CAI): 0.803.
                     Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine synthetase"
                     /protein_id="YP_001034314.1"
                     /db_xref="GeneID:4807442"
                     /translation="MSITAADIRREVKEKNVTFIRLMFSDILGTMKNVEIPATDEQLD
                     KVLSNKAMFDGSSIEGFVRINESDMYLYPDLDTWTVFPWGDENGSVAGLICDVYTTDH
                     VPFLGDPRSNLKRALKHMEELGFKSFNLGPEPEFFLFKLDENGDPTLEVNDKGGYFDL
                     APTDLADNTRREIVNVLTKMGFEVEASHHEVAVGQHEIDFKYDEVLRACDKIQIFKLV
                     VKTIARKHGLYATFMAKPKFGIAGSGMHCNMSLFDQDGNNAFFDPEDPKGMQLSEIAY
                     HFLGGLINHAYNYTAIMNPTVNSYKRLVPGYEAPVYIAWAGRNRSPLVRVPASRGMGT
                     RLELRSVDPMANPYIAMAVLLEVGLHGVENKIEAPAPIEENIYIMTPEERKEAGITDL
                     PSTLHNALKALTEDEVVKAALGEHIYTSFLEAKRIEWASYATFVSQWEVDNYLDLY"
     misc_feature    303136..304467
                     /gene="glnA"
                     /locus_tag="SSA_0307"
                     /note="Glutamine synthetase [Amino acid transport and
                     metabolism]; Region: GlnA; COG0174"
                     /db_xref="CDD:223252"
     gene            304525..304944
                     /locus_tag="SSA_0308"
                     /db_xref="GeneID:4807363"
     CDS             304525..304944
                     /locus_tag="SSA_0308"
                     /function="General function prediction only"
                     /note="GC: 39.76%; Codon Adaptation Index (CAI): 0.787.
                     Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034315.1"
                     /db_xref="GeneID:4807363"
                     /translation="MEEFHDFIKRVFDEQYEACFGSGMLEKLEPQDYYLRREEDGQLI
                     ALLHAQQVLANIHIKALVVDKEHQKKGLGASLLAELEEKAAEVGATSITLSTKSYQAK
                     DFYIKQGYEIYASLTDVPQKGITKYHFIKRLNEAILK"
     misc_feature    304636..304857
                     /locus_tag="SSA_0308"
                     /note="Acetyltransferase (GNAT) family; Region:
                     Acetyltransf_1; pfam00583"
                     /db_xref="CDD:278980"
     misc_feature    order(304705..304713,304741..304746)
                     /locus_tag="SSA_0308"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            305034..305453
                     /locus_tag="SSA_0309"
                     /db_xref="GeneID:4807942"
     CDS             305034..305453
                     /locus_tag="SSA_0309"
                     /note="GC: 39.76%; Codon Adaptation Index (CAI): 0.787.
                     Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase/bleomycin resistance
                     protein/dioxygenase"
                     /protein_id="YP_001034316.1"
                     /db_xref="GeneID:4807942"
                     /translation="MITSLYPVLMSEDVHQAAQFFIDHFQFQESFRSDWYISLKNIES
                     GFELAFIDSKHGTVPQAYQSKASGLIINIEVDNVDCFYEELRQQEEMEFLLPIKSEDF
                     GQRHFIVEAPGSVLVDVIQVIPPNAEFAANYLESEDE"
     misc_feature    305040..305396
                     /locus_tag="SSA_0309"
                     /note="This conserved domain belongs to a superfamily
                     including the bleomycin resistance protein, glyoxalase I,
                     and type I ring-cleaving dioxygenases; Region:
                     Glo_EDI_BRP_like_22; cd08359"
                     /db_xref="CDD:176707"
     misc_feature    order(305040..305063,305172..305177,305184..305186,
                     305226..305255,305313..305315,305379..305381)
                     /locus_tag="SSA_0309"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:176707"
     gene            305446..306033
                     /locus_tag="SSA_0310"
                     /db_xref="GeneID:4807941"
     CDS             305446..306033
                     /locus_tag="SSA_0310"
                     /function="Transcription"
                     /note="GC: 40.14%; Codon Adaptation Index (CAI): 0.782.
                     Helix-turn-helix prediction: AraC. Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034317.1"
                     /db_xref="GeneID:4807941"
                     /translation="MNKKQQASLETSKKILAIARKHFSLKGFSETSLEEIVDELGMTR
                     GALYHHFGNKKTLFTAVLAQIQSELGSYVEKNALEAQDSWEQLVEGCVAFVRFATLTE
                     NKRILLLDGPNVVEWKEWRRQDEANSFFHLREQLDILSKEGRLISIDLDMAAHMISGA
                     LNELSLFLAEKEEEAEVRGAVRSLLRGFKNHGEKG"
     misc_feature    305446..306027
                     /locus_tag="SSA_0310"
                     /note="DNA-binding transcriptional regulator, AcrR family
                     [Transcription]; Region: AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    305488..305628
                     /locus_tag="SSA_0310"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:278848"
     gene            306017..306763
                     /locus_tag="SSA_0311"
                     /db_xref="GeneID:4807574"
     CDS             306017..306763
                     /locus_tag="SSA_0311"
                     /function="DNA replication, recombination, and repair"
                     /note="GC: 41.63%; Codon Adaptation Index (CAI): 0.798.
                     Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034318.1"
                     /db_xref="GeneID:4807574"
                     /translation="MAKKVKDYYDLVHAEDLSRRLQTVTDKFDAQHFISLVESELEAL
                     EFTQRQELLAKSIKECLPFSYADSLKVFEQILGPELEGGLGMFSEGYWLWPIGKYVEL
                     YGGQEFELSAAFSKELTKRFTGEFSMRPLLANYPKATMDLLLEWSRDENMRVRRLASE
                     CMRIRLPWAKKQTVVLDYFDEFTTILRNLKDDADKSIQKSVANNLNDLYKEDPEKFEC
                     IIQAWQEEELSPSCAWIIKHASRTKNKAEK"
     misc_feature    306314..306742
                     /locus_tag="SSA_0311"
                     /note="3-methyladenine DNA glycosylase AlkC [Replication,
                     recombination and repair]; Region: AlkC; COG4335"
                     /db_xref="CDD:226785"
     gene            complement(306793..308475)
                     /locus_tag="SSA_0312"
                     /db_xref="GeneID:4807965"
     CDS             complement(306793..308475)
                     /locus_tag="SSA_0312"
                     /function="General function prediction only"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /GO_function="GO:0005554 - molecular function unknown"
                     /note="GC: 48.9%; Codon Adaptation Index (CAI): 0.773.
                     Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="metallo-beta-lactamase superfamily hydrolase"
                     /protein_id="YP_001034319.1"
                     /db_xref="GeneID:4807965"
                     /translation="MAYTLKPKEVGVFAIGGLGEIGKNTYGIEYQNEIIIVDAGIKFP
                     EDDLLGIDYVIPDYSYIVENIDRVKAVLITHGHEDHIGGIPFLLKQANVPIYAGPLAL
                     ALIRGKLEEHGLLRDAKLYEINQHTELQFKHLKATFFRTTHSIPEPLGIVIHTPQGKI
                     VCTGDFKFDFTPVGEPADLHRMAALGEEGVLCLLSDSTNAEVPTFTNSEKVVGQSIMK
                     IIEGIHGRIIFASFASNIFRLQQAADAAVKTGRKIAVFGRSMEKAIVNGIELGYIKVP
                     KDTFIEPNELKDYPAGEVLIMCTGSQGEPMAALSRIANGTHRQVQLQPGDTVIFSSSP
                     IPGNTTSVNKLINIISEAGVEVIHGKINNIHTSGHGGQQEQKLMLRLIKPKYFMPVHG
                     EYRMQKVHAGLAVDTGVPKDNIFIMSNGDVLALTANSARIAGSFNAQDIYVDGNRIGE
                     IGAAVLRDRKDLSEDGVVLAVATVDFESKMILAGPDILSRGFIYMRESGDLIRQSQRI
                     LFNAIRIALKNKDASVQSVSGAIVNALRPFLYESTEREPIIIPMVLTPDEEN"
     misc_feature    complement(306814..308463)
                     /locus_tag="SSA_0312"
                     /note="mRNA degradation ribonuclease J1/J2 [Translation,
                     ribosomal structure and biogenesis]; Region: RnjA;
                     COG0595"
                     /db_xref="CDD:223668"
     misc_feature    complement(307201..308439)
                     /locus_tag="SSA_0312"
                     /note="RNAaseJ, MBL-fold metallo-hydrolase domain; Region:
                     RNaseJ_MBL-fold; cd07714"
                     /db_xref="CDD:293800"
     misc_feature    complement(order(307303..307305,307885..307887,
                     307981..307983,308044..308049,308236..308247,
                     308251..308253,308353..308355))
                     /locus_tag="SSA_0312"
                     /note="active site"
                     /db_xref="CDD:293800"
     misc_feature    complement(order(307303..307305,307981..307983,
                     308047..308049,308236..308241,308245..308247,
                     308251..308253))
                     /locus_tag="SSA_0312"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:293800"
     misc_feature    complement(order(307981..307983,308047..308049,
                     308245..308247,308251..308253))
                     /locus_tag="SSA_0312"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:293800"
     misc_feature    complement(order(307303..307305,307981..307983,
                     308236..308241))
                     /locus_tag="SSA_0312"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:293800"
     gene            complement(308479..308709)
                     /locus_tag="SSA_0313"
                     /db_xref="GeneID:4807845"
     CDS             complement(308479..308709)
                     /locus_tag="SSA_0313"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 41.13%; Codon Adaptation Index (CAI): 0.813.
                     Highly conserved, but so far Firmicutes specific.
                     Curator(s): T. Kitten, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034320.1"
                     /db_xref="GeneID:4807845"
                     /translation="MIYKVFYQETKERSPRREKTRALYLEIEAANELEGRIQARKLIE
                     ENTPYNIEFIELLSDKHLEYEKESGTFELTEF"
     misc_feature    complement(308482..308709)
                     /locus_tag="SSA_0313"
                     /note="hypothetical protein; Provisional; Region:
                     PRK13667"
                     /db_xref="CDD:184224"
     gene            complement(309057..310109)
                     /gene="wcaG"
                     /locus_tag="SSA_0314"
                     /db_xref="GeneID:4808061"
     CDS             complement(309057..310109)
                     /gene="wcaG"
                     /locus_tag="SSA_0314"
                     /EC_number="1.1.1.219"
                     /function="Cell envelope biogenesis, outer membrane /
                     Carbohydrate transport and metabolism"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 46.82%; Codon Adaptation Index (CAI): 0.766.
                     Curator(s): T. Kitten, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside-diphosphate-sugar epimerase"
                     /protein_id="YP_001034321.1"
                     /db_xref="GeneID:4808061"
                     /translation="MTPNPTNQKPARTMTHAFVTGATGLLGNNLVRALLKENIQVTAL
                     VRSEEKARKQFADLPIQIVKGDILEPESYRDYLAGCDSLFHTAAFFRDNYKGGKHWQE
                     LYDTNIIGTNNLLEAAYEAGIRQFVHTSSCVVLEGEANQLIDESMSRSKDTPFDYYRS
                     KILSEEAVRDFLDKHSDVFGCFILPSVMLGPRDLGPTSSGQMIINFVEQKLPGILKAS
                     YNMVDARDVADIHLRAMKYGRSKERYLAVGRQVTMTELYQILEKITGVPAPKRKISPL
                     FVKIYAQASELYHRLTKKPILVTNELAHLMAEEYLKSNFSFAKTESELGGQHRPLEES
                     LADVVDWYRKHGYFAK"
     misc_feature    complement(309069..310061)
                     /gene="wcaG"
                     /locus_tag="SSA_0314"
                     /note="hopanoid-associated sugar epimerase; Region: HpnA;
                     TIGR03466"
                     /db_xref="CDD:163279"
     misc_feature    complement(309084..310061)
                     /gene="wcaG"
                     /locus_tag="SSA_0314"
                     /note="uncharacterized subgroup of aldehyde reductase and
                     flavonoid reductase related proteins, extended (e) SDRs;
                     Region: AR_FR_like_1_SDR_e; cd05228"
                     /db_xref="CDD:187539"
     misc_feature    complement(order(309546..309557,309627..309629,
                     309639..309641,309720..309725,309840..309854,
                     309972..309974,310032..310043,310047..310049))
                     /gene="wcaG"
                     /locus_tag="SSA_0314"
                     /note="putative NADP binding site [chemical binding];
                     other site"
                     /db_xref="CDD:187539"
     misc_feature    complement(order(309249..309251,309453..309455,
                     309471..309473,309531..309533,309549..309557,
                     309639..309641,309702..309704,309711..309719,
                     309834..309836,309840..309842))
                     /gene="wcaG"
                     /locus_tag="SSA_0314"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:187539"
     misc_feature    complement(order(309627..309629,309639..309641,
                     309717..309719,309789..309791))
                     /gene="wcaG"
                     /locus_tag="SSA_0314"
                     /note="active site"
                     /db_xref="CDD:187539"
     gene            310242..310706
                     /locus_tag="SSA_0315"
                     /db_xref="GeneID:4807643"
     CDS             310242..310706
                     /locus_tag="SSA_0315"
                     /function="Transcription"
                     /note="GC: 46.45%; Codon Adaptation Index (CAI): 0.774.
                     Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="YP_001034322.1"
                     /db_xref="GeneID:4807643"
                     /translation="MVAEGIRFGYLFRSAESLATREYGKLLEPLGITPNQSEVLLVLG
                     EHAPLSLKGLGESLICEEKSPSRLVQALIKKGLVKKEISSKDKRSSRLSLTAAGADLL
                     PKIAEQEAIFGKHLAQQVPNLEAFSQILEEFLVDSFYEDKLKRRSLWRQEEK"
     misc_feature    310320..310565
                     /locus_tag="SSA_0315"
                     /note="helix_turn_helix multiple antibiotic resistance
                     protein; Region: HTH_MARR; cl28354"
                     /db_xref="CDD:333174"
     gene            310716..311402
                     /locus_tag="SSA_0316"
                     /db_xref="GeneID:4805936"
     CDS             310716..311402
                     /locus_tag="SSA_0316"
                     /function="Posttranslational modification, protein
                     turnover, chaperones"
                     /note="GC: 50.95%; Codon Adaptation Index (CAI): 0.767.
                     Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034323.1"
                     /db_xref="GeneID:4805936"
                     /translation="MKIAAFDTSSKALTLAILEDETLLAQMTLNIKKNHSITLMPAID
                     FLMNSLDMKPTDLDRIVVAQGPGSYTGLRMAVATAKTLAHTLKIELVGVSSLLALVPE
                     QVEGLVIPVMDARRNNVYAGFYQSGQAVRPEAHLPLAEVLEIADAANQPVTFAGETAA
                     FAEQIEAALPQAAIQSTLPDAVAVGRLGLDLPAQSIHDFVPNYLKRVEAEENWLKTHQ
                     ESSDSYIQRL"
     misc_feature    310728..311330
                     /locus_tag="SSA_0316"
                     /note="tRNA threonylcarbamoyl adenosine modification
                     protein YeaZ; Region: T6A_YeaZ; TIGR03725"
                     /db_xref="CDD:274750"
     misc_feature    310812..311354
                     /locus_tag="SSA_0316"
                     /note="Glycoprotease family; Region: Peptidase_M22;
                     pfam00814"
                     /db_xref="CDD:279191"
     gene            311399..311851
                     /gene="rimI"
                     /locus_tag="SSA_0317"
                     /db_xref="GeneID:4805931"
     CDS             311399..311851
                     /gene="rimI"
                     /locus_tag="SSA_0317"
                     /EC_number="2.3.1.128"
                     /function="General function prediction only"
                     /note="GC: 47.46%; Codon Adaptation Index (CAI): 0.741.
                     Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein alanine acetyl transferase"
                     /protein_id="YP_001034324.1"
                     /db_xref="GeneID:4805931"
                     /translation="MITMRKWSDSSDMDAATLAKELEQLLLAVYEVSPWTAGQVEEVL
                     RSDVNSCALAEDENRLVAFLVWQETDFEAEVLQIAVLPSYQGQKIATALFAFLPADKE
                     IFLEVRESNKPALLFYKKEKFEEIARRKAYYHAPVEDAIVMKREIHER"
     misc_feature    311429..311827
                     /gene="rimI"
                     /locus_tag="SSA_0317"
                     /note="N-Acyltransferase superfamily: Various enyzmes that
                     characteristicly catalyze the transfer of an acyl group to
                     a substrate; Region: NAT_SF; cl17182"
                     /db_xref="CDD:302625"
     misc_feature    311480..311827
                     /gene="rimI"
                     /locus_tag="SSA_0317"
                     /note="ribosomal-protein-alanine acetyltransferase;
                     Region: rimI; TIGR01575"
                     /db_xref="CDD:273701"
     misc_feature    order(311630..311638,311666..311671)
                     /gene="rimI"
                     /locus_tag="SSA_0317"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            311841..312851
                     /gene="gcp"
                     /locus_tag="SSA_0318"
                     /db_xref="GeneID:4807667"
     CDS             311841..312851
                     /gene="gcp"
                     /locus_tag="SSA_0318"
                     /EC_number="3.4.24.57"
                     /function="Posttranslational modification, protein
                     turnover, chaperones"
                     /note="in most organisms, only the N-terminal domain is
                     present in a single polypeptide; in some archaea this
                     domain is fused to a kinase domain; this gene is essential
                     for growth in Escherichia coli and Bacillus subtilis; the
                     secreted glycoprotease from Pasteurella haemolytica showed
                     specificity for O-sialoglycosylated proteins; the
                     Pyrococcus structure shows DNA-binding properties,
                     iron-binding, ATP-binding, and AP endonuclease activity"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding/iron metalloprotein/AP endonuclease"
                     /protein_id="YP_001034325.1"
                     /db_xref="GeneID:4807667"
                     /translation="MKDRYILAFETSCDETSVAVLKNETELLSNVIASQIESHKRFGG
                     VVPEVASRHHVEVITVCIEEALAEAGISEEQVTAVAVTYGPGLVGALLVGLAAAKSFA
                     WAHDIPLIPVNHMAGHLMAAQSVEPLEFPLLALLVSGGHTELVYVSQAGDYKIVGETR
                     DDAVGEAYDKVGRVMGLTYPAGREIDLLAHEGQDIYDFPRAMIKEDNLEFSFSGLKSA
                     FINLHHNAQQKGEVLSNQDLSASFQAAVMDILMAKTKKALEKYPVKTLVVAGGVAANQ
                     GLRERLAAEIQDVKVIIPPLRLCGDNAGMIAYASVSEWNKENFASLDLNAKPSLAFET
                     ME"
     misc_feature    311853..312845
                     /gene="gcp"
                     /locus_tag="SSA_0318"
                     /note="UGMP family protein; Validated; Region: PRK09604"
                     /db_xref="CDD:236585"
     misc_feature    311856..>312209
                     /gene="gcp"
                     /locus_tag="SSA_0318"
                     /note="Carbamoyltransferase N-terminus; Region:
                     Carbam_trans_N; cl22532"
                     /db_xref="CDD:304575"
     misc_feature    <312132..312767
                     /gene="gcp"
                     /locus_tag="SSA_0318"
                     /note="Carbamoyltransferase N-terminus; Region:
                     Carbam_trans_N; cl22532"
                     /db_xref="CDD:304575"
     gene            312861..313556
                     /locus_tag="SSA_0319"
                     /db_xref="GeneID:4805900"
     CDS             312861..313556
                     /locus_tag="SSA_0319"
                     /function="Amino acid transport and metabolism"
                     /note="GC: 46.7%; Transporter classification
                     TC:2.A.78.1.2. Transmembrane domains: 6. Codon Adaptation
                     Index (CAI): 0.761. Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid permease"
                     /protein_id="YP_001034326.1"
                     /db_xref="GeneID:4805900"
                     /translation="MRGQTFKQGAQAAVPTALGYIGIGLACGIMASPYMNPLEMGLMS
                     VLVYAGSAQFAMIGLFAQQAPVLAIALTVFLINIRHLLLCLHASTFFRKSNLMQNIVI
                     GSFLTDESYGVLMGEQVHTKEIAASWMMGNNFMSYASWIVGTVFGTDLGALLPNPESF
                     GLDFALVSMFIGIFSSQFTIMLRRVKIKKLFLVLGVVGLAYLVLTMLLQNSLAVLFAT
                     LLGCTVGVLLDDK"
     misc_feature    312870..313538
                     /locus_tag="SSA_0319"
                     /note="Predicted branched-chain amino acid permease
                     (azaleucine resistance) [Amino acid transport and
                     metabolism]; Region: AzlC; COG1296"
                     /db_xref="CDD:224215"
     gene            313546..313884
                     /locus_tag="SSA_0320"
                     /db_xref="GeneID:4806285"
     CDS             313546..313884
                     /locus_tag="SSA_0320"
                     /function="Function unknown"
                     /note="GC: 41.89%; Transmembrane domains: 3. Codon
                     Adaptation Index (CAI): 0.768. SignalP prediction: Yes
                     (prob. 0.536); Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034327.1"
                     /db_xref="GeneID:4806285"
                     /translation="MISKYILLAILLSALVTWIPRILPFILVKYKGLPPMAERFLKYL
                     PVSIIFALILSSVTNAKTGQLPSFKWLDLIVVFPTSYVAFKYKNLIATVVFGVVLVAL
                     LRYLTGFLGL"
     misc_feature    313546..313860
                     /locus_tag="SSA_0320"
                     /note="Branched-chain amino acid transport protein [Amino
                     acid transport and metabolism]; Region: AzlD2; COG4392"
                     /db_xref="CDD:226827"
     gene            314007..314753
                     /gene="ubiE"
                     /locus_tag="SSA_0321"
                     /db_xref="GeneID:4806208"
     CDS             314007..314753
                     /gene="ubiE"
                     /locus_tag="SSA_0321"
                     /function="Coenzyme metabolism"
                     /GO_function="GO:0008757 - S-adenosylmethionine-dependent
                     methyltransferase activity"
                     /GO_function="GO:0016740 - transferase activity"
                     /note="GC: 44.44%; Codon Adaptation Index (CAI): 0.81.
                     Possibly involved in ubiquinone/ menaquinone biosynthesis.
                     Curator(s): T. Kitten, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="methylase"
                     /protein_id="YP_001034328.1"
                     /db_xref="GeneID:4806208"
                     /translation="MAEAGHKFLAKLGKKRLRPGGKLATDWLIEQGQFSSDKKVLEVA
                     CNMGTTTIELAKKYGCQITAVDLDKAALAQAKLNGDKAGVSELVTFEQANAMKLPYDD
                     NSFDIVINEAMLTMQTDKRKAKCMDEYYRVLKPGGVLLTHDVMLKQRDENIREELSRA
                     INVNVGPLTEGSWIQLARSHAFDRVDTFVGEMTLMSLRGMIYDEGLGGTLKICFNALK
                     KENYGQFMKMFKMFQKNQEKLGFIAMVSRK"
     misc_feature    314127..314426
                     /gene="ubiE"
                     /locus_tag="SSA_0321"
                     /note="Methyltransferase domain; Region: Methyltransf_11;
                     pfam08241"
                     /db_xref="CDD:285453"
     misc_feature    order(314133..314153,314202..314207,314283..314291,
                     314337..314339)
                     /gene="ubiE"
                     /locus_tag="SSA_0321"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     misc_feature    314286..314741
                     /gene="ubiE"
                     /locus_tag="SSA_0321"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cl17173"
                     /db_xref="CDD:302624"
     gene            314857..315594
                     /locus_tag="SSA_0322"
                     /db_xref="GeneID:4806455"
     CDS             314857..315594
                     /locus_tag="SSA_0322"
                     /function="Transcription"
                     /GO_process="GO:0006355 - regulation of transcription,
                     DNA-dependent"
                     /note="GC: 43.77%; Codon Adaptation Index (CAI): 0.79.
                     Helix-turn-helix prediction: AraC. Response to antibiotics
                     or oxygen radicals. Curator(s): T. Kitten, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="TipA family transcription regulator"
                     /protein_id="YP_001034329.1"
                     /db_xref="GeneID:4806455"
                     /translation="MYHIKEAAQLSGVSVKTLHHYDKIGLLVPAKSENGYRTYSQADL
                     ERLQVILYYKYLGFSLEKIAELLSQDEQALLPHLVRQLEYLQQERDRLDTLISTLQKT
                     IQDEKGERKMTMKEKFAGFTYEDNHKYHQEAVEEYGQEVMSEALVRQNGREEESAAAF
                     NQVFQSLAENMQQGLPIEAAENQEQAARLLQAIRTYGFDCSLQVFAHIGQGYVHNPEF
                     KKNIDQFGPGTAQYTADVIAVYVRTNA"
     misc_feature    314860..315165
                     /locus_tag="SSA_0322"
                     /note="Helix-Turn-Helix DNA binding domain of the
                     transcription regulators TipAL, Mta, and SkgA; Region:
                     HTH_TipAL-Mta; cd01106"
                     /db_xref="CDD:133381"
     misc_feature    order(314863..314871,314911..314913,314959..314967)
                     /locus_tag="SSA_0322"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:133381"
     misc_feature    314866..315180
                     /locus_tag="SSA_0322"
                     /note="Hg(II)-responsive transcriptional regulator;
                     Region: MerR; TIGR02051"
                     /db_xref="CDD:131106"
     misc_feature    order(315001..315003,315010..315012,315022..315027,
                     315052..315054,315088..315090,315100..315102,
                     315118..315120,315130..315132,315139..315144)
                     /locus_tag="SSA_0322"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:133381"
     misc_feature    315241..315576
                     /locus_tag="SSA_0322"
                     /note="TipAS antibiotic-recognition domain; Region: TipAS;
                     pfam07739"
                     /db_xref="CDD:285039"
     gene            complement(315714..316889)
                     /locus_tag="SSA_0323"
                     /db_xref="GeneID:4806440"
     CDS             complement(315714..316889)
                     /locus_tag="SSA_0323"
                     /function="General function prediction only"
                     /GO_function="GO:0016491 - oxidoreductase activity"
                     /note="GC: 50.26%; Codon Adaptation Index (CAI): 0.75.
                     Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="flavoprotein"
                     /protein_id="YP_001034330.1"
                     /db_xref="GeneID:4806440"
                     /translation="MKHFDTIIIGGGPAGMMAAISSSFYGQKTLLLEKNKRLGKKLAG
                     TGGGRCNVTNNGNLDDLMAGIPGNGRFLYSVFSQFDNHDIINFFTENGVKLKVEDHGR
                     VFPATDKSRTIIEALEKKIAELGGTVITNTEIVSVKKSDGLFTVRSSGQIWTCQKLIV
                     TTGGKSYPSTGSTGFGHDIARHFKHTVTDLEAAESPLLTDFPHKALQGISLDDVTLSY
                     GKHVITHDLLFTHFGLSGPAALRLSSFVKGGETIYLDLLPQMSQQALTDFLEEHREKS
                     LKNCLKILLPERMADFFAQPFPEKVKQLNLSEKEALIKQIKELATPVTGKMSLAKSFV
                     TKGGVSLKEINPKTLESKLVPGLHFAGEVLDINAHTGGFNITSALCTGWVAGSLHYE"
     misc_feature    complement(315729..316880)
                     /locus_tag="SSA_0323"
                     /note="HI0933-like protein; Region: HI0933_like;
                     pfam03486"
                     /db_xref="CDD:281484"
     misc_feature    complement(<316785..316880)
                     /locus_tag="SSA_0323"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl21454"
                     /db_xref="CDD:304358"
     misc_feature    complement(315732..316814)
                     /locus_tag="SSA_0323"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl21454"
                     /db_xref="CDD:304358"
     gene            317159..317653
                     /locus_tag="SSA_0324"
                     /db_xref="GeneID:4805805"
     CDS             317159..317653
                     /locus_tag="SSA_0324"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 46.87%; Codon Adaptation Index (CAI): 0.852.
                     Helix-turn-helix prediction: AraC. Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034331.1"
                     /db_xref="GeneID:4805805"
                     /translation="MAIEKTVSELAEILGVSRQAINNRVKALPPEDTEKNEKGVTVVT
                     RSGLIKLEEIYKKTIFEDEPVSEDVKQRELMEILVDEKNAEIVRLYEQLKAKDSQLAK
                     KDEQLRIKDVQIAEKDKQLDQQQQLTAKAMNERETLLLELDEAKEKVQEQESKGFWAR
                     LFGK"
     misc_feature    <317174..317299
                     /locus_tag="SSA_0324"
                     /note="Helix-turn-helix domains; Region: HTH; cl21459"
                     /db_xref="CDD:328727"
     gene            317743..319497
                     /gene="ugpQ"
                     /locus_tag="SSA_0325"
                     /db_xref="GeneID:4806128"
     CDS             317743..319497
                     /gene="ugpQ"
                     /locus_tag="SSA_0325"
                     /EC_number="3.1.4.46"
                     /function="Energy production and conversion"
                     /note="GC: 44.84%; Transmembrane domains: 7. Codon
                     Adaptation Index (CAI): 0.752. SignalP prediction: Yes
                     (prob. 0.982); Curator(s): T. Kitten, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane-anchored glycerophosphoryl diester
                     phosphodiesterase"
                     /protein_id="YP_001034332.1"
                     /db_xref="GeneID:4806128"
                     /translation="MKSQRLGLLRLYRNLDKILLLFFTVFMLMELAWVPFNSFAAETL
                     LKQTGYLFLSYTNALKVLTSNVWVGLAFLALFAANLFVAYFQIGLIFMGLRNLLDEEE
                     RSAFQFIKKSFKDSGSLIRYARPSKVLFIALYMGFIFPFLRQILKIYYLNKILIPEFI
                     VTYLKTALWMKLSIYALGFLLFLIAVRLMFALPKLFFEHFRLRDAIRYSLDKTKGHLI
                     RYTWQLFWILAKSFLFFLLSSIPILVLQQYADGQSNQIALTAAVVNYCLIKLAYYFMV
                     AYFLIKFVAFLTDSKLSEYRYRKGLPLMRWFILLVTSSVFALEGFAYLNLPLENVPLT
                     ISHRGVSQGNGVQNTVESLEKTALLKPDYIEMDVQETKDGQFVMMHDANLEALAGIDA
                     RPQELTLQELTALDISENGHTAKISSFDAYLKRANQMGQRLLIEIKTSSLDSDDMMDR
                     FLSQYGANIKVYGHQIQSLDYQVIDKTVQYDESIPTFFILPYNTIFPRTQASGYTMEY
                     STLDENFVDKLWTTDKQLYDWTINDADSIGKSFRLGVDGMITDDLELVQSSIKELQNN
                     PDYAVLLMSKAADLLNFV"
     misc_feature    317752..318672
                     /gene="ugpQ"
                     /locus_tag="SSA_0325"
                     /note="Membrane domain of glycerophosphoryl diester
                     phosphodiesterase; Region: GPDPase_memb; pfam10110"
                     /db_xref="CDD:287122"
     misc_feature    318736..319428
                     /gene="ugpQ"
                     /locus_tag="SSA_0325"
                     /note="Glycerophosphoryl diester phosphodiesterase [Lipid
                     transport and metabolism]; Region: UgpQ; COG0584"
                     /db_xref="CDD:223657"
     misc_feature    318742..319401
                     /gene="ugpQ"
                     /locus_tag="SSA_0325"
                     /note="Glycerophosphodiester phosphodiesterase domain of
                     uncharacterized bacterial glycerophosphodiester
                     phosphodiesterases; Region: GDPD_memb_like; cd08579"
                     /db_xref="CDD:176521"
     misc_feature    order(318751..318753,318835..318837,318841..318843,
                     318880..318882,319048..319050,319141..319143,
                     319327..319329)
                     /gene="ugpQ"
                     /locus_tag="SSA_0325"
                     /note="putative active site [active]"
                     /db_xref="CDD:176521"
     misc_feature    order(318751..318753,318880..318882)
                     /gene="ugpQ"
                     /locus_tag="SSA_0325"
                     /note="catalytic site [active]"
                     /db_xref="CDD:176521"
     misc_feature    order(318835..318837,318841..318843,319048..319050)
                     /gene="ugpQ"
                     /locus_tag="SSA_0325"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176521"
     gene            complement(319614..319913)
                     /locus_tag="SSA_0326"
                     /db_xref="GeneID:4806344"
     CDS             complement(319614..319913)
                     /locus_tag="SSA_0326"
                     /function="Function unknown"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /GO_function="GO:0005554 - molecular function unknown"
                     /note="GC: 44%; Codon Adaptation Index (CAI): 0.829.
                     Curator(s): T. Kitten, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034333.1"
                     /db_xref="GeneID:4806344"
                     /translation="MMNMQSMMKQAQKLQKQMEKGQAELAATEFTGKSAQDLVVAKLT
                     GDKKVVSIDFNPAVVDPEDLETLSEMTAQALNHALAQIDDATQKKMGAFAGKLPF"
     misc_feature    complement(319623..319913)
                     /locus_tag="SSA_0326"
                     /note="hypothetical protein; Validated; Region: PRK00153"
                     /db_xref="CDD:234669"
     gene            320119..320496
                     /locus_tag="SSA_0327"
                     /db_xref="GeneID:4805804"
     CDS             320119..320496
                     /locus_tag="SSA_0327"
                     /note="GC: 38.62%; Codon Adaptation Index (CAI): 0.797.
                     Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="YP_001034334.1"
                     /db_xref="GeneID:4805804"
                     /translation="MLSSLFILIGCSGSPKIQGKWNVQDASGEQKTIEIKDKTIIVNE
                     EEYEYTQNAVGFKNGVSYYGLTRKDNGGTFSIVFPEKDKNIAIMLIPDSNDDYLTGSM
                     LFAMNRKEKPDYKKYAEEYLNLQ"
     gene            complement(320577..322865)
                     /gene="pepXP"
                     /locus_tag="SSA_0328"
                     /db_xref="GeneID:4806593"
     CDS             complement(320577..322865)
                     /gene="pepXP"
                     /locus_tag="SSA_0328"
                     /EC_number="3.4.14.11"
                     /function="General function prediction only"
                     /note="catalyzes the removal of N-terminal dipeptides when
                     proline is the penultimate residue"
                     /codon_start=1
                     /transl_table=11
                     /product="x-prolyl-dipeptidyl aminopeptidase"
                     /protein_id="YP_001034335.1"
                     /db_xref="GeneID:4806593"
                     /translation="MRFNQYSYAKTKRENMLIELAELGFFYDSNRSDKENLEDFLRTS
                     FFTYKNTDYPLKSWAADSQTDLLSFFQSDRELTASVFYTVAFQLLEFSPFIDFTDVEA
                     FRQETDFPITFGDLLENLYQLLNTRTKNGNLLIDKLVSEGLIPEDNTHHCFNGKSLAT
                     FSSHDAIREVVYVESRVDTDQDGRPDLIKVSIIRPRYQGPVPAVMTASPYHQGTNDPA
                     SDKALHDMNVDLAKKEPHQITVQDPELKLLQLDSPVPAQEVSETEEKLGHIGTYTLND
                     YLLPRGFANLYVSGVGTKDSEGLMTSGDYQQIEAYKNVIDWLNGRCRAFTDHTRQREI
                     KATWSNGKVATTGISYLGTMSNGLATTGVDGLEVIIAEAGISSWYNYYRENGLVTSPG
                     GYPGEDFESLTELTYSRNLRAGDYLRNNDAYQQNLEQQRKDLDRQTGDYNQFWHDRNY
                     LLHADKVKAEVVFTHGSQDWNVKPLHVYNMFRALPPHIKKHLFFHNGAHVYMNNWQSI
                     DFRESINALLSKKLLGCESDFVLPAVIWQDNSQAQSWLTLEDFGGQEQNLHLQLGQDC
                     QSIQNQYSEEDYNRFAKNYQSFKTELFDGKVNQITLDWTLEKDLFLNGATQLNLRLKS
                     STDKGLISAQLLDFGLAKRHTPIPTPIEPRVMDNGRYYMLDNLVELPFAETPHRVITK
                     GFLNLQNRTNLLSVEEVTPDQWLEFSFELQPTIYKMKKGDQLRLVLYTTDFEHTVRDK
                     IDYQLTVDLEQSSLDLPTMTSH"
     misc_feature    complement(320586..322865)
                     /gene="pepXP"
                     /locus_tag="SSA_0328"
                     /note="x-prolyl-dipeptidyl aminopeptidase; Provisional;
                     Region: PRK05371"
                     /db_xref="CDD:235435"
     misc_feature    complement(322437..322865)
                     /gene="pepXP"
                     /locus_tag="SSA_0328"
                     /note="X-Prolyl dipeptidyl aminopeptidase PepX,
                     N-terminal; Region: PepX_N; smart00940"
                     /db_xref="CDD:198008"
     misc_feature    complement(321363..322322)
                     /gene="pepXP"
                     /locus_tag="SSA_0328"
                     /note="X-Pro dipeptidyl-peptidase (S15 family); Region:
                     Peptidase_S15; pfam02129"
                     /db_xref="CDD:280321"
     misc_feature    complement(320604..321272)
                     /gene="pepXP"
                     /locus_tag="SSA_0328"
                     /note="X-Pro dipeptidyl-peptidase C-terminal non-catalytic
                     domain; Region: PepX_C; smart00939"
                     /db_xref="CDD:214924"
     gene            322970..323875
                     /locus_tag="SSA_0329"
                     /db_xref="GeneID:4806537"
     CDS             322970..323875
                     /locus_tag="SSA_0329"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 45.81%; Transporter classification
                     TC:1.A.8.2.2. Transmembrane domains: 6. Codon Adaptation
                     Index (CAI): 0.795. Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol uptake facilitator/aquaporin protein"
                     /protein_id="YP_001034336.1"
                     /db_xref="GeneID:4806537"
                     /translation="MDFEWVVKYATEFLGTAILIVLGNGAVANVELKGTKGHQSGWLV
                     IAVGYGMGVMIPALMFGNVSGNHINPAFTLGLAVSGYFPWAQVAPYIAAQILGAIFGQ
                     ALVVATHRPYYLGTENPNNILGTFSTISSLDHGTPESRKAALFNGFINEFVGSFVLFF
                     AAMGLTKNFFGAELLSKAEATINSQAAQMAAQGTSVPKEQIAAAISQAKDQVAPFQVG
                     SLSVAHLALGFLVMALVTSLGGPTGPGLNPARDLGPRILHFILPESVLGKHKGDSKWW
                     YSWVPVVAPILAGITAVLLFKTIYG"
     misc_feature    322973..323872
                     /locus_tag="SSA_0329"
                     /note="Glycerol uptake facilitator and related aquaporins
                     (Major Intrinsic Protein Family) [Carbohydrate transport
                     and metabolism]; Region: GlpF; COG0580"
                     /db_xref="CDD:223653"
     misc_feature    order(323108..323110,323168..323176,323696..323701,
                     323708..323710,323717..323719)
                     /locus_tag="SSA_0329"
                     /note="amphipathic channel; other site"
                     /db_xref="CDD:238204"
     misc_feature    order(323174..323182,323708..323716)
                     /locus_tag="SSA_0329"
                     /note="Asn-Pro-Ala signature motifs; other site"
                     /db_xref="CDD:238204"
     gene            323939..325222
                     /locus_tag="SSA_0330"
                     /db_xref="GeneID:4807505"
     CDS             323939..325222
                     /locus_tag="SSA_0330"
                     /note="GC: 42.45%; Transmembrane domains: 6. Codon
                     Adaptation Index (CAI): 0.795. Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034337.1"
                     /db_xref="GeneID:4807505"
                     /translation="MEMQVSKYHKISGRRTLLFGFLALVFGLIIIVNGFRFTKLAFDF
                     ISLYLTVVGLVNIVLHVFTHKKEGAVWHSLLQIAVAMGISWLNRISDVPVNIVIISLG
                     SYQLLTAGIYGVTYLLYRQNHVKGGLRYLFDTVLYGGIGLTSILSPATDGHLQFLILG
                     IYLMMLGMSNIRDGLFFDNDREKHRLRRQIRINLPIIFAAFIPVENLEHFNRLIQGDA
                     ASNRKNVYNLVKSGDKKSDLEVLVHTSKTSLLGAIGHVDICYQGQVISYGSYDVFSER
                     CKGMIGDGVLFKVPKDVYIELCKKESKKTLFGYSLALTDKEKEAVEKRLAEIDQLLVE
                     WEPPAELKNGQPTYSYKLKHELGAQLYKFKTSRFKTYFVLSTNCCLLADSIIGQAGTD
                     ILDIRGIIAPGTYQSYLQYEFESARGLVIAQAVYQ"
     gene            325318..326052
                     /gene="cppA"
                     /locus_tag="SSA_0331"
                     /db_xref="GeneID:4807806"
     CDS             325318..326052
                     /gene="cppA"
                     /locus_tag="SSA_0331"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 42.45%; Codon Adaptation Index (CAI): 0.784.
                     Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="C3-degrading proteinase"
                     /protein_id="YP_001034338.1"
                     /db_xref="GeneID:4807806"
                     /translation="MSANHIIRIIPVLKINNRHLNQEFFVNQLGMKALLEEAAFLSLG
                     DQTKTEKLQLEESPSMRSRRVKGPKKLARIVVKVADAKEIESLLAQKPAWTKLYQGEK
                     GYAFEALSPEGDLVLLHAEENRTNLQEVAEAPEFEKQEDFIGLSQFEIETVEIRVPNA
                     NEAQEFYSKIENALDFLTFTEAEGQDLQADNALTWDLTMLKAQVNRLETAALRPIFEG
                     HEVFVPKSDKFLLSQDFSKIELWFEA"
     misc_feature    325342..325707
                     /gene="cppA"
                     /locus_tag="SSA_0331"
                     /note="This domain superfamily is found in a variety of
                     structurally related metalloproteins, including the type I
                     extradiol dioxygenases, glyoxalase I and a group of
                     antibiotic resistance proteins; Region: Glo_EDI_BRP_like;
                     cl14632"
                     /db_xref="CDD:301325"
     misc_feature    325768..326043
                     /gene="cppA"
                     /locus_tag="SSA_0331"
                     /note="CppA C-terminal; Region: CppA_C; pfam14507"
                     /db_xref="CDD:291193"
     gene            326049..326984
                     /locus_tag="SSA_0332"
                     /db_xref="GeneID:4807309"
     CDS             326049..326984
                     /locus_tag="SSA_0332"
                     /function="Defense mechanisms"
                     /note="GC: 47.22%; Codon Adaptation Index (CAI): 0.783.
