GenomeNet

Database: RefSeq
Entry: NC_009363
LinkDB: NC_009363
Original site: NC_009363 
LOCUS       NC_009363             670853 bp    DNA     linear   CON 23-JUN-2017
DEFINITION  Ostreococcus lucimarinus CCE9901 chromosome 9, complete sequence.
ACCESSION   NC_009363
VERSION     NC_009363.1
DBLINK      BioProject: PRJNA19407
            BioSample: SAMN03081420
            Assembly: GCF_000092065.1
KEYWORDS    RefSeq.
SOURCE      Ostreococcus lucimarinus CCE9901
  ORGANISM  Ostreococcus lucimarinus CCE9901
            Eukaryota; Viridiplantae; Chlorophyta; prasinophytes;
            Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus.
REFERENCE   1  (bases 1 to 670853)
  AUTHORS   Palenik,B., Grimwood,J., Aerts,A., Rouze,P., Salamov,A., Putnam,N.,
            Dupont,C., Jorgensen,R., Derelle,E., Rombauts,S., Zhou,K.,
            Otillar,R., Merchant,S.S., Podell,S., Gaasterland,T., Napoli,C.,
            Gendler,K., Manuell,A., Tai,V., Vallon,O., Piganeau,G., Jancek,S.,
            Heijde,M., Jabbari,K., Bowler,C., Lohr,M., Robbens,S., Werner,G.,
            Dubchak,I., Pazour,G.J., Ren,Q., Paulsen,I., Delwiche,C.,
            Schmutz,J., Rokhsar,D., Van de Peer,Y., Moreau,H. and
            Grigoriev,I.V.
  TITLE     The tiny eukaryote Ostreococcus provides genomic insights into the
            paradox of plankton speciation
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 104 (18), 7705-7710 (2007)
   PUBMED   17460045
REFERENCE   2  (bases 1 to 670853)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (22-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 670853)
  AUTHORS   Grigoriev,I., Grimwood,J., Aerts,A., Salamov,A., Zhou,K., Lou,Y.,
            Pitluck,S., Schmutz,J., Myers,R.M., Lucas,S., Detter,J.C., Glavina
            del Rio,T., Putnam,N., Rokhsar,D. and Palenik,B.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (21-FEB-2007) US DOE Joint Genome Institute, 2800
            Mitchell Drive B100, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP000589.
            URL -- http://www.jgi.doe.gov/ostreococcus
            JGI Project ID: 3436080
            Source DNA was provided by Brian Palenik (bpalenik@ucsd.edu))
            Stock culture is available from CCMP (http://ccmp.bigelow.org/) as
            strain number CCMP2514
            Contacts: Brian Palenik (bpalenik@ucsd.edu))
                      Igor Grigoriev (ivgrigoriev@lbl.gov)
            Annotation done by JGI-PGF
            Manual curation done by the Ostreococcus User Community
            Finishing done at Stanford/JGI, Stanford Human Genome Center
            (www-shgc.stanford.edu)
            The finished chromosome has no gaps. The sequence has less than one
            error in 100,000 bp.A
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. It is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..670853
                     /organism="Ostreococcus lucimarinus CCE9901"
                     /mol_type="genomic DNA"
                     /strain="CCE9901"
                     /db_xref="taxon:436017"
                     /chromosome="9"
     gene            complement(<353..>1018)
                     /locus_tag="OSTLU_16616"
                     /db_xref="GeneID:5003748"
     mRNA            complement(<353..>1018)
                     /locus_tag="OSTLU_16616"
                     /product="predicted protein"
                     /transcript_id="XM_001419632.1"
                     /db_xref="GeneID:5003748"
     CDS             complement(353..1018)
                     /locus_tag="OSTLU_16616"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419669.1"
                     /db_xref="GeneID:5003748"
                     /db_xref="JGIDB:Ost9901_3_16616"
                     /translation="MVIDNAFDDNVKIVFDLTNQAPLTRQGTNILAVDDHLESAEEKK
                     RNSPAWANFVPLDGLTSEFVPFAIGWYGEIGGEALSFIRRIVGHYVRDERTAAWRVRK
                     ILAAIQTRHLNILGVYLQNCRFDMESRGPILERLHGSRWQRRNLCEKACGIKAPPQAF
                     HSNRLCVTQEEGFGSHYFHRGQTTTGRLSSNTNTEEGTLTQESGAVRSVEGEVCGAVL
                     VDE"
     gene            <1426..>2097
                     /locus_tag="OSTLU_33298"
                     /db_xref="GeneID:5003701"
     mRNA            <1426..>2097
                     /locus_tag="OSTLU_33298"
                     /product="predicted protein"
                     /transcript_id="XM_001419425.1"
                     /db_xref="GeneID:5003701"
     CDS             1426..2097
                     /locus_tag="OSTLU_33298"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419462.1"
                     /db_xref="GeneID:5003701"
                     /db_xref="JGIDB:Ost9901_3_33298"
                     /translation="MYEEYSVTSTSGTLRIRALGASDAFELARWRTFAALAVLLENCE
                     RVEVEFIGPTLRRLYPGVVCEATSTDGSGRLRIQAIRGLYPEVSDVASASASEAAAYD
                     VVVAFNAGLPVGGDWARAIERIVSEHVDAFAANAPSLGNVAPPFWVSDYNEEAIDIAF
                     AFLRHVVQRVLESRNVDSRAEAIYLEPYSNAAYQSRKRISSCTVPTHANAYACAFVGL
                     SRLEE"
     gene            complement(<2158..>3621)
                     /locus_tag="OSTLU_33299"
                     /db_xref="GeneID:5003503"
     mRNA            complement(<2158..>3621)
                     /locus_tag="OSTLU_33299"
                     /product="predicted protein"
                     /transcript_id="XM_001419633.1"
                     /db_xref="GeneID:5003503"
     CDS             complement(2158..3618)
                     /locus_tag="OSTLU_33299"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419670.1"
                     /db_xref="GeneID:5003503"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="JGIDB:Ost9901_3_33299"
                     /translation="MPPLEDIKNVLLDALTEIESTARDVLASLDERRLVRVSKKLPGG
                     DVECGAANALFHALRAQSGRYASTTVTCVSPMGVEREHTAKSLATAATELIPNAFASK
                     HFAAVRVHDGGDSGMITICTLERYAELRDAGSAMCDKCGKFISGGERGLWWHRKTRHN
                     DLHQEAMDAVERERNALVAMSTSGSRSDLTNGDAAYLDNKTKKASREDDLREAMAAAR
                     RGDATVMDALIAAKRVKALPLPGLEAARRGDLNLLRSLVSRDGWDPRSKDAVDKHGSN
                     ALLWAAGAGHVECVEFLVEKCCMNPQTSVQSGRRSYAGRSALHWAARNGHVEVVEYLL
                     SRGVDPNSTTEDGSTAFAWACWQGHLAVMRQLVERAECDYKSCNDYGCNVACWTAMGA
                     GGVECCEYLASLGVRFNLINANGHSCLHKAAQRGNRDVCEWLLDTPSLGLTRDHAQPD
                     AEGYDPAGLALVEGFNDVADWLKARQLELEFANHKP"
     gene            complement(<3747..>4742)
                     /locus_tag="OSTLU_33300"
                     /db_xref="GeneID:5003702"
     mRNA            complement(<3747..>4742)
                     /locus_tag="OSTLU_33300"
                     /product="predicted protein"
                     /transcript_id="XM_001419634.1"
                     /db_xref="GeneID:5003702"
     CDS             complement(3747..4742)
                     /locus_tag="OSTLU_33300"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419671.1"
                     /db_xref="GeneID:5003702"
                     /db_xref="JGIDB:Ost9901_3_33300"
                     /translation="MPDENLTEYERQRLAHVQRNREYMARLGVNALADDIRNKMSSRK
                     ISTTSRKRVKREEPSEPTRRSSRVVGVKAEYDGSTIDALLDEDEENENGRARKRASVD
                     AELDDDELAKDVVATSREWLAEAREKLLATRADVANSFVEKSAKDEAWRRDAVARWGD
                     SVPSARSVSDWKAWTMSRLGTPPPPSPMQLLQEYYAHDAWQLLIACALMSRVASGALK
                     HECISNFFAKFPTPSAALAADSQDVFEIIKRLGLFPGRMRTIVEVSTKFLLETGEFEV
                     GLEPELKIYGIGEFGVDSFEIFARGDVRRKPKDCNLQSFCAWQRRHGNGKVKVET"
     gene            complement(<4915..>5736)
                     /locus_tag="OSTLU_35002"
                     /db_xref="GeneID:5003703"
     mRNA            complement(<4915..>5736)
                     /locus_tag="OSTLU_35002"
                     /product="predicted protein"
                     /transcript_id="XM_001419635.1"
                     /db_xref="GeneID:5003703"
     CDS             complement(4915..5736)
                     /locus_tag="OSTLU_35002"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419672.1"
                     /db_xref="GeneID:5003703"
                     /db_xref="InterPro:IPR006746"
                     /db_xref="JGIDB:Ost9901_3_35002"
                     /translation="MVGTRRASTSSSTSVAHGKDLIKQIQAAIATNDHATALERLDDF
                     KVHAATTFVGNEEDELRLRREAAEHGVMISAATRDEESFERHASQAKAAYDACKRAPC
                     KQPIERSQNEALIVGLNLLRLLVQNRIAEFHAELETTDDDVLKDQRVQAVLELEQFLM
                     EGAYNKIAQRQNALPDPSYEYFMSMLMNTVRDEIASCAESAYGSLTGAEAMKLLGFAN
                     AQEFEKYANARDWTMDANGGVVFNEEVAPASARDIPAAALINQTLLYAKELERIV"
     gene            complement(5895..9190)
                     /locus_tag="OSTLU_46533"
                     /db_xref="GeneID:5003704"
     mRNA            complement(5895..9190)
                     /locus_tag="OSTLU_46533"
                     /product="predicted protein"