                     Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034339.1"
                     /db_xref="GeneID:4807309"
                     /translation="MTLENIISKIKEQLKDGIYPGASLALYQAGQWQEFYFGLADPQE
                     GKATQAGLVYDLASVSKVVGVGTLAAFLYEQGKLELDLPLQHYYPAFHQEDVTLRQLL
                     THTSGLDPFIPNREQLTAPKLKEALNHLTVLEDKTFRYTDVNFLLLGFMLEEIFGQAL
                     DQIFQSQIFQPWGLTETCFGPVPGAVPTVRGVKDGQVHDPKARVLGIHSGSAGLFSTL
                     RDLEIFLEHYLQDDFAANLTQNFSKEPGKRRSLAWNLEGSWLDHTGYTGTFIMYNRKE
                     QKAAIFLSNRTYEKDERAQWILDRNQLMDLIRREL"
     misc_feature    326064..326930
                     /locus_tag="SSA_0332"
                     /note="Beta-lactamase; Region: Beta-lactamase; pfam00144"
                     /db_xref="CDD:278569"
     gene            327135..328013
                     /gene="mvaK1"
                     /locus_tag="SSA_0333"
                     /db_xref="GeneID:4808038"
     CDS             327135..328013
                     /gene="mvaK1"
                     /locus_tag="SSA_0333"
                     /EC_number="2.7.1.36"
                     /function="Lipid metabolism"
                     /note="GC: 49.37%; Codon Adaptation Index (CAI): 0.763.
                     Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="mevalonate kinase"
                     /protein_id="YP_001034340.1"
                     /db_xref="GeneID:4808038"
                     /translation="MTKEIGVGKAHSKIILMGEHSVVYGYPAISLPLNRIEVTCQVFP
                     SERAWTLYAEDTLSMAVFACLEHLGQQGAKIRCQVESMVPEKRGMGSSAAVSIAAIRA
                     VFDYFEEELDDQTLEILANRAEMIAHMNPSGLDAKTCLSDVAIKFIRNFGFSEIELDL
                     DAFLVIADTGIHGHTREAIRAVESQGQKALPLLQELGNLTKILEKAIFIKDLMTMGQA
                     MTKAHEKLAKLGVSCQKADELVAAALENGALGAKMSGGGLGGCVIALVGEKSQAEALA
                     ALLREKGAINTWIESL"
     misc_feature    327150..328010
                     /gene="mvaK1"
                     /locus_tag="SSA_0333"
                     /note="Mevalonate kinase [Lipid transport and metabolism];
                     Region: ERG12; COG1577"
                     /db_xref="CDD:224493"
     misc_feature    327369..327554
                     /gene="mvaK1"
                     /locus_tag="SSA_0333"
                     /note="GHMP kinases N terminal domain; Region:
                     GHMP_kinases_N; pfam00288"
                     /db_xref="CDD:278705"
     misc_feature    327741..327986
                     /gene="mvaK1"
                     /locus_tag="SSA_0333"
                     /note="GHMP kinases C terminal; Region: GHMP_kinases_C;
                     pfam08544"
                     /db_xref="CDD:285715"
     gene            327995..328942
                     /gene="mvaD"
                     /locus_tag="SSA_0334"
                     /db_xref="GeneID:4806421"
     CDS             327995..328942
                     /gene="mvaD"
                     /locus_tag="SSA_0334"
                     /EC_number="4.1.1.33"
                     /function="Lipid metabolism"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 47.78%; Codon Adaptation Index (CAI): 0.788.
                     Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="diphosphomevalonate decarboxylase"
                     /protein_id="YP_001034341.1"
                     /db_xref="GeneID:4806421"
                     /translation="MDRKPVSVKSYANIAIVKYWGKKDAEKMIPSTSSISLTLENMYT
                     ETQLSPLPDTATGDEFYIDSQLQSPAEHAKISKIIDRFRSPEDGFVRVDTSNNMPTAA
                     GLSSSSSGLSALVKACNAYFQTGYQTQELAQLAKFASGSSARSFFGPLAAWDKDSGAI
                     YPVKTDLKLAMIMLVLHDEKKPISSRDGMELCAKTSTIFPDWIAQSALDYKAMLSYLQ
                     DNDFAKVGQLTEENALRMHATTEKAYPPFSYLTEESYQAMDAVRKLREQGERCYFTMD
                     AGPNVKVLCLEEDLDHLVAIFEKDYRLIVSKTKDLSDED"
     misc_feature    328010..328900
                     /gene="mvaD"
                     /locus_tag="SSA_0334"
                     /note="diphosphomevalonate decarboxylase; Region:
                     mevDPdecarb; TIGR01240"
                     /db_xref="CDD:130307"
     gene            328932..329951
                     /gene="mvaK2"
                     /locus_tag="SSA_0335"
                     /db_xref="GeneID:4807924"
     CDS             328932..329951
                     /gene="mvaK2"
                     /locus_tag="SSA_0335"
                     /EC_number="2.7.4.2"
                     /function="Lipid metabolism"
                     /note="GC: 47.55%; Transmembrane domains: 1. Codon
                     Adaptation Index (CAI): 0.767. Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphomevalonate kinase"
                     /protein_id="YP_001034342.1"
                     /db_xref="GeneID:4807924"
                     /translation="MKTSARVQTCGKLYLAGEYAVLTTGQPAIIKAIPIYMTAEIQAA
                     SAYRLTSDMFEHSASLEPDPDYALIQETVAVMNDYLQVLGYQLQPFSLKISGKMERDG
                     KKFGIGSSGSVVILTIKAMAALYELDLEPKLLFKLASYVLLKRGDNGSMGDLACIAFE
                     DLIYYRSFDRELVRKRMGKVYLQQLLAEDWGFEIRSIKPCLAMDFLVGWTKQPAISKD
                     LVNQVKSAISESFLTGSRTQVDALEKALLAGDKLAIQSSMEKASQLLETLSPAIYTDR
                     LKVLKEAAEGLNCVAKSSGAGGGDCGIALSFDVASSNQLIQAWQEAGIELLYRERMGH
                     DEPES"
     misc_feature    328944..329933
                     /gene="mvaK2"
                     /locus_tag="SSA_0335"
                     /note="Mevalonate kinase [Lipid transport and metabolism];
                     Region: ERG12; COG1577"
                     /db_xref="CDD:224493"
     misc_feature    329247..329402
                     /gene="mvaK2"
                     /locus_tag="SSA_0335"
                     /note="GHMP kinases N terminal domain; Region:
                     GHMP_kinases_N; pfam00288"
                     /db_xref="CDD:278705"
     misc_feature    329655..329906
                     /gene="mvaK2"
                     /locus_tag="SSA_0335"
                     /note="GHMP kinases C terminal; Region: GHMP_kinases_C;
                     pfam08544"
                     /db_xref="CDD:285715"
     gene            329932..330939
                     /locus_tag="SSA_0336"
                     /db_xref="GeneID:4808082"
     CDS             329932..330939
                     /locus_tag="SSA_0336"
                     /EC_number="5.3.3.2"
                     /function="Energy production and conversion"
                     /note="catalyzes the isomerization of isopentenyl
                     pyrophosphate to dimethylallyl diphosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="isopentenyl pyrophosphate isomerase"
                     /protein_id="YP_001034343.1"
                     /db_xref="GeneID:4808082"
                     /translation="MMSQNRKDDHIKYALEQRPGYNSFDEMELVHRSLPKYDLAEIDL
                     STHFAGRDWEFPFYINAMTGGSQKGGQINEKLAQVAESCGLLFVTGSYSAALKNPSDP
                     SYRVATGRPNLLLATNIGLDKPFQAAQQAVADLHPLFLQVHVNLMQELLMPEGEREFR
                     SWRQHLADYSQRLDLPLILKEVGFGIDRSTVEEARSLGIQTFDISGRGGTSFAYIENQ
                     RGGNRDYLNDWGQSTLQSLLALQPLRDEVELLASGGVRHPLDIIKALVLGAKSVGLSR
                     AMLDLVENHSVEEVIDIVEGWKSDLRLIMCALSCRNLQELKSVPYLLYGRLKEAQEQI
                     Q"
     misc_feature    329932..330936
                     /locus_tag="SSA_0336"
                     /note="isopentenyl pyrophosphate isomerase; Provisional;
                     Region: PRK05437"
                     /db_xref="CDD:235465"
     misc_feature    329947..330885
                     /locus_tag="SSA_0336"
                     /note="Isopentenyl-diphosphate:dimethylallyl diphosphate
                     isomerase type 2 (IDI-2) FMN-binding domain. Two types of
                     IDIs have been characterized at present. The long known
                     IDI-1 is only dependent on divalent metals for activity,
                     whereas IDI-2 requires a metal; Region: IDI-2_FMN;
                     cd02811"
                     /db_xref="CDD:239205"
     misc_feature    order(330019..330030,330037..330039,330361..330363,
                     330472..330474,330481..330486,330496..330498,
                     330622..330624,330646..330648,330706..330711,
                     330817..330819,330826..330828)
                     /locus_tag="SSA_0336"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239205"
     misc_feature    order(330115..330126,330202..330204,330283..330285,
                     330358..330360,330469..330471,330685..330693,
                     330757..330759)
                     /locus_tag="SSA_0336"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239205"
     misc_feature    order(330121..330123,330142..330147)
                     /locus_tag="SSA_0336"
                     /note="homodimer contacts [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239205"
     misc_feature    order(330202..330204,330283..330285,330358..330360,
                     330469..330471,330685..330687,330754..330759)
                     /locus_tag="SSA_0336"
                     /note="putative active site [active]"
                     /db_xref="CDD:239205"
     misc_feature    order(330283..330285,330289..330291,330358..330360)
                     /locus_tag="SSA_0336"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:239205"
     gene            complement(330979..332253)
                     /gene="mvaA"
                     /locus_tag="SSA_0337"
                     /db_xref="GeneID:4807932"
     CDS             complement(330979..332253)
                     /gene="mvaA"
                     /locus_tag="SSA_0337"
                     /EC_number="1.1.1.34"
                     /EC_number="1.1.1.88"
                     /function="Lipid metabolism"
                     /note="GC: 50.43%; Codon Adaptation Index (CAI): 0.759.
                     Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxymethylglutaryl-CoA reductase"
                     /protein_id="YP_001034344.1"
                     /db_xref="GeneID:4807932"
                     /translation="MKVNWTGFSKKNPAERLQMLKEKGLLQDEHWQLLDSQQTLPLET
                     ANQMSENVLATLALPYSLVPDFLVDGKSYQVPFVTEEPSVVAAASFAAKIIKRSGGFE
                     TEVHKRQMIGQIALYQVDNADRAIKDILMKKKELLEQANQAYPSIVARGGGARDLWLE
                     PKEDFLIFYLSVDTQEAMGANMLNTMLEAITLPLKDLTGGKSLMAILSNYATDSLVTA
                     RCVIGYRFLSRDTAEAELLADKMQLASKLAQVDPYRAATHNKGIFNGIDALVLATGND
                     WRAVEAGAHAYASREGSYRGLSTWTADPDKRQLHGQMTLPMPIATKGGSIGLNPAVAA
                     SFDLLGQPQAKELASLIVSVGLAQNFAALKALVSTGIQAGHMKLQAKSLALQAGAQGE
                     EIAAVASCLTVKKTFNLATAQEILADLRKQDK"
     misc_feature    complement(330994..332235)
                     /gene="mvaA"
                     /locus_tag="SSA_0337"
                     /note="Class II hydroxymethylglutaryl-coenzyme A (HMG-CoA)
                     reductase (HMGR); Region: HMG-CoA_reductase_classII;
                     cd00644"
                     /db_xref="CDD:153082"
     misc_feature    complement(order(331024..331026,331096..331101,
                     331108..331113,331117..331122,331126..331128,
                     331138..331149,331156..331158,331258..331263,
                     331267..331269,331279..331281,331372..331374,
                     331378..331380,331387..331389,331399..331401,
                     331408..331413,331417..331428,331438..331443,
                     331453..331455,331462..331467,331474..331476,
                     331483..331488,331492..331497,331501..331506,
                     331513..331518,331522..331530,331537..331539,
                     331627..331647,331747..331749,331753..331755,
                     331909..331911,331915..331917,331921..331923,
                     331996..332022,332068..332112,332116..332121,
                     332128..332130,332152..332154,332203..332208,
                     332215..332217,332230..332232))
                     /gene="mvaA"
                     /locus_tag="SSA_0337"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:153082"
     misc_feature    complement(order(331129..331131,331282..331290,
                     331417..331419,331426..331428,331474..331476,
                     331483..331485,331627..331629,331633..331635,
                     331702..331704,331708..331731,331804..331806,
                     331813..331815,332011..332013))
                     /gene="mvaA"
                     /locus_tag="SSA_0337"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:153082"
     misc_feature    complement(order(331129..331131,331426..331428,
                     331474..331476,332011..332013))
                     /gene="mvaA"
                     /locus_tag="SSA_0337"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:153082"
     misc_feature    complement(order(331141..331143,331156..331158,
                     331168..331170,331462..331464,331471..331476,
                     331480..331485,331492..331494,332011..332013))
                     /gene="mvaA"
                     /locus_tag="SSA_0337"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:153082"
     misc_feature    complement(331093..331140)
                     /gene="mvaA"
                     /locus_tag="SSA_0337"
                     /note="flexible flap; other site"
                     /db_xref="CDD:153082"
     gene            complement(332250..333428)
                     /gene="mvaS"
                     /locus_tag="SSA_0338"
                     /db_xref="GeneID:4806115"
     CDS             complement(332250..333428)
                     /gene="mvaS"
                     /locus_tag="SSA_0338"
                     /EC_number="2.3.3.10"
                     /function="Lipid metabolism"
                     /note="GC: 47.16%; Codon Adaptation Index (CAI): 0.76.
                     Helix-turn-helix prediction: AraC. Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxymethylglutaryl-CoA synthase"
                     /protein_id="YP_001034345.1"
                     /db_xref="GeneID:4806115"
                     /translation="MTIGIDKIGFATSNYVLKLNDLAAARGTDPDKLSKGLLLKELSI
                     APLTEDIVTLGAAAADPILTAEDKEKIDMVIVATESGIDQSKAAAVFVHGLLGIQPFA
                     RSFEIKEACYGATAALDYAKLHIEKHPDSKVLVLASDIAKYGINTPGEPTQGAGAISM
                     LISSNPRILAFNDDNVAQTRDVMDFWRPNYSTTPYVNGLYSTQQYLDSLKTTWAEYQK
                     RHKLALKDFAAYCFHLPYPKLALKGLNKIMDKSLPQEQQDQLRKNFEASILYSQKVGN
                     IYTGSLFLGLLSLLENSDNLKAGDRIALFGYGSGAVSEIFSANLVEGYEKHLSQTRLE
                     ELDQRQALSIPNYERIFFEEAELDAEGNASFSGYEEQSFALAEIAEHQRKYIKVEKSS
                     "
     misc_feature    complement(332475..333425)
                     /gene="mvaS"
                     /locus_tag="SSA_0338"
                     /note="'initiating' condensing enzymes are a subclass of
                     decarboxylating condensing enzymes, including
                     beta-ketoacyl [ACP] synthase, type III and polyketide
                     synthases, type III, which include chalcone synthase and
                     related enzymes. They are characterized by the...; Region:
                     init_cond_enzymes; cd00827"
                     /db_xref="CDD:238423"
     misc_feature    complement(332274..333422)
                     /gene="mvaS"
                     /locus_tag="SSA_0338"
                     /note="3-hydroxy-3-methylglutaryl CoA synthase,
                     prokaryotic clade; Region: HMG-CoA-S_prok; TIGR01835"
                     /db_xref="CDD:213655"
     misc_feature    complement(order(332499..332501,332874..332879,
                     332886..332897,333000..333002,333057..333062,
                     333069..333074,333081..333083,333108..333125,
                     333150..333152,333159..333161,333186..333188,
                     333192..333194))
                     /gene="mvaS"
                     /locus_tag="SSA_0338"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238423"
     misc_feature    complement(order(332601..332603,332721..332723,
                     333096..333098))
                     /gene="mvaS"
                     /locus_tag="SSA_0338"
                     /note="active site"
                     /db_xref="CDD:238423"
     gene            complement(333573..334040)
                     /locus_tag="SSA_0339"
                     /db_xref="GeneID:4807732"
     CDS             complement(333573..334040)
                     /locus_tag="SSA_0339"
                     /function="Function unknown"
                     /note="GC: 47.86%; Transmembrane domains: 5. Codon
                     Adaptation Index (CAI): 0.738. SignalP prediction: Yes
                     (prob. 0.482); Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034346.1"
                     /db_xref="GeneID:4807732"
                     /translation="MTILNFLLQAVASLLAIITFLIVLNVQRSMLIPGGVLGMAIWLL
                     YLLLKGPTNVIIATFVAAILGSCISQILSIIYKTPAVVFILAILAPLVPGYISYRTTA
                     FFVTGDYSQAMIHATLVVILALVISIGMASGTVVLKLYHYLKKRQSKLTVNKQ"
     misc_feature    complement(333612..334040)
                     /locus_tag="SSA_0339"
                     /note="Uncharacterized membrane protein YjjB, DUF3815
                     family [Function unknown]; Region: YjjB; COG3610"
                     /db_xref="CDD:226137"
     gene            complement(334045..334821)
                     /locus_tag="SSA_0341"
                     /db_xref="GeneID:4806175"
     CDS             complement(334045..334821)
                     /locus_tag="SSA_0341"
                     /function="Function unknown"
                     /note="GC: 47.23%; Transmembrane domains: 7. Codon
                     Adaptation Index (CAI): 0.748. Helix-turn-helix
                     prediction: AraC. Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034347.1"
                     /db_xref="GeneID:4806175"
                     /translation="MTEKGIREEAKDFNLAVDVIMLAGTLLLQSGSETYRVEDTMIRI
                     AHSQGIIDCNALAMPVAIFFSIENTNVSRMKRNLKTNYNIEKVCDVNQVSRQLVTGEI
                     SLQEAFDELNRLKVKELPYNNKQLIAAATLSAPFFSIMFGGNFYDALGAAIATFFGFA
                     FSLYVDKYIRIPFVTAFAGAFVFGLLAHIWTRYSGFNSTDDLIIAGSVMPFVPGIALT
                     NSVRDIMTNHINSGMSKLFESLLITLALGAGTSVALLIMK"
     misc_feature    complement(334051..334770)
                     /locus_tag="SSA_0341"
                     /note="Putative threonine/serine exporter; Region: ThrE;
                     pfam06738"
                     /db_xref="CDD:310976"
     gene            complement(334981..337296)
                     /locus_tag="SSA_0342"
                     /db_xref="GeneID:4806840"
     CDS             complement(334981..337296)
                     /locus_tag="SSA_0342"
                     /EC_number="2.3.1.54"
                     /function="Energy production and conversion"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 44.39%; Codon Adaptation Index (CAI): 0.783.
                     Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate formate-lyase"
                     /protein_id="YP_001034348.1"
                     /db_xref="GeneID:4806840"
                     /translation="MVVKTVVEAQDIFDKAWEGFKGEDWKEKASVSRFVQANYTPYDG
                     DESFLAGPTERSLHIKKIVEETKAHYEETRFPMDTRPASIADIDAGYIDKDNELIYGI
                     QNDELFKLNFMPKGGIRMAETTLKENGYEPDPAVHEIFTKYVTTVNDGIFRAYTSNIR
                     RARHAHTVTGLPDAYSRGRIIGVYARLALYGADYLMAEKVRDWNGLTDIDEETIRLRE
                     EINLQYQALGEVVKLGDLYGVDVRRPAFDVKEAIQWTNIAFMAVCRVINGAATSLGRV
                     PIVLDIYAERDLARGTYTESEIQEFVDDFVMKLRTVKFARTKAYDQLYSGDPTFITTS
                     MAGMGNDGRHRVTKMDYRFLNTLDNIGNSPEPNLTVLWTDKLPYSFRRYCMHMSHKHS
                     SIQYEGVTTMAKDGYGEMSCISCCVSPLDPENEEQRHNIQYFGARVNVLKALLTGLNG
                     GYDDVHKDYKVFDIEPIRDEVLEFESVKANFEKSLDWLTDTYVDALNIIHYMTDKYNY
                     EAVQMAFLPTYQRANMGFGICGFANTVDTLSAIKYATVKPIRDENGYIYDYETIGEYP
                     RWGEDDPRSNELAEWLVEAYTTRLRSHKLYKNAEATVSLLTITSNVAYSKQTGNSPVH
                     KGVYLNEDGSVNLSKLEFFSPGANPSNKAKGGWLQNLNSLASLDFSYAADGISLTTQV
                     SPRALGKTHDEQVDNLVTILDGYFENGGQHVNLNVMDLKDVYDKIMSGEDVIVRISGY
                     CVNTKYLTPEQKTELTQRVFHEVLSMDDALS"
     misc_feature    complement(335014..337251)
                     /locus_tag="SSA_0342"
                     /note="Ribonucleotide reductase and Pyruvate formate
                     lyase; Region: RNR_PFL; cl09939"
                     /db_xref="CDD:324548"
     gene            337665..338729
                     /gene="dinP"
                     /locus_tag="SSA_0343"
                     /db_xref="GeneID:4806842"
     CDS             337665..338729
                     /gene="dinP"
                     /locus_tag="SSA_0343"
                     /EC_number="2.7.7.7"
                     /function="DNA replication, recombination, and repair"
                     /note="involved in translesion DNA polymerization with
                     beta clamp of polymerase III; belongs to Y family of
                     polymerases; does not contain proofreading function"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase IV"
                     /protein_id="YP_001034349.1"
                     /db_xref="GeneID:4806842"
                     /translation="MLIFPLINDTSRKIIHIDMDAFFASVEERDNPKLKGHPVIIGSD
                     PRLTGGRGVVSTCNYEARKFGVHSAMSSKEAYERCPQGIFISGNYEKYQAVGLQIREI
                     FKRYTDLIEPMSIDEAYLDVTENKLGIKSAVKIAKLIQHDIWNELQLTASAGVSYNKF
                     LAKIASDYEKPHGLTVILPEEAEVSLAPMDIAKFHGVGKKSVEKLHEMGVYTGADLLK
                     IPEMTLIDKFGRFGFDLYRKARGISNSPVKSNRIRKSIGKERTYAKLLYSEEDIKKEL
                     TLLAQKVENSLTKHDKKGRTIVLKIRYADFSTLTKRKSLNLATQDKEQIERTAHEIYD
                     SLEEQPRGIRLLGLTVTGFE"
     misc_feature    337707..338723
                     /gene="dinP"
                     /locus_tag="SSA_0343"
                     /note="DNA Polymerase IV/Kappa; Region: PolY_Pol_IV_kappa;
                     cd03586"
                     /db_xref="CDD:176459"
     misc_feature    order(337716..337721,337725..337733,337827..337832,
                     337839..337841,337848..337850,338010..338012,
                     338172..338174)
                     /gene="dinP"
                     /locus_tag="SSA_0343"
                     /note="active site"
                     /db_xref="CDD:176459"
     misc_feature    337719..338726
                     /gene="dinP"
                     /locus_tag="SSA_0343"
                     /note="DNA polymerase IV; Validated; Region: PRK02406"
                     /db_xref="CDD:235035"
     misc_feature    order(337791..337793,337875..337877,338004..338006,
                     338010..338015,338151..338153,338247..338267,
                     338352..338357,338424..338447,338520..338522,
                     338589..338600,338604..338606,338694..338699,
                     338709..338711,338718..338720)
                     /gene="dinP"
                     /locus_tag="SSA_0343"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:176459"
     gene            338943..339269
                     /locus_tag="SSA_0345"
                     /db_xref="GeneID:4806828"
     CDS             338943..339269
                     /locus_tag="SSA_0345"
                     /note="GC: 47.09%; Transmembrane domains: 1. Codon
                     Adaptation Index (CAI): 0.768. Curator(s): T. Kitten, J.
                     Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034350.1"
                     /db_xref="GeneID:4806828"
                     /translation="MNKSVIEKTSEHILKLNQELDRQREGQKEFLQQQAEKRKVWLEK
                     ITQGENLIRYSKWGVKAGYAVLAGGLLTSVFSPWRGLGIMAVGGLSLASNLWQIRRLQ
                     NQERSK"
     gene            339588..340382
                     /locus_tag="SSA_0346"
                     /db_xref="GeneID:4806371"
     CDS             339588..340382
                     /locus_tag="SSA_0346"
                     /note="GC: 51.82%; Transmembrane domains: 8. Codon
                     Adaptation Index (CAI): 0.777. Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034351.1"
                     /db_xref="GeneID:4806371"
                     /translation="MNKQTHVEPETRHILPFLAWTFGITWGAWLLQYILTALKLTSGA
                     EPLSFALNFIGGFGPTLGTFISLKISHPKKMLDFIFSHAKGWWIYMLVFCLVRVLTLF
                     IANPVLPPLNAILMFPLGWTFVTFAGGGNEEIGWRGLLQPALEKKFCFPLATVITALV
                     WVAWHLPLWLIPGTSQSQVSLPFYLSFGILLCFCQAVLYKQTASVFACMVFHGCINFA
                     QATIVGSATNGGRYLSFQAANLVMTALLVGWWYWKGNRKGVQKDAG"
     misc_feature    339627..340241
                     /locus_tag="SSA_0346"
                     /note="Membrane protease YdiL, CAAX protease family
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: YdiL; COG1266"
                     /db_xref="CDD:224185"
     misc_feature    339933..340238
                     /locus_tag="SSA_0346"
                     /note="CAAX protease self-immunity; Region: Abi;
                     pfam02517"
                     /db_xref="CDD:280650"
     gene            340428..341174
                     /locus_tag="SSA_0348"
                     /db_xref="GeneID:4806621"
     CDS             340428..341174
                     /locus_tag="SSA_0348"
                     /note="GC: 49.8%; Transmembrane domains: 8. Codon
                     Adaptation Index (CAI): 0.727. Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="CAAX amino protease"
                     /protein_id="YP_001034352.1"
                     /db_xref="GeneID:4806621"
                     /translation="MKTQTHVEPETRHIWPFLAWTFGISWSAWLASAFLRIPIISQVL
                     TIAGVFGPAIGAKLVLGKSFKELLASIGSARKRTWVHLLILTILYTLSIVFWSPLLPG
                     FSLLRIALIFLMTTLLTGGNEEIGWQGFLQPSLEKILPFPLATVTTGLIWSVWHLPLF
                     FTPGSSQAGTSFLVFTAACLLARFWLAALYKVSQSILYCVLFHGAINTIGEGIFLGKG
                     TENPLFFLGYILMAAYSIYLWYQRDQQDKA"
     misc_feature    340749..341054
                     /locus_tag="SSA_0348"
                     /note="CAAX protease self-immunity; Region: Abi;
                     pfam02517"
                     /db_xref="CDD:280650"
     gene            341250..341888
                     /locus_tag="SSA_0349"
                     /db_xref="GeneID:4806022"
     CDS             341250..341888
                     /locus_tag="SSA_0349"
                     /function="Transcription"
                     /note="GC: 49.14%; Codon Adaptation Index (CAI): 0.786.
                     Helix-turn-helix prediction: AraC. Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR/AcrR family transcriptional regulator"
                     /protein_id="YP_001034353.1"
                     /db_xref="GeneID:4806022"
                     /translation="MAQRKDKSQAMREKILNTATQLFIQKGSEKTSMQDIAQTAGISK
                     GAIYHHFKSKDEIVLAVMRSRQELMEEEMKQWLKATENLTGREQLQTILKSNLESQTA
                     RATDGILGEYEKDAGFILTMMRDNLWISAPLVSDIIKKGMADGSLQTQYPDQAAEVFL
                     LLVNFWMHGTVFESDPEKLPERFHFLQFMMTSVGLDIFTDELLQLFSQKNKA"
     misc_feature    341250..341798
                     /locus_tag="SSA_0349"
                     /note="DNA-binding transcriptional regulator, AcrR family
                     [Transcription]; Region: AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    341292..341432
                     /locus_tag="SSA_0349"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:278848"
     gene            complement(341942..344308)
                     /gene="recD"
                     /locus_tag="SSA_0350"
                     /db_xref="GeneID:4806560"
     CDS             complement(341942..344308)
                     /gene="recD"
                     /locus_tag="SSA_0350"
                     /EC_number="3.1.11.5"
                     /function="DNA replication, recombination, and repair"
                     /note="GC: 47.61%; Codon Adaptation Index (CAI): 0.773.
                     Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="helicase"
                     /protein_id="YP_001034354.1"
                     /db_xref="GeneID:4806560"
                     /translation="MEFYFSGTIERIIFENPSNFFRILLLDIEDTDAEDFEDFEIIVT
                     GSMADVMEGEDYSFWGSLVQHPKYGQQLKISRYERAKPSSKGLVKYFSSDHFKGIGVK
                     TAQKIVQLYGEDTEDTIDKILAEPEKLTQINGLSAKNREAFVAKLRLNYGTEMVLTKL
                     AAYGIPNKLAFQIQDTYKEETLDIVEKYPYQLVEDIQGIGFKIADRLAEELGIQSDAP
                     ERFRAGLVHTLLTQSMERGDTYVEARDLLEHTIELLESSRQVELNPSLVADELAHLIE
                     EDKVQNVETKIFENSLFFAEEGIKSNLVRLLEKGEQDCFDADNITAAIQQVEENSGIS
                     YDSIQKEAIRQAINQKVFILTGGPGTGKTTVINCIIAVYAQLRGLDLRKVNDLPILLA
                     APTGRAARRMNELTGLPSATIHRHLGMTGDDDTSHLDDYLDADFIIVDEFSMVDTWLA
                     NQLLSNISSQTKLLIVGDADQLPSVSPGQVLADLLQIPTIPQTKLETIYRQSEESTIV
                     TLASQIQKGILPADFTEKKADRSYFEARNEHIPPMIEKIASAAIRSGIPAQDVQVLAP
                     MYRGPAGIDQINNLMQNLINPVEKDELTFEAPDCQYRQGDRVIHLVNDAESNVFNGDL
                     GYISDLLPAKYTDSKQDELTIDFDGNELVYQRSEWYKIRLAYAMSIHKSQGSEFPVVI
                     LPITKSSHRMLQRNLIYTAITRAKSKLILLGEKAAFDYAAKNTGTARKTYLRERFEDL
                     KSPPELAHTPVDRLEKAVENYVLTEENFLKIDPLIGLTEEDIHSIFST"
     misc_feature    complement(342098..344296)
                     /gene="recD"
                     /locus_tag="SSA_0350"
                     /note="helicase, putative, RecD/TraA family; Region:
                     recD_rel; TIGR01448"
                     /db_xref="CDD:273632"
     misc_feature    complement(<343919..344035)
                     /gene="recD"
                     /locus_tag="SSA_0350"
                     /note="H3TH domains of structure-specific 5' nucleases (or
                     flap endonuclease-1-like) involved in DNA replication,
                     repair, and recombination; Region:
                     H3TH_StructSpec-5'-nucleases; cl22433"
                     /db_xref="CDD:304556"
     misc_feature    complement(343589..343843)
                     /gene="recD"
                     /locus_tag="SSA_0350"
                     /note="Helix-hairpin-helix containing domain; Region:
                     HHH_4; pfam14490"
                     /db_xref="CDD:291176"
     misc_feature    complement(342788..>343156)
                     /gene="recD"
                     /locus_tag="SSA_0350"
                     /note="P-loop containing Nucleoside Triphosphate
                     Hydrolases; Region: P-loop_NTPase; cl21455"
                     /db_xref="CDD:304359"
     misc_feature    complement(342176..342319)
                     /gene="recD"
                     /locus_tag="SSA_0350"
                     /note="UvrD-like helicase C-terminal domain; Region:
                     UvrD_C_2; pfam13538"
                     /db_xref="CDD:290272"
     gene            complement(344368..344997)
                     /gene="spi"
                     /locus_tag="SSA_0351"
                     /db_xref="GeneID:4806368"
     CDS             complement(344368..344997)
                     /gene="spi"
                     /locus_tag="SSA_0351"
                     /EC_number="3.4.21.89"
                     /function="Intracellular trafficking and secretion"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 45.56%; Transmembrane domains: 1. Codon
                     Adaptation Index (CAI): 0.781. SignalP prediction: Yes
                     (prob. 0.646); Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="Signal peptidase I"
                     /protein_id="YP_001034355.1"
                     /db_xref="GeneID:4806368"
                     /translation="MKKSNPVLSFLKEWGLFLFFISVIILSRLFLWSPVKVDGHSMDP
                     TLANGEYLLVLKHQSIDRFDIVVATETDGNGTSKEIVKRVIGMPGDTIQYENDTLYIN
                     GKKTDEPYLTDYIKKFKEDKLQSTYTGDDYDDNGEFFRKLAAQAQAFTVDKDGSPVFT
                     IKLLDDEYLLLGDDRIVSKDSRQVGAFKAKQIQGEAKFRFWPLLPFKTY"
     misc_feature    complement(344389..344910)
                     /gene="spi"
                     /locus_tag="SSA_0351"
                     /note="signal peptidase I, bacterial type; Region:
                     sigpep_I_bact; TIGR02227"
                     /db_xref="CDD:274044"
     misc_feature    complement(344686..344889)
                     /gene="spi"
                     /locus_tag="SSA_0351"
                     /note="Peptidase S24-like; Region: Peptidase_S24;
                     pfam00717"
                     /db_xref="CDD:279106"
     misc_feature    complement(order(344752..344754,344875..344877))
                     /gene="spi"
                     /locus_tag="SSA_0351"
                     /note="Catalytic site [active]"
                     /db_xref="CDD:119398"
     gene            complement(345001..345969)
                     /gene="rnhC"
                     /locus_tag="SSA_0352"
                     /db_xref="GeneID:4806557"
     CDS             complement(345001..345969)
                     /gene="rnhC"
                     /locus_tag="SSA_0352"
                     /EC_number="3.1.26.4"
                     /function="DNA replication, recombination, and repair"
                     /note="An endonuclease that specifically degrades the RNA
                     strand of RNA-DNA hybrids"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease HIII"
                     /protein_id="YP_001034356.1"
                     /db_xref="GeneID:4806557"
                     /translation="MLSYKIFVGFSILWLSTFPFYGTIGGMESITLSPKQQEIQAFAE
                     KYQSQLAPNKNPHIQYFFRLDQATVSVFSSGKVLFQGAKAAHYAGLFGHQPEKSSSSP
                     ASQNFALIGTDEVGNGSYFGGLAVVASFVTPDQHDFLRKLGVGDSKTFNDNKIRQLAP
                     VLKEKIAHQALLLSPEKYNEVIASGYNAVSVKVALHNQAIFLLLQKGINPEKIVIDAF
                     TSQQNYNKYLKQEKNHFPNPVSLIEKAEGKFLAVAVSSIIARDLFLENLENLSQELGY
                     ALPSGAGSKSDHVASQILQAYGMAGLQHSAKLHFKNTEKAQKLLER"
     misc_feature    complement(345004..345891)
                     /gene="rnhC"
                     /locus_tag="SSA_0352"
                     /note="ribonuclease HIII; Provisional; Region: PRK00996"
                     /db_xref="CDD:234886"
     misc_feature    complement(345658..345882)
                     /gene="rnhC"
                     /locus_tag="SSA_0352"
                     /note="Domain of unknown function (DUF3378); Region:
                     DUF3378; pfam11858"
                     /db_xref="CDD:288691"
     misc_feature    complement(345022..345645)
                     /gene="rnhC"
                     /locus_tag="SSA_0352"
                     /note="Bacterial type 2 ribonuclease, HII and HIII-like;
                     Region: RNase_HII_bacteria_HIII_like; cd06590"
                     /db_xref="CDD:260000"
     misc_feature    complement(order(345034..345042,345121..345123,
                     345190..345192,345232..345234,345238..345240,
                     345316..345324,345403..345411,345526..345528,
                     345616..345633))
                     /gene="rnhC"
                     /locus_tag="SSA_0352"
                     /note="RNA/DNA hybrid binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:260000"
     misc_feature    complement(order(345232..345234,345322..345324,
                     345628..345633))
                     /gene="rnhC"
                     /locus_tag="SSA_0352"
                     /note="active site"
                     /db_xref="CDD:260000"
     gene            346080..346370
                     /locus_tag="SSA_0353"
                     /db_xref="GeneID:4806688"
     CDS             346080..346370
                     /locus_tag="SSA_0353"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 38.83%; Codon Adaptation Index (CAI): 0.762.
                     Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034357.1"
                     /db_xref="GeneID:4806688"
                     /translation="MANLNRYKFTFGNKTLTLTTEHDNLFMEEVERVAKEKYKAIKEQ
                     MPAADDEVLAILLAVNSLSTQLSREIEFDDKEKELEDFRHKMLSDLREKSGK"
     gene            346381..346932
                     /locus_tag="SSA_0354"
                     /db_xref="GeneID:4807803"
     CDS             346381..346932
                     /locus_tag="SSA_0354"
                     /GO_component="GO:0016020 - membrane"
                     /note="GC: 44.02%; Transmembrane domains: 4. Codon
                     Adaptation Index (CAI): 0.782. Required for colicin V
                     production. Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034358.1"
                     /db_xref="GeneID:4807803"
                     /translation="MLSIIILLILAWSFYIGYSRGIVLQGYYAAATMVSMLVAGAFYK
                     SLAKFISLWVPYASATQGSSTYFFPSSQLFQLDQVFYAGLAYLIIFTAVYILGRFFGI
                     FANLIPYPNKLDTKWYNVTSGAIAVCISIFVLGMCLTILATVPMEMVQERLNSSFMIR
                     FIVKYTPITSNILKDLWVNQVIG"
     misc_feature    346411..346881
                     /locus_tag="SSA_0354"
                     /note="Colicin V production protein; Region: Colicin_V;
                     pfam02674"
                     /db_xref="CDD:280783"
     gene            346987..349320
                     /gene="mutS2"
                     /locus_tag="SSA_0355"
                     /db_xref="GeneID:4807531"
     CDS             346987..349320
                     /gene="mutS2"
                     /locus_tag="SSA_0355"
                     /function="DNA replication, recombination, and repair"
                     /note="GC: 49.4%; Codon Adaptation Index (CAI): 0.772.
                     Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein"
                     /protein_id="YP_001034359.1"
                     /db_xref="GeneID:4807531"
                     /translation="MNTKILETLEFSKIKELFAPYLLTEQGQLELGLLLPTSKKETVV
                     SAFLEMTDMQQIFVQHPHFSLAATQDITALTKRLELESDLNIEEFLALKRVLAVTQEL
                     KSFYEDLENVHLEKLDRLFDNLAVFPKLQGSLQAVNDGGFIESFASESLSRIRRKIQE
                     NENQVREILQEILKNKGEMLADQVVASRNGRNVLPVKNTYRNRISGVVHDISASGNTV
                     YIEPRAVVNLNEEIASSRADERYEIQRILQELSDLFRPHAAEIANNAWIIGHLDLVRA
                     KVRFMQETGAVVPDLSEEQDIQLLSVRHPLIENAVANDLHFGLDLTEIVITGPNTGGK
                     TIMLKTLGLAQIMAQSGLPILADKGSRVGIFSQIFADIGDEQSIEQSLSTFSSHMTNI
                     VSILEQVDSESLVLLDELGAGTDPQEGAALAIAILEDLRLRQIKTMATTHYPELKAYG
                     IETDWVENASMEFDTDSLRPTYRFMQGVPGRSNAFEIAQRLGLSEVIVGHAQEQTDTD
                     SDVNRIIERLEEQTLESRKRLDNIREVEQENLKFNRALKKLYNEFNREKETELNKARL
                     EAQEIVDLALSESESILKNLHDKSSLKPHEIIEAKAQLKKLAPETVDLSKNKVLKQAK
                     KNRAPKVGDDILVTSYGQRGTLVKQLKDGRWEAQVGLIKMTLEEQEFNLLKAEKEQQP
                     KRKQVNVVKRANTAGPKARLDLRGKRYEEAMEELDAFIDQALLNNMAQVDIIHGIGTG
                     VIREGVTKYLRRNKHVKSFGYAPQNAGGSGATIVIFK"
     misc_feature    346987..349317
                     /gene="mutS2"
                     /locus_tag="SSA_0355"
                     /note="recombination and DNA strand exchange inhibitor
                     protein; Reviewed; Region: PRK00409"
                     /db_xref="CDD:234750"
     misc_feature    347878..348465
                     /gene="mutS2"
                     /locus_tag="SSA_0355"
                     /note="ATP-binding cassette domain of MutS2; Region:
                     ABC_MutS2; cd03280"
                     /db_xref="CDD:213247"
     misc_feature    347968..347991
                     /gene="mutS2"
                     /locus_tag="SSA_0355"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213247"
     misc_feature    order(347977..347982,347986..347994,348103..348105,
                     348208..348213,348310..348312)
                     /gene="mutS2"
                     /locus_tag="SSA_0355"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213247"
     misc_feature    348094..348105
                     /gene="mutS2"
                     /locus_tag="SSA_0355"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213247"
     misc_feature    348118..348159
                     /gene="mutS2"
                     /locus_tag="SSA_0355"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213247"
     misc_feature    348196..348213
                     /gene="mutS2"
                     /locus_tag="SSA_0355"
                     /note="Walker B; other site"
                     /db_xref="CDD:213247"
     misc_feature    348220..348231
                     /gene="mutS2"
                     /locus_tag="SSA_0355"
                     /note="D-loop; other site"
                     /db_xref="CDD:213247"
     misc_feature    348298..348318
                     /gene="mutS2"
                     /locus_tag="SSA_0355"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213247"
     misc_feature    <348610..>348819
                     /gene="mutS2"
                     /locus_tag="SSA_0355"
                     /note="Predicted integral membrane zinc-ribbon
                     metal-binding protein; Region: zinc_ribbon_10; cl23974"
                     /db_xref="CDD:305131"
     misc_feature    349093..349314
                     /gene="mutS2"
                     /locus_tag="SSA_0355"
                     /note="Smr domain; Region: Smr; pfam01713"
                     /db_xref="CDD:279975"
     gene            349399..350817
                     /locus_tag="SSA_0356"
                     /db_xref="GeneID:4806652"
     CDS             349399..350817
                     /locus_tag="SSA_0356"
                     /EC_number="3.4.13.18"
                     /EC_number="3.4.-.-"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 47.99%; Codon Adaptation Index (CAI): 0.758.
                     Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptidase"
                     /protein_id="YP_001034360.1"
                     /db_xref="GeneID:4806652"
                     /translation="MKFNYLSDSCTTILVGKKASYDGSTIVARTEDSQNGVFTPKKFV
                     VVEPKDQPRHYQSVLTSFEMDLPDNPVRYTAVPDAVPKDGIWGAAGINSYNVAVSATE
                     TITTNSRVLGADPLVESGISEEDILTLVLPYIKTAREGVLRLGKILEEYGTYESNGIA
                     ISDINEIWWLETIGGHHWMARRVPDDAYVTNPNQLGSDYFEFDNPEHFLCHPNLKNFI
                     EENYLNLNYSDEGFNPRYAFGSQKDKDRHYNTPRAWDIQRFLNPEAEQDPRSFFIPWC
                     RKPYRKITIEDVKYVLSSHYQDSPYDPYGAEGDHHSRRAFRTIGINRTSQTAILQLRP
                     NQPQETTGIQWLSYGSMPYNTAVPFFTQVSTTPDYFANTTDKVSTDSFYWANRLIAGL
                     ADAHFSSHVGDLDNYQEKTMAWGHEMIGRVDRALAKGEDVDFEAENQAMSDKVQEATD
                     QLLEKVLLDASNLMTNHFSLSD"
     misc_feature    349423..350628
                     /locus_tag="SSA_0356"
                     /note="Peptidase family C69; Region: Peptidase_C69;
                     pfam03577"
                     /db_xref="CDD:281563"
     misc_feature    <350551..>350775
                     /locus_tag="SSA_0356"
                     /note="Protein of unknown function (DUF2797); Region:
                     DUF2797; pfam10977"
                     /db_xref="CDD:287891"
     gene            350903..351217
                     /locus_tag="SSA_0357"
                     /db_xref="GeneID:4806138"
     CDS             350903..351217
                     /locus_tag="SSA_0357"
                     /function="Posttranslational modification, protein
                     turnover, chaperones"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 45.71%; Codon Adaptation Index (CAI): 0.802.
                     Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin"
                     /protein_id="YP_001034361.1"
                     /db_xref="GeneID:4806138"
                     /translation="MVAAVTDATFAEETKDGLVLIDFWATWCGPCRMQAPILEQLAGE
                     VHEDELKILKMDVDENPNTAREFGIMSIPTLLFKKEGQVVKQVAGVHTKDQLKAIIAE
                     LS"
     misc_feature    350915..351211
                     /locus_tag="SSA_0357"
                     /note="thioredoxin; Region: thioredoxin; TIGR01068"
                     /db_xref="CDD:200072"
     misc_feature    order(350984..350986,350993..350995)
                     /locus_tag="SSA_0357"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239245"
     gene            complement(351378..351887)
                     /locus_tag="SSA_0358"
                     /db_xref="GeneID:4806230"
     CDS             complement(351378..351887)
                     /locus_tag="SSA_0358"
                     /note="GC: 30.59%; Codon Adaptation Index (CAI): 0.79.
                     Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034362.1"
                     /db_xref="GeneID:4806230"
                     /translation="MQYTIKLPSDYDMDIIRQRVRNTGHLMDGFDDLFFKVYLISEKS
                     EDQLFNSYCPLYIWKNTNGMTKFIFDGYFDHILNSFGWQNIEIGVTSSVEISDHFDSS
                     KYATLEVIDIEASESLKSFTIHEQMQNNESGKAVIFNPDKWKKCIFTFYTNKPDTQLP
                     TFEILHISQ"
     misc_feature    complement(351384..351887)
                     /locus_tag="SSA_0358"
                     /note="Domain of unknown function (DUF4865); Region:
                     DUF4865; pfam16157"
                     /db_xref="CDD:292775"
     gene            352327..352743
                     /locus_tag="SSA_0359"
                     /db_xref="GeneID:4807041"
     CDS             352327..352743
                     /locus_tag="SSA_0359"
                     /note="GC: 32.37%; Codon Adaptation Index (CAI): 0.736.
                     Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_001034363.1"
                     /db_xref="GeneID:4807041"
                     /translation="MRLISKKTSDIPIIAHQEDFDKIFCFQKIENLKHYDETIGHVKS
                     VYACSSIIKASEGIPIFVNKDENCPFRKQSLMKFAHLKSVVEIDSFENIISLVEDGKG
                     IALLPKWLNKRANIRPYDQDIILIPFYQYEKQNQIK"
     misc_feature    <352507..352710
                     /locus_tag="SSA_0359"
                     /note="Type 2 periplasmic binding fold superfamily;
                     Region: Periplasmic_Binding_Protein_Type_2; cl21456"
                     /db_xref="CDD:304360"
     gene            352844..353251
                     /locus_tag="SSA_0360"
                     /db_xref="GeneID:4806861"
     CDS             352844..353251
                     /locus_tag="SSA_0360"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 34.8%; Codon Adaptation Index (CAI): 0.81.
                     Helix-turn-helix prediction: AraC. Curator(s): T. Kitten,
                     J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034364.1"
                     /db_xref="GeneID:4806861"
                     /translation="MEFSFSLSMKAAKEDVWFYYENIEKWYDWEEDLKNITLNGGFKT
                     GSCGIMELEGMPPMEYQLTLVKPFEEFWDKTATPFGDILFGHQIIENDDGTVNVKHTV
                     ALDSKDQQHLEFLSQVFSDVPQSIFILKNCLEK"
     misc_feature    352844..353248
                     /locus_tag="SSA_0360"
                     /note="START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC (SRPBCC)
                     ligand-binding domain superfamily; Region: SRPBCC;
                     cl14643"
                     /db_xref="CDD:301327"
     misc_feature    order(352850..352852,352856..352858,352862..352864,
                     352889..352897,352901..352906,352949..352951,
                     352979..352981,352985..352987,352991..352993,
                     352997..352999,353021..353023,353027..353029,
                     353033..353035,353054..353056,353060..353062,
                     353090..353095,353099..353101,353105..353107,
                     353135..353137,353141..353143,353147..353149,
                     353153..353155,353183..353197,353201..353206,
                     353213..353221,353228..353230)
                     /locus_tag="SSA_0360"
                     /note="hydrophobic ligand binding site; other site"
                     /db_xref="CDD:176854"
     gene            353430..353654
                     /locus_tag="SSA_0362"
                     /db_xref="GeneID:4807048"
     CDS             353430..353654
                     /locus_tag="SSA_0362"
                     /function="Posttranslational modification, protein
                     turnover, chaperones"
                     /note="GC: 44.44%; Codon Adaptation Index (CAI): 0.8.
                     Possibly an incomplete product. Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin"
                     /protein_id="YP_001034365.1"
                     /db_xref="GeneID:4807048"
                     /translation="MPHAGTYLGQLAGEVHEDELKILKMDVDENPNTAREFGIMSIPT
                     LLFKKDGQVVKQVAGVHTKDQLKAIIAELS"
     misc_feature    <353451..353648
                     /locus_tag="SSA_0362"
                     /note="Protein Disulfide Oxidoreductases and Other
                     Proteins with a Thioredoxin fold; Region:
                     Thioredoxin_like; cl00388"
                     /db_xref="CDD:294274"
     gene            353998..355335
                     /gene="dagA"
                     /locus_tag="SSA_0363"
                     /db_xref="GeneID:4806888"
     CDS             353998..355335
                     /gene="dagA"
                     /locus_tag="SSA_0363"
                     /function="Amino acid transport and metabolism"
                     /note="GC: 49.7%; Transporter classification
                     TC:2.A.25.1.1. Transmembrane domains: 11. Codon Adaptation
                     Index (CAI): 0.745. Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanine/glycine/Na permease"
                     /protein_id="YP_001034366.1"
                     /db_xref="GeneID:4806888"
                     /translation="MLEILNRLDSFVWGPPLLILLVGTGIYLSLRLGLLQIFRLPRAF
                     RLIFVSDEEHQGDVSSFAALCTALAATVGTGNIIGVATAIKTGGPGALFWMWVAAFFG
                     MATKYAEGLLAIKYRRKDAHGAMAGGPMHYILLGMGEKWRPLAIFFAIAGILVALLGI
                     GTFTQVNSITEAMQNAIQLPPAVTASILAILVALVIFSGIQSIARVSTKVVPFMAAIY
                     ILGTVTVLAVNLDRLLPTLQLVFSSAFSQTAAVGGFAGATIQMAIQNGVARGVFSNES
                     GLGSAPIAAAAARTKEPVEQGLISMTGTFIDTLIICSLTGLTILITGVWDGNLNGVSL
                     TQAAFASVFANFGPVLLSVFLVLFAFTTILGWNYYGERCFEFLFGVRYIRVYRLLFVL
                     MIVLGGFVGLEAVWILADIVNALMALPNLIALLVLSPIVISETKKYFAKHRKN"
     misc_feature    353998..355326
                     /gene="dagA"
                     /locus_tag="SSA_0363"
                     /note="Na+/alanine symporter [Amino acid transport and
                     metabolism]; Region: AlsT; COG1115"
                     /db_xref="CDD:224040"
     gene            complement(355401..356438)
                     /gene="dctA"
                     /locus_tag="SSA_0364"
                     /db_xref="GeneID:4807294"
     CDS             complement(355401..356438)
                     /gene="dctA"
                     /locus_tag="SSA_0364"
                     /function="Amino acid transport and metabolism"
                     /note="involved in the import of serine and threonine
                     coupled with the import of sodium"
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine transporter SstT"
                     /protein_id="YP_001034367.1"
                     /db_xref="GeneID:4807294"
                     /translation="MANALSQQQKGQKSNMKTVIFLYLLGTFAAALVAVLVNFFFPIS
                     IELASSSQKVSPPDGIGQVLSNLLLQLVDNPVNALITANYIGILSWAVIFGIAMREAS
                     HHSKELLQTLADITSKIVEWIINLAPLGILGLVYTTISGKGFQALKSYGILLLALIAS
                     MLIVALVINPLISFIMLRKNPYPLVRRCLRVSGVTAFFTRSSAANIPVNMKLCRDLGL
                     NPETYSVSIPLGATINMAGAAITINTLTLAAVNTLDIRGDFGTALVLSIVAAISACGA
                     SGVAGGSLLLIPVACSLFGISNDLAMQVVSVGFVIGVIQDSCETALNSSTDVLFTAVA
                     EMSSWPKEKRY"
     misc_feature    complement(355422..356435)
                     /gene="dctA"
                     /locus_tag="SSA_0364"
                     /note="serine/threonine transporter SstT; Provisional;
                     Region: PRK13628"
                     /db_xref="CDD:184190"
     gene            356761..357624
                     /locus_tag="SSA_0365"
                     /db_xref="GeneID:4806978"
     CDS             356761..357624
                     /locus_tag="SSA_0365"
                     /function="Cell envelope biogenesis, outer membrane"
                     /note="GC: 46.06%; Transporter classification
                     TC:1.A.23.3.1. Transmembrane domains: 3. Codon Adaptation
                     Index (CAI): 0.748. Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="small-conductance mechanosensitive efflux
                     channel"
                     /protein_id="YP_001034368.1"
                     /db_xref="GeneID:4806978"
                     /translation="MSKTGNVFSRYIQQFDWSKIADDLFSKLVSLLLLFILFYIVKKI
                     LHLSVTKIIAPSLKLSKQDVARQKTITRLIENLLNYVLYFLLIYWVLSILGLPVSSLL
                     AGAGIAGVAIGMGAQGFLSDLVNGFFILLERQLDVGDNVRLTNGPINIAGTVISVGIR
                     TTQVRDADGTLHFVPNRNIMVVSNLSRGDMRVLIDIPIYAQTDLDEIYRIISKVNEEA
                     VPEHPEILKEPDVLGPQMASNGQFNFRISMIVQGGMQVSIYHIFYRLYHEALLREGIE
                     LPTLGPLSKGM"
     misc_feature    356791..357594
                     /locus_tag="SSA_0365"
                     /note="Small-conductance mechanosensitive channel [Cell
                     wall/membrane/envelope biogenesis]; Region: MscS; COG0668"
                     /db_xref="CDD:223740"
     misc_feature    356989..357588
                     /locus_tag="SSA_0365"
                     /note="Mechanosensitive ion channel; Region: MS_channel;
                     pfam00924"
                     /db_xref="CDD:279292"
     gene            357646..358272
                     /locus_tag="SSA_0366"
                     /db_xref="GeneID:4806921"
     CDS             357646..358272
                     /locus_tag="SSA_0366"
                     /note="GC: 43.06%; Transmembrane domains: 1. Codon
                     Adaptation Index (CAI): 0.786. Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034369.1"
                     /db_xref="GeneID:4806921"
                     /translation="MNQRIQQEIVSEDNLVYRLKRPLHKQGLFWAALVSGIIIFLLAL
                     LSILLVITTIGLMEENDHLKSLTGYHNSPLESYNSHAFEKTVEFSSGLKVTVHSAVED
                     SKKVMSDESTGVAVVATVTVENTSKKPILVSPYDFGLYDKKENVYILDGSTFDNTQIG
                     TNLAPGKSIRFDLVFDGEGGDEDTYTVTYENAKWQKEKNKTKQEKKKE"
     misc_feature    357883..358227
                     /locus_tag="SSA_0366"
                     /note="Domain of unknown function (DUF4352); Region:
                     DUF4352; pfam11611"
                     /db_xref="CDD:288464"
     gene            358449..359351
                     /locus_tag="SSA_0367"
                     /db_xref="GeneID:4806968"
     CDS             358449..359351
                     /locus_tag="SSA_0367"
                     /function="Posttranslational modification, protein
                     turnover, chaperones"
                     /note="GC: 43.08%; Codon Adaptation Index (CAI): 0.77.
                     Curator(s): T. Kitten; (possible metalloprotease)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034370.1"
                     /db_xref="GeneID:4806968"
                     /translation="MKINMIRSDKVYHELLELPLEKREGCFRAKILAPFATKYQTQHI
                     PLKAKYPGGFDALFLLGFMNQLPSTLSEKDRPAIDALSSDQLWQNCQDTIKRSIGLFE
                     QAGYDLEVEDYYFTILLGNPEKPMLQLNKGYSGDGGIPGYLMLSLLPNDYTLPRVQAA
                     LAHECNHNVRFQFIKWNQQTTLADWVVSEGLAESFAAELYGKDLIGPWVTSTSSEQLE
                     EIKPIISSQLQLTGMAEMAPYLYGDEIAEIQGQIPVGMPYAAGYAYGYHLIQAYLKKT
                     GKSIIEATVTPTEEILEATKDFWK"
     misc_feature    358704..359327
                     /locus_tag="SSA_0367"
                     /note="Predicted Zn-dependent protease (DUF2268); Region:
                     DUF2268; pfam10026"
                     /db_xref="CDD:287044"
     gene            359414..359782
                     /locus_tag="SSA_0368"
                     /db_xref="GeneID:4807169"
     CDS             359414..359782
                     /locus_tag="SSA_0368"
                     /note="GC: 36.59%; Codon Adaptation Index (CAI): 0.793.
                     Curator(s): T. Kitten, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034371.1"
                     /db_xref="GeneID:4807169"
                     /translation="MHYKRVELKVTNQGIHERKIFQGVKIFSRSKLSKDQKSILTQKL
                     YLTPKQNIVYYQRTDVNYDQNWHHNKDYYELAYGQIDRETVFKVCQDFDELSPFLEND
                     LLEKLKEKRSAGKFFEKLDI"
     misc_feature    359420..359779
                     /locus_tag="SSA_0368"
                     /note="EXLDI protein; Region: EXLDI; TIGR04342"
                     /db_xref="CDD:275138"
     gene            complement(359813..359986)
                     /locus_tag="SSA_0369"
                     /db_xref="GeneID:4807404"
     CDS             complement(359813..359986)
                     /locus_tag="SSA_0369"
                     /EC_number="1.4.1.4"
                     /function="Amino acid transport and metabolism"
                     /GO_function="GO:0016491 - oxidoreductase activity"
                     /note="GC: 41.38%; Codon Adaptation Index (CAI): 0.772.
                     Possibly incomplete product. Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="NADP-specific glutamate dehydrogenase"
                     /protein_id="YP_001034372.1"
                     /db_xref="GeneID:4807404"
                     /translation="MSVYSGRLKDIMTNIFNTAETYGLGKDYLAGANIAAFENVAKAM
                     IAQGICLSTIKLE"
     misc_feature    complement(359840..>359968)
                     /locus_tag="SSA_0369"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl21454"
                     /db_xref="CDD:304358"
     gene            complement(359987..360472)
                     /locus_tag="SSA_0370"
                     /db_xref="GeneID:4806942"
     CDS             complement(359987..360472)
                     /locus_tag="SSA_0370"
                     /EC_number="2.3.1.-"
                     /function="Amino acid transport and metabolism"
                     /note="GC: 45.68%; Codon Adaptation Index (CAI): 0.738.
                     Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="YP_001034373.1"
                     /db_xref="GeneID:4806942"
                     /translation="MNLRPMEVRDNPAVAQLIRASLEEFGLNKPGTVYFDSHLDHLAD
                     YYQHQERAAYFVLEDEGHLVGCGGFAPVSDKIAELQKLYVTKNSRGKGYSSRLIKQIF
                     QEARLAGYEQLYLETTTELATAVAVYQHYGFTSLQQPLSNAAGHPAMNIWMIKSLSSD
                     E"
     misc_feature    complement(360074..360445)
                     /locus_tag="SSA_0370"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_10; pfam13673"
                     /db_xref="CDD:290398"
     misc_feature    complement(360071..360301)
                     /locus_tag="SSA_0370"
                     /note="Acetyltransferase (GNAT) family; Region:
                     Acetyltransf_1; pfam00583"
                     /db_xref="CDD:278980"
     misc_feature    complement(order(360188..360193,360221..360229))
                     /locus_tag="SSA_0370"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(360503..361849)
                     /gene="gdhA"
                     /locus_tag="SSA_0371"
                     /db_xref="GeneID:4806972"
     CDS             complement(360503..361849)
                     /gene="gdhA"
                     /locus_tag="SSA_0371"
                     /EC_number="1.4.1.4"
                     /function="Amino acid transport and metabolism"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="converts 2-oxoglutarate to glutamate; in
                     Escherichia coli this enzyme plays a role in glutamate
                     synthesis when the cell is under energy restriction; uses
                     NADPH; forms a homohexamer"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate dehydrogenase"
                     /protein_id="YP_001034374.1"
                     /db_xref="GeneID:4806972"
                     /translation="MTTAKEYIQSTFETVKARNGHEAEFLQAVEEFLNTLEPVFEKHP
                     EYIEENILARITEPERVISFRVPWVDREGNVQVNRGYRVQFNSAVGPYKGGLRFHPTV
                     NQGILKFLGFEQIFKNVLTGLPIGGGKGGSDFDPKGKTDAEVMRFCQSFMTELQKHIG
                     PSLDVPAGDIGVGGREIGYLYGQYKRLNQFDAGVLTGKPLGFGGSLIRPEATGYGLVY
                     YTEEMLKANGQSFAGKKVVISGSGNVAQYALQKATELGATVISVSDSNGYVIDENGID
                     FDLLVDVKEKRRARLTEYAAEKATATYHEGSVWTYAEKYDIALPCATQNEINGEAAKR
                     LVAQGVICVSEGANMPSDLDAIAVYKENGIFYGPAKAANAGGVAVSALEMSQNSLRLS
                     WTREEVDGRLKDIMTNIFNTAKTTAETYGLGKDYLAGANIAAFENVANAMIAQGIV"
     misc_feature    complement(360506..361846)
                     /gene="gdhA"
                     /locus_tag="SSA_0371"
                     /note="glutamate dehydrogenase; Provisional; Region:
                     PRK09414"
                     /db_xref="CDD:181834"
     misc_feature    complement(361292..361678)
                     /gene="gdhA"
                     /locus_tag="SSA_0371"
                     /note="Glu/Leu/Phe/Val dehydrogenase, dimerization domain;
                     Region: ELFV_dehydrog_N; pfam02812"
                     /db_xref="CDD:280903"
     misc_feature    complement(360509..361264)
                     /gene="gdhA"
                     /locus_tag="SSA_0371"
                     /note="NAD(P) binding domain of glutamate dehydrogenase,
                     subgroup 2; Region: NAD_bind_2_Glu_DH; cd05313"
                     /db_xref="CDD:133455"
     misc_feature    complement(order(360806..360814,360881..360886,
                     361055..361060,361118..361126))
                     /gene="gdhA"
                     /locus_tag="SSA_0371"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:133455"
     gene            362202..363140
                     /gene="pyrDA"
                     /locus_tag="SSA_0373"
                     /db_xref="GeneID:4807019"
     CDS             362202..363140
                     /gene="pyrDA"
                     /locus_tag="SSA_0373"
                     /EC_number="1.3.98.1"
                     /function="Nucleotide transport and metabolism"
                     /note="catalyzes the conversion of dihydroorotate to
                     orotate in the pyrimidine biosynthesis pathway; subclass
                     1A is a dimer formed by two identical PyrD subunits each
                     containing an FMN group"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroorotate dehydrogenase 1A"
                     /protein_id="YP_001034375.1"
                     /db_xref="GeneID:4807019"
                     /translation="MVSTSTQIAGFAFDNCLMNAAGVACMTKEELAEVKDSAAGTFVT
                     KTATLEFRQGNPEPRYQDVPLGSINSMGLPNNGLDYYLDYLLELQESEPNRAFFLSLV
                     GMSPEETHTILKKVQASDFKGITELNLSCPNVPGKPQIAYDFETTEKILSEVFAYFTK
                     PLGIKLPPYFDIVHFDQAAAIFNKYPLKFVNCVNSIGNGLYIEDESVVIRPKNGFGGI
                     GGQYIKPTALANVHAFYQRLKPEIQIIGTGGVLTGRDAFEHILCGASMVQVGTTLHKE
                     GVAAFERITTELKAIMEEKGYENLEDFRGKLKYIEE"
     misc_feature    362208..363131
                     /gene="pyrDA"
                     /locus_tag="SSA_0373"
                     /note="dihydroorotate dehydrogenase 1A; Reviewed; Region:
                     PRK02506"
                     /db_xref="CDD:235045"
     misc_feature    362214..363116
                     /gene="pyrDA"
                     /locus_tag="SSA_0373"
                     /note="dihydroorotate dehydrogenase (subfamily 1) family
                     protein; Region: pyrD_sub1_fam; TIGR01037"
                     /db_xref="CDD:130109"
     misc_feature    order(362262..362264,362334..362339,362406..362408,
                     362412..362420,362583..362585,362592..362594,
                     362598..362600,362694..362696,362778..362786,
                     362859..362861,362946..362948,363009..363014)
                     /gene="pyrDA"
                     /locus_tag="SSA_0373"
                     /note="active site"
                     /db_xref="CDD:240092"
     misc_feature    order(362262..362264,362334..362339,362406..362408,
                     362412..362414,362583..362585,362694..362696,
                     362778..362780,362859..362861,362946..362948,
                     363009..363014)
                     /gene="pyrDA"
                     /locus_tag="SSA_0373"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:240092"
     misc_feature    order(362334..362336,362406..362408,362412..362420,
                     362583..362585,362592..362594,362598..362600,
                     362781..362786)
                     /gene="pyrDA"
                     /locus_tag="SSA_0373"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:240092"
     misc_feature    order(362334..362336,362592..362594,362694..362696)
                     /gene="pyrDA"
                     /locus_tag="SSA_0373"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:240092"
     misc_feature    order(362613..362618,362709..362714,362718..362720,
                     362787..362789,362793..362795,362799..362801,
                     362805..362807,362811..362813,362814..362822,
                     362829..362831,362844..362846,362865..362867,
                     362874..362876,362886..362888,362985..362987)
                     /gene="pyrDA"
                     /locus_tag="SSA_0373"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240092"
     gene            363303..364238
                     /locus_tag="SSA_0374"
                     /db_xref="GeneID:4807036"
     CDS             363303..364238
                     /locus_tag="SSA_0374"
                     /EC_number="1.8.4.11"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 48.72%; Codon Adaptation Index (CAI): 0.784.
                     Curator(s): T. Kitten, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide methionine sulfoxide reductase
                     msrA/msrB"
                     /protein_id="YP_001034376.1"
                     /db_xref="GeneID:4807036"
                     /translation="MAEIYLAGGCFWGLEEYFSRIEGVEETTVGYANGQVETTSYQLI
                     HQTDHAETVHLIYDEKRVSLREILLYYFRVIDPLSVNKQGNDVGRQYRTGVYYTDQAD
                     KAVIEQVFAEQEKQLGQKIAVELEPLRHYVLAEDYHQDYLKKNPGGYCHINVNDAYQP
                     LVDPGQYEKPTDVELKEQLTEEQYQVTQHSATERPFHNAYNATFEEGIYVDVTTGEPL
                     FFAGDKFESGCGWPSFSRPIARDVLKYYEDKSLGMERIEVRSRSGNAHLGHVFTDGPE
                     AAGGLRYCINSAALRFIPKEKMEAEGYGYLLTFMQ"
     misc_feature    363303..363773
                     /locus_tag="SSA_0374"
                     /note="Peptide methionine sulfoxide reductase MsrA
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: MsrA; COG0225"
                     /db_xref="CDD:223303"
     misc_feature    363801..364208
                     /locus_tag="SSA_0374"
                     /note="Peptide methionine sulfoxide reductase MsrB
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: MsrB; COG0229"
                     /db_xref="CDD:223307"
     gene            364397..365269
                     /locus_tag="SSA_0375"
                     /db_xref="GeneID:4807078"
     CDS             364397..365269
                     /locus_tag="SSA_0375"
                     /function="Inorganic ion transport and metabolism"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 41.92%; Transporter classification
                     TC:3.A.1.24.1. Codon Adaptation Index (CAI): 0.79. LipoP
                     prediction: SpII. SignalP prediction: Yes (prob. 1);
                     Curator(s): T. Kitten, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein transporter"
                     /protein_id="YP_001034377.1"
                     /db_xref="GeneID:4807078"
                     /translation="MMNLKKIFSVGLVGLAALGLAACGGSSSKESKSADGPVTVKVGV
                     MSLSDTEEARWNKVQEILDKENAGVKLEYTQFTDYSQPNQALLDGDVDINAFQHYNFL
                     ENWNKEKGADLVSVADTYIAPIRLYSGTKDGKNKYTDVKDIPENGTIAVPNDATNESR
                     ALYLLESAGLIKLDVKGKELATVANIKENKKNLTISELDASQTPASLTSADAAVVNNT
                     FVREAGIDYKKALFKEEANENSKQWYNLIAAKPDWKKSDKADAIEKIIKAYHTDEVKK
                     VIEESSDGMDQPVW"
     misc_feature    364397..365266
                     /locus_tag="SSA_0375"
                     /note="ABC-type metal ion transport system, periplasmic
                     component/surface antigen [Inorganic ion transport and
                     metabolism]; Region: NlpA; COG1464"
                     /db_xref="CDD:224381"
     gene            365519..366586
                     /locus_tag="SSA_0376"
                     /db_xref="GeneID:4806964"
     CDS             365519..366586
                     /locus_tag="SSA_0376"
                     /function="Inorganic ion transport and metabolism"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 43.91%; Transporter classification
                     TC:3.A.1.24.2. Codon Adaptation Index (CAI): 0.776.
                     Curator(s): T. Kitten, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="methionine ABC transporter ATPase"
                     /protein_id="YP_001034378.1"
                     /db_xref="GeneID:4806964"
                     /translation="MGKEIIKLDHIDVVFNQKKQNIKAVEDVTIHINQGDIYGIVGYS
                     GAGKSTLVRVINLLQVPSAGKITVDDTVFYDHHQVQLTAAQLRQKRKDIGMIFQHFNL
                     MAQMTAKENVAFALKHSPLSAAEKEKKVHTLLDLVGLADRADNYPAQLSGGQKQRVAI
                     ARALANDPKILISDESTSALDPKTTKQILALLQDLNQKLGLTIVLITHEMQIVKDIAN
                     RVAVMQNGQLIEEGSVLDIFSNPKNELTQDFITTATGINEAMIKINQQKIVQNLPENS
                     ILAHLKYSGVVTDTAIINDIYKQYQISANILHANIEILDHVPVGEMVVILSGETKQLA
                     AVQESLRETGVELHVLKEGSN"
     misc_feature    365531..366574
                     /locus_tag="SSA_0376"
                     /note="ABC-type methionine transport system, ATPase
                     component [Amino acid transport and metabolism]; Region:
                     AbcC; COG1135"
                     /db_xref="CDD:224058"
     misc_feature    365531..366244
                     /locus_tag="SSA_0376"
                     /note="ATP-binding cassette domain of methionine
                     transporter; Region: ABC_MetN_methionine_transporter;
                     cd03258"
                     /db_xref="CDD:213225"
     misc_feature    365642..365665
                     /locus_tag="SSA_0376"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213225"
     misc_feature    order(365651..365656,365660..365668,365810..365812,
                     366038..366043,366140..366142)
                     /locus_tag="SSA_0376"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213225"
     misc_feature    365801..365812
                     /locus_tag="SSA_0376"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213225"
     misc_feature    365966..365995
                     /locus_tag="SSA_0376"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213225"
     misc_feature    366026..366043
                     /locus_tag="SSA_0376"
                     /note="Walker B; other site"
                     /db_xref="CDD:213225"
     misc_feature    366050..366061
                     /locus_tag="SSA_0376"
                     /note="D-loop; other site"
                     /db_xref="CDD:213225"
     misc_feature    366128..366148
                     /locus_tag="SSA_0376"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213225"
     misc_feature    366341..366568
                     /locus_tag="SSA_0376"
                     /note="This domain is found at the C-terminus of ABC
                     transporter proteins involved in D-methionine transport as
                     well as a number of ferredoxin-like proteins; Region: NIL;
                     smart00930"
                     /db_xref="CDD:197998"
     gene            366586..367278
                     /locus_tag="SSA_0377"
                     /db_xref="GeneID:4805827"
     CDS             366586..367278
                     /locus_tag="SSA_0377"
                     /function="Inorganic ion transport and metabolism"
                     /note="GC: 47.33%; Transporter classification
                     TC:3.A.1.24.1. Transmembrane domains: 6. Codon Adaptation
                     Index (CAI): 0.764. Curator(s): T. Kitten, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="methionine ABC transporter permease"
                     /protein_id="YP_001034379.1"
                     /db_xref="GeneID:4805827"
                     /translation="MLQLIQQFMPNVYRMGWSGQAGWGTAIYLTLYMTIIPFFIGGIL
                     GFIAGLLLVLTGPRGILENRLVFFVLDKVTSIFRAIPFIILLALINPFTRIIVGTGIG
                     PTAALVPLSLAVFPFFARQVQVVLSELDRGVIEAAQASGATFWDIVGVYLREGLPDLI
                     RVTTVTLISLVGETAMAGAIGAGGLGNVALTYGYQRFNHDVTILATILILLLIFFIQF
                     VGDFLTRKISHR"
     misc_feature    366613..367275
                     /locus_tag="SSA_0377"
                     /note="ABC-type methionine transport system, permease
                     component [Amino acid transport and metabolism]; Region:
                     MetP; COG2011"
                     /db_xref="CDD:224922"
     misc_feature    order(366811..366855,367099..367107)
                     /locus_tag="SSA_0377"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(366979..367017,367030..367035,367045..367047)
                     /locus_tag="SSA_0377"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            367416..368687
                     /locus_tag="SSA_0378"
                     /db_xref="GeneID:4805840"
     CDS             367416..368687
                     /locus_tag="SSA_0378"
                     /function="Nucleotide transport and metabolism / General
                     function prediction only"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 49.29%; Codon Adaptation Index (CAI): 0.772.
                     Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="chlorohydrolase"
                     /protein_id="YP_001034380.1"
                     /db_xref="GeneID:4805840"
                     /translation="MKAYTNVNLVTCDSAFHVYRDGLLVVEDDRIAYCGPYDESWLGK
                     CSETVDYEGAWIMPGLVNCHTHSAMTLLRGIRDDSNLHEWLEDYIWPAESQFTADLTT
                     EAVQLALAEMLLSGTTTFNDMYNPQGVEIDRIYQTVRQSGMRCYFSPTLFSSEAETAE
                     ETLDRTRTIIEKILSYDDEDFQVMVAPHSPYACDEELLKGSLELARELDLKLHIHVAE
                     TQDENKIILERYGKRPLAFLKGLGYLEQPAIFAHGVELNPSEIADLAASPVSIAHNPI
                     SNLKLASGVAPVTDLLAAGVTVGLATDSVASNNNLDMFEEGRTAALLQKMRAGDATQF
                     TIEQALKALTIEGAEALGLDNKIGSLEAGKQADFIVIQPKGRLHLYPLENMLSHLVYA
                     VKGSDVQDVYIAGQQVVRNGQVLTVDVGNFV"
     misc_feature    367416..368672
                     /locus_tag="SSA_0378"
                     /note="chlorohydrolase; Validated; Region: PRK06687"
                     /db_xref="CDD:180657"
     misc_feature    367452..368645
                     /locus_tag="SSA_0378"
                     /note="guanine deaminase; Provisional; Region: PRK09228"
                     /db_xref="CDD:236419"
     misc_feature    order(367605..367607,367611..367613,368058..368060,
                     368067..368069,368169..368171,368322..368324)
                     /locus_tag="SSA_0378"
                     /note="active site"
                     /db_xref="CDD:238623"
     misc_feature    order(367683..367685,367692..367694,367782..367787,
                     367860..367865)
                     /locus_tag="SSA_0378"
                     /note="putative substrate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:238623"
     gene            368962..370893
                     /locus_tag="SSA_0379"
                     /db_xref="GeneID:4805973"
     CDS             368962..370893
                     /locus_tag="SSA_0379"
                     /EC_number="2.7.1.69"
                     /function="Carbohydrate transport and metabolism"
                     /note="GC: 44.98%; Transporter classification
                     TC:4.A.1.2.6. Transmembrane domains: 11. Codon Adaptation
                     Index (CAI): 0.805. Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system beta-glucoside-specific transporter
                     subunit EII"
                     /protein_id="YP_001034381.1"
                     /db_xref="GeneID:4805973"
                     /translation="MAKDYTELAKDIVAHVGGKDNITKLVHCVTRLRFSLKDESKADT
                     DYLMKRDGVVTVVKAGGQYQVVIGNHVPDVYETVLKVAGISGEGSVDADDDAVEGNLF
                     DRFIALVSGLFQPMLGTLSAAGMIKGVVAIMAALGVAKTDGAYVVLNAAGDGLFQFLP
                     LILAITAAKRFKMNQFTALAIGFALVYPNIAASFTAEKPLYTLFAGTPIESPIFSTFF
                     GLPIIFPASSYLSTVLPVIAAVWAGAKIEKGFKKIIPDVVKVFIVPFFTLLITVPLAF
                     LVIGPVMSWASDLVGALFTGIYDFSPVLYGIVLGAAWQVLVMFGLHWGLVPLAILELQ
                     KGPGVILVASIAICFAQAGALLNIMMRTKEEKVRQLSIPAFISALFGVTEPAIYGITL
                     PMRLPFIMTCISGALTGAYLAFFDVKMQVMGGMGLFAIPSFIEASNSMTLIHFLIAIV
                     ANFVLGFGLTQLIKIPNLFGGPSEKDAAESLDSEKERVSAGITEQVVTSPLAGEVVAL
                     EDTPDAVFASGAMGKGVAIEPSVGEVVAPADGVIRLLFPTNHAIGLATDDGAELLIHV
                     GMDTVALDGKGFTAHVVQGSKVKKGQLLLSFDIDTIKEAGYPVTTPIIVTNTANYKQI
                     EVLAKGEIQLGNQLLELKK"
     misc_feature    368974..370887
                     /locus_tag="SSA_0379"
                     /note="PTS system, beta-glucoside-specific IIABC
                     component; Region: PTS-II-ABC-beta; TIGR01995"
                     /db_xref="CDD:273919"
     misc_feature    368977..369210
                     /locus_tag="SSA_0379"
                     /note="PTS_IIB, PTS system, glucose/sucrose specific IIB
                     subunit. The bacterial phosphoenolpyruvate: sugar
                     phosphotransferase system (PTS) is a multi-protein system
                     involved in the regulation of a variety of metabolic and
                     transcriptional processes. This family...; Region:
                     PTS_IIB_glc; cd00212"
                     /db_xref="CDD:238130"
     misc_feature    369040..369060
                     /locus_tag="SSA_0379"
                     /note="active site turn [active]"
                     /db_xref="CDD:238130"
     misc_feature    369043..369045
                     /locus_tag="SSA_0379"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238130"
     misc_feature    369256..370401
                     /locus_tag="SSA_0379"
                     /note="Phosphotransferase system IIC components,
                     glucose/maltose/N-acetylglucosamine-specific [Carbohydrate
                     transport and metabolism]; Region: PtsG1; COG1263"
                     /db_xref="CDD:224183"
     misc_feature    370435..370890
                     /locus_tag="SSA_0379"
                     /note="Phosphotransferase system IIA component
                     [Carbohydrate transport and metabolism]; Region: NagE;
                     COG2190"
                     /db_xref="CDD:225101"
     misc_feature    order(370498..370509,370519..370524,370588..370593,
                     370597..370602,370618..370626,370642..370650,
                     370654..370656,370666..370668,370672..370677,
                     370711..370713,370807..370809,370816..370818)
                     /locus_tag="SSA_0379"
                     /note="HPr interaction site; other site"
                     /db_xref="CDD:238128"
     misc_feature    order(370498..370500,370504..370509,370513..370515,
                     370519..370524,370591..370593,370597..370599,
                     370609..370611,370648..370650,370654..370656,
                     370666..370668,370672..370677,370681..370683,
                     370807..370809)
                     /locus_tag="SSA_0379"
                     /note="glycerol kinase (GK) interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238128"
     misc_feature    order(370603..370605,370609..370611,370654..370656,
                     370660..370662)
                     /locus_tag="SSA_0379"
                     /note="active site"
                     /db_xref="CDD:238128"
     misc_feature    370654..370656
                     /locus_tag="SSA_0379"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238128"
     gene            371056..372438
                     /locus_tag="SSA_0380"
                     /db_xref="GeneID:4806649"
     CDS             371056..372438
                     /locus_tag="SSA_0380"
                     /function="Cell envelope biogenesis, outer membrane"
                     /note="GC: 46.71%; Transmembrane domains: 1. Codon
                     Adaptation Index (CAI): 0.788. Curator(s): T. Kitten, J.
                     Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="enzyme of poly-gamma-glutamate biosynthesis
                     (capsule formation)"
                     /protein_id="YP_001034382.1"
                     /db_xref="GeneID:4806649"
                     /translation="MDKKILWEKIQTFFQELWKKISAFAAEHTLLTDAYQAWRDWFKE
                     LPFPRPKIFQKQLSNRQFVGVLLTVVGLSAGLILLSEHVQDFTFLSPSKKEQQSGSSQ
                     NQMVRIMATGDLLYHDGLYLSAQKEDGTYDFSENFHYAKEWLRQGDLVLGDFEGTIRP
                     DYPLNGYPLFNAPEAVVPAIKDAGYQVMDLAHNHILDSGLEGVFTTAQAFEKEGITPV
                     GVYPHESRSQAPLLIKEVKGIRIALLAYSYGYNGMEGLLSQEDYDNRLSDLDEEKMRA
                     EIERAEKEADITVVMPQMGVEYQLEPTEEQMTLYHKMVDWGADIVFGGHPHVVEPAEI
                     LEKDGQKKLIMYSMGNFISNQRIETMEGIENAHWTERGVLMDVTIEKTPKGTQIKSAQ
                     AHPSWVSRVEKGTTSADGLPLYTYQTWILDDFVEGGKYRDKLDQETRARIDTAYQEMN
                     SHVGLNWPGQ"
     misc_feature    371374..372120
                     /locus_tag="SSA_0380"
                     /note="Bacterial capsule synthesis protein PGA_cap;
                     Region: PGA_cap; pfam09587"
                     /db_xref="CDD:286646"
     misc_feature    order(371392..371394,371398..371400,371518..371520,
                     371632..371637,371932..371934,372028..372030,
                     372034..372036)
                     /locus_tag="SSA_0380"
                     /note="putative active site [active]"
                     /db_xref="CDD:277327"
     misc_feature    order(371392..371394,371398..371400,371518..371520,
                     371632..371634,371932..371934,372028..372030,
                     372034..372036)
                     /locus_tag="SSA_0380"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:277327"
     gene            372903..373574
                     /locus_tag="SSA_0381"
                     /db_xref="GeneID:4806110"
     CDS             372903..373574
                     /locus_tag="SSA_0381"
                     /note="GC: 32.89%; Transmembrane domains: 2. Codon
                     Adaptation Index (CAI): 0.737. Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034383.1"
                     /db_xref="GeneID:4806110"
                     /translation="MHFFEQLFLLIDFLIHFLPLLFIFVVFIVSWIVYICIKKPFYKN
                     IYGKVISLLFLGTLIWNLVYFGGEDHGGSYQLVKLKPGEAVYVKIKKPYLDLIKGSGV
                     SVLKFKDKTDGKIRIYDSYLREQIGENEYIYDAEKKSVHYYNEKDGRITIPNEQALSD
                     LGVEFNENYSIDVNFTQNRAFVFSVSDSDQDITVQNKSDKPISFYVKAYHRVYGSEGR
                     DRDLE"
     gene            complement(373690..374562)
                     /locus_tag="SSA_0382"
                     /db_xref="GeneID:4805960"
     CDS             complement(373690..374562)
                     /locus_tag="SSA_0382"
                     /function="Transcription"
                     /note="GC: 45.13%; Codon Adaptation Index (CAI): 0.758.