                     /transcript_id="XM_001419636.1"
                     /db_xref="GeneID:5003704"
     CDS             complement(5903..9169)
                     /locus_tag="OSTLU_46533"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419673.1"
                     /db_xref="GeneID:5003704"
                     /db_xref="InterPro:IPR001431"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="JGIDB:Ost9901_3_46533"
                     /translation="MLDEPLTPHEEIRRGTLANGLKYVILPNKVPEGRFEAHLEMHVG
                     SVDEREDEQGLAHLVEHVTFLGSRKRDQWLGSGTRGNAYTDFHHTVFHIHAPTTNKDG
                     HYMPPNVLDILYDVAFAPQLLDTRVAKEKKAVLAEAQMMNTIEYRVDCQLLEHLHWDN
                     LLGTRFPIGKLDQVEAWPAQAVRDFHARWYFPANATLYVVGDFDASVDEVEGMISAAF
                     DEAAPAEGAEEAESPLKRHAVRPPVKHAYGAPSYELDEIQRSNDEAKASGKDDPFLPF
                     VAPEGKVSMFQHEHLSNASFNIFSKLAVKPLEKMGDLHRTILQRIVLLVLQSRIQARY
                     AETNADYKRIELDHSDSAREGCCVSTVTVTCEPREYEFALQVAVEESRRLQKFGLTPS
                     ELDRFKAAMLRDSEQLAQQAGCVPSLENLDFVMEQDACGHVVMDQVAGHEALVRMSDY
                     ITLEACNGACDELLGFIGEYGVENNRKPNSGKCTAIVACVPATMTNVDGETVPFDITP
                     ERIEQVLAADYGEITEPEDIFVPEVLIADDEINALIEQTAPTFTEATYHEPTGVYQRT
                     LSNGIRVNYKVLDAEPGSAFLRLVVPGGRSVESPNIGPGGIGSSAVGLRTVQEAGDVG
                     EWSRKQIELLTMQHLLVYDVEPEVEYMFLDSAFATDGGLRTILEIMHLTLTKPTWDEQ
                     ALERVKDIYRMFQINTNKNIELLTHDTVNAVIYEDRRIMDPNKEALQALTLDGVRDMI
                     EAQFASGALELNIVGDIIPEEVDEMVLAFMGSIQTKPAPPLPQVPPLKLKEVPKDDPV
                     RAQRLWLKDSDERACAVAAGPGPSMWAPMTSLYSEIPSFVNQDAYTPEQIAALRDPVN
                     EVASAKGNPFAQQSARRANSLATYCAGMMLAEVIGGRLFTTVRDALGLTYDCNFTMSF
                     GLQNNDATTYRLLVTSTPEKIDEALNAGVRVLRGFQMQRVSQREVDRARLTLLSRHEM
                     DLKTNNYWADLMQCTNTPDLAPLKKIQCVADLPLMYDAMTVDDLQEVYDRLGLSEGEI
                     FTSVTIAGQTEPPPFLSKKDVDAAALAAQTLTAALGGINIAEAIKRLKKEQSPSASAE
                     "
     gene            <10644..12131
                     /locus_tag="OSTLU_24989"
                     /db_xref="GeneID:5003705"
     mRNA            join(<10644..10676,11157..12131)
                     /locus_tag="OSTLU_24989"
                     /product="predicted protein"
                     /transcript_id="XM_001419426.1"
                     /db_xref="GeneID:5003705"
     CDS             join(10644..10676,11157..11963)
                     /locus_tag="OSTLU_24989"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419463.1"
                     /db_xref="GeneID:5003705"
                     /db_xref="InterPro:IPR000652"
                     /db_xref="JGIDB:Ost9901_3_24989"
                     /translation="MLPRCWVVASRVHAAAQRRSVVVNAGTGKFIVGGNWKCNGTAES
                     VKSLVKELNSGKIDADVDVYVAPPFVFIPRVQKELNNKNYAVAAQNCWVSAGGAFTGE
                     VSADMLADADIPWVILGHSERRALCGETNEFVGEKTKYALSKGLKVALCIGETLEQRE
                     AGTTLDICRAQLKAVNDVVTAADWENIVIAYEPVWAIGTGKVATPDQAQEVHAGIRKW
                     CADNISPAIASKIRIQYGGSVNAGNCDELAQKEDIDGFLVGGASLIGEAFVTICNSAK
                     HSK"
     gene            complement(<12172..>13062)
                     /locus_tag="OSTLU_94637"
                     /db_xref="GeneID:5003794"
     mRNA            complement(<12172..>13062)
                     /locus_tag="OSTLU_94637"
                     /product="ABC(ATP-binding) family transporter: iron
                     compound"
                     /transcript_id="XM_001419637.1"
                     /db_xref="GeneID:5003794"
     CDS             complement(12172..13062)
                     /locus_tag="OSTLU_94637"
                     /codon_start=1
                     /product="ABC(ATP-binding) family transporter: iron
                     compound"
                     /protein_id="XP_001419674.1"
                     /db_xref="GeneID:5003794"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="JGIDB:Ost9901_3_94637"
                     /translation="MHGVVDVVLDDAPEPSCAVAVDALTYAYPGCDAVLRDWSLRLPP
                     GSRCLLSGANGAGKTTALHVIAGKTMVNEDVVRVLGRPPFHDIALTCGGELSYLGAQW
                     RRNIGSAGADVPLQGDISARKMIEGVADVDPARRERLVKLLDVDLDWSMKALSDGQRR
                     RVQICLGLLKPYKVLLCDEITVDLDILGRLDLLEFFKEECEVRGATIVYATHIFDGMA
                     DWMTHLAFTSNGQLKYGGAKVDIPEIQGTKHLLSTIEKWLRIDRDERRAREAAELAAP
                     TAKKIDAASHFQTRHMAYYR"
     gene            <13380..>13817
                     /locus_tag="OSTLU_16622"
                     /db_xref="GeneID:5003706"
     mRNA            <13380..>13817
                     /locus_tag="OSTLU_16622"
                     /product="predicted protein"
                     /transcript_id="XM_001419427.1"
                     /db_xref="GeneID:5003706"
     CDS             13380..13817
                     /locus_tag="OSTLU_16622"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419464.1"
                     /db_xref="GeneID:5003706"
                     /db_xref="JGIDB:Ost9901_3_16622"
                     /translation="MTTRTRAVEPEALFEIAKVDDSVYGPVVCVAAALWVGWVFYNGS
                     REVKAISEELEAKGYDVGSIQRLKELKFLKRFVDGGDKAEIQEAFDKIWFSRAKTIAA
                     TGDIMQVRRMTEYWRKRGVKVERLSDLDVLQDWMVKKYNKQQK"
     gene            <14027..>14726
                     /locus_tag="OSTLU_94638"
                     /db_xref="GeneID:5003795"
     mRNA            join(<14027..14205,14408..>14726)
                     /locus_tag="OSTLU_94638"
                     /product="predicted protein"
                     /transcript_id="XM_001419428.1"
                     /db_xref="GeneID:5003795"
     CDS             join(14027..14205,14408..14726)
                     /locus_tag="OSTLU_94638"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419465.1"
                     /db_xref="GeneID:5003795"
                     /db_xref="InterPro:IPR004345"
                     /db_xref="JGIDB:Ost9901_3_94638"
                     /translation="MLGLGLKIAGFGVGYCYPTYSALKLLDRKVIGPEDVTLWLTYFM
                     IAFTLAIGEAIGVVGWIPAYRIMKVLFCAWMVNPRFKGAITLYKKGIQPIFHQLSPSI
                     DKHAENLKKGDFAAIQQELGPQFAKVQELVKKHGPEAIERAMNLAGKGDKKNAATAAN
                     GTKAE"
     gene            complement(<14842..>15786)
                     /locus_tag="OSTLU_34728"
                     /db_xref="GeneID:5003796"
     mRNA            complement(<14842..>15786)
                     /locus_tag="OSTLU_34728"
                     /product="predicted protein"
                     /transcript_id="XM_001419638.1"
                     /db_xref="GeneID:5003796"
     CDS             complement(14842..15786)
                     /locus_tag="OSTLU_34728"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419675.1"
                     /db_xref="GeneID:5003796"
                     /db_xref="InterPro:IPR000146"
                     /db_xref="JGIDB:Ost9901_3_34728"
                     /translation="MAKACVRIGGFVRRAGLKDVKAFVEGKNGAVNVHGEEQAALDDA
                     AHEVCVKELIQGGRCAWIASEESEDIVTANVDGRIAVVFDPLDGSSNIECGVGVGTIF
                     GLVDVGAESSPEHVYARPGRDMSTVGYVLYGASMVLVLSFMSEDAHGGVCAFTYDADR
                     DAFVLTKRDIRIPESGNVYSVNQANYKKWDDATRAYIDECASSKSLRYIGSMVADVHR
                     TLLYGGTFHYPACSSNAQGKLRAVYECFPMAAIIERAGGLAISGANDSVLSFVPSTAH
                     SRMPFHCGSARDIERLDEILSSEVRAGKKGRVSSPSPR"
     gene            <16072..>17220
                     /locus_tag="OSTLU_12848"
                     /db_xref="GeneID:5003707"
     mRNA            join(<16072..16143,16630..>17220)
                     /locus_tag="OSTLU_12848"
                     /product="predicted protein"
                     /transcript_id="XM_001419429.1"
                     /db_xref="GeneID:5003707"
     CDS             join(16072..16143,16630..17220)
                     /locus_tag="OSTLU_12848"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419466.1"
                     /db_xref="GeneID:5003707"
                     /db_xref="InterPro:IPR000866"
                     /db_xref="JGIDB:Ost9901_3_12848"
                     /translation="MRDARARVRSASSPRARGAVVKVKQARKPLVGYEAPDFSAEAVF
                     DQEFQDIKLSDYRGKYVVLFFYPLDFTFVCPTEITAFSDRYEEFAKLNTEVLGCSVDS
                     KFSHLAWLQTDRNDGGLGDLAYPLVSDLKREITEAYDVLYEDGTALRGLYIIDREGVI
                     QHSTVNNAPFGRSVDETLRVLQAIQHVQNNPDEVCPAGWTPGAATMKPDPKGSKEYFK
                     AI"
     gene            complement(17339..18386)
                     /locus_tag="OSTLU_33309"
                     /db_xref="GeneID:5003797"
     mRNA            complement(17339..18386)
                     /locus_tag="OSTLU_33309"
                     /product="predicted protein"
                     /transcript_id="XM_001419639.1"
                     /db_xref="GeneID:5003797"
     CDS             complement(17355..18377)
                     /locus_tag="OSTLU_33309"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419676.1"