                     Helix-turn-helix prediction: AraC. Curator(s): T. Kitten,
                     J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_001034384.1"
                     /db_xref="GeneID:4805960"
                     /translation="MIDLGQLHKNTVFKNQGTPYSLTRTITENGHPDILFHWHTDVEM
                     IYVHEGKAQFHIDDDYFNSEKGDIILIRPNALHSIHPINDERHYMDAINFHLDLMGYS
                     AMDQASINYLQPLYNGQLDLTHVIKPNDTAYAEIRQCLLAAMETGYFRKSHYEFQLKA
                     QLNQLFYLLFENGYVISKDLSPEGYRKEEKIRSIIDYINAHYQEDLNIDQLAGICGYS
                     STHFMNFFKKHLGVSCIEYLIQFRLRKAAELLQHSNLSVLEISSQAGFNNLSNFNRQF
                     KKYYQMTPSQYRKK"
     misc_feature    complement(374065..374481)
                     /locus_tag="SSA_0382"
                     /note="Conserved domain found in cupin and related
                     proteins; Region: cupin_like; cl21464"
                     /db_xref="CDD:304367"
     misc_feature    complement(373849..373971)
                     /locus_tag="SSA_0382"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:278590"
     misc_feature    complement(373699..373950)
                     /locus_tag="SSA_0382"
                     /note="helix_turn_helix, arabinose operon control protein;
                     Region: HTH_ARAC; smart00342"
                     /db_xref="CDD:197666"
     misc_feature    complement(373696..373809)
                     /locus_tag="SSA_0382"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:278590"
     gene            374674..376113
                     /gene="bglA"
                     /locus_tag="SSA_0383"
                     /db_xref="GeneID:4806549"
     CDS             374674..376113
                     /gene="bglA"
                     /locus_tag="SSA_0383"
                     /EC_number="3.2.1.86"
                     /note="GC: 48.06%; Codon Adaptation Index (CAI): 0.785.
                     Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="Beta-glucosidase"
                     /protein_id="YP_001034385.1"
                     /db_xref="GeneID:4806549"
                     /translation="MGKFPQNFLWGGATAANQYEGAYNLDGKGLSVQDVTPKGGVPAK
                     PGDRNPLITDGPTPDNLKLEGIDFYHRYKEDIALFAEMGFKVYRTSIAWSRIFPNGDE
                     LEPNEAGLQFYDNLFDELAKYGIEPLITLSHYETPLHLARQYNGWANRDLIGFYERYV
                     RTVFTRYRDKVKYWLTFNEINSVLHAPFMSGGIATPAEELSKQDLYQAVHHELVASAL
                     ATKIGHEINPDFKIGCMVLAMPAYPMTPKPEDVLAAREFENQNYLFSDIHVRGKYPAY
                     INRFFKENGIEIQFAPGDKELLAENTVDFISFSYYMSVVAAHDPENYSSGRGNLLGGI
                     MNPHLASSEWGWQIDPVGLRLVLNSFYDRYQLPLFIVENGLGAKDVLVDGPNGPTVED
                     DYRIDYLKQHLQQVGEALEDGVELLGYTTWGCIDLVSASTAELSKRYGFIYVDRNDDG
                     SGTLARYKKKSFDWYKEVIATNGDSLYQD"
     misc_feature    374674..376098
                     /gene="bglA"
                     /locus_tag="SSA_0383"
                     /note="Beta-glucosidase/6-phospho-beta-glucosidase/beta-
                     galactosidase [Carbohydrate transport and metabolism];
                     Region: BglB; COG2723"
                     /db_xref="CDD:225343"
     gene            376380..378509
                     /locus_tag="SSA_0384"
                     /db_xref="GeneID:4805851"
     CDS             376380..378509
                     /locus_tag="SSA_0384"
                     /function="Cell division and chromosome partitioning"
                     /note="GC: 43.15%; Transmembrane domains: 1. Codon
                     Adaptation Index (CAI): 0.803. LipoP prediction: SpII.
                     SignalP prediction: Yes (prob. 0.997); Curator(s): T.
                     Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034386.1"
                     /db_xref="GeneID:4805851"
                     /translation="MSRKIRFISLLTLLICFLMGCSLFQKNGGGPGEQGGQFSESVRK
                     LREKYSKNTPYDVQEKVIQIKENEPITFPTEVQKPNDFETLPHAGQTELISSFEIYGD
                     SNLRAILGGDFKLNDKRQIVIEPAYHFSATRVEPNGEHTEYGLAKQGESWGVFDTLYL
                     LQRDDERTGKKLKKPKLWIVKIDKKGRDKLALKTKSSLLGDGRLQLEWTEVPGADSYS
                     IIKREYVTMPGSDTKTGLYNYKEVDRVTSTVYRTDLPTHYDSRNGGRSGDDPILARQR
                     LLQAYDQDYSKKTVEKKPYELLVVPLKDKEALGTISNPISSDSFAKLMPNQIDFRTFS
                     DQVSALRQKGNIPEEAPLQMMDGQTQNFPIVYEKIEKEGRDVRCLVSIKGMPTVKTDF
                     FIEQASVEEVQPVVDKHNEKVNKEESKSGVSEKYISVEQADLDLKGKTVVHDVSDIEE
                     RVAARSAAQEYFAKALLSDAEYVDYSEFPELSEGDVSELLHDVLEQNPVIQQGVVPTI
                     DAKQHVVSFKYDANETAKYKKARKKVKEIVKDIIKDQMSDREKIEAINQYMIEHISYD
                     KAAYQGFLNYKTSIENKESEEAISKAFKDMQDGIRKYESSFDITGPLFEGKGVCQAYA
                     VTFQALAQEAGLETMYVSGNTDDFDPHAWNFAKVDGQWLALDVTWNDSDGDSAKKENE
                     YLLLAMDNPLYAQSHYAFDRYEDAIKE"
     misc_feature    377985..378377
                     /locus_tag="SSA_0384"
                     /note="Transglutaminase-like superfamily; Region:
                     Transglut_core; pfam01841"
                     /db_xref="CDD:280085"
     gene            complement(378616..380340)
                     /gene="opuAb"
                     /locus_tag="SSA_0385"
                     /db_xref="GeneID:4807972"
     CDS             complement(378616..380340)
                     /gene="opuAb"
                     /locus_tag="SSA_0385"
                     /function="Amino acid transport and metabolism"
                     /note="GC: 49.22%; Transporter classification
                     TC:3.A.1.12.5. Transmembrane domains: 7. Codon Adaptation
                     Index (CAI): 0.772. Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="glycine/betaine ABC transporter permease"
                     /protein_id="YP_001034387.1"
                     /db_xref="GeneID:4807972"
                     /translation="MDILQQPIPVSQWVEAFTNWVTDTFSGLFSVLQAIGNAIMNGMT
                     DTLLFIPPLLFIAVITIFTYLISKRKLGLPLLTLLGLLFVYNQGLWENLMNTVTLVIV
                     SSAISIIIGIPLGIWMAKSNRVEAVIKPLLDFMQTMPAFVYLIPAVAFFGIGMVPGVF
                     ASVIFALPPTVRFTNLAIRQISTELIEASDSFGGTGKQKLFKVELPLAKNTILAGVNQ
                     TIMLALSMVVTASMIGAPGLGRGVLSALQHADIGSGFVNGVSLVILAIIIDRLTQKLN
                     QPLAKKSPVTTKEKRNKVMLWSALAAVFLTAFVGNQVTKLQQSKKEKVNLAYVEWDSE
                     VASTNVVAEALKEMGYDVTITPLDNAVMWKSVANGEADAMVSAWLPTTHAALYEEYKD
                     KLVDLGPNLEGVKTGLVVPSYMDADSIEDLSDQAKKTITGIEPGAGIMTATEKTMQEY
                     SNLSGWNLSSSSTGAMTTALDQAIKDKEDIIVTGWSPHWMFSKYDLKYLKDPKGTMGG
                     KEAIHTITRKNLDKDLPEVNKVLDNFNWTQKDMEEVMLKINEGSSPEAAAKEWIKNHQ
                     KEVESWKK"
     misc_feature    complement(379495..380340)
                     /gene="opuAb"
                     /locus_tag="SSA_0385"
                     /note="ABC-type proline/glycine betaine transport system,
                     permease component [Amino acid transport and metabolism];
                     Region: ProW; COG4176"
                     /db_xref="CDD:226644"
     misc_feature    complement(order(379537..379542,379549..379554,
                     379558..379563,379570..379575,379603..379608,
                     379645..379650,379657..379668,379687..379689,
                     379696..379701,379741..379743,379792..379794,
                     379801..379806,379816..379818,379822..379827,
                     379834..379836,379840..379842,379846..379851,
                     379897..379899,379903..379908,379915..379944,
                     379948..379959,379984..379986,379999..380004))
                     /gene="opuAb"
                     /locus_tag="SSA_0385"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(379651..379668,379897..379941))
                     /gene="opuAb"
                     /locus_tag="SSA_0385"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(379573..379575,379603..379605,
                     379612..379614,379648..379650,379864..379866,
                     379897..379899))
                     /gene="opuAb"
                     /locus_tag="SSA_0385"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(379720..379722,379732..379737,
                     379753..379791))
                     /gene="opuAb"
                     /locus_tag="SSA_0385"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(378619..379473)
                     /gene="opuAb"
                     /locus_tag="SSA_0385"
                     /note="ABC-type proline/glycine betaine transport system,
                     periplasmic component [Amino acid transport and
                     metabolism]; Region: ProX; COG2113"
                     /db_xref="CDD:225024"
     misc_feature    complement(378619..379374)
                     /gene="opuAb"
                     /locus_tag="SSA_0385"
                     /note="Substrate binding domain of Lactococcus lactis
                     ABC-type transporter OpuA and related proteins; the type 2
                     periplasmic binding protein fold; Region: PBP2_OpuAC_like;
                     cd13639"
                     /db_xref="CDD:270357"
     misc_feature    complement(order(378886..378888,379027..379032,
                     379042..379044,379123..379125,379207..379209,
                     379342..379344,379348..379350))
                     /gene="opuAb"
                     /locus_tag="SSA_0385"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:270357"
     gene            complement(380355..381545)
                     /gene="opuAa"
                     /locus_tag="SSA_0386"
                     /db_xref="GeneID:4806036"
     CDS             complement(380355..381545)
                     /gene="opuAa"
                     /locus_tag="SSA_0386"
                     /EC_number="3.6.3.32"
                     /function="Amino acid transport and metabolism"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 48.53%; Transporter classification
                     TC:3.A.1.12.5. Codon Adaptation Index (CAI): 0.781.
                     Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="glycine-betaine ABC transporter ATPase
                     component"
                     /protein_id="YP_001034388.1"
                     /db_xref="GeneID:4806036"
                     /translation="MNKLEVKHLTKIFGKRQKQALEMVQQAKSKTKILEKTGATVGVY
                     DVNFEVQAGEIFVIMGLSGSGKSTLIRLLNRLIDPTSGDIYIDGQDVAKMNEEELRDV
                     RRHKLNMVFQNFGLFPHRTILENTEFGLEVRGVDKEERTRLAEQALDNAGLLSFKDQY
                     PDQLSGGMQQRVGLARALANNPDILLMDEAFSALDPLIRREMQDELLDLQAEHERTII
                     FITHDLNEALRIGDRIAIMADGQIMQIGTGEEILTNPANDFVREFVEDVDRSKVLTAQ
                     NIMTTPLTTNIDIDGPTVALNRMKKEEVSMLLAVDRKRHLKGSLTAEAARDARKQHQA
                     LAEVIDKNVRKVTQETLITDIFPLIYDSPAPLAVVDDKDKLVGVIIKGRVIEALANTT
                     ESEE"
     misc_feature    complement(380376..381545)
                     /gene="opuAa"
                     /locus_tag="SSA_0386"
                     /note="ABC-type proline/glycine betaine transport system,
                     ATPase component [Amino acid transport and metabolism];
                     Region: ProV; COG4175"
                     /db_xref="CDD:226643"
     misc_feature    complement(380730..381536)
                     /gene="opuAa"
                     /locus_tag="SSA_0386"
                     /note="ATP-binding cassette domain of the osmoprotectant
                     proline/glycine betaine uptake system; Region:
                     ABC_Pro_Gly_Betaine; cd03294"
                     /db_xref="CDD:213261"
     misc_feature    complement(381345..381368)
                     /gene="opuAa"
                     /locus_tag="SSA_0386"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213261"
     misc_feature    complement(order(380880..380882,380979..380984,
                     381210..381212,381342..381350,381354..381359))
                     /gene="opuAa"
                     /locus_tag="SSA_0386"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213261"
     misc_feature    complement(381210..381221)
                     /gene="opuAa"
                     /locus_tag="SSA_0386"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213261"
     misc_feature    complement(381027..381056)
                     /gene="opuAa"
                     /locus_tag="SSA_0386"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213261"
     misc_feature    complement(380979..380996)
                     /gene="opuAa"
                     /locus_tag="SSA_0386"
                     /note="Walker B; other site"
                     /db_xref="CDD:213261"
     misc_feature    complement(380961..380972)
                     /gene="opuAa"
                     /locus_tag="SSA_0386"
                     /note="D-loop; other site"
                     /db_xref="CDD:213261"
     misc_feature    complement(380874..380894)
                     /gene="opuAa"
                     /locus_tag="SSA_0386"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213261"
     misc_feature    complement(380385..380711)
                     /gene="opuAa"
                     /locus_tag="SSA_0386"
                     /note="The CBS domain, named after human CBS, is a small
                     domain originally identified in cystathionine
                     beta-synthase and is subsequently found in a wide range of
                     different proteins. CBS domains usually occur in tandem
                     repeats. They associate to form a so-called...; Region:
                     CBS_pair; cl15354"
                     /db_xref="CDD:301603"
     gene            complement(381792..382433)
                     /locus_tag="SSA_0387"
                     /db_xref="GeneID:4807916"
     CDS             complement(381792..382433)
                     /locus_tag="SSA_0387"
                     /function="Inorganic ion transport and metabolism"
                     /note="GC: 48.29%; Codon Adaptation Index (CAI): 0.735.
                     Helix-turn-helix prediction: AraC. Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_001034389.1"
                     /db_xref="GeneID:4807916"
                     /translation="MSKKEVAFPRYQQIAVAIAERIVDGKYPIGSKIYARSTLASNFN
                     VSPETARKAINVLVDLEIMEVRHGSGAFISSKEKAQQFLETYKDVNSLQDLKSKLHQS
                     IQRQEEEFANFSQLLNQLLSRTKDVQQRFPFNPYELQLSADAINLGKSINELNIWHST
                     GATIVAVQQGDQLLISPGPYTKLEAGNTIYFVGNELSVGLMHNLFFNEIETNK"
     misc_feature    complement(<382086..382409)
                     /locus_tag="SSA_0387"
                     /note="DNA-binding transcriptional regulator, GntR family
                     [Transcription]; Region: MngR; COG2188"
                     /db_xref="CDD:225099"
     misc_feature    complement(381819..>382133)
                     /locus_tag="SSA_0387"
                     /note="K+/H+ antiporter YhaU, regulatory subunit KhtT
                     [Inorganic ion transport and metabolism]; Region: KhtT;
                     cl27466"
                     /db_xref="CDD:332287"
     gene            382614..384308
                     /locus_tag="SSA_0388"
                     /db_xref="GeneID:4806825"
     CDS             382614..384308
                     /locus_tag="SSA_0388"
                     /function="DNA replication, recombination, and repair"
                     /note="GC: 45.37%; Transmembrane domains: 2. Codon
                     Adaptation Index (CAI): 0.746. SignalP prediction: Yes
                     (prob. 0.933); Helix-turn-helix prediction: AraC.
                     Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="mismatch repair ATPase"
                     /protein_id="YP_001034390.1"
                     /db_xref="GeneID:4806825"
                     /translation="MSQFILVLLGFLAVLVLVIASAIRRKLRFKKRLTAAWGSHERVD
                     CRPDSESSLYESFLLDEEAGTYDSLVDDQTWGDLDFFDIFQDIDTASQSSLGSEYLYS
                     KLRLLHFEADQDFDDLQAYLAQHPEVRSQLQLLFSEIGKKNHNQAKKLIYKPAQANHR
                     GSFYLFLALIPLLSPFLYFINPSLGYIAPITSMAFNIVYSMATRWSLEMKLDSMSYLV
                     RIFYIGKKIARLPLPQQAALKEALASFSRIQLFGEVFRPQSGASELEIFYLYINSVLL
                     IPQLAQAYISNRLVKANQQARQVLEILGRLEAAIAVLNYKESLPIYTKPSFTSSAGMK
                     GKGLYHPLLERPVSNNLDFSKNMMISGDNASGKSTYLRIAAINAILAQGLGFACAESL
                     TLQHGHVLSSMDVTDDIGSGDSYFIAESRAIERIIDSLEEEGLHYFFIDELFKGTNTV
                     ERIGAGLAIIDWLAQKPCLYMISSHDVELVAASGQLNAQYHFDSQYIAGEIVFDYKIK
                     QGSALTKNAVNTLESLNYPEEITDTAREIITAYEASGSWNLLEKRQSKLDDKDRNG"
     misc_feature    383613..384179
                     /locus_tag="SSA_0388"
                     /note="P-loop containing Nucleoside Triphosphate
                     Hydrolases; Region: P-loop_NTPase; cl21455"
                     /db_xref="CDD:304359"
     misc_feature    383694..383717
                     /locus_tag="SSA_0388"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(383703..383708,383712..383720,383823..383825,
                     383934..383939,384036..384038)
                     /locus_tag="SSA_0388"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    383814..383825
                     /locus_tag="SSA_0388"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    383838..383879
                     /locus_tag="SSA_0388"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    383922..383939
                     /locus_tag="SSA_0388"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    383946..383957
                     /locus_tag="SSA_0388"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    384024..384044
                     /locus_tag="SSA_0388"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            384312..385142
                     /locus_tag="SSA_0389"
                     /db_xref="GeneID:4806786"
     CDS             384312..385142
                     /locus_tag="SSA_0389"
                     /function="General function prediction only"
                     /note="GC: 46.69%; Codon Adaptation Index (CAI): 0.747.
                     Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034391.1"
                     /db_xref="GeneID:4806786"
                     /translation="MSIKMIATDMDGTLLDGQGQLDLPRLTTILDELEKRDIRFVVAT
                     GNEIPRMRLLLGDLVERMTLVVANGARIFEKNRLSMSSFWEPGLIRDALTYFSGHERE
                     LQLVVTSEIGGFVQEGTEFPLIEKVMTKEMAQLFYKRMNFLPSLQDYPFDKVLKMSMM
                     VEEAAAVEHARLINQHFAGRLSAVASGYGAIDILQDGMHKAWGLQQLMAKWQIQSSGI
                     MAFGDSENDIEMLELAGISYAMENGDERVKKIADYLAPANTEAGVLQILEQYLEEEKG
                     "
     misc_feature    384312..385133
                     /locus_tag="SSA_0389"
                     /note="Hydroxymethylpyrimidine pyrophosphatase and other
                     HAD family phosphatases [Coenzyme transport and
                     metabolism, General function prediction only]; Region:
                     Cof; COG0561"
                     /db_xref="CDD:223635"
     misc_feature    384327..>384542
                     /locus_tag="SSA_0389"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    order(384336..384344,384441..384446)
                     /locus_tag="SSA_0389"
                     /note="active site"
                     /db_xref="CDD:119389"
     misc_feature    384336..384353
                     /locus_tag="SSA_0389"
                     /note="motif I; other site"
                     /db_xref="CDD:119389"
     misc_feature    384441..384443
                     /locus_tag="SSA_0389"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     misc_feature    <384897..385067
                     /locus_tag="SSA_0389"
                     /note="Haloacid Dehalogenase-like Hydrolases; Region:
                     HAD_like; cl21460"
                     /db_xref="CDD:304363"
     gene            385142..385774
                     /locus_tag="SSA_0390"
                     /db_xref="GeneID:4806773"
     CDS             385142..385774
                     /locus_tag="SSA_0390"
                     /function="Amino acid transport and metabolism"
                     /note="GC: 47.71%; Codon Adaptation Index (CAI): 0.763.
                     Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034392.1"
                     /db_xref="GeneID:4806773"
                     /translation="MAVQLLEEWLLKEQAKLQQNYRELNQLSVKEPDIIFIGDSIVEY
                     YPLQELLQTDKRLINRGIRGYKTDLLLENLDAHLFGQALDKVFILIGTNDIGKAMPQT
                     ETLANLEAVIQEISRDYPLAQIQLLSVLPVNEAPAYKSTVYVRSNEKIQALNQAYRQL
                     ANAYMNVQFIDLYDAFLNEEGQLRPDYTTDGLHLTIPGYAVLSKALQEYL"
     misc_feature    385235..385771
                     /locus_tag="SSA_0390"
                     /note="NnaC (CMP-NeuNAc synthetase) _like subfamily of
                     SGNH_hydrolases, a diverse family of lipases and
                     esterases. The tertiary fold of the enzyme is
                     substantially different from that of the alpha/beta
                     hydrolase family and unique among all known hydrolases;
                     its...; Region: NnaC_like; cd01841"
                     /db_xref="CDD:238879"
     misc_feature    order(385259..385261,385331..385333,385418..385420,
                     385709..385711,385718..385720)
                     /locus_tag="SSA_0390"
                     /note="active site"
                     /db_xref="CDD:238879"
     misc_feature    order(385259..385261,385709..385711,385718..385720)
                     /locus_tag="SSA_0390"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238879"
     misc_feature    order(385259..385261,385331..385333,385418..385420)
                     /locus_tag="SSA_0390"
                     /note="oxyanion hole [active]"
                     /db_xref="CDD:238879"
     gene            386086..387861
                     /gene="spxB"
                     /locus_tag="SSA_0391"
                     /db_xref="GeneID:4806355"
     CDS             386086..387861
                     /gene="spxB"
                     /locus_tag="SSA_0391"
                     /EC_number="1.2.3.3"
                     /function="acetolactate synthase, pyruvate dehydrogenase
                     (cytochrome), glyoxylate carboligase, phosphonopyruvate
                     decarboxylase] [Amino acid transport and metabolism /
                     Coenzyme metabolism"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 43.3%; Codon Adaptation Index (CAI): 0.777.
                     Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate oxidase"
                     /protein_id="YP_001034393.1"
                     /db_xref="GeneID:4806355"
                     /translation="MTQGKITASAAMLNVLKTWGVDTIYGIPSGTLSSLMDALAEDKD
                     IRFLQVRHEETGALAAVMQAKFGGSIGVAVGSGGPGATHLINGVYDAAMDNTPFLAIL
                     GSRPVNELNMDAFQELNQNPMYNGIAVYNKRVAYAEQLPKVIDEACRAAISKKGPAVV
                     EIPVNFGFQEIDENSYYGSGSYERSFIAPALNETEIDKAVEILNKAERPVIYAGFGGV
                     KAGEVITELSRKIKAPIITTGKNFEAFEWNYEGLTGSAYRVGWKPANEVVFEADTVLF
                     LGSNFPFAEVYEAFKNTEKFIQVDIDPYKLGKRHALDASILGDAGQAAKAILDKVDEV
                     ESTPWWRANVKNNQNWRDYMNKLEGKTEGELQLYQVYNAINKHADQDAIYSIDVGDTT
                     QTSTRHLHMTPKNMWRTSPLFATMGIALPGGIAAKKDNPDRQVWNIMGDGAFNMCYPD
                     VITNVQYNLPVINLVFSNGKYAFIKDKYEDTNKHLFGCDFPNADYAKIAEAQGAVGFT
                     VDRIEDIDAVVAEAVKLNKEGKTVVIDARITQHRPLPVEVLELDPKLHSEEAIKAFKE
                     KYEAEELVPFRLFLEEEGLQSRAIK"
     misc_feature    386104..386595
                     /gene="spxB"
                     /locus_tag="SSA_0391"
                     /note="Pyrimidine (PYR) binding domain of POX; Region:
                     TPP_PYR_POX; cd07039"
                     /db_xref="CDD:132922"
     misc_feature    386107..387831
                     /gene="spxB"
                     /locus_tag="SSA_0391"
                     /note="pyruvate oxidase; Region: pyruv_oxi_spxB;
                     TIGR02720"
                     /db_xref="CDD:213733"
     misc_feature    order(386152..386154,386167..386169,386173..386175,
                     386182..386184,386191..386196,386230..386241,
                     386248..386250,386260..386262,386269..386274,
                     386278..386283,386320..386322,386329..386331,
                     386341..386343,386350..386355,386362..386367,
                     386587..386589)
                     /gene="spxB"
                     /locus_tag="SSA_0391"
                     /note="PYR/PP interface [polypeptide binding]; other site"
                     /db_xref="CDD:132922"
     misc_feature    order(386167..386169,386173..386175,386182..386184,
                     386191..386196,386230..386241,386245..386247,
                     386320..386322,386329..386334,386341..386343,
                     386350..386352,386440..386442,386446..386448,
                     386452..386454,386476..386478,386521..386523,
                     386530..386532,386587..386589)
                     /gene="spxB"
                     /locus_tag="SSA_0391"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:132922"
     misc_feature    order(386167..386169,386173..386175,386182..386184,
                     386191..386196,386230..386241,386245..386247,
                     386320..386322,386329..386334,386341..386343,
                     386350..386352,386452..386454,386587..386589)
                     /gene="spxB"
                     /locus_tag="SSA_0391"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132922"
     misc_feature    order(386167..386169,386242..386244,386311..386313,
                     386332..386334)
                     /gene="spxB"
                     /locus_tag="SSA_0391"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132922"
     misc_feature    386671..387066
                     /gene="spxB"
                     /locus_tag="SSA_0391"
                     /note="Thiamine pyrophosphate enzyme, central domain;
                     Region: TPP_enzyme_M; pfam00205"
                     /db_xref="CDD:278628"
     misc_feature    387187..387717
                     /gene="spxB"
                     /locus_tag="SSA_0391"
                     /note="Thiamine pyrophosphate (TPP) family, Pyruvate
                     oxidase (POX) subfamily, TPP-binding module; composed of
                     proteins similar to Lactobacillus plantarum POX, which
                     plays a key role in controlling acetate production under
                     aerobic conditions. POX decarboxylates...; Region:
                     TPP_POX; cd02014"
                     /db_xref="CDD:238972"
     misc_feature    order(387253..387255,387325..387327,387331..387333,
                     387406..387414,387487..387489,387493..387495,
                     387499..387504)
                     /gene="spxB"
                     /locus_tag="SSA_0391"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238972"
     gene            388016..388363
                     /locus_tag="SSA_0392"
                     /db_xref="GeneID:4806690"
     CDS             388016..388363
                     /locus_tag="SSA_0392"
                     /function="Function unknown"
                     /note="GC: 39.94%; Codon Adaptation Index (CAI): 0.791.
                     Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034394.1"
                     /db_xref="GeneID:4806690"
                     /translation="MNLNQLDIIVSDVPQVCADLERIFDKKADYVDDSFAQFTIGSHC
                     LMLSQNHLIPLENFQTGIILHIEIEDVDQNYQRLKELGAEILHGPAVTDWGTESLLVK
                     GPAGLVIDFYRMK"
     misc_feature    <388145..388351
                     /locus_tag="SSA_0392"
                     /note="vicinal oxygen chelate (VOC) family; Region: VOC;
                     cl14632"
                     /db_xref="CDD:326334"
     gene            388906..390480
                     /locus_tag="SSA_0393"
                     /db_xref="GeneID:4806626"
     CDS             388906..390480
                     /locus_tag="SSA_0393"
                     /function="Defense mechanisms"
                     /note="GC: 36.13%; Transporter classification
                     TC:3.A.1.112.3. Transmembrane domains: 5. Codon Adaptation
                     Index (CAI): 0.77. SignalP prediction: Yes (prob. 0.695);
                     Curator(s): T. Kitten, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="bacteriocin ABC transporter permease/ATP-binding
                     protein"
                     /protein_id="YP_001034395.1"
                     /db_xref="GeneID:4806626"
                     /translation="MNKIFHYLDKKTKFYTIIGALANGGLALAQPLVVSQALSLNQGE
                     LTYSKIIQFAVFGFTVYFVLYSLMLFCNHTHNVFRREIQMNMRADLFGKLMTNKDFSE
                     DEKITMLTQDMEYLGDNYLEKYVNIICWSFVALLTAIYIISQNLLLGSIFVFFTILRP
                     IPQFLMNKRLKHTGDDMAQGRVDVHNQVSDSIRGAHTLLMNQAISENQNRFWKINLNY
                     QRAIQKFCFTHNIIFFCNGFMVFLSQVLPLVLGFYFAMAGQKVSVASLVAMYIAAGQL
                     VSPIQTIMYDAVDIQGAKTTADKIFGILEIGDVKQIDKKDAQELHALHIKNLSKSYGD
                     RQLFTHLNLDVQAGQKVLIKGPSGCGKSTLFRLITGEEIADEGEIIGVTTVNECTSSF
                     VSSIGIINQHPFLFNDTVRYNLTLGQEFSEEELLAVLKQVKLDFELTGGLDFIIKNNG
                     ENISGGQRVRIELARFLLRRKNLLLADEVTATLDKENALMVRELLFSLPVMMLEIAHH
                     IDDESRYQQVVDLGKY"
     misc_feature    388912..390474
                     /locus_tag="SSA_0393"
                     /note="ABC-type multidrug transport system, ATPase and
                     permease component [Defense mechanisms]; Region: MdlB;
                     COG1132"
                     /db_xref="CDD:224055"
     gene            390713..390991
                     /locus_tag="SSA_0394"
                     /db_xref="GeneID:4807590"
     CDS             390713..390991
                     /locus_tag="SSA_0394"
                     /note="GC: 42.29%; Transmembrane domains: 3. Codon
                     Adaptation Index (CAI): 0.737. Helix-turn-helix
                     prediction: AraC. Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034396.1"
                     /db_xref="GeneID:4807590"
                     /translation="MKEALKMSEKQMKVLGWVATFMSVMMYVSYFPQIMNNLAGQKGN
                     FIQPLVAAINCSLWVYYGLFKKERDIPLAAANAPGIVFGLVTAITALI"
     misc_feature    390749..390967
                     /locus_tag="SSA_0394"
                     /note="PQ loop repeat; Region: PQ-loop; cl21610"
                     /db_xref="CDD:304463"
     gene            391201..392640
                     /gene="arb"
                     /locus_tag="SSA_0395"
                     /db_xref="GeneID:4806082"
     CDS             391201..392640
                     /gene="arb"
                     /locus_tag="SSA_0395"
                     /EC_number="3.2.1.86"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="required for arbutin uptake and metabolism"
                     /codon_start=1
                     /transl_table=11
                     /product="6-phospho-beta-glucosidase"
                     /protein_id="YP_001034397.1"
                     /db_xref="GeneID:4806082"
                     /translation="MTEKLTFPDGFLWGGATAANQCEGAYDADGRGLANVDVVPIGED
                     RLAIITGKKKMFDFEEGYFYPAKEAIDMYHRFKEDIALFGEMGFKTYRLSIAWSRIFP
                     KGDELEPNEAGLKFYEDLFKECHKYGIEPLVTITHFDCPMHLIEQYGGWRNRLMLEFY
                     ERLCRTLFTRYKGLVKYWLTFNEINMILHAPFMGAGLCFEEGENEEQVKYQAAHHELV
                     ASAIATKLAHEIDPENKVGCMLAAGQNYPNTCHPRDVWAGMEEDRKNYFFIDVQARGE
                     YPNYAKKAWEREGITVDMTEEDLQLLKEHTVDFISFSYYSSRVASGDPKVNELTEGNI
                     FASLKNPYLESSDWGWQIDPLGLRITLNTIWDRYQKPMFIVENGLGAVDTPDENGYVA
                     DDYRIDYLAAHVKAMREAINEDGVVLWGYTTWGCIDLVSAGTGEMKKRYGFIYVDRDN
                     EGKGTLKRSKKKSFDWYKEVIATNGASVK"
     misc_feature    391204..392634
                     /gene="arb"
                     /locus_tag="SSA_0395"
                     /note="6-phospho-beta-glucosidase; Reviewed; Region: arb;
                     PRK09593"
                     /db_xref="CDD:236580"
     gene            complement(392738..393685)
                     /locus_tag="SSA_0396"
                     /db_xref="GeneID:4807895"
     CDS             complement(392738..393685)
                     /locus_tag="SSA_0396"
                     /function="General function prediction only"
                     /note="GC: 45.15%; Transmembrane domains: 1. Codon
                     Adaptation Index (CAI): 0.77. LipoP prediction: SpI.
                     SignalP prediction: Yes (prob. 0.528); Curator(s): T.
                     Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034398.1"
                     /db_xref="GeneID:4807895"
                     /translation="MLKRIFIFILKTITWLVGLLALALLAIFLYHRFQIAQESKLIEK
                     PIGQLVEVEGKKLNVYTAGKGKKTLVFLAGLGTNAPVLDFKALYSKLEDDYRIVVVER
                     LGYGYSDDGNDDRSLDRQVEQTRTALKAAKISGPYVLVPHSIAGLETIHWANHYPEEV
                     EAIIGLDMTMPHTDVADQQKFYGSYQTIQMGRMLGLARLPIFFDENSSPAIKSGALND
                     QEKAVFKALFHQRSITQAVMNEVKNRKKNVETINKEPVPQIPTLIFAAVQKGGETPKL
                     EEEFVAQNAQAKLVTLESSHYIHDEKPKEIAQQIKEFLK"
     misc_feature    complement(392741..393541)
                     /locus_tag="SSA_0396"
                     /note="Pimeloyl-ACP methyl ester carboxylesterase
                     [Coenzyme transport and metabolism, General function
                     prediction only]; Region: MhpC; COG0596"
                     /db_xref="CDD:223669"
     gene            complement(394082..394747)
                     /locus_tag="SSA_0397"
                     /db_xref="GeneID:4807213"
     CDS             complement(394082..394747)
                     /locus_tag="SSA_0397"
                     /note="GC: 38.14%; Transmembrane domains: 6. Codon
                     Adaptation Index (CAI): 0.758. Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034399.1"
                     /db_xref="GeneID:4807213"
                     /translation="MFKLISAWLKIWIPILFAMGIGILLYLITHWTTLDAGSRFVAII
                     YVMLPLHCLEEWRFPGGFHYNYNMLRRSRKPDCYPMNQFSDMLTIMLAELIGIVCLFY
                     GVNQIIVIWNLIFCFFEMIGHLIFGFSMYRRFRTVGKRTIYNPGFATAVVFTLHALYY
                     VLIQYPTNLPSLPIIILAIISGIVLVSSVVLIPEQLFKSKETPYPFDSNRYYEKYIAR
                     EKN"
     gene            complement(394764..396542)
                     /locus_tag="SSA_0398"
                     /db_xref="GeneID:4808093"
     CDS             complement(394764..396542)
                     /locus_tag="SSA_0398"
                     /function="Defense mechanisms"
                     /GO_process="GO:0046677 - response to antibiotic"
                     /note="GC: 45.31%; Transmembrane domains: 4. Codon
                     Adaptation Index (CAI): 0.763. LipoP prediction: SpI.
                     SignalP prediction: Yes (prob. 1); Curator(s): T. Kitten,
                     J. Alves; beta-lactamase family"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034400.1"
                     /db_xref="GeneID:4808093"
                     /translation="MKKTFSLILLTLLTLGLFRPITALAEEQKLPSGIERNQIGQKIE
                     DYVKEHEKTTAAMETAVFDKDSTIYQGNFGYMDKEKGIKADNSSVFDWGSVTKLTVWI
                     AVMQLWEQGKIDLEEDIKTYLPENFLKNLHFDKAITMLDLMNHQTGFDESLSYTKGDK
                     NIEENLRMLQPVQSFEPGTVTSYSNYGAGLASLIVERISGQTFADYTHEHIFQPLGMD
                     KTALLPDLSDNPYVQKKRQESKAYDTKGNSLGTAFYEYGLYSIGQAAGTLEDLQKFAQ
                     ALLGRKILFDRPETWNTLYTPTSTYPGTDIARNAHGFWINEYGVSIIGHGGNTDGFSS
                     RLMLDLESGIGYIVMTNQSMEENYNYQMPELVFGKRKTADEETQKQFTPGYYRSPRTF
                     LHGPLSFLRLMMPSIEKIDNPAQNRILSTNFWTIYESKGKITIPVAVVDYEKISAFDF
                     YKDYIILGLGILGIVYSFGTIITNLLLGVYRLISRKTVEPTDRTWKVWNLLTSLGILA
                     VPLNLLMIMIPLMSDDLDSLAHWRYMLFAALGLLLTAAALLPLFRKSREKFSKGRLFL
                     TAMTSLSALAVVANILYWSLYQWWVL"
     misc_feature    complement(395487..396422)
                     /locus_tag="SSA_0398"
                     /note="Beta-lactamase; Region: Beta-lactamase; pfam00144"
                     /db_xref="CDD:278569"
     gene            complement(396560..398341)
                     /locus_tag="SSA_0400"
                     /db_xref="GeneID:4807639"
     CDS             complement(396560..398341)
                     /locus_tag="SSA_0400"
                     /function="Defense mechanisms"
                     /GO_process="GO:0046677 - response to antibiotic"
                     /note="GC: 48.09%; Transmembrane domains: 4. Codon
                     Adaptation Index (CAI): 0.765. LipoP prediction: SpI.
                     SignalP prediction: Yes (prob. 1); Curator(s): T. Kitten;
                     beta-lactamase family"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034401.1"
                     /db_xref="GeneID:4807639"
                     /translation="MKKPFILTLLTIITLGLFQPATVLAEEAQKLPSGIERDQIGQKI
                     QDYVKEHEKTTAGMVTAVFDKDGTIYQGNFGYMDKEKDIKADDDSVFEWGSVTKLTVW
                     LSVMQLWEQGKINLEEDIRTYLPEGFLKNLRYDKPITMLDLMNHQAGFDETTFYMRSD
                     KSIEEILKEQQPIQSFEPGTVTAYSNYGAGLAALIVERISGQTFADYAHEHIFQPLGM
                     DKTAILPDLSDNSYVQKKRQETKGYDTKGNLLSKDHFITSIYPIGAATGTLKDIEKFA
                     QALLARKTLFERPETWNTLYTASSNYPNTDIIRNAHGFWANEYGTTVLGHGGNTAGAT
                     SRIMLDLEHGIGYVVMTNQGTEQNYNFQMPELVFGPRKTASKETQEQFRPGYYRTLRN
                     FNQGPLAIFKMIPASADYLQEPSDDQRLPNNFWTIYQSQGKTRIAVAVADYEKVSDFD
                     FFKDYVVLGLAGLGIIYALGLLLISPLLGVYRLIFRKKKDQPDRTWKVWNLLTAVGIL
                     AVPINLFLLFMSATSGDFSEIAQWRYMLFAALGLLLTVSALLPLFRKSREKLSKGRLF
                     LTAVTSLSALAVAANILYWSLYQWWVF"
     misc_feature    complement(397283..398218)
                     /locus_tag="SSA_0400"
                     /note="Beta-lactamase; Region: Beta-lactamase; pfam00144"
                     /db_xref="CDD:278569"
     gene            398602..399282
                     /locus_tag="SSA_0401"
                     /db_xref="GeneID:4808103"
     CDS             398602..399282
                     /locus_tag="SSA_0401"
                     /function="Signal transduction mechanisms / Transcription"
                     /note="GC: 48.75%; Codon Adaptation Index (CAI): 0.789.
                     Curator(s): T. Kitten, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="two-component response transcriptional
                     regulator"
                     /protein_id="YP_001034402.1"
                     /db_xref="GeneID:4808103"
                     /translation="MAHILLIEDNSDIHEILKDLFQKEHTVYSAYSGTEGISLFEREE
                     IDLVLLDIMLPGKNGDEVLKEIRSSNATVPVVMLTALGEKALVSQYLLNGANDYIVKP
                     FNLDEVFARITVQLRSQQALSGEEEGQSFKNIRLLKATFEAVCGEKSVRLSKKEYHIL
                     QLLLRHPKKIYTKEELFEQVWEESYLPGDNTLNTHLSNLRKKLAQLDPTEEYIETVWG
                     LGVRLKED"
     misc_feature    398608..399279
                     /locus_tag="SSA_0401"
                     /note="DNA-binding response regulator, OmpR family,
                     contains REC and winged-helix (wHTH) domain [Signal
                     transduction mechanisms, Transcription]; Region: OmpR;
                     COG0745"
                     /db_xref="CDD:223816"
     misc_feature    398614..398949
                     /locus_tag="SSA_0401"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(398623..398628,398752..398754,398776..398778,
                     398836..398838,398893..398895,398902..398907)
                     /locus_tag="SSA_0401"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    398752..398754
                     /locus_tag="SSA_0401"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(398761..398766,398770..398778)
                     /locus_tag="SSA_0401"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    398902..398910
                     /locus_tag="SSA_0401"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    399001..399270
                     /locus_tag="SSA_0401"
                     /note="DNA-binding effector domain of two-component system
                     response regulators; Region: trans_reg_C; cd00383"
                     /db_xref="CDD:294013"
     misc_feature    order(399058..399060,399115..399120,399172..399174,
                     399181..399183,399205..399210,399244..399246,
                     399259..399261)
                     /locus_tag="SSA_0401"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:294013"
     gene            399284..400159
                     /locus_tag="SSA_0402"
                     /db_xref="GeneID:4806514"
     CDS             399284..400159
                     /locus_tag="SSA_0402"
                     /EC_number="2.7.3.-"
                     /function="Signal transduction mechanisms"
                     /note="GC: 48.4%; Transmembrane domains: 1. Codon
                     Adaptation Index (CAI): 0.769. SignalP prediction: Yes
                     (prob. 0.46); Helix-turn-helix prediction: AraC.