                     /db_xref="GeneID:5003797"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="JGIDB:Ost9901_3_33309"
                     /translation="MPSPPPTVPKARPRCGEPRRVLVTGGAGFVGSHLVDALLKRGDE
                     VIVMDNFFTGSQRNLEHLKGNPKFEIIRHDIVTPFLVEIDEVYHLACPASPIHYKFNP
                     VKTIKTNVLGTMNALGLAKRCKAKFLLTSTSEVYGDPLEHPQTESYWGNVNPIGERAC
                     YDEGKRCAETLAFDYHREHGLEIRVARIFNTYGPRMAMDDGRVVSNFVAQALEGKPMT
                     IYGDGTQTRSFQYVSDLVAGLIALMDNDSGFVGPVNLGNPGEFTMLELAEKVREVVNP
                     NAEIVFCENTSDDPSRRKPDISLAKEKLGGWEPKVKLEDGLKLMVEDFRERIEDKRAR
                     DAAGGR"
     gene            complement(<18811..>19353)
                     /locus_tag="OSTLU_16627"
                     /db_xref="GeneID:5003708"
     mRNA            complement(<18811..>19353)
                     /locus_tag="OSTLU_16627"
                     /product="predicted protein"
                     /transcript_id="XM_001419640.1"
                     /db_xref="GeneID:5003708"
     CDS             complement(18811..19353)
                     /locus_tag="OSTLU_16627"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419677.1"
                     /db_xref="GeneID:5003708"
                     /db_xref="JGIDB:Ost9901_3_16627"
                     /translation="MAMDDAYGSGVMSEEKSGRPRESAAEKAKRVAAELAKRGILVGD
                     RVRVDVRVGAPLPARSKKFASDAGAASDAGATTSTSTTDSTATKRRFITRAVHGYVVC
                     VRNGRAGVKRTGRGDTETSFPTYPTAWCTALDVGELWEMCTGPRNLAGVSGASDEALA
                     EYLKATGQSSDEEEEEEARS"
     gene            <20119..>20562
                     /locus_tag="OSTLU_93190"
                     /db_xref="GeneID:5003709"
     mRNA            <20119..>20562
                     /locus_tag="OSTLU_93190"
                     /product="predicted protein"
                     /transcript_id="XM_001419430.1"
                     /db_xref="GeneID:5003709"
     CDS             20119..20562
                     /locus_tag="OSTLU_93190"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419467.1"
                     /db_xref="GeneID:5003709"
                     /db_xref="InterPro:IPR005574"
                     /db_xref="JGIDB:Ost9901_3_93190"
                     /translation="MSAALCIGRKSAEDVEDAGELRLGPDFDDANCLSLAEVKIVCES
                     KVADDAEQAEETSTTRTRVFEKTLAYAKRFSGNTSSTAAAAIRELHNNSGLHDFEGAA
                     ISNLKPQDWDEAKTLVPSLEQEDRGLTEEGIQAMLDEMSNVRKFE"
     gene            complement(20591..21979)
                     /locus_tag="OSTLU_46582"
                     /db_xref="GeneID:5003798"
     mRNA            complement(20591..21979)
                     /locus_tag="OSTLU_46582"
                     /product="predicted protein"
                     /transcript_id="XM_001419641.1"
                     /db_xref="GeneID:5003798"
     CDS             complement(20630..21931)
                     /locus_tag="OSTLU_46582"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419678.1"
                     /db_xref="GeneID:5003798"
                     /db_xref="InterPro:IPR009637"
                     /db_xref="JGIDB:Ost9901_3_46582"
                     /translation="MTAATAEARIATYEVSKDDRSLILLREPFGFAVGGTMEIALKES
                     RVYLPEHAPPLDKTKLGFFITEAKDEGALDAALEDGACVLDVDFVDQAFTFADMDAQL
                     KKGEREVSSYEFMKEIKVPGDYMLFFASCAPHTVVSFEITTTFANKDARGRNDYLGAG
                     EKSLPSVYYLFFLLDTCAAVAWAFILGRANGQRGVRKIHWLMLALVCFKTLSVLAQAG
                     RYHITRLTGSSRGWTAAYYVFTVCRSMLMFSVIALVGMGWSFLKPFLHQREKNLLMAV
                     IPLQVLANIAAVVIGEEGPADQGWFAWQNMFIVIDIMCCCAVLVPIVWSIKHLRDTSD
                     SSEKKARNLEKLLLFRHFYVMTVAYIYFTRIIVYLLKSTVEYELRWTAAFFNELATLA
                     YYVATGYMFRPEEENMYFSLKHDEDEDGVEMSDRARWGDAV"
     gene            <22869..>23531
                     /locus_tag="OSTLU_4977"
                     /db_xref="GeneID:5003710"
     mRNA            <22869..>23531
                     /locus_tag="OSTLU_4977"
                     /product="predicted protein"
                     /transcript_id="XM_001419431.1"
                     /db_xref="GeneID:5003710"
     CDS             <22869..>23531
                     /locus_tag="OSTLU_4977"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419468.1"
                     /db_xref="GeneID:5003710"
                     /db_xref="InterPro:IPR002680"
                     /db_xref="JGIDB:Ost9901_3_4977"
                     /translation="HPQYDLRQVENVKPAHRQPRHVRDYLAYGLVQFSRWSFDKVTGY
                     TPKKSLTTDGWLMRFIFLETVAGVPGMVGAMLRHMMSLRTLKRDHGWIHTLLEEAENE
                     RMHLLTFLKLREPGLMFRLAVLGAQGVFFNAFFLSYLISPRTCHRFVGYLEEEAVRTY
                     THALHDIDGDGPASEWATMPAPKLAIKYWRMPDDATVRDLIIAVRADEASHSHVNHTL
                     SSM"
     gene            complement(<24290..>24727)
                     /locus_tag="OSTLU_8170"
                     /pseudo
                     /db_xref="GeneID:5003715"
     CDS             complement(<24290..>24727)
                     /locus_tag="OSTLU_8170"
                     /pseudo
                     /codon_start=1
                     /db_xref="GeneID:5003715"
     gene            complement(24952..26076)
                     /locus_tag="OSTLU_33315"
                     /db_xref="GeneID:5003711"
     mRNA            complement(join(24952..25824,25985..26076))
                     /locus_tag="OSTLU_33315"
                     /product="predicted protein"
                     /transcript_id="XM_001419642.1"
                     /db_xref="GeneID:5003711"
     CDS             complement(join(24997..25824,25985..26053))
                     /locus_tag="OSTLU_33315"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419679.1"
                     /db_xref="GeneID:5003711"
                     /db_xref="JGIDB:Ost9901_3_33315"
                     /translation="MGACASICESTPDVPANIIADPEGPSKFVVKSCSMFNKDYEVYR
                     DEVGPNNRWLFLNREGKGFFDPTGYIDLENYTRIDPNDKKKGQVLWKLKYNEKPHFDM
                     GMSLGADSEDDGDDNPNVRTVTNMFKQMMQQMQMGENRFYSMKWRTFSEAKLKSVKTP
                     GGAYSVKIKAKGYCTRQVSVHYTRDEQGHQRRNVNVTDKEYVTKISYKIKTADGTTID
                     RFDLFCCEGSDLKWECAAFTAELRGGWISKYPHEITTKPGIDPGFALLFAHVCVTEFA
                     PDEIKKDLKPNWNQCPGYINPY"
     gene            <26139..>27338
                     /gene="HDA3509"
                     /locus_tag="OSTLU_34647"
                     /db_xref="GeneID:5003712"
     mRNA            <26139..>27338
                     /gene="HDA3509"
                     /locus_tag="OSTLU_34647"
                     /product="predicted protein"
                     /transcript_id="XM_001419432.1"
                     /db_xref="GeneID:5003712"
     CDS             26139..27338
                     /gene="HDA3509"
                     /locus_tag="OSTLU_34647"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419469.1"
                     /db_xref="GeneID:5003712"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="JGIDB:Ost9901_3_34647"
                     /translation="MARPRVHLTRVAPASPRASRRAERHPSRARRIASASASASASSS
                     PSLLFATSAALEHVQLGHPESNARVPAILDALEAGALTPAARPGEVLEITDVVPATKK
                     ALERVHAKNYCNGLELLCATRAPTNLDTAPTYCTPSSFQDVMLGVGAATRLVDEVIDR
                     AKETKEKAPSAFGLIRPPGHHAVPRGAMGFCLVGTAAAAARHAQLRGHKKVLIFDYDV
                     HHGNGTNDIFRDDDSVLFISTHEDGSYPGTGKITDMGEGDGLGATINIPLPPGSGDKA
                     VLSALEEIVVPAAARFQPDFIIVSAGYDAHWRDPLAGLTFRTGTYHRLCTKLKELANE
                     MCGGKIVFLLEGGYDLVGLSEGVADSFRALLGDASTDVGEIPGLRDEPDDKVRNVLTE
                     VKAMHQV"
     gene            complement(<27414..>28412)
                     /locus_tag="OSTLU_16632"
                     /db_xref="GeneID:5003716"
     mRNA            complement(<27414..>28412)
                     /locus_tag="OSTLU_16632"
                     /product="predicted protein"
                     /transcript_id="XM_001419643.1"
                     /db_xref="GeneID:5003716"
     CDS             complement(27414..28412)
                     /locus_tag="OSTLU_16632"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419680.1"
                     /db_xref="GeneID:5003716"
                     /db_xref="JGIDB:Ost9901_3_16632"
                     /translation="MARAKKRARTIARAALVVSTALAIEGARATTFTADGRSCKWPLE
                     LAEDVFVNECVPYGRDGALWCVAEEDGKWGVCADLDFDASARGKVSMEAAARAATTLA
                     REEELTYEARRQAMEVLESTSTLMLKALARESIEIEGKIVENPVVEFLAKRQRERPDN
                     FNAVNDPTTSTPAPASTTSPPLQRPPPSPPPPSPPPLSPPPPNQPRCVARTDIRWESP
                     QADGSSEFGMDIYIVLASGESISGGWKILFKFARDGVVLYSSSAYGADARTMYAPEDG
                     RVFELRDRGYDAYIALYSTKRIGFNVRTRSAQSLRLSTLAVNGEDCEIVSESSIRA"
     gene            <28589..>29353
                     /locus_tag="OSTLU_33318"
                     /db_xref="GeneID:5003713"
     mRNA            <28589..>29353
                     /locus_tag="OSTLU_33318"