                     Curator(s): T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="YP_001034403.1"
                     /db_xref="GeneID:4806514"
                     /translation="MLVLVILFALTSLSLAIGFIRYHLAVKDVAQQIRRKRKTGSQNR
                     LAPAAHAPSILELTEEAELLFGELDKTTFVVQQEKKTLDMAISNIAHDIRTPLTIASG
                     YTQQLLKDDSQESQQLVKIADSLGMVSKRLEALMEYRRLMEGAIRANVQPTDISQLVT
                     QQLFTYYDAFQKAQIDLQVELAEGLELETDPEILERIVQNMISNVLKHGRKAASISLK
                     KDGEHCIFTVKNIVQQPIQYLDKLTNRFYSENLSSSEESSGLGLYITQQLVEILGGDL
                     TMKAEDDWFELVVTL"
     misc_feature    399284..400126
                     /locus_tag="SSA_0402"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    399539..399715
                     /locus_tag="SSA_0402"
                     /note="His Kinase A (phosphoacceptor) domain; Region:
                     HisKA; smart00388"
                     /db_xref="CDD:214644"
     misc_feature    order(399548..399550,399560..399562,399569..399571,
                     399581..399583,399590..399592,399644..399646,
                     399653..399655,399665..399667,399674..399676,
                     399686..399688)
                     /locus_tag="SSA_0402"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    399554..399556
                     /locus_tag="SSA_0402"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    399848..400132
                     /locus_tag="SSA_0402"
                     /note="Histidine kinase-, DNA gyrase B-, and HSP90-like
                     ATPase; Region: HATPase_c; pfam02518"
                     /db_xref="CDD:280651"
     misc_feature    399893..399895
                     /locus_tag="SSA_0402"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     gene            400615..401448
                     /locus_tag="SSA_0403"
                     /db_xref="GeneID:4806361"
     CDS             400615..401448
                     /locus_tag="SSA_0403"
                     /note="GC: 43.88%; Transmembrane domains: 8. Codon
                     Adaptation Index (CAI): 0.754. Curator(s): M. Chaplin"
                     /codon_start=1
                     /transl_table=11
                     /product="CAAX amino protease"
                     /protein_id="YP_001034404.1"
                     /db_xref="GeneID:4806361"
                     /translation="MNTETTIKPQPKLILLFLAWNFGWTWGFWLLDIILKNLWPDSPP
                     TAYLALEAILNGIAMFGPMLASLIVLKKKGFKAICSYLFSGKKETWLYLLIYGGGLTA
                     FYALASGGKLVDGALVRFPWFFIYCIVLSGGIEEFGWRGFLQPALEKKFSFFVSTLMT
                     GIIWAIWHIPLWFYDRFYDRSQDLFSVFIIFSILLSFWLAALYKKTQSGLACNIFHAL
                     SNTLIPTFVGIAQANNQLDFSQVNPFFYFGGVILLTLYSIYLWYRTDREEKALPSKEE
                     I"
     misc_feature    400696..401301
                     /locus_tag="SSA_0403"
                     /note="Membrane protease YdiL, CAAX protease family
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: YdiL; COG1266"
                     /db_xref="CDD:224185"
     misc_feature    400972..401280
                     /locus_tag="SSA_0403"
                     /note="CAAX protease self-immunity; Region: Abi;
                     pfam02517"
                     /db_xref="CDD:280650"
     gene            401558..402175
                     /locus_tag="SSA_0405"
                     /db_xref="GeneID:4806486"
     CDS             401558..402175
                     /locus_tag="SSA_0405"
                     /function="Transcription"
                     /note="GC: 47.09%; Transmembrane domains: 4. Codon
                     Adaptation Index (CAI): 0.725. Curator(s): M. Chaplin, J.
                     Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="YP_001034405.1"
                     /db_xref="GeneID:4806486"
                     /translation="MNLSDRIQYLRKARGISQEGLADQLGVSRQAVSKWESEQSMPDL
                     DKIISMSDYFEVTTDYLLKGMEPVVQKEEEQSIKHRRIASNICYQLSLGFIGLGIILS
                     IILADFLKISVLLTPVLIVQGVGLLVWGTGRNLSDVRPSFQVKLALILFLLFVPLGFL
                     SNVLFPLGKIFPYPTSLAASLAFVTFYLILGVCISLFLKKQDWKQ"
     misc_feature    401564..>401800
                     /locus_tag="SSA_0405"
                     /note="Transcriptional regulator, contains XRE-family HTH
                     domain [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    401567..401740
                     /locus_tag="SSA_0405"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(401579..401581,401591..401593,401666..401668)
                     /locus_tag="SSA_0405"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(401588..401590,401663..401665)
                     /locus_tag="SSA_0405"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(401609..401614,401645..401647,401654..401656,
                     401666..401671)
                     /locus_tag="SSA_0405"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            complement(402286..403008)
                     /locus_tag="SSA_0406"
                     /db_xref="GeneID:4807198"
     CDS             complement(402286..403008)
                     /locus_tag="SSA_0406"
                     /GO_function="GO:0017153 - sodium:dicarboxylate symporter
                     activity"
                     /note="GC: 43.98%; Transmembrane domains: 6. Codon
                     Adaptation Index (CAI): 0.745. Weakly similar ro membrane
                     proteins. Curator(s): M. Chaplin, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034406.1"
                     /db_xref="GeneID:4807198"
                     /translation="MFNSIKADYYRLFRSVGFWGVQAFCIFGILLAIFTSKVVSSDNG
                     IFFAIDVVSYNSGMLFIACNVMTSLLLGVDLNDKLYHNNLTTGKTRTQYYFSKALVIA
                     SLLPMQFILLYILGIVIEFVRTGGNMGTLPANFWGQFAILFVMQVICTYAWYCITSFV
                     LYLTRNYSVVFITYIMTYILLGLPSQMVDANNEWFKAIKMEFVYGDASIPGVIIKTAI
                     FALSLITVFSLAGLATLKKRDL"
     gene            complement(403001..403933)
                     /locus_tag="SSA_0407"
                     /db_xref="GeneID:4807767"
     CDS             complement(403001..403933)
                     /locus_tag="SSA_0407"
                     /function="Defense mechanisms"
                     /note="GC: 45.44%; Transporter classification
                     TC:3.A.1.124.2. Codon Adaptation Index (CAI): 0.76.
                     Curator(s): M. Chaplin, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug ABC transporter ATPase"
                     /protein_id="YP_001034407.1"
                     /db_xref="GeneID:4807767"
                     /translation="MQNVLEVKGLTKKYGDQYALKDVSLSIKKGEIYGLIGKNGAGKT
                     TLIKIITQVIYPSGGTVSVLGSQNQQEWTRALSHTGSVIESPVAHAHMSAYENLRYYC
                     TDRGIPNADKVIKETLQYVGLTDTGKKKFRNFSLGMKQRLGIAIAILGRPDLLILDEP
                     INGLDPVGIQEFREMVKRLNQELGITIIISSHILSELYLVATRFGFINQGHFIKELSK
                     EEFNRESGDYIILKTDNIKQAAHLVQDKLGYQLRPTNKEDELHISGKVQEIRKIAKEL
                     VLADIPIGEIYYAHKDLEKYFTDLINQQGGNTHV"
     misc_feature    complement(403028..403933)
                     /locus_tag="SSA_0407"
                     /note="ABC-type multidrug transport system, ATPase
                     component [Defense mechanisms]; Region: CcmA; COG1131"
                     /db_xref="CDD:224054"
     misc_feature    complement(403289..403921)
                     /locus_tag="SSA_0407"
                     /note="P-loop containing Nucleoside Triphosphate
                     Hydrolases; Region: P-loop_NTPase; cl21455"
                     /db_xref="CDD:304359"
     misc_feature    complement(403802..403825)
                     /locus_tag="SSA_0407"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(403358..403360,403457..403462,
                     403682..403684,403799..403807,403811..403816))
                     /locus_tag="SSA_0407"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(403682..403693)
                     /locus_tag="SSA_0407"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(403505..403534)
                     /locus_tag="SSA_0407"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(403457..403474)
                     /locus_tag="SSA_0407"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(403439..403450)
                     /locus_tag="SSA_0407"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(403352..403372)
                     /locus_tag="SSA_0407"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            complement(404079..404774)
                     /locus_tag="SSA_0408"
                     /db_xref="GeneID:4807202"
     CDS             complement(404079..404774)
                     /locus_tag="SSA_0408"
                     /GO_function="GO:0017153 - sodium:dicarboxylate symporter
                     activity"
                     /note="GC: 41.67%; Transmembrane domains: 6. Codon
                     Adaptation Index (CAI): 0.737. Weakly similar to membrane
                     proteins and transporters. Curator(s): M. Chaplin, J.
                     Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034408.1"
                     /db_xref="GeneID:4807202"
                     /translation="MLHTFQADFYRFFRSKAVWITEFIFLLTTLSAVFGKLNAVQLIQ
                     AVSNAIGNNTFIIIILSMVVIGTDLNKQLYKNTLTSGVSRTSFFVSKALVMVCVTFLQ
                     LALYYSINFILAAILNGIGDLSATFLLQFILLFFVQCLTVIAWTAIISFILYLSKSMI
                     AALGGYLFCASLTGALAQFYPKSLWLQHFTMSFDFETLQSNGVTLRIVLIALFLGTVF
                     TAASLYTFHKKDL"
     gene            complement(404787..405695)
                     /locus_tag="SSA_0409"
                     /db_xref="GeneID:4806706"
     CDS             complement(404787..405695)
                     /locus_tag="SSA_0409"
                     /function="Defense mechanisms"
                     /note="GC: 45.87%; Transporter classification
                     TC:3.A.1.124.2. Codon Adaptation Index (CAI): 0.739.
                     Curator(s): M. Chaplin, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug ABC transporter ATPase"
                     /protein_id="YP_001034409.1"
                     /db_xref="GeneID:4806706"
                     /translation="MQTVLEVKQVTKQYGQQYALDHVSLSIQKGDIYGLIGKNGAGKT
                     TLLKTISRLIHANSGTVSVFGSQNSKEWNEALRKIGTVIETPVAYNQMTAYQNLNYYC
                     KVHQIPQPDQLIKQTLDYVGLSNTGKKKFRNFSLGMKQRLGIAIALISKPELMILDEP
                     INGLDPLGIKEFRLMIQRLNQELGITFIISSHILSELYLVATKFGVIDQGRLVAEFTK
                     DDFDRASEDYIILKTSDRDQAANLIQGKLHYQLKDADKSDELHIVAQEQELNDINREL
                     VLSNIHVNGIYAAQKDLEKYFTDLVQ"
     misc_feature    complement(404790..405695)
                     /locus_tag="SSA_0409"
                     /note="ABC-type multidrug transport system, ATPase
                     component [Defense mechanisms]; Region: CcmA; COG1131"
                     /db_xref="CDD:224054"
     misc_feature    complement(405048..405683)
                     /locus_tag="SSA_0409"
                     /note="P-loop containing Nucleoside Triphosphate
                     Hydrolases; Region: P-loop_NTPase; cl21455"
                     /db_xref="CDD:304359"
     misc_feature    complement(405564..405587)
                     /locus_tag="SSA_0409"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(405120..405122,405219..405224,
                     405444..405446,405561..405569,405573..405578))
                     /locus_tag="SSA_0409"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(405444..405455)
                     /locus_tag="SSA_0409"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(405267..405296)
                     /locus_tag="SSA_0409"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(405219..405236)
                     /locus_tag="SSA_0409"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(405201..405212)
                     /locus_tag="SSA_0409"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(405114..405134)
                     /locus_tag="SSA_0409"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            complement(405840..406532)
                     /locus_tag="SSA_0410"
                     /db_xref="GeneID:4806624"
     CDS             complement(405840..406532)
                     /locus_tag="SSA_0410"
                     /note="GC: 42.71%; Transmembrane domains: 6. Codon
                     Adaptation Index (CAI): 0.712. Curator(s): M. Chaplin, J.
                     Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034410.1"
                     /db_xref="GeneID:4806624"
                     /translation="MLHTIQAELYQLVRSKPFWLIEGLLFFLIFISSLGERNFNFYIS
                     TSSDPEEIVIQGWTGFEALGQLAKDFLPFVMITVLVLIIFLLGRDLTRKLYNNILASG
                     ISRKEFYLSKIAVLITIIILQMAAAFAVAFIFGSLFHGLGTMPKNFFWSFSLSFFRSF
                     LFIMTCSSVVSCLLYLTRSTLASYLGFFALIMLQSSLVIVFPQINSELFLFLILAGSL
                     LGGYQAFQHRDL"
     gene            complement(406570..407328)
                     /locus_tag="SSA_0411"
                     /db_xref="GeneID:4806997"
     CDS             complement(406570..407328)
                     /locus_tag="SSA_0411"
                     /note="GC: 42.56%; Transmembrane domains: 6. Codon
                     Adaptation Index (CAI): 0.756. Curator(s): M. Chaplin, J.
                     Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034411.1"
                     /db_xref="GeneID:4806997"
                     /translation="MMDFIRADFYRLMRSKGFWITEFLLFCVIISTTFFHANIHFGAN
                     ISSNAAASQSLGKLTGLQALDYFAGNTDSLLFFTIIGLSMVLGVDLSRKLYKNCLSYG
                     ISKLSYYFSKFFVCVSIAAFHFLMILSISFVTASLSNGIGSAPSSFLPQLGAALFIQF
                     LSTVAWIAIISFILYASHSIVSSFLTYFLGGTLLTIPLIFYPDNEWLLYLTLRFNTNM
                     AADGGAVIKAILTVVTVTLVFLISGLMVFKKKNL"
     gene            complement(407345..408253)
                     /locus_tag="SSA_0412"
                     /db_xref="GeneID:4806821"
     CDS             complement(407345..408253)
                     /locus_tag="SSA_0412"
                     /function="Defense mechanisms"
                     /note="GC: 48.73%; Transporter classification
                     TC:3.A.1.124.2. Codon Adaptation Index (CAI): 0.74.
                     Curator(s): M. Chaplin, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug ABC transporter ATPase"
                     /protein_id="YP_001034412.1"
                     /db_xref="GeneID:4806821"
                     /translation="MENVLVLQQVSKKFGRQYALTDVSLTIKKGDIYGLIGKNGAGKT
                     TLIKVITQLLEASSGNVSLFGSQNYQEWTQSLKRVGSVIETPVAHNHLTAYENLSYYC
                     KLRHIPHADKVIRETLEYVDLTDTGKKKFRDFSLGMKQRLGLAIALLTRPDLMILDEP
                     INGLDPVGIKEFRQLVQRLNEELGMTFIISSHILSELYLVGIRFGIIEEGRLIREISK
                     AEFEEQSEDYIVLKTSQLEEASRLIHDQLMHRIKVVNASDEIHIFTHSHEISKIVKEL
                     AVADIPVQEIYYARQNLENFFTDLVE"
     misc_feature    complement(407606..408241)
                     /locus_tag="SSA_0412"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl25403"
                     /db_xref="CDD:330224"
     misc_feature    complement(408122..408145)
                     /locus_tag="SSA_0412"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(407678..407680,407777..407782,
                     408002..408004,408119..408127,408131..408136))
                     /locus_tag="SSA_0412"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(408002..408013)
                     /locus_tag="SSA_0412"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(407825..407854)
                     /locus_tag="SSA_0412"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(407777..407794)
                     /locus_tag="SSA_0412"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(407759..407770)
                     /locus_tag="SSA_0412"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(407672..407692)
                     /locus_tag="SSA_0412"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            complement(408405..410126)
                     /gene="pabB"
                     /locus_tag="SSA_0413"
                     /db_xref="GeneID:4807154"
     CDS             complement(408405..410126)
                     /gene="pabB"
                     /locus_tag="SSA_0413"
                     /EC_number="2.6.1.85"
                     /EC_number="4.1.3.-"
                     /function="Amino acid transport and metabolism / Coenzyme
                     metabolism"
                     /note="GC: 49.3%; Codon Adaptation Index (CAI): 0.761.
                     Curator(s): M. Chaplin, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="anthranilate/para-aminobenzoate synthases
                     component I/ chorismate binding enzyme"
                     /protein_id="YP_001034413.1"
                     /db_xref="GeneID:4807154"
                     /translation="MHKKTIIDFKQLGQRLIFTNPIKELKTRRLDQVEELLTEIEGWQ
                     EKGYYAVGYVSYEAAPAFEEKFQVHSAPLQKEYLLYFTIHDKAEQASIPLTYEEVEMP
                     ASWQGLTSEQEYQKDIETIHRHIRQGDTYQVNYTVQLCAELNPEDSLAIYNRLVVEQN
                     AAYNAYVEHDETAILSISPELFFEEQRGQLTTRPMKGTTNRGLTLEQDRERAAWLAQD
                     AKNRAENMMIVDLLRNDMNRISQTGSERVEHLCSVEQYSTVWQMTSTIKSQLQERVGL
                     AELFKALFPCGSITGAPKISTMAIIKATEKAARGVYCGTVGICLPDQRRIFNVAIRTI
                     QLEGRKAIYGVGGGITWDSTWKSEYIETQQKSAVLYRKNPRFDLISTGKVTDGKLTLQ
                     EQHLQRLTEAASYFAYPFDQDKLKQELEETCTQLDKGQDYRLRIALKKDGSIELETTP
                     LLPLTDTFRKAKLVEQTANLAQPFTYFKTSHRPHLTLEQQEQIYYNAQGQLLETSIGN
                     LLLELNGKLYTPPAELGLLKGIYRQQLLDKGRATEKILTLADLAQAKKIYACNAVRGL
                     YELEIED"
     misc_feature    complement(409029..410090)
                     /gene="pabB"
                     /locus_tag="SSA_0413"
                     /note="aminodeoxychorismate synthase; Provisional; Region:
                     PRK07508"
                     /db_xref="CDD:236035"
     misc_feature    complement(409020..409979)
                     /gene="pabB"
                     /locus_tag="SSA_0413"
                     /note="chorismate binding enzyme; Region: Chorismate_bind;
                     cl10555"
                     /db_xref="CDD:299194"
     misc_feature    complement(408417..409007)
                     /gene="pabB"
                     /locus_tag="SSA_0413"
                     /note="PyridoxaL 5'-Phosphate Dependent Enzymes class IV
                     (PLPDE_IV). This D-amino acid superfamily, one of five
                     classes of PLPDE, consists of branched-chain amino acid
                     aminotransferases (BCAT), D-amino acid transferases
                     (DAAT), and 4-amino-4-deoxychorismate...; Region:
                     PLPDE_IV; cl00224"
                     /db_xref="CDD:294155"
     misc_feature    complement(order(408441..408443,408534..408539,
                     408618..408620,408693..408695,408933..408935,
                     408990..408992))
                     /gene="pabB"
                     /locus_tag="SSA_0413"
                     /note="substrate-cofactor binding pocket; other site"
                     /db_xref="CDD:238254"
     misc_feature    complement(order(408618..408620,408693..408695,
                     408933..408935))
                     /gene="pabB"
                     /locus_tag="SSA_0413"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238254"
     misc_feature    complement(408693..408695)
                     /gene="pabB"
                     /locus_tag="SSA_0413"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238254"
     gene            410258..410629
                     /locus_tag="SSA_0414"
                     /db_xref="GeneID:4806339"
     CDS             410258..410629
                     /locus_tag="SSA_0414"
                     /note="GC: 41.4%; Transmembrane domains: 3. Codon
                     Adaptation Index (CAI): 0.723. SignalP prediction: Yes
                     (prob. 0.829); Weakly similar to integral membrane
                     protein. Curator(s): M. Chaplin, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034414.1"
                     /db_xref="GeneID:4806339"
                     /translation="MKSNKLLLVNGVASILGGLLILYASSKRWHWEIVALVPKMVEKS
                     DWGVLIILISLLFLCLSLAGMAHYSEEPRVNKMSHKLLFFAFLAGIIPFLGNLAGVLA
                     IISGIFYLQDVPKFKSDDKAD"
     gene            410708..411790
                     /locus_tag="SSA_0415"
                     /db_xref="GeneID:4808106"
     CDS             410708..411790
                     /locus_tag="SSA_0415"
                     /function="General function prediction only"
                     /note="GC: 48.01%; Transporter classification
                     TC:9.B.22.1.1. Transmembrane domains: 8. Codon Adaptation
                     Index (CAI): 0.743. SignalP prediction: Yes (prob. 0.733);
                     Curator(s): M. Chaplin, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="YP_001034415.1"
                     /db_xref="GeneID:4808106"
                     /translation="MKKINESYKLIVFAALALALVLYIGNIWSGLQSLTSVFSPIILG
                     GVLAFIFNVPMKKLEDFLGKCRVPQKLQRGLALILEVLILALIMTGIVSIVVPTLTTA
                     VNQLSATIGKVAPQVAKWLQQSGLLSSSQLKDLTKQLQNSDIVNRAISLLGSLTGNIS
                     AIFGNFFSVIMSIFLMFAFLSSKEHLQTITSRLLQVLLPEKAVKRLSYVGSVIVETYD
                     KFLMGQMIEAVIVGILVFIAYSLTGLPYAALTGVLAGVLSFIPYIGPFSACALGAIFI
                     FTDSPWKALLSIAVFQLVQLIEGNIIYPRVVGQSVGLPTLFTLAAALIGGNLFGLVGM
                     IFFTPIFAVIYRLVREFVVEKEEKKR"
     misc_feature    410786..411784
                     /locus_tag="SSA_0415"
                     /note="Predicted PurR-regulated permease PerM [General
                     function prediction only]; Region: PerM; COG0628"
                     /db_xref="CDD:223701"
     gene            412030..414282
                     /gene="metE"
                     /locus_tag="SSA_0416"
                     /db_xref="GeneID:4806257"
     CDS             412030..414282
                     /gene="metE"
                     /locus_tag="SSA_0416"
                     /EC_number="2.1.1.14"
                     /function="Amino acid transport and metabolism"
                     /note="catalyzes the transfer of a methyl group from
                     5-methyltetrahydrofolate to homocysteine to form
                     methionine"
                     /codon_start=1
                     /transl_table=11
                     /product="5-
                     methyltetrahydropteroyltriglutamate/homocysteine
                     S-methyltransferase"
                     /protein_id="YP_001034416.1"
                     /db_xref="GeneID:4806257"
                     /translation="MSTTIIGFPRLGEFRELKFTTEKYFRHEISAEELLAAAKELRAK
                     HWNIVKEKGISEIPSNDFSHYDNVLDAAFLFNVVPSSVQGLELTDLERYFALARGYQG
                     EKGDVRALPMKKWFNTNYHYIVPKFEKETQVKLAGHKIFDEFAEAKELGLVTRPVVVG
                     PFTLLQVSDFEDGVAPADFVDALVVAYQEVFAKLAELGAERIQLDEPSLVKDLSAEEK
                     ALFLDLYKKLLADKKGLEVLVQTYFGDVRDIYADLVQLPVDAIGLDFVEGKKTLELVK
                     GGFPADKTLYAGIVNGKNIWRNNYEKSLAVLEQIPAENIVLTSSCSLLHVPFTTANEE
                     FEPAILNHFAFAVEKLDEIRDLDAIRNGGGAEALAANKELFATERVGENAELRARIAG
                     LTDADYTRLPVFAEREEIQHKTLNLPPLPTTTIGSFPQTKEVRAKRLAFRKGELSQED
                     YDKFLAEQIDEWIKWQEEVGFDVLVHGEFERNDMVEYFGQNLSGYLFSKNGWVQSYGM
                     RGVKPPIIWGDVTRLNPITVKWSSYAQSRTDKPVKGMLTGPVTILNWSFPREDISIKD
                     STLQIALAIKDEVLDLEAAGVKIIQIDEAALREKLPLRRSDWYEDYLDWAIPAFRLVH
                     STVAPDTQIHTHMCYSEFTDIIPAIDNMDADVISFEASRSNLEILDELKAKNFQTEVG
                     PGVYDIHSPRVPNEGEIDHTIEAILAKVPSKKVWINPDCGLKTRGIPETKASLVRLVE
                     AAKAARQHLK"
     misc_feature    412030..414279
                     /gene="metE"
                     /locus_tag="SSA_0416"
                     /note="5-methyltetrahydropteroyltriglutamate--homocysteine
                     S-methyltransferase; Provisional; Region: PRK05222"
                     /db_xref="CDD:235367"
     misc_feature    412033..413106
                     /gene="metE"
                     /locus_tag="SSA_0416"
                     /note="CIMS - Cobalamine-independent methonine synthase,
                     or MetE, N-terminal domain_like. Many members have been
                     characterized as
                     5-methyltetrahydropteroyltriglutamate-homocysteine
                     methyltransferases, EC:2.1.1.14, mostly from bacteria and
                     plants. This enzyme...; Region: CIMS_N_terminal_like;
                     cd03312"
                     /db_xref="CDD:239428"
     misc_feature    order(412072..412074,412081..412083,412369..412371,
                     412384..412386,412390..412392)
                     /gene="metE"
                     /locus_tag="SSA_0416"
                     /note="THF binding site; other site"
                     /db_xref="CDD:239428"
     misc_feature    413287..414258
                     /gene="metE"
                     /locus_tag="SSA_0416"
                     /note="Cobalamin-independent synthase, Catalytic domain;
                     Region: Meth_synt_2; pfam01717"
                     /db_xref="CDD:279978"
     misc_feature    order(413302..413310,413461..413463,413479..413481,
                     413800..413802,413806..413808,413935..413937,
                     413941..413943,414190..414195)
                     /gene="metE"
                     /locus_tag="SSA_0416"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239427"
     misc_feature    order(413554..413562,413692..413694,413812..413814)
                     /gene="metE"
                     /locus_tag="SSA_0416"
                     /note="THF binding site; other site"
                     /db_xref="CDD:239427"
     misc_feature    order(413935..413937,413941..413943,414007..414009,
                     414190..414192)
                     /gene="metE"
                     /locus_tag="SSA_0416"
                     /note="zinc-binding site [ion binding]; other site"
                     /db_xref="CDD:239427"
     gene            414420..415298
                     /gene="metF"
                     /locus_tag="SSA_0417"
                     /db_xref="GeneID:4807150"
     CDS             414420..415298
                     /gene="metF"
                     /locus_tag="SSA_0417"
                     /EC_number="1.5.1.20"
                     /function="Amino acid transport and metabolism"
                     /note="GC: 45.39%; Codon Adaptation Index (CAI): 0.772.
                     Curator(s): M. Chaplin"
                     /codon_start=1
                     /transl_table=11
                     /product="5,10-methylenetetrahydrofolate reductase"
                     /protein_id="YP_001034417.1"
                     /db_xref="GeneID:4807150"
                     /translation="MVRRHTPSLSFEVFPPNPAVGNDKIFQALREMQDLAPHFISVTA
                     SNNKFDIEETTVRLTEFIANELQIPTIAHLPAVYLTKDMVSNILQSLDRVGVHQILAL
                     RGDIFPDVAPKDDFTYATDLIEYIKTEAPHFDIIGACYPEGHPDSPNQISDIQNLKKK
                     VDAGCSSLVTQLFFDNERFYDFQDKCILAGIEVPIHAGIMPILNRNQALRLLKTCENI
                     KLPRKFRAILDKYEHDPESLRAAGLAYAVDQIVDLVTQDVAGIHLYTMNNAATAYHIY
                     KATHALFNHNPSVQSF"
     misc_feature    414444..415259
                     /gene="metF"
                     /locus_tag="SSA_0417"
                     /note="5,10-methylenetetrahydrofolate reductase,
                     prokaryotic form; Region: fadh2; TIGR00676"
                     /db_xref="CDD:273212"
     misc_feature    order(414552..414554,414636..414638,414723..414731,
                     414771..414776,414831..414833,414837..414839,
                     414849..414851,414855..414857,414876..414878,
                     414885..414887,414894..414899,414924..414926,
                     414930..414932,415209..415211)
                     /gene="metF"
                     /locus_tag="SSA_0417"
                     /note="FAD binding site [chemical binding]; other site"
                     /db_xref="CDD:238299"
     gene            415396..416244
                     /locus_tag="SSA_0418"
                     /db_xref="GeneID:4806659"
     CDS             415396..416244
                     /locus_tag="SSA_0418"
                     /function="Transcription"
                     /GO_process="GO:0045449 - regulation of transcription"
                     /GO_process="GO:0006355 - regulation of transcription,
                     DNA-dependent"
                     /note="GC: 50.41%; Codon Adaptation Index (CAI): 0.775.
                     Helix-turn-helix prediction: AraC. Curator(s): M. Chaplin"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_001034418.1"
                     /db_xref="GeneID:4806659"
                     /translation="MEHSLTLVKSMQFGQEDCFFAFCGYSKTEAHHSFGPAVRDVYVI
                     HIVLEGRGTYSVGNQRYDLQEGQGFVVPPGQSVFYQADREEPWSYVWMGLGGRLLPRY
                     LQDLGLQSGQWSFELTSLQEFKALVFESLAYEGSGITAELALQRQVYRFLELLSQRLK
                     QTSLITESRRVNPYVQQVLELLSSHLPESLSVQELAQKLALHPSYLSRLFKDEVGKGI
                     KEYSNDLRLNMAADLLTGSQLSVEEIANKTGFAGTQSFSKAFKKARGQSPLNFRKASS
                     HLGQEL"
     misc_feature    415453..415851
                     /locus_tag="SSA_0418"
                     /note="AraC-like ligand binding domain; Region:
                     AraC_binding; pfam02311"
                     /db_xref="CDD:280472"
     misc_feature    415855..416229
                     /locus_tag="SSA_0418"
                     /note="AraC-type DNA-binding domain and AraC-containing
                     proteins [Transcription]; Region: AraC; COG2207"
                     /db_xref="CDD:225117"
     misc_feature    415939..416058
                     /locus_tag="SSA_0418"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:278590"
     gene            416353..418590
                     /locus_tag="SSA_0419"
                     /db_xref="GeneID:4805923"
     CDS             416353..418590
                     /locus_tag="SSA_0419"
                     /EC_number="3.2.1.22"
                     /function="Carbohydrate transport and metabolism"
                     /note="GC: 49.46%; Codon Adaptation Index (CAI): 0.77.
                     Curator(s): M. Chaplin"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-galactosidase"
                     /protein_id="YP_001034419.1"
                     /db_xref="GeneID:4805923"
                     /translation="MNKASIWFKEECRQFHLTNGEISYIFRVYEDGKLLQLYYGAVVP
                     ERDYSYLVELQHRPMTTYRKEGDLRYSLEHVRQEFPEYGTTDFRHPAICLRQENGSRI
                     TDFVYVSHQIVDGKPALEGLPATYTETQTEAKTLILTLRDEVTEVEVQLFYTIFADWP
                     VIARSSKVINQGREACYLESLASLSLDLPDADYNWLQLSGAWARERYIKERPLQQGIQ
                     SIESTRGISSPHHNPFVALKRPETTEFSGSVLGAALVYSGNFLIQAEVDTYDVARMQL
                     GINPFGFEWKLAAGQSFTSPEALLVYSERGLNGMSQVFHQLFRQRLARGYWRERARPV
                     LINNWEATYFDFSENQLLELAEKAQEVGVELFVLDDGWFGQRTNDRAGLGDWFVNPER
                     LPKGLGSLAERIHGLGMQFGLWFEPEMVNKDSQLYRTHPDWLLAVPDRQPHHGRNQFV
                     LDYSRPEVVDEIFERLSAVIEEAQLDYIKWDMNRPLTDVFSAAWPADQQGEIFHRYVL
                     GVYDLYERLISRYPRLLFESCSSGGGRFDPGMLYYAPQAWTSDDSDAIERLKIQYGTS
                     LLYPLSSMGAHVSIVPNHQTNRLTPLKTRGNVAFFGSFGYELDLNQLSPEELAEVREQ
                     IAFYKRHRDLIHNGTFYRLRSPFKGDGQTAWMVVSQDQNTALLGTFKVLNQVNRSHQR
                     LQLKGLAADTVYRLEGRAYTGAELMRVGLVTTDASSGQLLEDSEQKPSYDFDSKLWLF
                     EAEDE"
     misc_feature    416395..418485
                     /locus_tag="SSA_0419"
                     /note="Alpha-galactosidase [Carbohydrate transport and
                     metabolism]; Region: GalA; COG3345"
                     /db_xref="CDD:225882"
     misc_feature    416452..417213
                     /locus_tag="SSA_0419"
                     /note="Glycosyl hydrolase family 36 N-terminal domain;
                     Region: Glyco_hydro_36N; pfam16875"
                     /db_xref="CDD:293480"
     misc_feature    417226..418266
                     /locus_tag="SSA_0419"
                     /note="Melibiase; Region: Melibiase; pfam02065"
                     /db_xref="CDD:280271"
     misc_feature    order(417367..417369,417460..417462,417592..417594,
                     417787..417789,417799..417801,417937..417939,
                     417994..417996,418003..418005)
                     /locus_tag="SSA_0419"
                     /note="active site"
                     /db_xref="CDD:269892"
     misc_feature    order(417793..417795,418003..418005)
                     /locus_tag="SSA_0419"
                     /note="catalytic site [active]"
                     /db_xref="CDD:269892"
     misc_feature    418309..418572
                     /locus_tag="SSA_0419"
                     /note="Glycosyl hydrolase family 36 C-terminal domain;
                     Region: Glyco_hydro_36C; pfam16874"
                     /db_xref="CDD:293479"
     gene            418760..419692
                     /locus_tag="SSA_0420"
                     /db_xref="GeneID:4807333"
     CDS             418760..419692
                     /locus_tag="SSA_0420"
                     /function="General function prediction only"
                     /GO_function="GO:0016787 - hydrolase activity"
                     /note="GC: 48.98%; Codon Adaptation Index (CAI): 0.766.
                     Curator(s): M. Chaplin"
                     /codon_start=1
                     /transl_table=11
                     /product="HAD superfamily hydrolase"
                     /protein_id="YP_001034420.1"
                     /db_xref="GeneID:4807333"
                     /translation="MGEFVKNEESICQFGLLVESIRQMRGRGSLMTRKIIFLDVDGTI
                     IDYDNHIPESAVVAIRKAREKGHLVYVCTGRSKAEMPPEIWDIGFDGMIGGNGSYVEH
                     EGQVILYQLIPRDVAKRLVDWLQERGLEFYLESNNGLFASKGFREAARPVLRTYVLGK
                     GAKPEEVVNMEAEEALHGLVYGGELYRDDLNKVSFILRSYQDHLDSKAAFPELKAGTW
                     GGKGEHALFGDLGVKDITKAHAIEVLLKHLHADRADTLAFGDAKVDIPMLDYCQVGVA
                     MGNGGAEIKAMADLVTDSVSQDGLYKAFEKLELI"
     misc_feature    418862..>419113
                     /locus_tag="SSA_0420"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    418865..419671
                     /locus_tag="SSA_0420"
                     /note="haloacid dehalogenase-like hydrolase; Region:
                     Hydrolase_3; pfam08282"
                     /db_xref="CDD:285482"
     misc_feature    order(418874..418882,418976..418981)
                     /locus_tag="SSA_0420"
                     /note="active site"
                     /db_xref="CDD:119389"
     misc_feature    418874..418891
                     /locus_tag="SSA_0420"
                     /note="motif I; other site"
                     /db_xref="CDD:119389"
     misc_feature    418976..418978
                     /locus_tag="SSA_0420"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     misc_feature    <419441..419635
                     /locus_tag="SSA_0420"
                     /note="Haloacid Dehalogenase-like Hydrolases; Region:
                     HAD_like; cl21460"
                     /db_xref="CDD:304363"
     gene            419704..420300
                     /locus_tag="SSA_0421"
                     /db_xref="GeneID:4807123"
     CDS             419704..420300
                     /locus_tag="SSA_0421"
                     /EC_number="5.4.2.1"
                     /function="Carbohydrate transport and metabolism"
                     /note="GC: 48.07%; Codon Adaptation Index (CAI): 0.797.
                     Curator(s): M. Chaplin, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate mutase family protein"
                     /protein_id="YP_001034421.1"
                     /db_xref="GeneID:4807123"
                     /translation="MMAKTLYLMRHGQTLFNLRHKVQGWCDAPLTDFGVYQAKVAGQY
                     FKDAGITFDDAYSSTQERACDTLELVTDDKLPYKRVKGLKEWNFGTFEGESEDLNPPL
                     PYKDFFVTYGGESQDQVQERMATTILQLMQETDGQSVLMVSHGGAMANFARAWQKNWR
                     LDDLGHMTNCGILKFTFEKDQFYLEEVIGHDFSDWEGK"
     misc_feature    419719..420264
                     /locus_tag="SSA_0421"
                     /note="Histidine phosphatase superfamily (branch 1);
                     Region: His_Phos_1; pfam00300"
                     /db_xref="CDD:278716"
     misc_feature    order(419731..419736,419887..419889,420133..420138)
                     /locus_tag="SSA_0421"
                     /note="catalytic core [active]"
                     /db_xref="CDD:132718"
     gene            420297..420899
                     /locus_tag="SSA_0422"
                     /db_xref="GeneID:4807261"
     CDS             420297..420899
                     /locus_tag="SSA_0422"
                     /EC_number="5.4.2.1"
                     /function="Carbohydrate transport and metabolism"
                     /note="GC: 50.75%; Codon Adaptation Index (CAI): 0.783.
                     Curator(s): M. Chaplin, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate mutase family protein"
                     /protein_id="YP_001034422.1"
                     /db_xref="GeneID:4807261"
                     /translation="MKDLYLMRHGQTFFNQEGLVQGACDSPLTELGQDQARQAGAYLK
                     ERGIRFGQLYSSTQERASDTLELVSGRTDYTRLKGIKEWNFGLFEAQPERLQPKFRPG
                     ATSFEDLFVPYGGEGVDQVGERMLVTLTEVMEQAEAEPVLAVSHGGAMWAFYLKIAAQ
                     ALDPKVRFGNCAICHYHYEPGHFKLAEVIDPLTGSVYECE"
     misc_feature    420306..420851
                     /locus_tag="SSA_0422"
                     /note="Histidine phosphatase superfamily (branch 1);
                     Region: His_Phos_1; pfam00300"
                     /db_xref="CDD:278716"
     misc_feature    order(420318..420323,420474..420476,420732..420737)
                     /locus_tag="SSA_0422"
                     /note="catalytic core [active]"
                     /db_xref="CDD:132718"
     gene            complement(420958..421437)
                     /locus_tag="SSA_0423"
                     /db_xref="GeneID:4806814"
     CDS             complement(420958..421437)
                     /locus_tag="SSA_0423"
                     /note="GC: 46.88%; Transmembrane domains: 4. Codon
                     Adaptation Index (CAI): 0.703. SignalP prediction: Yes
                     (prob. 0.945); Curator(s): M. Chaplin, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034423.1"
                     /db_xref="GeneID:4806814"
                     /translation="MILSTSVTNPSKKRFRKTALIYALLTIFFFAFSRIYESFSFGET
                     SSHMHYLFTIPLVGGILLLLFMKGIPNLSRLSLNLWNSAVAIMTAGMLFRGIVNLSGR
                     STTLDMPYWYVGAAFAALALLSMVFTRSEWNKEIQAQPIPSKKEDTKLSRRETYSQV"
     gene            complement(421412..422323)
                     /locus_tag="SSA_0424"
                     /db_xref="GeneID:4807858"
     CDS             complement(421412..422323)
                     /locus_tag="SSA_0424"
                     /function="Carbohydrate transport and metabolism"
                     /note="GC: 48.79%; Transmembrane domains: 1. Codon
                     Adaptation Index (CAI): 0.712. LipoP prediction: SpI.