                     /product="predicted protein"
                     /transcript_id="XM_001419433.1"
                     /db_xref="GeneID:5003713"
     CDS             28589..29353
                     /locus_tag="OSTLU_33318"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419470.1"
                     /db_xref="GeneID:5003713"
                     /db_xref="JGIDB:Ost9901_3_33318"
                     /translation="MRADESLESACVRVVLGLVGKRARTRGGADEKASASGTASSFDA
                     ARCREIVLEQHAKRRKVRGGRVGSVRGVRDADVDDFDEDDEDEDDYARLTEAEVERVL
                     LAMQDAMERELANEERLMSERAEVEYREDEEEQERLTRAIEAFERWKFPEAEDVGENA
                     ESSGEDVLCPVCATRRVLYNRHVLFCACGDFRIARADENVGLTYLKRRLAETFEAHVS
                     RGCGNAGGLRFSVRDEYGLDACVAKCERCSFLEIVM"
     gene            complement(<29414..>30526)
                     /locus_tag="OSTLU_16634"
                     /db_xref="GeneID:5003717"
     mRNA            complement(<29414..>30526)
                     /locus_tag="OSTLU_16634"
                     /product="predicted protein"
                     /transcript_id="XM_001419644.1"
                     /db_xref="GeneID:5003717"
     CDS             complement(29414..30526)
                     /locus_tag="OSTLU_16634"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419681.1"
                     /db_xref="GeneID:5003717"
                     /db_xref="JGIDB:Ost9901_3_16634"
                     /translation="MSDGMDAFMPPHRANQSSSSTTSSSTATATMTSGSEDLDPVVAR
                     SREVLEMATVGDLLRVTAEAADGSGRDRADEDETRDALRWFVVKRVGMSTGGRQLVEG
                     ELEGKKAQILDQGGANQARIGISGALLDERTPLTRLKNVRDADKFKRAIKSYERRVER
                     ESDALTLVSSVDKALTLNGLEQAVKKNPRFWTEGDGAHSRRVIKDPTESATKMTGELL
                     ALKHGHRDVVLMQIVCDWTDALEDSVRAPFAAATLEDMLTQDASISMRLSEARYQVGE
                     DKDGNPEFSNGITAVIYRETAKETANVLVSMGVQATRNIAGAFQQALVGVALGYTDEN
                     IAHHIRRLHNEDKLTDEDIFALIITARDEKEALNAK"
     gene            <31464..>32090
                     /locus_tag="OSTLU_33320"
                     /db_xref="GeneID:5003714"
     mRNA            <31464..>32090
                     /locus_tag="OSTLU_33320"
                     /product="predicted protein"
                     /transcript_id="XM_001419434.1"
                     /db_xref="GeneID:5003714"
     CDS             31464..32090
                     /locus_tag="OSTLU_33320"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419471.1"
                     /db_xref="GeneID:5003714"
                     /db_xref="JGIDB:Ost9901_3_33320"
                     /translation="MGSQNRTNKARTKREAVPNNAKARKQIAKLESAKKPGITYAQKR
                     KAEKAARDTLKMSGNSARASNDQAMRREGGVKYGALEVRYRALAKKLRQIEDLERKRS
                     EGTRMDAQQTKKLKRKEYLEAEMKNLEKLISGEAGDEEEEDEGEDDEEMSEEDEEEDD
                     DDDDDDEEEEEDEDDEEEEEEDEDEDEEESSEEEDEDEDEEEDDSESE"
     gene            complement(<32131..>33708)
                     /locus_tag="OSTLU_35087"
                     /db_xref="GeneID:5003718"
     mRNA            complement(join(<32131..33392,33555..>33708))
                     /locus_tag="OSTLU_35087"
                     /product="predicted protein"
                     /transcript_id="XM_001419645.1"
                     /db_xref="GeneID:5003718"
     CDS             complement(join(32131..33392,33555..33708))
                     /locus_tag="OSTLU_35087"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419682.1"
                     /db_xref="GeneID:5003718"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="JGIDB:Ost9901_3_35087"
                     /translation="MFKTSAKQRRRVRGVVRGAGRGRVIGFYHPSGGDGGGGERVLFA
                     AIAAAQRATEGRDVTCCVYAGATSARGDEPVEDGDELIARARERFGIELRAPINVIRL
                     TRERWARAETYKRCTILGQFIGGAWLGLEALWTFAPDVFVDTVGHAATYPIARYLFGC
                     QTVAYVHYPTVSRDMIARVESGRLMYNNSRLFASSKFLSGLKVLYYRAFAVVYGWCGR
                     SCKCVMVNSSWTKSHIDALWRVDSRVVYPPCNVEDLSKLPLTRPRLNARGTPVKKDKS
                     SIRVVSVGQFRPEKAHVVQIAAWKALKKFKTLSSKIENAILVFVGGCRDEADRERLAD
                     LQQSVKDLELQDSVQFHVDVSYDEVKRELSRASIGLHSMIDEHFGICVVEYMAAGAVP
                     VAHASGGPFLDIIRDQHDGPTGFTADSVATFAETLEHLLLMRRTEREEISARARARSD
                     IFSETEFNSNFIDSLVNSGVL"
     gene            <34026..>34577
                     /locus_tag="OSTLU_33322"
                     /db_xref="GeneID:5003620"
     mRNA            <34026..>34577