                     SignalP prediction: Yes (prob. 0.999). Related to
                     N-acetylglucosamine-1-phosphodiester
                     alpha-N-acetylglucosaminidase. Curator(s): M. Chaplin"
                     /codon_start=1
                     /transl_table=11
                     /product="exopolysaccharide biosynthesis protein"
                     /protein_id="YP_001034424.1"
                     /db_xref="GeneID:4807858"
                     /translation="MKFLKKRYAYASIFGLLLTASFSYSMLKTFVIAETISTVSSSSS
                     SSNAEAASKAAETATVTDTSYSDDNISVTLTEKTVSNTQVYIADVTVSSSEYLKTAFA
                     QNTYGNNVTAKTSETAANNNAILAVNGDYYGANTTGYVIRNGVVYRDTVREDSSNGDL
                     AIYKDGSFKIIYEDQISADQLVKDGVVNLLAFGPSLVENGEIAVDTNSEVGQSMSSNP
                     RTAIGIIDENHYIIIVSDGRTSESEGLSLYQMAEIMKSYGVKTAYNLDGGGSSTLYFN
                     GQVINKPTTNGNTISERSVSDIVYIGY"
     misc_feature    complement(421421..421963)
                     /locus_tag="SSA_0424"
                     /note="Predicted periplasmic protein (DUF2233); Region:
                     DUF2233; pfam09992"
                     /db_xref="CDD:287014"
     gene            complement(422320..423369)
                     /locus_tag="SSA_0425"
                     /db_xref="GeneID:4806559"
     CDS             complement(422320..423369)
                     /locus_tag="SSA_0425"
                     /EC_number="2.4.1.83"
                     /function="Cell envelope biogenesis, outer membrane"
                     /GO_function="GO:0016757 - transferase activity,
                     transferring glycosyl groups"
                     /GO_function="GO:0016740 - transferase activity"
                     /note="GC: 46.48%; Transmembrane domains: 3. Codon
                     Adaptation Index (CAI): 0.73. Probably involved in
                     cell-wall biogenesis. Curator(s): M. Chaplin"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="YP_001034425.1"
                     /db_xref="GeneID:4806559"
                     /translation="MDMDYLVIPAYEPDYNLIKLIKKIHHKSDFHIIVIDDGSSSKCQ
                     IVFEQAEQYATVLRHQVNQGKGQALKTAFTFIQALKIYGTVVTADADGQHKVWDIFRV
                     ASKASENPNQLILGARAFTGKVPLRSRFGNSLTRALFKVQTGVSVSDTQTGLRAFTTN
                     MIPFMLKVEGQRYEYEMNMLLEASKEYPILEVPIETVYINDNQGSHFRPIRDGLMIYK
                     NIFKFALTSLSSFVVDYIVYALALLFLAAVPTSLRILLANGIARVTSSIFNYSTNKKL
                     VFKNDDSILKTGTGYFSLAVVLFILDTLLIRLFYAVFGLNLLIVKIIVGILLFTVSWM
                     VQKRFIFKERTHTAS"
     misc_feature    complement(422821..423354)
                     /locus_tag="SSA_0425"
                     /note="DPM_DPG-synthase_like is a member of the
                     Glycosyltransferase 2 superfamily; Region:
                     DPM_DPG-synthase_like; cd04179"
                     /db_xref="CDD:133022"
     misc_feature    complement(order(423097..423099,423337..423339,
                     423343..423345))
                     /locus_tag="SSA_0425"
                     /note="Ligand binding site; other site"
                     /db_xref="CDD:133022"
     misc_feature    complement(order(423097..423102,423259..423261))
                     /locus_tag="SSA_0425"
                     /note="Putative Catalytic site; other site"
                     /db_xref="CDD:133022"
     misc_feature    complement(423097..423105)
                     /locus_tag="SSA_0425"
                     /note="DXD motif; other site"
                     /db_xref="CDD:133022"
     misc_feature    complement(422347..422706)
                     /locus_tag="SSA_0425"
                     /note="GtrA-like protein; Region: GtrA; pfam04138"
                     /db_xref="CDD:282051"
     gene            complement(423655..424476)
                     /locus_tag="SSA_0426"
                     /db_xref="GeneID:4808107"
     CDS             complement(423655..424476)
                     /locus_tag="SSA_0426"
                     /function="Function unknown"
                     /note="GC: 48.91%; Transmembrane domains: 8. Codon
                     Adaptation Index (CAI): 0.737. SignalP prediction: Yes
                     (prob. 0.968); Curator(s): M. Chaplin"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034426.1"
                     /db_xref="GeneID:4808107"
                     /translation="MKKNIVLFIFLLLSAIGLEYETQAYTTGSMSGTSYGIVGLSALL
                     ALLYIIPALLLIRQLGKKWQTPALSLGVALLGGLFISGWTSGLANTYIHEWVSTSFPN
                     TLLSDLENAIAAPLVEEPLKLLAVAFAVYLVPVKKLKSFLMLGITAGMGFQISEDFSY
                     ILSDLPEGFSFTISGILGRITGGIASHWLYTALTTLGLALMLRYAKTQKNYFRVGLFY
                     FLAAFVLHFFWNSPLTAIETDIPIIVPAMTALAVFIFYQAYRKAHKIDQEELEVE"
     misc_feature    complement(423715..424281)
                     /locus_tag="SSA_0426"
                     /note="Protease prsW family; Region: PrsW-protease;
                     pfam13367"
                     /db_xref="CDD:290104"
     gene            424637..427675
                     /locus_tag="SSA_0427"
                     /db_xref="GeneID:4807217"
     CDS             424637..427675
                     /locus_tag="SSA_0427"
                     /function="General function prediction only"
                     /GO_function="GO:0005488 - binding"
                     /note="GC: 47.84%; Codon Adaptation Index (CAI): 0.766.
                     Helix-turn-helix prediction: AraC. Curator(s): M. Chaplin,
                     J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="SARP family transcriptional regulator"
                     /protein_id="YP_001034427.1"
                     /db_xref="GeneID:4807217"
                     /translation="MSKNLLRLKLLGSPSVFLNQEEVFFPFAKINALLYYLHINGAVN
                     REEIAGILWENKDNQTAKKNLRNTIYQANKLLGGEWIVAPNRTVLSLNPECMIESDVE
                     RFTDHPAKHLSLYQGDFLQGFYLKDSEAFDYWVSKMRTRYEQLYIQACYQQLETEKDQ
                     LDLEEAERNLRRLISIDEFDEKNYHLLMKLYQDHDRPGKVIETYYKLVNILDKELGIS
                     PTEPIQQLYHEVLAKDRSERKTKQFLRNTDHFFGRVDEIKRLESYFSKVIETQEARAL
                     VLVGGTGIGKRTVTRQVLANQTKYFQIVMAECFKEEMKAELQPWRGLLDGLGDLVIQH
                     QILSINQWQVILESYFPILTEGASDLQLDADKLAQFVVDILQKISKKKALIVLIEDCH
                     WMDKASVAVLEQVMNHLTGYPVAFVLTKHLSTPSYLEHFFNHLLVRQKLGFIELQPLN
                     FKDSVAYLQAQTGQLAMSEARLEDIYRVSQGIPFFLSEYAEQLLRGEKFYPLTPAIKA
                     KLSLKLDYLSSQEEELVDYLACFRASASVSLLARLIGLPTEEVVEITEEFGQKQLLME
                     EEQGEDLVVRFSQELLRIYAYERLSLAKKRMLHHQIAQGMEDQLGDSLYHAQLLNEIA
                     YHYKLSKQPIKSLEYELHYLEATLQFHHELFPIYSREFGFIEKTDDSNQSAILDQFDR
                     IRREIEGLERKHQNHKDFQLLVLRFLYLEGRYAIRTGDYQQGMDNIQQVIISAKELQQ
                     MDFLLEGYRQMIYYCIQTENIPEMRYYTELALDASVQANNHEAIAINLRLKGLYHLMI
                     GDEEQSLHHLYQSIDCFSLTASLRSKYSIQIAAALDYLAEIEQIRGNFTASLAHQKEA
                     IKLTENKTAEPSIFAFYIGLGMTYYQLKDYEQAERIFLKAKTALKSLSFPWKETQLEV
                     YLALIGCEKRDYQPVLDLLRKKDSLISRYGNPRDKGLIYYLMAVIKHQLLTGSLQQAD
                     FEDLLDQDFETYYETAKSQLNPYRDRHQLKELENLRQGLS"
     misc_feature    424649..425401
                     /locus_tag="SSA_0427"
                     /note="DNA-binding transcriptional activator of the SARP
                     family [Signal transduction mechanisms]; Region: DnrI;
                     COG3629"
                     /db_xref="CDD:226156"
     misc_feature    <424970..425329
                     /locus_tag="SSA_0427"
                     /note="Bacterial Transcriptional Activation (BTA) domain;
                     Region: BTAD; cd15831"
                     /db_xref="CDD:276938"
     misc_feature    425060..425164
                     /locus_tag="SSA_0427"
                     /note="TPR repeat [structural motif]; Region: TPR repeat"
                     /db_xref="CDD:276938"
     misc_feature    425171..425272
                     /locus_tag="SSA_0427"
                     /note="TPR repeat [structural motif]; Region: TPR repeat"
                     /db_xref="CDD:276938"
     misc_feature    425381..427672
                     /locus_tag="SSA_0427"
                     /note="Predicted ATPase [General function prediction
                     only]; Region: COG3899"
                     /db_xref="CDD:226415"
     misc_feature    425381..425887
                     /locus_tag="SSA_0427"
                     /note="AAA ATPase domain; Region: AAA_16; pfam13191"
                     /db_xref="CDD:289934"
     misc_feature    426989..427108
                     /locus_tag="SSA_0427"
                     /note="TPR repeat [structural motif]; Region: TPR repeat"
                     /db_xref="CDD:276809"
     misc_feature    order(426992..426994,427001..427006,427013..427018,
                     427022..427024,427127..427129,427136..427141,
                     427148..427153,427157..427162,427247..427249,
                     427256..427261,427268..427273,427280..427282)
                     /locus_tag="SSA_0427"
                     /note="putative protein binding surface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:276809"
     misc_feature    427121..427213
                     /locus_tag="SSA_0427"
                     /note="TPR repeat [structural motif]; Region: TPR repeat"
                     /db_xref="CDD:276809"
     misc_feature    427244..427324
                     /locus_tag="SSA_0427"
                     /note="TPR repeat [structural motif]; Region: TPR repeat"
                     /db_xref="CDD:276809"
     gene            complement(427755..428894)
                     /gene="hutG"
                     /locus_tag="SSA_0428"
                     /db_xref="GeneID:4807642"
     CDS             complement(427755..428894)
                     /gene="hutG"
                     /locus_tag="SSA_0428"
                     /EC_number="3.5.3.8"
                     /function="Amino acid transport and metabolism"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="catalyzes the formation of glutamate and formamide
                     from N-formimidoyl-L-glutamate"
                     /codon_start=1
                     /transl_table=11
                     /product="formimidoylglutamase"
                     /protein_id="YP_001034428.1"
                     /db_xref="GeneID:4807642"
                     /translation="MDYSDSRYYSIFLIKHSLSVRVLFPPKVIDRLGGNSYNKVASIV
                     MEKDKIMLEDYYQLDNSYYHKRLDDDLYAAKWGMVIEFLDLNDPNLRPFDGVNFALIG
                     FKSDKGVYINHGRVGAVEGPQAIRTQLAKLPWHLGRNVRVFDVGDIDGPNRSLEQLQQ
                     SLARAVKRLRELNLRPIVLGGGHETAYGHYLGLKSSLASDQDLAVINMDAHFDLRPYD
                     QTGPNSGTGFRQMFDDTLAQKQAFNYLILGIQEHNNNLFLFDFVAKSKAIQFLTGMDM
                     YQMGYKEVCKVVDTFLAGKEQVYLTIDIDCFSAGAAPGVSAIQSLGVDPNLAVLVFQH
                     IAASGKLIGFDIVEVSPPHDIDNHTANLAASFVFYLTQVWAQAHD"
     misc_feature    complement(427758..428744)
                     /gene="hutG"
                     /locus_tag="SSA_0428"
                     /note="formimidoylglutamase; Provisional; Region:
                     PRK13775"
                     /db_xref="CDD:172313"
     misc_feature    complement(order(427851..427853,427980..427982,
                     427986..427988,428220..428225,428256..428264,
                     428268..428270,428346..428348))
                     /gene="hutG"
                     /locus_tag="SSA_0428"
                     /note="putative active site [active]"
                     /db_xref="CDD:212514"
     misc_feature    complement(order(427980..427982,427986..427988,
                     428256..428258,428262..428264,428268..428270,
                     428346..428348))
                     /gene="hutG"
                     /locus_tag="SSA_0428"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:212514"
     gene            complement(429791..431341)
                     /gene="hutH"
                     /locus_tag="SSA_0429"
                     /db_xref="GeneID:4805807"
     CDS             complement(429791..431341)
                     /gene="hutH"
                     /locus_tag="SSA_0429"
                     /EC_number="4.3.1.3"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="catalyzes the degradation of histidine to urocanate
                     and ammmonia"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine ammonia-lyase"
                     /protein_id="YP_001034429.1"
                     /db_xref="GeneID:4805807"
                     /translation="MNLMTHVINLDGEHLTLEDVIAVARHGATCEIDQEAKKAVEASR
                     KIVDDIVREKRVVYGVTTGFGSLCNVSISPEDTTQLQENLIRTHSSGYGDPLPEDAVR
                     AIMLIRINSLVKGYSGIRLSTVEKLLELLNKGVVPYIPEKGSLGASGDLAPLAHMVLP
                     MLGLGRAYYQGQLLSGQEALDKAGIEKIALAAKEGLALINGTTVLTGIGALATYDAIQ
                     LLKLSDVAGALSMEVHNGITSPFEEDLHTIRPQSGQLATARNIRNLLEGSGNTTVATQ
                     QRVQDPYTLRCIPQIHGASKDSIAYVKTKVEIEINSVTDNPIITKEGHVISGGNFHGE
                     PMAQPFDFLGIAISEIGNVSERRVERLVNSQLSKLPSFLVKHPGLNSGFMITQYACAS
                     LASENKVLSHPASVDSIPSCENQEDFVSMGTTAARKAAEILKNSRRIVATEIMAACQA
                     LDLKPENHELGKGTKPAYDLFRQHVRFIEFDKDIEIYEELNKASELIENEEFLAAVEK
                     AVDLSIQF"
     misc_feature    complement(429824..431329)
                     /gene="hutH"
                     /locus_tag="SSA_0429"
                     /note="histidine ammonia-lyase; Provisional; Region:
                     PRK09367"
                     /db_xref="CDD:236484"
     misc_feature    complement(order(430361..430363,430394..430396,
                     430484..430486,430493..430495,430742..430744,
                     430754..430768,431090..431092,431099..431101,
                     431150..431152,431156..431158,431162..431170))
                     /gene="hutH"
                     /locus_tag="SSA_0429"
                     /note="active sites [active]"
                     /db_xref="CDD:176460"
     misc_feature    complement(order(430037..430042,430049..430051,
                     430058..430063,430079..430081,430088..430108,
                     430139..430150,430154..430171,430175..430177,
                     430181..430192,430196..430201,430205..430210,
                     430244..430246,430253..430255,430262..430264,
                     430274..430276,430286..430288,430295..430297,
                     430316..430318,430328..430330,430337..430342,
                     430346..430366,430370..430372,430385..430390,
                     430403..430408,430415..430420,430427..430432,
                     430439..430441,430448..430453,430469..430474,
                     430481..430486,430490..430498,430502..430504,
                     430580..430582,430589..430591,430595..430600,
                     430607..430612,430865..430867,430874..430876,
                     430913..430918,431000..431002,431063..431086,
                     431093..431095,431150..431155))
                     /gene="hutH"
                     /locus_tag="SSA_0429"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176460"
     gene            complement(431338..432690)
                     /locus_tag="SSA_0430"
                     /db_xref="GeneID:4807244"
     CDS             complement(431338..432690)
                     /locus_tag="SSA_0430"
                     /function="Amino acid transport and metabolism"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 42.72%; Transporter classification
                     TC:2.A.3.6.1. Transmembrane domains: 12. Codon Adaptation
                     Index (CAI): 0.757. Curator(s): M. Chaplin, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="cationic amino acid transporter"
                     /protein_id="YP_001034430.1"
                     /db_xref="GeneID:4807244"
                     /translation="MDATKLTAQEQEQEKAKFSFSGATLYGINAVIGSGIFLLPQKIY
                     KGLGPASLAVMLGTALLVILLAVCLAETAGYFNKNGGAFQYSKAAFGDFVGFNVGFLG
                     WAVTIIAWSAMAAGFARLFVITFKSFAPYELLLSVSLIILLSLMNISGLKTSKMFTLT
                     ATVAKLIPIVAFSLCAIFFIKGGIDKGNFTPFLQLEPGVDIMKAISSTAIYIFYGFIG
                     FETMSIVAGEMRNPEKNVPRAILGSISIVSVLYMLIIAGTIAMLGSRILQTDASVQDA
                     FVEMIGPVGAWIVSIGALISIAGLNIGESIMVPRYGAAIANEGLLPKKIAETNSKNAP
                     IVAIIISGILAIVLLFSGKFEELAALSVVFRFFQYIPTALAVLVLRKKYPDKKVVFRV
                     PFGPVIPILAVLVSLVMIWGENPMNYVYGLIGVLIASAVYFIYIVLICKNKVLEQEGE
                     "
     misc_feature    complement(431386..432624)
                     /locus_tag="SSA_0430"
                     /note="Amino acid permease; Region: AA_permease_2;
                     cl26159"
                     /db_xref="CDD:330980"
     gene            complement(432766..433365)
                     /locus_tag="SSA_0431"
                     /db_xref="GeneID:4807471"
     CDS             complement(432766..433365)
                     /locus_tag="SSA_0431"
                     /function="Function unknown"
                     /note="GC: 47%; Codon Adaptation Index (CAI): 0.712.
                     Curator(s): M. Chaplin"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034431.1"
                     /db_xref="GeneID:4807471"
                     /translation="MTNVTLLRVNDFQVSDWSGGKTKQLYLSPPTGHYGKRDFDYRLS
                     TATVELAESQFSDLSGFHRILMSLDHTLHLHNASRQEETVLAPFTPYVFEGSDSITSR
                     GTCTDFNLIYSDHYQGQMIAISNGQELSQDDEIQFIYALEDLTVTVTTLPVLNLEAEQ
                     LLIVEKETQETELHIMFSSNQPKGTPLSIWAGLTHIPTK"
     misc_feature    complement(432886..433365)
                     /locus_tag="SSA_0431"
                     /note="HutD; Region: HutD; cl01532"
                     /db_xref="CDD:294908"
     gene            complement(433378..435051)
                     /locus_tag="SSA_0432"
                     /db_xref="GeneID:4808102"
     CDS             complement(433378..435051)
                     /locus_tag="SSA_0432"
                     /EC_number="6.3.4.3"
                     /function="Nucleotide transport and metabolism"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="catalyzes the formation of
                     10-formyltetrahydrofolate from formate and
                     tetrahydrofolate"
                     /codon_start=1
                     /transl_table=11
                     /product="formate--tetrahydrofolate ligase"
                     /protein_id="YP_001034432.2"
                     /db_xref="GeneID:4808102"
                     /translation="MVLSDIEIANSVQMKSIKEVAEKLGIAEDALSLYGNYKAKISAG
                     QLEALKDKPDGKLILVTAISPTPAGEGKTTTSVGLVDALAAIGKKAVIALREPSLGPV
                     FGIKGGAAGGGHAQVVPMEDINLHFTGDFHAIGVANNLLAALIDNHIHHGNALGIDSR
                     RITWKRAVDMNDRQLRHIVDGLQGKVNGVPREDGFDITVASEVMAILCLSENITDLKN
                     RLEKIIIGYSFEGKPVTAKDLKAGGAMAAVLKDAIHPNLVQTLEHTPALIHGGPFANI
                     AHGCNSVLATKLALKYADYAVTEAGFGADLGAEKFIDIKCRTSGLRPAAVVLVATIRA
                     LKMHGGVAKSDLAEENVQAVVDGLPNLEKHLENIQDVYGLPAVVAINKFPLDTEAELQ
                     AVYDACQKRGVDVVISDVWANGGAGGKELAEKVVELAEGDNHFQFVYNEEDSIETKLN
                     KIVTKVYGGKGVRLTPAAKRELKQLDELGFSNYPICMAKTQYSFSDDAKKLGAPKDFV
                     VTISQLKVSAGAGFIVALTGAIMTMPGLPKVPASEKIDVDKDGNISGLF"
     misc_feature    complement(433381..435045)
                     /locus_tag="SSA_0432"
                     /note="Formate--tetrahydrofolate ligase; Region: FTHFS;
                     pfam01268"
                     /db_xref="CDD:279592"
     misc_feature    complement(order(434662..434664,434764..434766))
                     /locus_tag="SSA_0432"
                     /note="Potassium binding sites [ion binding]; other site"
                     /db_xref="CDD:238266"
     misc_feature    complement(order(434677..434685,434761..434766))
                     /locus_tag="SSA_0432"
                     /note="Cesium cation binding sites [ion binding]; other
                     site"
                     /db_xref="CDD:238266"
     gene            complement(435118..435744)
                     /locus_tag="SSA_0433"
                     /db_xref="GeneID:4806435"
     CDS             complement(435118..435744)
                     /locus_tag="SSA_0433"
                     /EC_number="4.3.1.4"
                     /function="Amino acid transport and metabolism"
                     /note="GC: 49.12%; Codon Adaptation Index (CAI): 0.792.
                     Curator(s): M. Chaplin"
                     /codon_start=1
                     /transl_table=11
                     /product="methenyltetrahydrofolate cyclohydrolase"
                     /protein_id="YP_001034433.1"
                     /db_xref="GeneID:4806435"
                     /translation="MKLVDLSLTEFAQVLGSDAPAPGGGSAAALSAANGISLTKMVCE
                     LTLGKKKYAEFEAEIAQVHAESARLQESLLAAIDKDTEAFNLVSAVFDMPKETEEDKA
                     ARREAMQQALKEATKSPYGMMEDILTALQTTQKAVGKSNTNAASDLGVAALNLKAGLQ
                     GAWLNVLINLSGVKDEAFVADYRSKGEDLLQKGCVLADEIYQEILKVV"
     misc_feature    complement(435121..435744)
                     /locus_tag="SSA_0433"
                     /note="Formiminotransferase-cyclodeaminase; Region:
                     FTCD_C; cl01350"
                     /db_xref="CDD:294812"
     gene            complement(435759..436658)
                     /locus_tag="SSA_0434"
                     /db_xref="GeneID:4806053"
     CDS             complement(435759..436658)
                     /locus_tag="SSA_0434"
                     /EC_number="2.1.2.5"
                     /EC_number="4.3.1.4"
                     /function="Amino acid transport and metabolism"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 47.11%; Codon Adaptation Index (CAI): 0.796.
                     Curator(s): M. Chaplin"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate formiminotransferase"
                     /protein_id="YP_001034434.1"
                     /db_xref="GeneID:4806053"
                     /translation="MAKIVECIPNFSEGRNQAVIDGLVEVAKSVPGVTLLDHSSDASH
                     NRSVFTLVGDDQNIQEVAFRLVKYASENIDLTKHQGEHPRMGATDVLPFVPIKDITSE
                     ECVEIAKTVSERINRELGIPIFLYEDAATRPERKNLAKVRKGQFEGMPEKLLEPDWAP
                     DYGERKIHPTAGVTAVGARMPLIAYNINLDTDNLEIANNIAKVIRGSSGGYKYCKAIG
                     VMLEDRNIAQVSINMVNLEKFPLYRVFETVRFEAKRYGVGILGSEVIGLAPAKALIDA
                     AEYYLQIEDFDYGKQVLENHLLG"
     misc_feature    complement(435762..436658)
                     /locus_tag="SSA_0434"
                     /note="Glutamate formiminotransferase [Amino acid
                     transport and metabolism]; Region: GluFT; COG3643"
                     /db_xref="CDD:226169"
     misc_feature    complement(436122..436640)
                     /locus_tag="SSA_0434"
                     /note="Formiminotransferase domain, N-terminal subdomain;
                     Region: FTCD_N; pfam07837"
                     /db_xref="CDD:285123"
     misc_feature    complement(<435807..436115)
                     /locus_tag="SSA_0434"
                     /note="Formiminotransferase domain; Region: FTCD;
                     pfam02971"
                     /db_xref="CDD:281034"
     gene            complement(436779..438809)
                     /gene="hutU"
                     /locus_tag="SSA_0435"
                     /db_xref="GeneID:4808078"
     CDS             complement(436779..438809)
                     /gene="hutU"
                     /locus_tag="SSA_0435"
                     /EC_number="4.2.1.49"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="catalyzes the formation of
                     4-imidazolone-5-propanoate from urocanate during histidine
                     metabolism"
                     /codon_start=1
                     /transl_table=11
                     /product="urocanate hydratase"
                     /protein_id="YP_001034435.1"
                     /db_xref="GeneID:4808078"
                     /translation="MSYFSENEIAAAMTVKLDDVLPEKTVFQEGIRRAPDRGFRLTQA
                     QTEIALKNALRYIPKRFHEEVIPEFLEELKTRGRIYGYRWRPKERIYGKPIDEYKGNC
                     TAAKAMQVMIDNNLSFEIALYPYELVTYGETGSVCANWMQYNLIMKYLEIMTDHQTLV
                     VESGHPLGLFKSKPEAPRVIITNGLLVGEYDNMKDWEIAEEMGVTNYGQMTAGGWMYI
                     GPQGIVHGTFNTLLNAGRLKLGVADDGDLTGKLFISSGLGGMSGAQGKAAEIAKAVAI
                     VAEVDQSRIETRHSQGWISQLAESPKEAIDLAQKALEAGESTSIAYHGNIVDLLEYVN
                     ENNIHVDLLSDQTSCHNVYDGGYCPAGISFEERTRLLAEDKESFAKLVDETLERHFKA
                     IKTLTSNGTYFFDYGNAFMKAVYDSGIKEISKNGFDDKDGFIWPSYVEDIMGPMLFDY
                     GYGPFRWVCLSGKHEDLVATDHAAMEVIDPNRRYQDRDNYNWIRDAEKNQLVVGTQAR
                     ILYQDCMGRVNIALKFNELVREGKIGPVMIGRDHHDVSGTDSPFRETSNIKDGSNVTC
                     DMAVQCYAGNAARGMSLVALHNGGGTGIGKAINGGFGLVLDGSERIDEIIKSAIAWDT
                     IGGVARRNWARNEHAIETAIEYNRLHQGTDHITIPYLTDEDLVKESVKKLFE"
     misc_feature    complement(436875..438542)
                     /gene="hutU"
                     /locus_tag="SSA_0435"
                     /note="Urocanase; Region: Urocanase; pfam01175"
                     /db_xref="CDD:279512"
     gene            439009..440274
                     /gene="hutI"
                     /locus_tag="SSA_0436"
                     /db_xref="GeneID:4805791"
     CDS             439009..440274
                     /gene="hutI"
                     /locus_tag="SSA_0436"
                     /EC_number="3.5.2.7"
                     /function="Secondary metabolites biosynthesis, transport,
                     and catabolism"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="catalyzing the hydrolysis of
                     4-imidazolone-5-propionate to N-formimidoyl-L-glutamate,
                     the third step in the histidine degradation pathway"
                     /codon_start=1
                     /transl_table=11
                     /product="imidazolonepropionase"
                     /protein_id="YP_001034436.1"
                     /db_xref="GeneID:4805791"
                     /translation="MTADLLLTHFNQVFCPKDLGHPLFGEEMKEAQVLEDGYIAVKDG
                     KILAVGSGEPDASLVGPDTKIQSYEGKIATPGLIDCHTHLVYGGSREHEFAKKLAGVP
                     YLEILAQGGGILSTVRATREASFDTLYDKSRRLLDYMLLHGVTTVEAKSGYGLDWETE
                     KRQLDVVGALDRDHEIDLVSTFMAAHAVPPEYKGRSQEYLELIVEEMLPRVKAENLAE
                     FCDIFCEKGVFTADESRYLLSKAKEMGFKLRIHADEIESIGGVDVAAELGATSAEHLM
                     VATDEGIRKMAEAKVIGNLLPATTFSLMEDTYAPARKMLEAGMAITLTTDSNPGSCPT
                     ANLQFVMQLGCFMMRLTPVEVLNAVTINAAYSVNRQDKIGSFDTGKQADITILDAKNI
                     DYPLYFFATNLTHQVYKAGKLVVDQGRIV"
     misc_feature    439009..440256
                     /gene="hutI"
                     /locus_tag="SSA_0436"
                     /note="imidazolonepropionase; Validated; Region: PRK09356"
                     /db_xref="CDD:236478"
     misc_feature    439012..440268
                     /gene="hutI"
                     /locus_tag="SSA_0436"
                     /note="Imidazolonepropionase or related amidohydrolase
                     [Secondary metabolites biosynthesis, transport and
                     catabolism]; Region: HutI; COG1228"
                     /db_xref="CDD:224149"
     misc_feature    order(439249..439251,439255..439257,439759..439761,
                     439768..439770,439828..439830,439984..439986)
                     /gene="hutI"
                     /locus_tag="SSA_0436"
                     /note="active site"
                     /db_xref="CDD:238621"
     gene            440453..440743
                     /gene="rpsF"
                     /locus_tag="SSA_0437"
                     /db_xref="GeneID:4807370"
     CDS             440453..440743
                     /gene="rpsF"
                     /locus_tag="SSA_0437"
                     /function="Translation, ribosomal structure and
                     biogenesis"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="binds cooperatively with S18 to the S15-16S
                     complex, allowing platform assembly to continue with S11
                     and S21"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S6"
                     /protein_id="YP_001034437.1"
                     /db_xref="GeneID:4807370"
                     /translation="MAKYEILYIIRPNIEEEAKNALVARFDSILTDNGATVVESKDWE
                     KRRLAYEIQDFREGLYHIVNVEANDDAALKEFDRLSKINADILRHMIVKLDA"
     misc_feature    440453..440737
                     /gene="rpsF"
                     /locus_tag="SSA_0437"
                     /note="30S ribosomal protein S6; Reviewed; Region: rpsF;
                     PRK00453"
                     /db_xref="CDD:179034"
     misc_feature    order(440462..440464,440600..440602,440612..440614,
                     440660..440662,440669..440674,440693..440695,
                     440714..440716,440723..440731)
                     /gene="rpsF"
                     /locus_tag="SSA_0437"
                     /note="rRNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:275385"
     misc_feature    order(440465..440467,440471..440473,440588..440590,
                     440594..440602,440630..440632,440636..440638,
                     440714..440716,440726..440728)
                     /gene="rpsF"
                     /locus_tag="SSA_0437"
                     /note="S18 interface [polypeptide binding]; other site"
                     /db_xref="CDD:275385"
     gene            440755..441249
                     /gene="ssb"
                     /locus_tag="SSA_0438"
                     /db_xref="GeneID:4805799"
     CDS             440755..441249
                     /gene="ssb"
                     /locus_tag="SSA_0438"
                     /function="DNA replication, recombination, and repair"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="binds to single stranded DNA and may facilitate the
                     binding and interaction of other proteins to DNA"
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded DNA-binding protein"
                     /protein_id="YP_001034438.1"
                     /db_xref="GeneID:4805799"
                     /translation="MINNVVLVGRMTRDAELRYTPQNQAVATFTLAVNRNFKNQSGER
                     EADFINVVIWRQQAENLANWAKKGALIGITGRIQTRNYENQQGQRVYVTEVVADNFQL
                     LESRSNREGQSSGGYGGNSFGGSSAPSYGSADSSNQVPNFSRDESPFGNSNPMDISDD
                     DLPF"
     misc_feature    440755..441246
                     /gene="ssb"
                     /locus_tag="SSA_0438"
                     /note="single-stranded DNA-binding protein; Provisional;
                     Region: PRK07275"
                     /db_xref="CDD:180915"
     misc_feature    order(440767..440778,440851..440859,440893..440895,
                     440899..440901,440962..440964,440989..440991,
                     441022..441024,441031..441033)
                     /gene="ssb"
                     /locus_tag="SSA_0438"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239942"
     misc_feature    order(440782..440790,440806..440808,440836..440838,
                     440857..440862,440887..440892,440896..440898,
                     440902..440904,440908..440910,440914..440916,
                     440953..440958,440980..440982,440986..440988,
                     440992..440997,441034..441036,441040..441042)
                     /gene="ssb"
                     /locus_tag="SSA_0438"
                     /note="ssDNA binding site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:239942"
     misc_feature    order(440962..440964,440968..440970,440974..440976,
                     441055..441057)
                     /gene="ssb"
                     /locus_tag="SSA_0438"
                     /note="tetramer (dimer of dimers) interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239942"
     gene            441286..441525
                     /gene="rpsR"
                     /locus_tag="SSA_0440"
                     /db_xref="GeneID:4806047"
     CDS             441286..441525
                     /gene="rpsR"
                     /locus_tag="SSA_0440"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="binds as a heterodimer with protein S6 to the
                     central domain of the 16S rRNA; helps stabilize the
                     platform of the 30S subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S18"
                     /protein_id="YP_001034439.1"
                     /db_xref="GeneID:4806047"
                     /translation="MAQQRRGGFKRRKKVDYIAANKIEYVDYKDTELLSRFVSERGKI
                     LPRRVTGTSAKNQRKVTTAIKRARVMALMPFVNED"
     misc_feature    441286..441519
                     /gene="rpsR"
                     /locus_tag="SSA_0440"
                     /note="30S ribosomal protein S18; Reviewed; Region: rpsR;
                     PRK00391"
                     /db_xref="CDD:178997"
     gene            441621..442235
                     /locus_tag="SSA_0441"
                     /db_xref="GeneID:4806133"
     CDS             441621..442235
                     /locus_tag="SSA_0441"
                     /function="Transcription"
                     /note="GC: 40.16%; Codon Adaptation Index (CAI): 0.793.
                     Helix-turn-helix prediction: AraC. Curator(s): M. Chaplin"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034440.1"
                     /db_xref="GeneID:4806133"
                     /translation="MRDVKEVEVRRAEIMSAALQLFAQKGYLKTRTQDIIDKLGISRG
                     LLYYHFKDKEDILYCLIEKNSEPLLRKLETISYQPNVGAKEKIRTFIEATLIPEESRT
                     QENQVLQETVNLETNRYVLDRFYHRLCERMIIFFTHILEEGQKSGDFHLKYPHEMASF
                     LMTAYVFVSNDIKMSQEKPETLQDYLTSFQAILERSLGLEESIF"
     misc_feature    441621..442214
                     /locus_tag="SSA_0441"
                     /note="DNA-binding transcriptional regulator, AcrR family
                     [Transcription]; Region: AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    441660..441791
                     /locus_tag="SSA_0441"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:278848"
     gene            442377..443090
                     /locus_tag="SSA_0442"
                     /db_xref="GeneID:4806566"
     CDS             442377..443090
                     /locus_tag="SSA_0442"
                     /function="Defense mechanisms"
                     /note="GC: 40.62%; Transporter classification
                     TC:3.A.1.211.3. Codon Adaptation Index (CAI): 0.727.
                     Curator(s): M. Chaplin, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug ABC transporter ATPase"
                     /protein_id="YP_001034441.1"
                     /db_xref="GeneID:4806566"
                     /translation="MLKIEHLTKVYSNGKKAVDDLSLIVEPGDIYGFIGANGAGKTST
                     IKSIVGIHDFDKGEIYICGHSIRKEPLLCKKKMAFLPDNPDLYKNLTARQFLDFVADI
                     YRVSLEKRQAAIEKYSKMFELDTSLDQLISAYSHGMKQRLALIAALLHEPELLILDEP
                     FVGLDPKGAYYFKQIMRELASQGHAIFFSTHVLEVAEELCNKVAILQKGRLVANGRTS
                     EVKGASSLEQVFMELQEDD"
     misc_feature    442377..443075
                     /locus_tag="SSA_0442"
                     /note="ABC-type Na+ transport system, ATPase component
                     NatA [Energy production and conversion, Inorganic ion
                     transport and metabolism]; Region: NatA; COG4555"
                     /db_xref="CDD:226927"
     misc_feature    442380..443009
                     /locus_tag="SSA_0442"
                     /note="ATP-binding cassette domain of the drug resistance
                     transporter and related proteins, subfamily A; Region:
                     ABC_DR_subfamily_A; cd03230"
                     /db_xref="CDD:213197"
     misc_feature    442479..442502
                     /locus_tag="SSA_0442"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213197"
     misc_feature    order(442488..442493,442497..442505,442620..442622,
                     442848..442853,442947..442949)
                     /locus_tag="SSA_0442"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213197"
     misc_feature    442611..442622
                     /locus_tag="SSA_0442"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213197"
     misc_feature    442776..442805
                     /locus_tag="SSA_0442"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213197"
     misc_feature    442836..442853
                     /locus_tag="SSA_0442"
                     /note="Walker B; other site"
                     /db_xref="CDD:213197"
     misc_feature    442860..442871
                     /locus_tag="SSA_0442"
                     /note="D-loop; other site"
                     /db_xref="CDD:213197"
     misc_feature    442935..442955
                     /locus_tag="SSA_0442"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213197"
     gene            443017..444627
                     /locus_tag="SSA_0443"
                     /db_xref="GeneID:4808108"
     CDS             443017..444627
                     /locus_tag="SSA_0443"
                     /note="GC: 41.28%; Transmembrane domains: 12. Codon
                     Adaptation Index (CAI): 0.726. Curator(s): M. Chaplin, J.
                     Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_001034442.1"
                     /db_xref="GeneID:4808108"
                     /translation="MEGPLKLRGHPVWNKYLWSYRKMTNILLLLKVQLYSTFSLNDLR
                     KGRGLGRYFKLGLLFLLVLLFSGYNLLTALSLVRFGQANLIPAYMIALISFIIFFFSL
                     MQSNGILFDQEELGRLIVLPLSIREIVCEKYAFLYLLNSVFAVLLMLPAGLVWFRYGA
                     SLLELLFYLLLMGFVPLLPLCLASLLGLCVAYIASKASHKNLVAFLFSLLLLLGLATG
                     SMWAMRAGLSAENVGLLLTKQLTSLYPPTSLFFNSQHFWWPSLLLMLIYFALTGLFLR
                     YLSRNYLKINQMITGVKSESKVYRSRQKSPFMALYRREIANFMSSYLYMLNSGLGTIL
                     IIVLAISLCFMSPDVLFSSIGLRDSREFLPLLLAGCLSISNPAAVSISLEGEEIWLLQ
                     TLPVSMRHIMMAKLALTVSLHCTALLLGLPVLVWRFSLGGLQVVDLVLVSLAYSLFTA
                     LQGLVVNFHYPKFIWDNEMIVIKQSFSTILSGGIGILVLVFPLCLSLLFGMDLEISLR
                     ISALELLLLTVVLYRHLIKQGYFKEVHG"
     gene            444627..444836
                     /locus_tag="SSA_0445"
                     /db_xref="GeneID:4807494"
     CDS             444627..444836
                     /locus_tag="SSA_0445"
                     /note="GC: 37.14%; Transmembrane domains: 2. Codon
                     Adaptation Index (CAI): 0.721. SignalP prediction: Yes
                     (prob. 0.999); Curator(s): M. Chaplin"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034443.1"
                     /db_xref="GeneID:4807494"
                     /translation="MKKKDLFVLFFLAVIIFLIICLLPEQVPIHFNSAGKADIVVNRF
                     CLILSLPIPYSLYWKYFRSKSKRGH"
     misc_feature    444648..444782
                     /locus_tag="SSA_0445"
                     /note="Protein of unknown function (DUF1648); Region:
                     DUF1648; pfam07853"
                     /db_xref="CDD:311689"
     gene            complement(444854..445528)
                     /locus_tag="SSA_0446"
                     /db_xref="GeneID:4807290"
     CDS             complement(444854..445528)
                     /locus_tag="SSA_0446"
                     /note="GC: 48.15%; Transmembrane domains: 4. Codon
                     Adaptation Index (CAI): 0.761. Helix-turn-helix
                     prediction: AraC. Curator(s): M. Chaplin, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034444.1"
                     /db_xref="GeneID:4807290"
                     /translation="MSQVSLDKLSKKNKEFIHIATNQLLQDGKSDQEIQTILEGILPE
                     ILENQTKGITARGLYGAPTTWAASLTAKERYDAEHPKENDDPKWMMLDSVLFIFGFFT
                     LLTSIVNLASSQPSVYGLTTLVLGSIVGGLSFYALYHFIYRFYGPDKDRSQRPKLLKS
                     ILTMAAAILLWSMSIVLTSLLPEFLNPRLSNVVVAIVGAITLVLRFYLKKRFNIKSAT
                     MGPTRY"
     misc_feature    complement(444896..445507)
                     /locus_tag="SSA_0446"
                     /note="Protein of unknown function (DUF1129); Region:
                     DUF1129; pfam06570"
                     /db_xref="CDD:284083"
     gene            complement(445547..446491)
                     /locus_tag="SSA_0447"
                     /db_xref="GeneID:4807610"
     CDS             complement(445547..446491)
                     /locus_tag="SSA_0447"
                     /function="Inorganic ion transport and metabolism"
                     /note="GC: 45.5%; Transporter classification
                     TC:1.A.35.3.1. Transmembrane domains: 2. Codon Adaptation
                     Index (CAI): 0.744. Curator(s): M. Chaplin, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium/cobalt transporter CorA"
                     /protein_id="YP_001034445.1"
                     /db_xref="GeneID:4807610"
                     /translation="MKQVFLSTTTEFKEIDSLESGTWINLVNPSQSESIEIANAFGID
                     ITDLRAPLDAEEMSRVTIEDEYTLIIVDVPITEERNNQTYYVTIPLGIIITEEAIITT
                     CLEKLPLLDIFIHRRLRNFYTFMKSRFIFQILYHNAELYLTALRSIDRKSEQIESQLH
                     QSTRNEELIELMELEKTIVYFKASLKTNERVIKKLTSSTSNIKKYLEDEDLLEDTLIE
                     TQQAIEMADIYGNILHSMTETFASIISNNQNNIMKALALVTIVMSIPTMIFSAYGMNF
                     KNNELPLNGEPHAFWIIMFIAFAMSASVMAYLMHKKLF"
     misc_feature    complement(445550..446425)
                     /locus_tag="SSA_0447"
                     /note="uncharacterized bacterial subfamily of the
                     Escherichia coli CorA-Salmonella typhimurium ZntB family;
                     Region: EcCorA_ZntB-like_u2; cd12827"
                     /db_xref="CDD:213361"
     misc_feature    complement(order(445844..445846,445913..445915,
                     445922..445927,446072..446074,446081..446083,
                     446165..446170,446174..446185,446225..446227,
                     446276..446278,446282..446284,446318..446320,
                     446417..446419))
                     /locus_tag="SSA_0447"
                     /note="Cl binding site [ion binding]; other site"
                     /db_xref="CDD:213361"
     misc_feature    complement(order(445559..445561,445568..445570,
                     445607..445612,445619..445624,445664..445687,
                     445691..445708,445712..445720,445724..445762,
                     445766..445789,445796..445804,445808..445813,
                     445817..445822,445829..445834,445838..445843,
                     445850..445855,445859..445864,445895..445900,
                     445910..445915,445922..445927,445931..445933,
                     445943..445948,445952..445957,445964..445969,
                     445976..445981,445985..445990,446024..446026,
                     446033..446038,446042..446047,446054..446056,
                     446063..446068,446075..446077,446087..446089,
                     446099..446101,446108..446110,446144..446146,
                     446156..446158,446309..446311,446315..446317,
                     446342..446347,446354..446356))
                     /locus_tag="SSA_0447"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:213361"
     gene            446620..449451
                     /gene="uvrA"
                     /locus_tag="SSA_0448"
                     /db_xref="GeneID:4806010"
     CDS             446620..449451
                     /gene="uvrA"
                     /locus_tag="SSA_0448"
                     /function="DNA replication, recombination, and repair"
                     /note="The UvrABC repair system catalyzes the recognition
                     and processing of DNA lesions. UvrA is an ATPase and a
                     DNA-binding protein. A damage recognition complex composed
                     of 2 uvrA and 2 uvrB subunits scans DNA for abnormalities.
                     When the presence of a lesion has been verified by uvrB,
                     the uvrA molecules dissociate"
                     /codon_start=1
                     /transl_table=11
                     /product="excinuclease ABC subunit A"
                     /protein_id="YP_001034446.1"
                     /db_xref="GeneID:4806010"
                     /translation="MQDKIVIHGARAHNLKNIDVEIPRDKLVVVTGLSGSGKSSLAFD
                     TLYAEGQRRYVESLSAYARQFLGNMEKPDVDSIDGLSPAISIDQKTTSKNPRSTVGTA
                     TEINDYLRLLYARVGTPYCINGHGAITASSVEQIVDKVLELPERQRLQILAQVIRKKK
                     GQHKTVFDKIQKDGYVRVRVDGDIYDVTEVPELSKSKQHDIEVVVDRIVLKEGVRSRL
                     FDSVEAALRIAEGYVVIDTMDGQELLFSEHYACPVCGFTVPELEPRLFSFNAPFGSCP
                     DCDGLGVKLEVDLDVVVPEAGKTLREGALAPWNPISSNYYPQMLEQAMAAFGIDMDKP
                     FEELTEEEKQLIFFGSDGREFHFHYENEFGGVRDIDIPFEGVVTNINRRYHETNSDFT
                     RTQMRAYMNELTCAACHGYRLSPQALSVKVGGENGLHIGEISDLSIADHLVQLDKLSL
                     TDNEATIARPILKEIHDRLTFLNNVGLNYLTLSRSAGTLSGGESQRIRLATQIGSNLS
                     GVLYILDEPSIGLHQRDNDRLIASLKKMRDLGNTLIVVEHDEDTMREADWLIDVGPGA
                     GVFGGEIVAAGTPAQVAKSKKSITGQYLSGKREIPVPLERRVGNGRFIEVTGAQENNL
                     QNITARFPLGKFIAVTGVSGSGKSTLVNSILKKAIAQKLNRNSAKPGKFKKISGIEHV
                     DRLIDIDQSPIGRTPRSNPATYTGVFDDIRDLFAKTNEAKIRGYKKGRFSFNVKGGRC
                     EACSGDGIIKIEMHFLPDVYVACEVCHGTRYNSETLEVHYKEKNIAQVLDMTVNDAVE
                     FFQHIPKIARKLQTIKDVGLGYVTLGQPATTLSGGEAQRMKLASELHKRSTGKSFYIL
                     DEPTTGLHSEDIAKLLQVLSRFVDDGNTVLVIEHNLDVIKTADHIIDLGPEGGVGGGT
                     IIATGTPEEVAANPASYTGQYLKGKLHVK"
     misc_feature    446620..449439
                     /gene="uvrA"
                     /locus_tag="SSA_0448"
                     /note="excinuclease ABC subunit A; Reviewed; Region: uvrA;
                     PRK00349"
                     /db_xref="CDD:234734"
     misc_feature    446632..>446970
                     /gene="uvrA"
                     /locus_tag="SSA_0448"
                     /note="ATP-binding cassette domain I of the excision
                     repair protein UvrA; Region: ABC_UvrA_I; cd03270"
                     /db_xref="CDD:213237"
     misc_feature    <448012..448350
                     /gene="uvrA"
                     /locus_tag="SSA_0448"
                     /note="ATP-binding cassette domain I of the excision
                     repair protein UvrA; Region: ABC_UvrA_I; cd03270"
                     /db_xref="CDD:213237"
     misc_feature    448459..449382
                     /gene="uvrA"
                     /locus_tag="SSA_0448"
                     /note="ATP-binding cassette domain II of the excision
                     repair protein UvrA; Region: ABC_UvrA_II; cd03271"
                     /db_xref="CDD:213238"
     gene            449604..450665
                     /gene="pepP"
                     /locus_tag="SSA_0449"
                     /db_xref="GeneID:4807423"
     CDS             449604..450665
                     /gene="pepP"
                     /locus_tag="SSA_0449"
                     /EC_number="3.4.11.9"
                     /function="Amino acid transport and metabolism"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 46.8%; Codon Adaptation Index (CAI): 0.768.
                     Curator(s): M. Chaplin"
                     /codon_start=1
                     /transl_table=11
                     /product="aminopeptidase"
                     /protein_id="YP_001034447.1"
                     /db_xref="GeneID:4807423"
                     /translation="MLSRVEKFEAALAQTECDAVLVTNLKNIYYLTGFSGTEATVFIS
                     KTRRIFLTDARYTLIAKGVVQDFDIVETRDAIREIVKIIADDKLQKIGFEDEISYAYF
                     KMLESVFSAYELVPMTAFIENLRMIKDEHEIATIRKACQISDQAFLDVLDFIKPGETT
                     ELAVMNFLDARMRQLGASGASFDFIIASGYRSAMPHGVASDKVIQKGETLTMDFGCYY
                     NHYVSDMTRTVHVGQVTDEEREIYDIVLRSNQALIEAAKAGLSRIDFDRIPRQIINDA
                     GYGPYFSHGIGHGIGLDIHEIPYFGKSEEPIEAGMVLTDEPGIYLDGKYGVRIEDDLL
                     ITETGCEVLTLAPKELIVI"
     misc_feature    449604..450662
                     /gene="pepP"
                     /locus_tag="SSA_0449"
                     /note="Xaa-Pro aminopeptidase [Amino acid transport and
                     metabolism]; Region: PepP; COG0006"
                     /db_xref="CDD:223085"
     misc_feature    449613..449984
                     /gene="pepP"
                     /locus_tag="SSA_0449"
                     /note="Creatinase/Prolidase N-terminal domain; Region:
                     Creatinase_N; pfam01321"
                     /db_xref="CDD:279639"
     misc_feature    450000..450623
                     /gene="pepP"
                     /locus_tag="SSA_0449"
                     /note="Similar to Prolidase and Aminopeptidase P. The
                     members of this subfamily presumably catalyse hydrolysis
                     of Xaa-Pro dipeptides and/or release of any N-terminal
                     amino acid, including proline, that is linked with
                     proline; Region: APP-like; cd01092"
                     /db_xref="CDD:238525"
     misc_feature    order(450189..450191,450240..450242,450273..450275,
                     450465..450467,450549..450551,450591..450593)
                     /gene="pepP"
                     /locus_tag="SSA_0449"
                     /note="active site"
                     /db_xref="CDD:238525"
     gene            450727..451287
                     /gene="efp"
                     /locus_tag="SSA_0450"
                     /db_xref="GeneID:4807787"
     CDS             450727..451287
                     /gene="efp"
                     /locus_tag="SSA_0450"
                     /function="Translation, ribosomal structure and
                     biogenesis"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="Involved in peptide bond synthesis; alters the
                     affinity of the ribosome for aminoacyl-tRNA"
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor P"
                     /protein_id="YP_001034448.1"
                     /db_xref="GeneID:4807787"
                     /translation="MIEASKLKAGMTFETADGKLIRVLEASHHKPGKGNTIMRMKLRD
                     VRTGSTFDTSYRPEEKFEQAIIETVPAQYLYQMDDTAYFMNTETYDQYEIPVVNVEEE
                     LKFILENSDVKIQFYGTEVIGVTVPTTVELVVTDTQPSIKGATVTGSGKPATLETGLV
                     VNVPDFIEVGQKLIINTAEGTYVSRA"
     misc_feature    450727..451284
                     /gene="efp"
                     /locus_tag="SSA_0450"
                     /note="elongation factor P; Validated; Region: PRK00529"
                     /db_xref="CDD:234788"
     gene            451307..451696
                     /locus_tag="SSA_0451"
                     /db_xref="GeneID:4807074"
     CDS             451307..451696
                     /locus_tag="SSA_0451"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 44.87%; Codon Adaptation Index (CAI): 0.764.
                     Curator(s): M. Chaplin"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034449.1"
                     /db_xref="GeneID:4807074"
                     /translation="MAAEQLGEIVIAPRVLEKIIAIATAKVEGVYSFANKSMSDSLSM
                     RSLGRGVSLHTDETGDVTVDIYLYLEYGVSVPTVAVAIQKAVKSAVFDMAEVELSAVN
                     IHVAGIVPEKAPKPDLKDLFDEDFLND"
     misc_feature    451316..451684
                     /locus_tag="SSA_0451"
                     /note="Uncharacterized conserved protein YloU, alkaline
                     shock protein (Asp23) family [Function unknown]; Region:
                     YloU; COG1302"
                     /db_xref="CDD:224221"
     gene            451674..452120
                     /gene="nusB"
                     /locus_tag="SSA_0452"
                     /db_xref="GeneID:4807021"
     CDS             451674..452120
                     /gene="nusB"
                     /locus_tag="SSA_0452"
                     /function="Transcription"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /GO_process="GO:0006355 - regulation of transcription,
                     DNA-dependent"
                     /note="Regulates rRNA biosynthesis by transcriptional
                     antitermination"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription antitermination protein NusB"
                     /protein_id="YP_001034450.1"
                     /db_xref="GeneID:4807021"
                     /translation="MRTSSMTDILLESRRGLRQRAFQALMSLEYEGDLVEACRFAYSY
                     DKDEGADKAAEADIPAFLLNLVSGVVQSKDDLDKKIAQHLKKGWTVDRLTLVEKNILR
                     LGIFEITEFDTPQLVAVNEAIELSKQFSDEKSSKFINGILSQFIVE"
     misc_feature    451710..452111
                     /gene="nusB"
                     /locus_tag="SSA_0452"
                     /note="transcription antitermination protein NusB;
                     Reviewed; Region: nusB; PRK00202"
                     /db_xref="CDD:234686"
     misc_feature    451719..451727
                     /gene="nusB"
                     /locus_tag="SSA_0452"
                     /note="putative RNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238253"
     gene            452352..456053
                     /locus_tag="SSA_0453"
                     /db_xref="GeneID:4807461"
     CDS             452352..456053
                     /locus_tag="SSA_0453"
                     /EC_number="3.2.1.1"
                     /EC_number="3.2.1.41"
                     /function="Carbohydrate transport and metabolism"
                     /note="GC: 45.19%; Transmembrane domains: 1. Codon
                     Adaptation Index (CAI): 0.777. LipoP prediction: SpI.
                     SignalP prediction: Yes (prob. 0.999); Curator(s): M.
                     Chaplin"
                     /codon_start=1
                     /transl_table=11
                     /product="Type II secretory pathway, pullulanase PulA
                     glycosidase"
                     /protein_id="YP_001034451.1"
                     /db_xref="GeneID:4807461"
                     /translation="MKNNDHLQSRMGEKRHYFGIRRLKVGVASVVIASGFLLGNAQLV
                     RADEASTATSPATEAVSDTNAAAQPKSADEGKTGEADSSGAGASEQAAPTGVVADQAL
                     ASAGSEAVGQEAGNPSEKDKQEPVSQPQASAKDAIEEGNIRFHFKTLPSQNLDSLGLW
                     TWDDVETPSSQKGAWPTGATSFATAKEDDYGYYLDVKMAEKRSKISLLINNTAGQNIT
                     GDKTVELLSPQMNEIWFDTDYQPYTYEPLKKGMVRINYYRTDGQYDKKSLWLWGDVQN
                     PSKNWPDGVDFENTGKYGRYVDVPLKEAAKTIGFLLLDESKSGDDVKIQNQDYNFTNL
                     EKNSQIFLRDADPTVYTNPYFVNDIRMTGAQHIGLTEIEASFSTLESAKKEDILKNLK
                     ITDKDGNEVVVKDVVLDSKTKSAKFIGVFNQAQSPYLIKYGNDQFKTSMNWQLKDSIY
                     KYDGELGARVSQAGKQVDITFWSPSADQVDLVVYDKEDQNKVVGRLAMQKGASGIWTG
                     NLTPESSLGISDYRGYFYHYEITRGGKKFLVLDPYAKSLAAWNSEDADKGDAYKIAKA
                     AFVDPSEYGPKDLTYATIPNFKKREDALIYEVHVRDFTSDPAISKDLKSQFGTFSAFI
                     EKLDYLKDLGVTHVQLLPVLSYYFVNELKNTERMDKYASSNSNYNWGYDPQNYFSLTG
                     MYSSAPTDPAKRIEEFKNLVNEIHKRGMGVILDVVYNHTAKTSIFEDLEPNYYHFMDA
                     DGTPRSSFGGGRLGTTHYMSRRVLVDSIKYLTEQYKVDGFRFDMMGDHDAESIQKAFE
                     EAKKLNPNLIMLGEGWKTYAGDENKAVQPADQSWMKSTDTVAVFSDDIRNTLKSGYPN
                     EGTPAFITGGKRSVDNVFKNIKAQPTNFEADSPGDVIQYIAAHDNLTLFDIIAQSIKK
                     DPAVAANYQEIHRRLRLGNLMILTSQGTPFIHSGQEYGRTKQFRDPAYKYPVSEDKVP
                     NKAHLLTNEDGTPFDYPYFIHDSYDSSDAVNHFDWTKTTDSEKFPENAKSRAYMKGLI
                     ALRKSTDAFTRSSKDEVEQNVTLITQPGKDGVEKEDLVLGYQVVASNGDIYAVFVNAD
                     TKERQFNFGEAYKHLAGAEVVADGNTAGVTAISDPAGVTRNSNGLALAPLTATILRLR
                     KVNPAQEEKSQAPAAQKEQLSASSVANAQPQALSLDAQKPQASEAKETVSQTEKTLPK
                     TGTSTSLLALLGGFLAFLAGLLTFRKSNN"
     misc_feature    452379..452483
                     /locus_tag="SSA_0453"
                     /note="Gram-positive signal peptide, YSIRK family; Region:
                     YSIRK_signal; TIGR01168"
                     /db_xref="CDD:273479"
     misc_feature    452760..455981
                     /locus_tag="SSA_0453"
                     /note="pullulanase, extracellular, Gram-positive; Region:
                     pullulan_Gpos; TIGR02102"
                     /db_xref="CDD:273973"
     misc_feature    452769..453086
                     /locus_tag="SSA_0453"
                     /note="Family 41 Carbohydrate-Binding Module from
                     pullulanase-like enzymes; Region: CBM41_pullulanase;
                     cd10315"
                     /db_xref="CDD:199215"
     misc_feature    order(452829..452831,452835..452837,452973..452975,
                     452997..452999,453009..453011)
                     /locus_tag="SSA_0453"
                     /note="carbohydrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:199215"
     misc_feature    453105..453410
                     /locus_tag="SSA_0453"
                     /note="Family 41 Carbohydrate-Binding Module from
                     pullulanase-like enzymes; Region: CBM41_pullulanase;
                     cd10315"
                     /db_xref="CDD:199215"
     misc_feature    order(453156..453158,453162..453164,453282..453284,
                     453318..453320,453333..453335)
                     /locus_tag="SSA_0453"
                     /note="carbohydrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:199215"
     misc_feature    453711..454064
                     /locus_tag="SSA_0453"
                     /note="Early set domain associated with the catalytic
                     domain of pullulanase (also called dextrinase and
                     alpha-dextrin endo-1,6-alpha glucosidase); Region:
                     E_set_Pullulanase; cd02860"
                     /db_xref="CDD:199890"
     misc_feature    454122..455450
                     /locus_tag="SSA_0453"
                     /note="Alpha amylase catalytic domain found in Pullulanase
                     (also called dextrinase; alpha-dextrin endo-1,6-alpha
                     glucosidase), limit dextrinase, and related proteins;
                     Region: AmyAc_Pullulanase_LD-like; cd11341"
                     /db_xref="CDD:200480"
     misc_feature    order(454284..454286,454302..454304,454392..454394)
                     /locus_tag="SSA_0453"
                     /note="Ca binding site [ion binding]; other site"
                     /db_xref="CDD:200480"
     misc_feature    order(454365..454370,454509..454511,454692..454694,
                     454698..454703,454785..454787,454791..454793,
                     454881..454883,454890..454892,455046..455054,
                     455331..455333,455337..455339)
                     /locus_tag="SSA_0453"
                     /note="active site"
                     /db_xref="CDD:200480"
     misc_feature    order(454698..454700,454785..454787,455049..455051)
                     /locus_tag="SSA_0453"
                     /note="catalytic site [active]"
                     /db_xref="CDD:200480"
     gene            complement(456140..457105)
                     /gene="scrR"
                     /locus_tag="SSA_0454"
                     /db_xref="GeneID:4808087"
     CDS             complement(456140..457105)
                     /gene="scrR"
                     /locus_tag="SSA_0454"
                     /function="Transcription"
                     /note="GC: 46.79%; Codon Adaptation Index (CAI): 0.744.
                     Helix-turn-helix prediction: LysR\AraC. Curator(s): M.
                     Chaplin, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="lactose operon transcriptional repressor, LacI
                     family"
                     /protein_id="YP_001034452.1"
                     /db_xref="GeneID:4808087"
                     /translation="MVAKLTDVAKLAGVSPTTVSRVINRKGYLSDKTISKVEAAMREL
                     AYKPNNLARSLQGKSAKLIGLIFPNISNVFYAELIDKLEHELFKQGYKTIICNSEHDS
                     DKEREYLEMLEANQVDGIISGSHNLGIEDYNRVTAPIIAFDRNLSPDIPVVSSDNYGG
                     GVLAAQTLVKAGAQNIIMITGNDNSNSPTGLRHAGFASVLPDAPIINVSSDFSPVRKE
                     MEIKQILSQTKPDAIFASDDLTAILIMKVAQELDIQIPKDLKIIGYDGTYFVENYYPQ
                     LATIKQPLKDIARLSVDLLLKKIAGQEVQTTGYFLPVSLLPGKSV"
     misc_feature    complement(456143..457099)
                     /gene="scrR"
                     /locus_tag="SSA_0454"
                     /note="DNA-binding transcriptional regulator, LacI/PurR
                     family [Transcription]; Region: PurR; COG1609"
                     /db_xref="CDD:224525"
     misc_feature    complement(456890..457099)
                     /gene="scrR"
                     /locus_tag="SSA_0454"
                     /note="helix_turn _helix lactose operon repressor; Region:
                     HTH_LACI; smart00354"
                     /db_xref="CDD:197675"
     misc_feature    complement(order(456941..456943,456947..456952,
                     456959..456961,456968..456970,457007..457009,
                     457016..457021,457034..457036,457043..457048,
                     457052..457066))
                     /gene="scrR"
                     /locus_tag="SSA_0454"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143331"
     misc_feature    complement(456941..456970)
                     /gene="scrR"
                     /locus_tag="SSA_0454"
                     /note="domain linker motif; other site"
                     /db_xref="CDD:143331"
     misc_feature    complement(456143..456922)
                     /gene="scrR"
                     /locus_tag="SSA_0454"
                     /note="Ligand binding domain of the lacI-like
                     transcription regulator from a novel metal-reducing
                     bacterium Alkaliphilus Metalliredigens (strain Qymf) and
                     its close homologs; Region: PBP1_Qymf_like; cd06291"
                     /db_xref="CDD:107286"
     misc_feature    complement(order(456356..456358,456368..456370,
                     456761..456763,456773..456775,456782..456784,
                     456821..456823,456827..456829,456857..456859,
                     456866..456868,456878..456880,456896..456898))
                     /gene="scrR"
                     /locus_tag="SSA_0454"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:107286"
     misc_feature    complement(order(456260..456262,456311..456313,
                     456395..456397,456530..456532,456677..456679,
                     456734..456736,456884..456886,456890..456892))
                     /gene="scrR"
                     /locus_tag="SSA_0454"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107286"
     misc_feature    complement(order(456332..456334,456422..456424))
                     /gene="scrR"
                     /locus_tag="SSA_0454"
                     /note="sodium binding site [ion binding]; other site"
                     /db_xref="CDD:107286"
     gene            complement(457086..458540)
                     /gene="scrB"
                     /locus_tag="SSA_0455"
                     /db_xref="GeneID:4808104"
     CDS             complement(457086..458540)
                     /gene="scrB"
                     /locus_tag="SSA_0455"
                     /EC_number="3.2.1.26"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 46.19%; Codon Adaptation Index (CAI): 0.771.
                     Curator(s): M. Chaplin, T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="sucrose-6-phosphate hydrolase"
                     /protein_id="YP_001034453.1"
                     /db_xref="GeneID:4808104"
                     /translation="MAWTTEKRYKRYEDWTQEEVQHIKENIAKSPWRANYHVEPQTGL
                     LNDPNGFSYFDGKWVVFYQNFPFGAAHGLKCWVQMESDDLVHFTETGLRVLPDTPLDS
                     HGAYSGSAMQFDDKLFLFYTGNVRDENWVRHPYQIGALLDKSGKLEKIDKVLIEQPAE
                     ATDHFRDPQIFNYKGQFYAIVGGQNLDKQGYVKLYKAVDNDYTNWEVIGDLDFANDKT
                     AYMMECPNLVFINDQPVLLYCPQGLSKDVQDYGNIYPNMYKIGQSFDTNKAAMINPSP
                     IQNLDYGFDCYATQAFNAPDGRVLAVSWLGLPDVEYPSDRFDHQGAFSLVKELSLKDG
                     KLYQYPVPAIKDLRAEEQPFAALTESKNSYELELNLAADTEHEIVLFADKDGKGLRIN
                     FDLKAGLVTVDRSLAGEPFALDFGTSRSCNIDKEATSATIFIDKSIFEIFINKGEKVF
                     SGRVFPREDQTGIAITKGNPTGTYYELDYGRKAN"
     misc_feature    complement(457173..458483)
                     /gene="scrB"
                     /locus_tag="SSA_0455"
                     /note="sucrose-6-phosphate hydrolase; Region: scrB_fam;
                     TIGR01322"
                     /db_xref="CDD:273554"
     misc_feature    complement(457521..458432)
                     /gene="scrB"
                     /locus_tag="SSA_0455"
                     /note="Glycosyl hydrolases family 32 N-terminal domain;
                     Region: Glyco_hydro_32N; pfam00251"
                     /db_xref="CDD:278671"
     misc_feature    complement(order(457872..457874,458040..458045,
                     458220..458225,458352..458354,458400..458405))
                     /gene="scrB"
                     /locus_tag="SSA_0455"
                     /note="substrate binding [chemical binding]; other site"
                     /db_xref="CDD:185737"
     misc_feature    complement(order(457872..457874,458040..458042,
                     458400..458402))
                     /gene="scrB"
                     /locus_tag="SSA_0455"
                     /note="active site"
                     /db_xref="CDD:185737"
     misc_feature    complement(457203..457409)
                     /gene="scrB"
                     /locus_tag="SSA_0455"
                     /note="Glycosyl hydrolases family 32 C terminal; Region:
                     Glyco_hydro_32C; pfam08244"
                     /db_xref="CDD:285456"
     gene            458735..460645
                     /gene="scrA"
                     /locus_tag="SSA_0456"
                     /db_xref="GeneID:4806388"
     CDS             458735..460645
                     /gene="scrA"
                     /locus_tag="SSA_0456"
                     /EC_number="2.7.1.69"
                     /function="Carbohydrate transport and metabolism"
                     /note="GC: 42.12%; Transporter classification
                     TC:4.A.1.2.1. Transmembrane domains: 10. Codon Adaptation
                     Index (CAI): 0.809. Curator(s): M. Chaplin"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphotransferase system IIC components,
                     glucose/maltose/N-acetylglucosamine-specific"
                     /protein_id="YP_001034454.1"
                     /db_xref="GeneID:4806388"
                     /translation="MNNTDIAKKVIEALGGRENVNSVAHCATRLRVMVKDEGKIDKNT
                     VENLEKVQGAFFNSGQYQIIFGTGTVNKIYDEVVALGLPTSSKDDMKVEAAKQGNWFQ
                     RAIRTFGDVFVPLLPAIVATGLFMGIRGAIAQDQVLSLFGTTADAFKATNFYTYTVVL
                     TDTAFAFFPALICWSAFRVFGGNPLIGLVLGLMMVNSALPNAWDVASGDAKPILFFGF
                     IKVVGYQNSVLPAFFVGLIGAKLEKWLHKRIPDVLDLLVVPFLTFLVMSILALFVIGP
                     VFHDVESYVKVATTWLLSLPFGLGGLVLGGVHQVIVVTGVHHIFNLLESNLVTSTGAD
                     PLNAIITAAMTAQLGATLAVGVKTKNPKLKALAFPAALSAGLGITEPAIFGVNLRFVK
                     PFVIGLGAGAVGGWLASIMGLAGTSFGITIIPGTLLYLNGQLLQYIFMVVLTTGLSFV
                     LTYLFGYKDEETAGEKAETEELVEEETTGNVPASLQDETIISPIVGQAVALSDVNDPV
                     FSSGAMGRGIAIKPSEGVVYAPADAEVTIAFETGHAYGLKTANGAEILIHVGIDTVSM
                     GGEGFDQKVAQGDKVKAGDVLGTFEAEKIAAAGLDDTTMVIVTNTADYASVTPVAEGA
                     LAKGDAIIEVKA"
     misc_feature    458738..460099
                     /gene="scrA"
                     /locus_tag="SSA_0456"
                     /note="PTS system, sucrose-specific IIBC component;
                     Region: PTS-II-BC-sucr; TIGR01996"
                     /db_xref="CDD:131051"
     misc_feature    458744..458977
                     /gene="scrA"
                     /locus_tag="SSA_0456"
                     /note="PTS_IIB, PTS system, glucose/sucrose specific IIB
                     subunit. The bacterial phosphoenolpyruvate: sugar
                     phosphotransferase system (PTS) is a multi-protein system
                     involved in the regulation of a variety of metabolic and
                     transcriptional processes. This family...; Region:
                     PTS_IIB_glc; cd00212"
                     /db_xref="CDD:238130"
     misc_feature    458807..458827
                     /gene="scrA"
                     /locus_tag="SSA_0456"
                     /note="active site turn [active]"
                     /db_xref="CDD:238130"
     misc_feature    458810..458812
                     /gene="scrA"
                     /locus_tag="SSA_0456"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238130"
     misc_feature    459014..460132
                     /gene="scrA"
                     /locus_tag="SSA_0456"
                     /note="Phosphotransferase system IIC components,
                     glucose/maltose/N-acetylglucosamine-specific [Carbohydrate
                     transport and metabolism]; Region: PtsG1; COG1263"
                     /db_xref="CDD:224183"
     misc_feature    460181..460636
                     /gene="scrA"
                     /locus_tag="SSA_0456"
                     /note="Phosphotransferase system IIA component
                     [Carbohydrate transport and metabolism]; Region: NagE;
                     COG2190"
                     /db_xref="CDD:225101"
     misc_feature    order(460250..460261,460271..460276,460340..460345,
                     460349..460354,460370..460378,460394..460402,
                     460406..460408,460418..460420,460424..460429,
                     460463..460465,460559..460561,460568..460570)
                     /gene="scrA"
                     /locus_tag="SSA_0456"
                     /note="HPr interaction site; other site"
                     /db_xref="CDD:238128"
     misc_feature    order(460250..460252,460256..460261,460265..460267,
                     460271..460276,460343..460345,460349..460351,
                     460361..460363,460400..460402,460406..460408,
                     460418..460420,460424..460429,460433..460435,
                     460559..460561)
                     /gene="scrA"
                     /locus_tag="SSA_0456"
                     /note="glycerol kinase (GK) interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238128"
     misc_feature    order(460355..460357,460361..460363,460406..460408,
                     460412..460414)
                     /gene="scrA"
                     /locus_tag="SSA_0456"
                     /note="active site"
                     /db_xref="CDD:238128"
     misc_feature    460406..460408
                     /gene="scrA"
                     /locus_tag="SSA_0456"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238128"
     gene            460803..461702
                     /gene="scrK"
                     /locus_tag="SSA_0457"
                     /db_xref="GeneID:4806510"
     CDS             460803..461702
                     /gene="scrK"
                     /locus_tag="SSA_0457"
                     /EC_number="2.7.1.4"
                     /function="Transcription / Carbohydrate transport and
                     metabolism"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 47.78%; Codon Adaptation Index (CAI): 0.801.
                     Curator(s): M. Chaplin"
                     /codon_start=1
                     /transl_table=11
                     /product="fructokinase"
                     /protein_id="YP_001034455.1"
                     /db_xref="GeneID:4806510"
                     /translation="MTKLYGSLEAGGTKFVCAVGDERFEVVEKTQFPTTTPIETLDKT
                     IEFFSRFDNLAGLAVGSFGPIDIDPNSKTYGFITTTPKPHWANVDIVGALRRALNVPI
                     YFTTDVNSSAYGEVVARNNAGGRIENLVYYTIGTGIGAGAIQRGEFVGGTGHPEMGHY
                     YVAKHPMDVEKEFNGVCPFHNGCLEGLAAGPSLEARTGVRGENIKLNSSVWDIQAYYI
                     AQAAIQATVTFRPDVIVFGGGVMAQQHMLDRVREKFTVLLNGYLPVPDVRDYIVTPAV
                     AGNGSATLGNFVLAKEVSERHAK"
     misc_feature    460818..461678
                     /gene="scrK"
                     /locus_tag="SSA_0457"
                     /note="Nucleotide-Binding Domain of the sugar
                     kinase/HSP70/actin superfamily; Region:
                     NBD_sugar-kinase_HSP70_actin; cl17037"
                     /db_xref="CDD:327376"
     misc_feature    order(460827..460838,460842..460844,460848..460850,
                     461121..461123,461199..461210)
                     /gene="scrK"
                     /locus_tag="SSA_0457"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212657"
     gene            461749..462159
                     /locus_tag="SSA_0458"
                     /db_xref="GeneID:4807156"
     CDS             461749..462159
                     /locus_tag="SSA_0458"
                     /EC_number="3.5.1.88"
                     /note="cleaves off formyl group from N-terminal methionine
                     residues of newly synthesized proteins; binds iron(2+)"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide deformylase"
                     /protein_id="YP_001034456.1"
                     /db_xref="GeneID:4807156"
                     /translation="MEKAIVKDIFFLQQLSERASREDLYLAQDLQDTLQANRENCIGL
                     AANMIGVRKRVIIFLYGLVPVVMFNPVLLSKSGPYQTEEGCLSLVGSRPTQRYQEITV
                     DYLDKNWQQQTMTLKGLPAQICQHELDHLEGIII"
     misc_feature    461749..462156
                     /locus_tag="SSA_0458"
                     /note="peptide deformylase; Validated; Region: PRK09218"
                     /db_xref="CDD:181704"
     misc_feature    order(461869..461877,461890..461892,461998..462006,
                     462124..462129,462136..462138)
                     /locus_tag="SSA_0458"
                     /note="active site"
                     /db_xref="CDD:238271"
     misc_feature    order(461875..461877,461890..461892,462004..462006,
                     462127..462129)
                     /locus_tag="SSA_0458"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238271"
     misc_feature    order(462001..462003,462124..462126,462136..462138)
                     /locus_tag="SSA_0458"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:238271"
     gene            462238..462573
                     /locus_tag="SSA_0459"
                     /db_xref="GeneID:4806498"
     CDS             462238..462573
                     /locus_tag="SSA_0459"
                     /note="GC: 44.64%; Transmembrane domains: 3. Codon
                     Adaptation Index (CAI): 0.734. SignalP prediction: Yes
                     (prob. 0.983); Curator(s): M. Chaplin"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001034457.1"
                     /db_xref="GeneID:4806498"
                     /translation="MKTKTLALISGLVGLIGGTILLLSNIFFVPFSALLGDSGLNLLG
                     AVIKLAALGLGITSLAYYKGQMRFSVAAGVLLIVGSSNIAPIPFIGWIAGILLIIGGA
                     LFLASSSKF"
     gene            462748..463206
                     /locus_tag="SSA_0460"
                     /db_xref="GeneID:4807273"
     CDS             462748..463206
                     /locus_tag="SSA_0460"
                     /function="Transcription"
                     /note="GC: 42.48%; Codon Adaptation Index (CAI): 0.791.
                     Helix-turn-helix prediction: AraC. Curator(s): M. Chaplin,
                     J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="multiple antibiotic resistance operon
                     transcription repressor MarR"
                     /protein_id="YP_001034458.1"
                     /db_xref="GeneID:4807273"
                     /translation="MDKPLLELKRFGRKIHLIAEKLAKEQGIESMAGPQGQVLHIVAC
                     RMEEGKDTLIKDIEQELDISKSVASNLMKRMEKNGFIKLEMGKTDKRAKYIRLTPQSQ
                     ERMKKIRDFFDEMNLSILNGVSEQELLIFSQVMAKFYQNIESLENGGKDV"
     misc_feature    462796..463134
                     /locus_tag="SSA_0460"
                     /note="DNA-binding transcriptional regulator, MarR family
                     [Transcription]; Region: MarR; COG1846"
                     /db_xref="CDD:224759"
     gene            463199..464965
                     /locus_tag="SSA_0461"
                     /db_xref="GeneID:4808109"
     CDS             463199..464965
                     /locus_tag="SSA_0461"
                     /function="Defense mechanisms"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 47.43%; Transporter classification
                     TC:3.A.1.117.1. Transmembrane domains: 6. Codon Adaptation
                     Index (CAI): 0.771. Curator(s): M. Chaplin, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug ABC transporter ATPase/permease"
                     /protein_id="YP_001034459.1"
                     /db_xref="GeneID:4808109"
                     /translation="MFKLFKRLTVREVSMIVLSVLFTFLTVYLELEVPTYISTITELL
                     QTPGTGLADLWEPGLKMIGLSFASLLSAIVVGFFAARIAASFTQSLRSDIFNRVLDYS
                     QTEIKKFSIPSLLTRTTNDITQVQTLITMGLQVVTRGPIMAIWAMTKIIGKSENWLTA
                     VLIAVLVNILLTVVLVTLAFPKQSVAQRLVDKLNSVTRESLTGIRVVRAYNAEDYQDE
                     KFAAANDEVTRLNLFIGRLMAMMNPVMMGISSGLTLAIYWIGAYLIQEAGLQERLPLF
                     SDMVVFMSYAMQIVIGFLLMGALFIVLPRTIVSAGRINEVLDLHSSITSPEHPKAASD
                     SKGEVVFRDVSFRYAKNSEAVIEHVSFTAQAGDTVAFIGSTGSGKSTLVNLIPRFYDV
                     TEGEILVDGVNVQDYQLEDLHNKVGYIPQKAVLFSGDIESNLDFGQSKESPLDEQKMW
                     DALDLAQAKPFVQEKEKGLKSEVAQSGTNFSGGQRQRLAIARALARKPEILIFDDSFS
                     ALDYKTDRILRKELAERTQDMTKLIVAQRISTIMDADQILVLDAGKVVGQGTHRELLA
                     SNEVYQEIAYSQLSKEELENGK"
     misc_feature    463241..464941
                     /locus_tag="SSA_0461"
                     /note="ABC-type multidrug transport system, ATPase and
                     permease component [Defense mechanisms]; Region: MdlB;
                     COG1132"
                     /db_xref="CDD:224055"
     misc_feature    463379..464068
                     /locus_tag="SSA_0461"
                     /note="ABC transporter transmembrane region; Region:
                     ABC_membrane; cl00549"
                     /db_xref="CDD:294371"
     misc_feature    464213..464917
                     /locus_tag="SSA_0461"
                     /note="P-loop containing Nucleoside Triphosphate
                     Hydrolases; Region: P-loop_NTPase; cl21455"
                     /db_xref="CDD:304359"
     misc_feature    464315..464338
                     /locus_tag="SSA_0461"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(464324..464329,464333..464341,464459..464461,
                     464708..464713,464804..464806)
                     /locus_tag="SSA_0461"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    464450..464461
                     /locus_tag="SSA_0461"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    464636..464665
                     /locus_tag="SSA_0461"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    464696..464713
                     /locus_tag="SSA_0461"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    464720..464731
                     /locus_tag="SSA_0461"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    464792..464812
                     /locus_tag="SSA_0461"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            464955..466712
                     /locus_tag="SSA_0462"
                     /db_xref="GeneID:4807589"
     CDS             464955..466712
                     /locus_tag="SSA_0462"
                     /function="Defense mechanisms"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 47.33%; Transporter classification
                     TC:3.A.1.106.1. Transmembrane domains: 5. Codon Adaptation
                     Index (CAI): 0.777. SignalP prediction: Yes (prob. 0.48);
                     Curator(s): M. Chaplin, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug ABC transporter ATPase/permease"
                     /protein_id="YP_001034460.1"
                     /db_xref="GeneID:4807589"
                     /translation="MENKKPSLFSQIRPYLKGFQLPLALAFVGAVLSNIITVYGPIKL
                     KEITNLISDGLATSIDLKAVSQIALLLTVLYAVGALLNYGQSFIISTVIQYFSKRLRT
                     AIAEKINKLPLGYFDGHSQGDTLSRVTNDVDTVGQSLNQSLGNVISASLLLVAVVLTM
                     FFMNWILALVTILATILGFVFVGLIMGKSQGYFTAQQNDLAAVNGYVEEMYSGHNVVT
                     SYNAIEQSKERFAVLNNNLYNSIWKSQFISGMMMPLMFFTGNFAYVLVILVGAALAIN
                     GSISIGIIVAFMVYVRTFSQPLSQIAQGITVLQQAGAALVRVLDFLAEPEMEDDQHKE
                     QQLAAVKGDVAFEEVFFGYKPDQTIIHDFSAQAKAGQKIAIVGPTGAGKTTIVNLLMK
                     FYEINKGRISIDGIDIKDMKRSEVHDAFSMVLQDTWLFEGTIRENLIYNQEHVTDEAV
                     VAAAKAVGVHHFIMTLPQGYDTVLDDTVNLSVGQKQLLTIARALLKDAPLLILDEATS
                     SVDTRTEELIQKAMDKLMEGRTSFVIAHRLSTIRNADLILVMRDGNIIEQGNHDELMD
                     QNGFYADLYNSQFVEEDAS"
     misc_feature    464970..466691
                     /locus_tag="SSA_0462"
                     /note="ABC-type multidrug transport system, ATPase and
                     permease component [Defense mechanisms]; Region: MdlB;
                     COG1132"
                     /db_xref="CDD:224055"
     misc_feature    465033..465848
                     /locus_tag="SSA_0462"
                     /note="ABC transporter transmembrane region; Region:
                     ABC_membrane; pfam00664"
                     /db_xref="CDD:279056"
     misc_feature    465978..466661
                     /locus_tag="SSA_0462"
                     /note="ATP-binding cassette domain of glucan transporter
                     and related proteins, subfamily C; Region:
                     ABCC_Glucan_exporter_like; cd03254"
                     /db_xref="CDD:213221"
     misc_feature    466083..466106
                     /locus_tag="SSA_0462"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213221"
     misc_feature    order(466092..466097,466101..466109,466227..466229,
                     466464..466469,466560..466562)
                     /locus_tag="SSA_0462"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213221"
     misc_feature    466218..466229
                     /locus_tag="SSA_0462"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213221"
     misc_feature    466392..466421
                     /locus_tag="SSA_0462"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213221"
     misc_feature    466452..466469
                     /locus_tag="SSA_0462"
                     /note="Walker B; other site"
                     /db_xref="CDD:213221"
     misc_feature    466476..466487
                     /locus_tag="SSA_0462"
                     /note="D-loop; other site"
                     /db_xref="CDD:213221"
     misc_feature    466548..466568
                     /locus_tag="SSA_0462"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213221"
     gene            467005..468363
                     /locus_tag="SSA_0463"
                     /db_xref="GeneID:4806655"
     CDS             467005..468363
                     /locus_tag="SSA_0463"
                     /function="Coenzyme metabolism"
                     /note="responsible for the amidation of carboxylic groups
                     at position A and C of cobyrinic acid or hydrogenobrynic
                     acid"
                     /codon_start=1
                     /transl_table=11
                     /product="cobyrinic acid a,c-diamide synthase"
                     /protein_id="YP_001034461.1"
                     /db_xref="GeneID:4806655"
                     /translation="MKQFMLAGVSSGVGKTTVTLGILKALADRGYQVQPYKIGPDYID
                     TAYHSRITKRPSRNVDSFMIPDDQSLAWSYYKWHGDADVAVVEGVMGLFDGLGTDKDC
                     ASSASVAKKLGIPVVLIIDGKATSTSAAAMVHGFATFDPDLDIAGVIINRVASQTHFE
                     LIKGAIERYTDVEVLGYLPKNATAELPSRHLGLIPDVEMDDLDRRFEDLGAATAKHIN
                     LDRLLEKAELPDKRMTNPFRISNDQPLTLAYALDDAFHFYYEDNLDFLRELNVQLVPF
                     SPLKDKELPAADAYYFGGGFPEVYAQELMANADFRASVKKAHEQGRPIYAECGGLMYL
                     GELLEVEGQVYEMVGIFKGKSLMTPGLKSFGYCQAETQVDSLFGPKGTAVRGHEFHHS
                     VFETEEDTVLKLEKVRDGQVVAAWTGGYQKGRTFASYLHVHFYQDEQLLANWLDYIKE
                     AN"
     misc_feature    467005..468357
                     /locus_tag="SSA_0463"
                     /note="cobyrinic acid a,c-diamide synthase; Validated;
                     Region: PRK01077"
                     /db_xref="CDD:234896"
     misc_feature    467008..467553
                     /locus_tag="SSA_0463"
                     /note="P-loop containing Nucleoside Triphosphate
                     Hydrolases; Region: P-loop_NTPase; cl21455"
                     /db_xref="CDD:304359"
     misc_feature    467743..468339
                     /locus_tag="SSA_0463"
                     /note="Type 1 glutamine amidotransferase (GATase1) domain
                     found in Cobyrinic Acid a,c-Diamide Synthase; Region:
                     GATase1_CobB; cd03130"
                     /db_xref="CDD:153224"
     misc_feature    order(467986..467988,468301..468303,468307..468309)
                     /locus_tag="SSA_0463"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:153224"
     gene            468365..469315
                     /locus_tag="SSA_0464"
                     /db_xref="GeneID:4807268"
     CDS             468365..469315
                     /locus_tag="SSA_0464"
                     /EC_number="6.3.1.10"
                     /function="Coenzyme metabolism"
                     /note="GC: 49.42%; Transmembrane domains: 5. Codon
                     Adaptation Index (CAI): 0.765. Curator(s): M. Chaplin"
                     /codon_start=1
                     /transl_table=11
                     /product="cobalamin biosynthesis protein cobD"
                     /protein_id="YP_001034462.1"
                     /db_xref="GeneID:4807268"
                     /translation="MTLIAIFLAVLLDWLIGDPYSWPHPVKWMGSYIYLCMRLQEKKQ
                     FSPYLFGFFLWLTTVGLALGVSCGLLWLAGLAHPVLYWLVWIYLAYASLAAKSLAFEA
                     QKVYHTLKFGTLEEARKQVGMIVGRETSQLTPEEISKATIETVAENTSDGVIGPLLCL
                     FLGGPILAMTYKAINTLDSMVGYKTEKYRKIGLISAKMDDLANLIPARLTWLFLILSS
                     QILLLDVKGALRIGWRDRYQHASPNSAFSEAVVAGALGIQLGGPHVYHGELIEKPTIG
                     EDSRPVEADDIQTAISLLYTSTMTGLILFTLFYLVMQAYF"
     misc_feature    468380..469246
                     /locus_tag="SSA_0464"
                     /note="CobD/Cbib protein; Region: CobD_Cbib; pfam03186"
                     /db_xref="CDD:281215"
     gene            469325..470023
                     /gene="cbiC"
                     /locus_tag="SSA_0465"
                     /db_xref="GeneID:4807117"
     CDS             469325..470023
                     /gene="cbiC"
                     /locus_tag="SSA_0465"
                     /EC_number="5.4.1.2"
                     /note="catalyzes the interconversion of
                     cobalt-precorrin-8X and cobyrinic acid in the anaerobic
                     biosynthesis of cobalamin"
                     /codon_start=1
                     /transl_table=11
                     /product="cobalt-precorrin-8X methylmutase"
                     /protein_id="YP_001034463.1"
                     /db_xref="GeneID:4807117"
                     /translation="MTYIQNPSSIEEKSFQIIQSMITEKDPDYVFHSEMEESIIKRAI
                     HTTGDFDYLYTMRFEHDVLKKIEEVIRAKGTILLDSNISLNGINKRVLDQLGVSYRCL
                     ISDEEVVALAKEKQITRAMAAVEIAAKIEGPKVFAFGGAPTALSYLIELAEQGLVEAD
                     AVIGVPVGFINVEESKEELLQSGLPALVNLGRKGGSTIVVAIVNAIIYQLREVVTDDY
                     VRYSTPSSKEGGKN"
     misc_feature    469325..469966
                     /gene="cbiC"
                     /locus_tag="SSA_0465"
                     /note="cobalt-precorrin-8X methylmutase; Validated;
                     Region: cbiC; PRK08286"
                     /db_xref="CDD:181353"
     gene            470024..470728
                     /gene="cbiC"
                     /locus_tag="SSA_0466"
                     /db_xref="GeneID:4806239"
     CDS             470024..470728
                     /gene="cbiC"
                     /locus_tag="SSA_0466"
                     /EC_number="5.4.1.2"
                     /note="catalyzes the interconversion of
                     cobalt-precorrin-8X and cobyrinic acid in the anaerobic
                     biosynthesis of cobalamin"
                     /codon_start=1
                     /transl_table=11
                     /product="cobalt-precorrin-8X methylmutase"
                     /protein_id="YP_001034464.1"
                     /db_xref="GeneID:4806239"
                     /translation="MTYLKAAHKIEEASFSKIQEIIDQEHPDIHFSDPFEEAVLKRVV
                     FTSADFDYLYNIKFSNQVIEKILYVLRNKGTIFTDTTMVLGGFNKKLLDDLGVSYRCL
                     VNEPAVFQEAKEKGITRSMAAVEYAAKVDGPKLFVFGNAPTSIFKVLDMVEEGSLQPD
                     AVVGVPVGFVGAAESKLKLHESSVPSIAALGQKGGSTIAAAVVNAILYQLKLATTDYE
                     RYSVSDKKQAPEKGEG"
     misc_feature    470024..470665
                     /gene="cbiC"
                     /locus_tag="SSA_0466"
                     /note="cobalt-precorrin-8X methylmutase; Validated;
                     Region: cbiC; PRK08286"
                     /db_xref="CDD:181353"
     gene            470728..471855
                     /gene="cbiD"
                     /locus_tag="SSA_0467"
                     /db_xref="GeneID:4807259"
     CDS             470728..471855
                     /gene="cbiD"
                     /locus_tag="SSA_0467"
                     /note="Catalyzes the methylation of C-1 in
                     cobalt-precorrin-5 and the subsequent extrusion of acetic
                     acid from the resulting intermediate to form
                     cobalt-precorrin-6A"
                     /codon_start=1
                     /transl_table=11
                     /product="cobalt-precorrin-6A synthase"
                     /protein_id="YP_001034465.1"
                     /db_xref="GeneID:4807259"
                     /translation="MMDEYAYVNGKKLRKGFTTGTCATAATVAALSMILNQEREEKVT
                     VHTASGVEVTMDVHNPSFGPEEATAAIEKDGGDDADATHGLLIYSTVTLLPDQTEIEI
                     DGGQGVGRVTEKGLACDVGMAAINPTPRRMIEQHVRKIIGPNCGARVIISVPGGEETA
                     KLTYNSRLGIIGGISILGTTGIVNPMSEESWKAAITIELTMLYNQGHRSVVLVPGNYG
                     EDFATNTVGIPAGRIVNMSNFVGHVLKEVQRIGFTKVLMIGHMGKFVKVAAGIFSTHS
                     KDSDARMETLVANLALMGAPMELLKKVDKCLTTEAAGTAIKEFSYEGVYQVLADKIKA
                     RSERLLRYRKPEVNIEVVVFGTEEGYLASTQPLEQIKEEWT"
     misc_feature    470824..471837
                     /gene="cbiD"
                     /locus_tag="SSA_0467"
                     /note="cobalt-precorrin-6A synthase; Reviewed; Region:
                     cbiD; PRK00075"
                     /db_xref="CDD:234615"
     gene            471846..472478
                     /locus_tag="SSA_0468"
                     /db_xref="GeneID:4808077"
     CDS             471846..472478
                     /locus_tag="SSA_0468"
                     /EC_number="2.1.1.132"
                     /function="Coenzyme metabolism"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="catalyzes the methylation of C-5 in
                     cobalt-precorrin-6Y to form cobalt-precorrin-7W-a"
                     /codon_start=1
                     /transl_table=11
                     /product="cobalt-precorrin-6Y C(5)-methyltransferase"
                     /protein_id="YP_001034466.1"
                     /db_xref="GeneID:4808077"
                     /translation="MDMIYVIGIGPGDPSYGLLGQEAYFEKADRILGSERHLEILPPA
                     YRDKGLVPPKKLAALAELLESFVEDEEILYLASGDPLIYGLGKWLSEKFKGRVVISPG
                     ISAMQYLASRIALPMNDAYLTSSHAKVPNFDLIMSLSKVFMVTDQKVGPYEIAQEAVK
                     RGLDKVLVIGEQLSYEDERITILPASEVEDREYEMNVVVVLDEGFGIYQG"
     misc_feature    471852..472457
                     /locus_tag="SSA_0468"
                     /note="cobalt-precorrin-6Y C(5)-methyltransferase;
                     Validated; Region: PRK05787"
                     /db_xref="CDD:235609"
     misc_feature    order(471876..471878,471951..471953,472074..472082,
                     472089..472097,472155..472160,472215..472217,
                     472272..472277,472353..472355,472359..472364,
                     472428..472436)
                     /locus_tag="SSA_0468"
                     /note="active site"
                     /db_xref="CDD:212503"
     misc_feature    order(471894..471905,471909..471911,472080..472097,
                     472104..472109,472113..472118,472140..472142,
                     472146..472157,472161..472166,472173..472178,
                     472203..472217)
                     /locus_tag="SSA_0468"
                     /note="putative homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:212503"
     misc_feature    order(471951..471953,472074..472082,472089..472094,
                     472155..472160,472275..472280,472353..472355,
                     472359..472364,472428..472436)
                     /locus_tag="SSA_0468"
                     /note="SAM binding site [chemical binding]; other site"
                     /db_xref="CDD:212503"
     gene            472450..473019
                     /gene="cobL"
                     /locus_tag="SSA_0469"
                     /db_xref="GeneID:4806225"
     CDS             472450..473019
                     /gene="cobL"
                     /locus_tag="SSA_0469"
                     /EC_number="1.-.-.-"
                     /function="Coenzyme metabolism"
                     /note="catalyzes the methylation of either C-15 or C-5 in
                     cobalt-precorrin-6Y to form cobalt-precorrin-7W;
                     decarboxylating"
                     /codon_start=1
                     /transl_table=11
                     /product="cobalt-precorrin-6Y C(15)-methyltransferase"
                     /protein_id="YP_001034467.1"
                     /db_xref="GeneID:4806225"
                     /translation="MRDSEFIRAKVPMTKEEVRAISLDKLELHRAKRMLDVGSGTGSV
                     TIQAARTYPELEVVAVERNEDAVALTQENIQHFGCQNVRLHQGLAPIELEGSFDAIFV
                     GGTGGNMQEIFDWCAQLMEPGGRLVLNFILLENALEAAQIAEQMDWEDLEIVSVQASR
                     WTGIGKGHYFKPQNPTIIVSCKKKEREAN"
     misc_feature    472450..473007
                     /gene="cobL"
                     /locus_tag="SSA_0469"
                     /note="cobalt-precorrin-6Y C(15)-methyltransferase;
                     Validated; Region: PRK08287"
                     /db_xref="CDD:181354"
     misc_feature    472450..472998
                     /gene="cobL"
                     /locus_tag="SSA_0469"
                     /note="Precorrin-6B methylase 2 [Coenzyme transport and
                     metabolism]; Region: CobL; COG2242"
                     /db_xref="CDD:225151"
     misc_feature    order(472558..472578,472630..472635,472708..472710,
                     472756..472758)
                     /gene="cobL"
                     /locus_tag="SSA_0469"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            473019..473792
                     /gene="cobM"
                     /locus_tag="SSA_0470"
                     /db_xref="GeneID:4807194"
     CDS             473019..473792
                     /gene="cobM"
                     /locus_tag="SSA_0470"
                     /EC_number="2.1.1.133"
                     /function="Coenzyme metabolism"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 49.61%; Codon Adaptation Index (CAI): 0.787.
                     Curator(s): M. Chaplin, J. Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="precorrin-4 methylase"
                     /protein_id="YP_001034468.1"
                     /db_xref="GeneID:4807194"
                     /translation="MSKVHFVGAGPGDVELITLKGYKQLSEADVVIYAGSLVNPDLLN
                     YCKEGAEIHDSASMHLMEIIDVMEAGVKAGKDVVRLQTGDFSIYGSIREQIEEMKKRD
                     IEFDCTPGVSSFLGAASSIGAEYTVPEVSQSLIITRMAGRTPVPDRESLKSYAQHRTS
                     MAIFLSVQGIEKVVSELIEGGYPPETPVAVIYKATWPDEKKVFGDLTNIAEKVKEAKI
                     RKTALILVGDFLGQEFYYSKLYHADFQHEFRRGKSSHAK"
     misc_feature    473019..473771
                     /gene="cobM"
                     /locus_tag="SSA_0470"
                     /note="cobalt-precorrin-4 C(11)-methyltransferase;
                     Provisional; Region: cbiF; PRK15473"
                     /db_xref="CDD:185370"
     misc_feature    order(473049..473051,473127..473129,473262..473270,
                     473277..473279,473352..473357,473505..473513,
                     473589..473591,473595..473600,473679..473687)
                     /gene="cobM"
                     /locus_tag="SSA_0470"
                     /note="SAM binding site [chemical binding]; other site"
                     /db_xref="CDD:212500"
     misc_feature    order(473049..473051,473262..473270,473277..473285,
                     473352..473357,473430..473432,473505..473510,
                     473589..473591,473595..473600,473682..473687)
                     /gene="cobM"
                     /locus_tag="SSA_0470"
                     /note="active site"
                     /db_xref="CDD:212500"
     misc_feature    order(473055..473057,473061..473078,473082..473084,
                     473196..473198,473268..473297,473301..473306,
                     473313..473315,473337..473339,473343..473354,
                     473358..473363,473370..473375,473382..473384,
                     473388..473396,473406..473432,473451..473456,
                     473460..473465,473475..473480,473484..473489)
                     /gene="cobM"
                     /locus_tag="SSA_0470"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212500"
     gene            473740..474843
                     /locus_tag="SSA_0471"
                     /db_xref="GeneID:4807885"
     CDS             473740..474843
                     /locus_tag="SSA_0471"
                     /function="Coenzyme metabolism"
                     /note="catalyzes the formation of cobalt-precorrin 4 from
                     cobalt-precorrin 3"
                     /codon_start=1
                     /transl_table=11
                     /product="cobalamin biosynthesis protein CbiG"
                     /protein_id="YP_001034469.1"
                     /db_xref="GeneID:4807885"
                     /translation="MRISSMSLDGGRAAMPSDSQARYAIATVTAAGKDLALTLREKLG
                     KEIPIYTTPRLADDRVIAIEGRVIEALGQLFQEVDVLICIMAIGAVVRAIAPVLKDKA
                     SDPAVVVMDEKATNVISLLSGHLGGANQVTRDIAELLGSNPVITTATDVQNVTALDNL
                     AQSVNGWRPELREFIKPFNSYLGSGRTVYFYQEKDWVTDLRGLTLVDEEGLAAVLKGN
                     EPLILLTTEKKDIQRENLALIYPQPYILGVGARKDVAPAVFREGFEEFCQQQGISASE
                     ISKIVSIDVKKDEAAILALAEELGCPFETFSKEELSVVADRYPQSEFVKKTVGVGSVA
                     LASADLASQGQVLTERFAKNGCTYALAKAITKK"
     misc_feature    473791..474831
                     /locus_tag="SSA_0471"
                     /note="cobalamin biosynthesis protein CbiG; Validated;
                     Region: PRK05788"
                     /db_xref="CDD:235610"
     misc_feature    473950..474186
                     /locus_tag="SSA_0471"
                     /note="Cobalamin synthesis G N-terminal; Region: CbiG_N;
                     pfam11760"
                     /db_xref="CDD:288593"
     misc_feature    474469..474822
                     /locus_tag="SSA_0471"
                     /note="Cobalamin synthesis G C-terminus; Region: CbiG_C;
                     pfam01890"
                     /db_xref="CDD:280130"
     gene            474920..475645
                     /locus_tag="SSA_0472"
                     /db_xref="GeneID:4806552"
     CDS             474920..475645
                     /locus_tag="SSA_0472"
                     /EC_number="2.1.1.131"
                     /function="Coenzyme metabolism"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 44.9%; Codon Adaptation Index (CAI): 0.78.
                     Curator(s): M. Chaplin"
                     /codon_start=1
                     /transl_table=11
                     /product="precorrin-3B C(17)-methyltransferase"
                     /protein_id="YP_001034470.1"
                     /db_xref="GeneID:4806552"
                     /translation="MLYVIGLGPGKEELMSQEALAAIADCEIIVGYSTYMRLILDLVK
                     DKELVANGMRQEIDRCQKAIDLARETGKNVGVVSSGDAGVYGMAGLILELLGDASDVE
                     VKVVPGITASLGAAAVMGAPLMNDFCHISLSDLMTPWEMIEKRLHAAAQGDFVVCLYN
                     PRSKGRPDHLTKALSIMSEYKSEDTIVGIGKDIGRKDEEIILTTIKDLDETLVDMTTI
                     VIVGNKETYVKNGRMITPRGYTL"
     misc_feature    474923..475636
                     /locus_tag="SSA_0472"
                     /note="Precorrin-3B C(17)-methyltransferase (CobJ/CbiH);
                     Region: Precorrin_3B_C17_MT; cd11646"
                     /db_xref="CDD:212505"
     misc_feature    order(474944..474946,475154..475162,475169..475177,
                     475247..475252,475310..475312,475391..475396,
                     475487..475489,475493..475498,475568..475573)
                     /locus_tag="SSA_0472"
                     /note="active site"
                     /db_xref="CDD:212505"
     misc_feature    order(474944..474946,475154..475162,475169..475174,
                     475247..475252,475262..475264,475394..475402,
                     475487..475489,475493..475498,475502..475504,
                     475562..475573)
                     /locus_tag="SSA_0472"
                     /note="SAM binding site [chemical binding]; other site"
                     /db_xref="CDD:212505"
     misc_feature    order(474950..474952,474962..474973,475160..475162,
                     475166..475174,475184..475186,475193..475198,
                     475226..475228,475232..475234,475238..475249,
                     475256..475258,475277..475282,475286..475312,
                     475349..475351,475376..475381,475586..475588,
                     475598..475603,475613..475615,475619..475621,
                     475628..475630)
                     /locus_tag="SSA_0472"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212505"
     gene            475642..476391
                     /locus_tag="SSA_0473"
                     /db_xref="GeneID:4806177"
     CDS             475642..476391
                     /locus_tag="SSA_0473"
                     /EC_number="1.3.1.54"
                     /function="Coenzyme metabolism"
                     /note="GC: 51.6%; Codon Adaptation Index (CAI): 0.768.
                     Curator(s): M. Chaplin"
                     /codon_start=1
                     /transl_table=11
                     /product="precorrin-6x reductase"
                     /protein_id="YP_001034471.1"
                     /db_xref="GeneID:4806177"
                     /translation="MMKLLLGGTSDSTAILEVLDRLKIDVTSSVVTDYGRHLASKYGQ
                     PVIQGRLTAEDMVAFIKENDVDEIIDATHPFADIVSKEAIRAAEMAGVSYLRFERQAT
                     LDLSGAIVVHSTQEAIDEIAKRGYKTVYLGTGSKTLPLFVNGLPEQRIVVRVLPTSEV
                     LLACEQLGLVADQIDAIKAPFSKECNKELLLRSGADVFVSKESGTVGGIREKIDGCQE
                     LGMDCIIISRPIVSYPQMVSSLEELEAYLTK"
     misc_feature    475651..476382
                     /locus_tag="SSA_0473"
                     /note="Precorrin-6x reductase CbiJ/CobK; Region: CbiJ;
                     pfam02571"
                     /db_xref="CDD:280694"
     gene            476410..477849
                     /locus_tag="SSA_0474"
                     /db_xref="GeneID:4808023"
     CDS             476410..477849
                     /locus_tag="SSA_0474"
                     /EC_number="2.1.1.107"
                     /function="Coenzyme metabolism"
                     /experiment="MUDPIT (2D nano LC MS/MS)"
                     /note="GC: 50.07%; Codon Adaptation Index (CAI): 0.77.
                     Curator(s): M. Chaplin"
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrin-III C-methyltransferase"
                     /protein_id="YP_001034472.1"
                     /db_xref="GeneID:4808023"
                     /translation="MSGLVTLLGAGPGDAELLSLKGKRRLQEADVLVFDRLVNQELFQ
                     HLKSDCEKIDVGKKPGQPCIRQEEIEKILIEKARQGKRVVRLKSGDPYIFGRGGEEGV
                     KLVEAGVDFEVVPGITSAVAGLTYAGIPMTYRDVATSFHVFTAHLKDETEMLNWEAIS
                     KLKGTLVFLMGMKNLPTIVQELTARGYGKDKPAAIVEWGTHPQQRSVDGTLGNIVELA
                     EAEDFKAPSVIVVGDVVAYRQQLNFHENLPLFGRKILIQQSETGRLPRLLKDAGAALT
                     TFPARDLVEELELQLPDLEQVDGLLFADMQSWPLFLKALRKAGKDLRSLPHIRFAAIG
                     HHTAKSIEASGIVLDRMTPQQSDTDFATALEKEGGNWYILTAEHKKASLAELYSMPII
                     ASHRLAFGSQINSTNWLEIEVVCLPNSAAAMNFVAASQEAGFDWKDVPIVVMGASTRA
                     VLAEAGFSKIVETDEATIASIVDKCREIL"
     misc_feature    476422..477117
                     /locus_tag="SSA_0474"
                     /note="Uroporphyrin-III C-methyltransferase
                     (S-Adenosyl-L-methionine:uroporphyrinogen III
                     methyltransferase, SUMT); Region: SUMT; cd11642"
                     /db_xref="CDD:212501"
     misc_feature    order(476443..476445,476512..476520,476671..476679,
                     476686..476697,476761..476766,476776..476778,
                     476839..476841,476845..476847,476911..476925,
                     476995..476997,477001..477006,477010..477012,
                     477082..477093)
                     /locus_tag="SSA_0474"
                     /note="active site"
                     /db_xref="CDD:212501"
     misc_feature    order(476443..476445,476671..476679,476686..476691,
                     476761..476766,476914..476916,476995..476997,
                     477001..477006,477085..477093)
                     /locus_tag="SSA_0474"
                     /note="SAM binding site [chemical binding]; other site"
                     /db_xref="CDD:212501"
     misc_feature    order(476455..476472,476476..476478,476677..476679,
                     476683..476691,476701..476706,476710..476712,
                     476722..476727,476746..476748,476752..476754,
                     476758..476760,476770..476775,476797..476799,
                     476803..476811,476821..476835)
                     /locus_tag="SSA_0474"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212501"
     misc_feature    477196..477828
                     /locus_tag="SSA_0474"
                     /note="Uroporphyrinogen-III synthase (HemD) catalyzes the
                     asymmetrical cyclization of tetrapyrrole (linear) to
                     uroporphyrinogen-III, the fourth step in the biosynthesis
                     of heme. This ubiquitous enzyme is present in eukaryotes,
                     bacteria and archaea. Mutations in...; Region: HemD;
                     cl03649"
                     /db_xref="CDD:295955"
     gene            477863..478630
                     /locus_tag="SSA_0475"
                     /db_xref="GeneID:4807865"
     CDS             477863..478630
                     /locus_tag="SSA_0475"
                     /EC_number="4.99.1.3"
                     /function="Coenzyme metabolism"
                     /note="GC: 48.44%; Codon Adaptation Index (CAI): 0.797.
                     Curator(s): M. Chaplin"
                     /codon_start=1
                     /transl_table=11
                     /product="CbiK protein"
                     /protein_id="YP_001034473.1"
                     /db_xref="GeneID:4807865"
                     /translation="MSKAIVVVSFGTTYPETRRKTIEACEQAIQERFPAYPVYRAFTS
                     NVVRRRIKKQEGLDIPTVKEVLDQLLEAGTEEVYIQPLHVILGSEYEKILTQAKEFES
                     AFKKLVVAKPLLNSQEDYEAVKDILLERYGHEGQDAATVLMGHGSQHYAFTAYAALDH
                     MLKGSSVYVGCVESYPPVELIEQELKKDGVREVHLAPFMLVAGDHATNDMSSDEEGSW
                     YRFFKEQGYEVKAHLVGLGEYPEVQQLYIQHLEEIIE"
     misc_feature    477869..478624
                     /locus_tag="SSA_0475"
                     /note="Cobalt chelatase (CbiK); Region: CbiK; pfam06180"
                     /db_xref="CDD:283769"
     misc_feature    477869..478255
                     /locus_tag="SSA_0475"
                     /note="Anaerobic cobalamin biosynthetic cobalt chelatase
                     (CbiK), N-terminal domain. CbiK is part of the
                     cobalt-early path for cobalamin biosynthesis. It catalyzes
                     the insertion of cobalt into the oxidized form of
                     precorrin-2, factor II (sirohydrochlorin), the...; Region:
                     CbiK_N; cd03412"
                     /db_xref="CDD:239505"
     misc_feature    order(477890..477892,477902..477904,478127..478129)
                     /locus_tag="SSA_0475"
                     /note="active site"
                     /db_xref="CDD:239505"
     misc_feature    order(477902..477904,477920..477925,478112..478114,
                     478121..478126,478220..478222,478232..478234,
                     478244..478246,478250..478255)
                     /locus_tag="SSA_0475"
                     /note="C-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239505"
     misc_feature    478274..478573
                     /locus_tag="SSA_0475"
                     /note="Anaerobic cobalamin biosynthetic cobalt chelatase
                     (CbiK), C-terminal domain. CbiK is part of the
                     cobalt-early path for cobalamin biosynthesis. It catalyzes
                     the insertion of cobalt into the oxidized form of
                     precorrin-2, factor II (sirohydrochlorin), the...; Region:
                     CbiK_C; cd03413"
                     /db_xref="CDD:239506"
     misc_feature    order(478295..478297,478307..478309,478475..478477)
                     /locus_tag="SSA_0475"
                     /note="active site"
                     /db_xref="CDD:239506"
     misc_feature    order(478310..478312,478322..478324,478334..478336,
                     478454..478462,478466..478468,478472..478474,
                     478565..478567,478571..478573)
                     /locus_tag="SSA_0475"
                     /note="N-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239506"
     gene            478640..479341
                     /locus_tag="SSA_0476"
                     /db_xref="GeneID:4806254"
     CDS             478640..479341
                     /locus_tag="SSA_0476"
                     /EC_number="2.1.1.130"
                     /function="Coenzyme metabolism"
                     /note="catalyzes the formation of precorrin-3A from
                     precorrin-2"
                     /codon_start=1
                     /transl_table=11
                     /product="cobalt-precorrin-2 C(20)-methyltransferase"
                     /protein_id="YP_001034474.1"
                     /db_xref="GeneID:4806254"
                     /translation="MAKFYGIGVGPGDSELVTVKASRLLEDLDILYTPEAKKGSKSFA
                     LGIAEPYLKEHLEIKQRHFPMVLSNSTKEVQWQAISAEIAEDVRSGKNVGFITLGDPM
                     VYSTYSYLLALLEKEIDCQTIPGITSFCSMASELGQPLIMDEESLAVMPATASAEKIE
                     AALELHDSIVIMKVANHLDTVLPLLEKLGLLQQTFMVSNSSTDKQQTLLGLEGITPET
                     KLPYFTTFLVKKKIF"
     misc_feature    478640..479332
                     /locus_tag="SSA_0476"
                     /note="cobalt-precorrin-2 C(20)-methyltransferase;
                     Validated; Region: PRK05576"
                     /db_xref="CDD:235512"
     misc_feature    order(478670..478672,478931..478939,478946..478954,
                     479018..479023,479033..479035,479153..479158,
                     479228..479230,479234..479239,479303..479314)
                     /locus_tag="SSA_0476"
                     /note="SAM binding site [chemical binding]; other site"
                     /db_xref="CDD:212504"
     misc_feature    order(478670..478672,478931..478939,478946..478954,
                     479018..479023,479090..479092,479150..479155,
                     479228..479230,479234..479239,479309..479314)
                     /locus_tag="SSA_0476"
                     /note="active site"
                     /db_xref="CDD:212504"
     misc_feature    order(478679..478699,478937..478951,478961..478966,
                     478970..478972,479003..479005,479009..479017,
                     479024..479032,479036..479041,479048..479059,
                     479072..479086,479090..479092,479138..479140)
                     /locus_tag="SSA_0476"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212504"
     gene            479363..480145
                     /gene="cbiM"
                     /locus_tag="SSA_0477"
                     /db_xref="GeneID:4805979"
     CDS             479363..480145
                     /gene="cbiM"
                     /locus_tag="SSA_0477"
                     /function="Inorganic ion transport and metabolism"
                     /note="GC: 43.81%; Transporter classification
                     TC:3.A.1.23.2. Transmembrane domains: 6. Codon Adaptation
                     Index (CAI): 0.768. LipoP prediction: SpI. SignalP
                     prediction: Yes (prob. 0.995); Curator(s): M. Chaplin, J.
                     Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="cobalt ABC transporter ATP-binding protein"
                     /protein_id="YP_001034475.1"
                     /db_xref="GeneID:4805979"
                     /translation="MKIHSCELRLLEKEKNMKLLKNKKVTFVALLAILAVLSTQSVSA
                     MHIMEGYLPLFWCIFWFAVFLPFFVVGLMRIKKIVAEDPNSKTMLALSGAFIFILSSL
                     KIPSVTGSSSHPTGVGLGTAMFGPSVISVLGTICLLFQALLLAHGGLTTLGANAFSMA
                     VVGPFVGYFVYKFAKSIKLSTPVSIFICAVIADLATYATTSIQLGLVFPDANSGFVGS
                     ALKFMGVFLTTQIPIAIVEGLLTVVLYNLISENVKERAGLFK"
     misc_feature    479495..480112
                     /gene="cbiM"
                     /locus_tag="SSA_0477"
                     /note="cobalt transport protein CbiM; Validated; Region:
                     PRK08319"
                     /db_xref="CDD:181384"
     gene            480142..480447
                     /gene="cbiN"
                     /locus_tag="SSA_0478"
                     /db_xref="GeneID:4806090"
     CDS             480142..480447
                     /gene="cbiN"
                     /locus_tag="SSA_0478"
                     /note="GC: 42.48%; Transporter classification
                     TC:3.A.1.18.1. Transmembrane domains: 2. Codon Adaptation
                     Index (CAI): 0.778. LipoP prediction: SpI. SignalP
                     prediction: Yes (prob. 1); Curator(s): M. Chaplin, J.
                     Alves"
                     /codon_start=1
                     /transl_table=11
                     /product="cobalt transport protein cbiN"
                     /protein_id="YP_001034476.1"
                     /db_xref="GeneID:4806090"
                     /translation="MKKYKNIILILAAVAVTLAAFIFAPKGVEYSGTDDAAEKTISSI
                     QKDYEPWFSPIFEPAGPEVESLLFTLQGSIGAGIIFYVIGYHKGKKQGQQKENSEHK"
     misc_feature    480145..480432
                     /gene="cbiN"
                     /locus_tag="SSA_0478"
                     /note="cobalt transport protein CbiN; Provisional; Region:
                     PRK02898"
                     /db_xref="CDD:179494"
     gene            480565..481239
                     /locus_tag="SSA_0479"
                     /db_xref="GeneID:4806325"
     CDS             480565..481239
                     /locus_tag="SSA_0479"
                     /function="Inorganic ion transport and metabolism"
                     /note="GC: 43.41%; Transporter classification
                     TC:3.A.1.18.1. Transmembrane domains: 5. Codon Adaptation
                     Index (CAI): 0.791. Curator(s): M. Chaplin, T. Kitten"
                     /codon_start=1
                     /transl_table=11
                     /product="CbiQ protein"
                     /protein_id="YP_001034477.1"
                     /db_xref="GeneID:4806325"
                     /translation="MFAIDKYAYQNRLKNLPVAYKFVIYLLLLAVSFSGVRSLQLGLI
                     VLMAPLTCYVARLPWLRYLKWYLHASIFILISLLTFVLTYQNSQEQLLLALPLGQGYL
                     GISQSSVQQTIFILLRIYSSLVSTYFFVLTVPFAQMLRLFKAMHVPRVLLDLIVLMYR
                     FIFLVFYEFVTIRDTLDLKFSFYNKRKQHQAWGRLANTLFVKLLDDNQHLNEVLTLRF
                     DAEHSE"
     misc_feature    480565..481215
                     /locus_tag="SSA_0479"
                     /note="Cobalt transport protein; Region: CbiQ; cl00463"
                     /db_xref="CDD:294315"
     gene            481302..482117
                     /locus_tag="SSA_0480"
                     /db_xref="GeneID:4806061"
     CDS             481302..482117
                     /locus_tag="SSA_0480"
                     /function="Inorganic ion transport and metabolism"
                     /note="GC: 48.16%; Transporter classification
                     TC:3.A.1.18.1. Codon Adaptation Index (CAI): 0.78.
                     Curator(s): M. Chaplin"
                     /codon_start=1
                     /transl_table=11
                     /product="cobalt ABC transporter ATP-binding protein"
                     /protein_id="YP_001034478.1"
                     /db_xref="GeneID:4806061"
                     /translation="MLQVKNISFSYDENPTLHDISMDFEEGRITGILGVNGSGKSTIM
                     KIITRLLQPQKGSVLYDGQPVGDSKKALFQYRQHVNMVFQNPEQQLFYTIVKDDIGMA
                     LENLGYEEDEITSRVATALEMMDISHLKDRPLQYLSYGQKKRVAIAGMLALQPKYLLL
                     DEPTAGLDPKGRDQMAETMKKLVQAGTNIIVSSHDMDLMYDCCDYAYLLQKGHLIAEG
                     SKFDFFQQGNLLVEAGLAVPWIVKLHQTIQTPLAENEAAFFEQLGGNVTWSKH"
     misc_feature    481302..482096
                     /locus_tag="SSA_0480"
                     /note="cobalt transporter ATP-binding subunit;
                     Provisional; Region: cbiO; PRK13638"
                     /db_xref="CDD:184198"
     misc_feature    481308..481940
                     /locus_tag="SSA_0480"
                     /note="First domain of the ATP-binding cassette component
                     of cobalt transport system; Region:
                     ABC_cobalt_CbiO_domain1; cd03225"
                     /db_xref="CDD:213192"
     misc_feature    481401..481424
                     /locus_tag="SSA_0480"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213192"
     misc_feature    order(481410..481415,481419..481427,481551..481553,
                     481782..481787,481881..481883)
                     /locus_tag="SSA_0480"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213192"
     misc_feature    481542..481553
                     /locus_tag="SSA_0480"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213192"
     misc_feature    481710..481739
                     /locus_tag="SSA_0480"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213192"
     misc_feature    481770..481787
                     /locus_tag="SSA_0480"
                     /note="Walker B; other site"
                     /db_xref="CDD:213192"
     misc_feature    481794..481805
                     /locus_tag="SSA_0480"
                     /note="D-loop; other site"
                     /db_xref="CDD:213192"
     misc_feature    481869..481889
                     /locus_tag="SSA_0480"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213192"
     gene            482102..483601
                     /locus_tag="SSA_0481"
                     /db_xref="GeneID:4807837"
     CDS             482102..483601
                     /locus_tag="SSA_0481"
                     /EC_number="6.3.5.10"
                     /function="Coenzyme metabolism"
                     /note="catalyzes amidations at positions B, D, E, and G on
                     adenosylcobyrinic A,C-diamide. NH(2) groups are provided
                     by glutamine, and one molecule of ATP is hydrogenolyzed
                     for each amidation"
                     /codon_start=1
                     /transl_table=11
                     /product="cobyric acid synthase"
                     /protein_id="YP_001034479.1"
                     /db_xref="GeneID:4807837"
                     /translation="MVKALMVQGTASDAGKSIIAAGLCRIFKQDGLEVVPFKSQNMAL
                     NSFITKKGDEMGRAQVVQAEAAGKEPDVRMNPVLLKPTSDRKSQVVFLGRVLRDMDAV
                     EYHEYKQQLLPKIKEVYDELGAENDIIVIEGAGSPAEINLNDRDIVNMGMAKLVDAPV
                     ILVADIDKGGVFASIYGTIELMPPEDRKRIKGVIINKFRGDVALLQSGIDMIEELTQV
                     PVIGVVPYAQLDIDSEDSVALVQKSRRFDSRKSLDIAVVSLKRLSNFTDFHSLEIQPD
                     VSVRYVQPGDAIGRPDLLILPGSKNTIEDMNYLCESGLEAEILECLEQGVRIFGICGG
                     YQLLGQKISDPLHLESDLEETRGLGILETETVLQPVKRTTQVRALHEGQELEGYEIHM
                     GETQLADRLEPFSIIKEQNGEATERPDGAVAYGGQVQGTYLHGVFDNLEWTRQYLNEL
                     RLAKGLEPLEDQLVSIKDFKDREYDKLADVLRQSLDMEQIYQIINREEK"
     misc_feature    482102..483583
                     /locus_tag="SSA_0481"
                     /note="cobyric acid synthase; Provisional; Region:
                     PRK00784"
                     /db_xref="CDD:234838"
     misc_feature    482108..482779
                     /locus_tag="SSA_0481"
                     /note="P-loop containing Nucleoside Triphosphate
                     Hydrolases; Region: P-loop_NTPase; cl21455"
                     /db_xref="CDD:304359"
     misc_feature    482861..483442
                     /locus_tag="SSA_0481"
                     /note="Type 1 glutamine amidotransferase (GATase1) domain
                     found in Cobyric Acid Synthase (CobQ); Region:
                     GATase1_CobQ; cd01750"
                     /db_xref="CDD:153221"
     misc_feature    order(483095..483097,483272..483274,483278..483280)
                     /locus_tag="SSA_0481"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:153221"
     gene            483598..484173
                     /locus_tag="SSA_0482"
                     /db_xref="GeneID:4806155"
     CDS             483598..484173
                     /locus_tag="SSA_0482"
                     /function="Function unknown"
                     /note="GC: 50.87%; Codon Adaptation Index (CAI): 0.746.
                     Curator(s): M. Chaplin"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP:cobalamin adenosyl transferase"
                     /protein_id="YP_001034480.1"
                     /db_xref="GeneID:4806155"
                     /translation="MRIYTKYGDKGFTRLYGGDRVSKTHIRVEAYGTMDELCSHLGYV
                     VSEMRDYPVLDDLRLECEEIQQHLFDCGSDLATPRELRPYKQEPANVSWLEERMDEYM
                     HIPPKIDRFIIPGGHRIASLLHVARTMTRRLERRMVAVIEADEAVNEIGLIYINRLSD
                     YFFVLARLVNDRLEEPDTIYKRSAKIFREKK"
     misc_feature    483607..484104
                     /locus_tag="SSA_0482"
                     /note="Cobalamin adenosyltransferase; Region:
                     Cob_adeno_trans; pfam01923"
                     /db_xref="CDD:280157"
     gene            484185..484616
                     /locus_tag="SSA_0483"
                     /db_xref="GeneID:4805893"
     CDS             484185..484616
                     /locus_tag="SSA_0483"
                     /EC_number="1.3.1.76"
                     /function="Coenzyme metabolism"
                     /note="GC: 50.46%; Codon Adaptation Index (CAI): 0.724.
                     Curator(s): M. Chaplin"
                     /codon_start=1
                     /transl_table=11
                     /product="siroheme synthase"
                     /protein_id="YP_001034481.1"
                     /db_xref="GeneID:4805893"
                     /translation="MYPVMINIREKKVVVVGGGKVAARKIKTLLAEQAAVTVVSPTLH
                     ADIPQAEIQWLARPYQTGDLEGAKLVFACTDQEKVNRQIMVDAAPSQLVNNTGDKTFS
                     DFYNVAIARKKDVSVMISTNGLSPSRSKEIRKKIEAILDQL"
     misc_feature    484185..484613
                     /locus_tag="SSA_0483"
                     /note="precorrin-2 dehydrogenase; Validated; Region:
                     PRK06719"
                     /db_xref="CDD:180668"
     misc_feature    484245..484508
                     /locus_tag="SSA_0483"
                     /note="Putative NAD(P)-binding; Region: NAD_binding_7;
                     pfam13241"
                     /db_xref="CDD:289982"
     misc_feature    484527..484598
                     /locus_tag="SSA_0483"
                     /note="Sirohaem biosynthesis protein central; Region:
                     Sirohm_synth_M; pfam14824"
                     /db_xref="CDD:291490"
     gene            484632..485885
                     /locus_tag="SSA_0484"
                     /db_xref="GeneID:4806219"
     CDS             484632..485885
                     /locus_tag="SSA_0484"
                     /EC_number="1.2.1.70"
                     /function="Coenzyme metabolism"
                     /note="GC: 48.09%; Codon Adaptation Index (CAI): 0.774.
                     Curator(s): M. Chaplin"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-tRNA reductase"
                     /protein_id="YP_001034482.1"
                     /db_xref="GeneID:4806219"
                     /translation="MHLLYVGLTHRETPLTILEKAHFSDQEGLKALKLLKREKSILEN
                     IILSTCNRTELYLVVDQLHTGRYYSKHFLADWFQIPVKELEEYLVFREGDEALRHLLR
                     VSIGLESKIVGESQVLGQLKQAFLTAQDAGTTGIVLNQAFKQALTFAKRMHDTYRIND
                     RPISIGLTAIQELDRMGLDYSTKKIAVIGLGEIGQLVTKYALQRPFESVMLLNRTVSK
                     AQAFLTEDRVSAHGWDELEEVLADADVVFSAVKTEEYIIFPSMLKEGAIVFDLCLPRS
                     CHPSSSLKLYNIENLTNQLEQYKAERQEIAGRIALEIDEELVKFADWRQQLGIIPLIQ
                     EIRDKALEAQASAMESLNRKIPDLTEREQKQISKHMKSIINQVLKEPILQLKELSVGE
                     HSDYDIALIAKIFGLHRERGKDEGH"
     misc_feature    484632..485861
                     /locus_tag="SSA_0484"