                     /locus_tag="OSTLU_33322"
                     /product="predicted protein"
                     /transcript_id="XM_001419435.1"
                     /db_xref="GeneID:5003620"
     CDS             34026..34577
                     /locus_tag="OSTLU_33322"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419472.1"
                     /db_xref="GeneID:5003620"
                     /db_xref="InterPro:IPR001537"
                     /db_xref="JGIDB:Ost9901_3_33322"
                     /translation="MGPNVTVRAIETASDAQRKDLHVVLVTPKIPGNTGCIARTCAAS
                     RVPLHLVAPLGFSLDDAQLKRAGLDYWKSVCVKVHDDWDAFYAYWRELGDERGRLVAF
                     SKFGARPHAEDGAYRPGDWLLFGAETTGLPDAAMEACKATGGVRRIPIDESHVRSLNL
                     SVSCGIGVYEALRQLDGSPTVDE"
     gene            complement(<34662..>34976)
                     /locus_tag="OSTLU_8821"
                     /db_xref="GeneID:5003719"
     mRNA            complement(<34662..>34976)
                     /locus_tag="OSTLU_8821"
                     /product="predicted protein"
                     /transcript_id="XM_001419646.2"
                     /db_xref="GeneID:5003719"
     CDS             complement(34662..>34976)
                     /locus_tag="OSTLU_8821"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419683.1"
                     /db_xref="GeneID:5003719"
                     /db_xref="InterPro:IPR007572"
                     /db_xref="JGIDB:Ost9901_3_8821"
                     /translation="RLVSVLTSLPRRFNLYFQRRNYRVTLWRAISAYFGFYLANVMTL
                     SFGAIGINDVVAGALSVAFFEVVTRIYYASAETNKWLEFLNWFKVGYCYSLIADAFKL
                     GS"
     gene            complement(<35325..>36149)
                     /locus_tag="OSTLU_34772"
                     /db_xref="GeneID:5003621"
     mRNA            complement(<35325..>36149)
                     /locus_tag="OSTLU_34772"
                     /product="predicted protein"
                     /transcript_id="XM_001419647.1"
                     /db_xref="GeneID:5003621"
     CDS             complement(35325..36149)
                     /locus_tag="OSTLU_34772"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419684.1"
                     /db_xref="GeneID:5003621"
                     /db_xref="InterPro:IPR008594"
                     /db_xref="JGIDB:Ost9901_3_34772"
                     /translation="MLERIRLRSRAPYSGAEYGYYVGELAPSTSASSGGEDVECDVLY
                     PGCLLDADETSRAKLLKKHITRSSTQKLVCVRETPELYAKAHEKYIASIPREATAWVR
                     KILSLEKERERLLHCDDDFLLNVDSKWTTHPDCDGADRATWRAHSSVTDLYCLGLCVR
                     EDFKSLRDARAEHLPLLRAMLRKGRAVIEDIYGVNAEEMRVFVHYPPQFYHFHVHYQA
                     LSAKEQGCACERAHSLEDIIDNLERDGDHYARANLSLKMGERDALYAFYNDAATRA"
     gene            <36792..>37418
                     /locus_tag="OSTLU_16639"
                     /db_xref="GeneID:5003622"
     mRNA            <36792..>37418
                     /locus_tag="OSTLU_16639"
                     /product="predicted protein"
                     /transcript_id="XM_001419436.1"
                     /db_xref="GeneID:5003622"
     CDS             36792..37418
                     /locus_tag="OSTLU_16639"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419473.1"
                     /db_xref="GeneID:5003622"
                     /db_xref="InterPro:IPR010721"
                     /db_xref="JGIDB:Ost9901_3_16639"
                     /translation="MLALHVAGGAAYGARLAAFLFYRSVTWDEWRERAKNAPEANAKS
                     FAKQTLVIALCSALYAMMSSPMMWHAQNVNAVNAAKYAGVIAVGLALEWVGLILEAVA
                     DQQKFNYKATEEGKTKWCSKGLYKFCRHPNYLGEIMFWVGLYVAGFPAMLTRPITLVP
                     SSLGLLFIVKLMTSAAKRGDKKQLEKYGEDNAAYKAWVESTCSLVPGN"
     gene            complement(<37475..>37933)
                     /locus_tag="OSTLU_93196"
                     /db_xref="GeneID:5003720"
     mRNA            complement(<37475..>37933)
                     /locus_tag="OSTLU_93196"
                     /product="predicted protein"
                     /transcript_id="XM_001419648.1"
                     /db_xref="GeneID:5003720"
     CDS             complement(37475..37933)
                     /locus_tag="OSTLU_93196"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419685.1"
                     /db_xref="GeneID:5003720"
                     /db_xref="JGIDB:Ost9901_3_93196"
                     /translation="MHAIRATQRTNRTSTSCATASCASKRHARAQRVARPSQRRVTVA
                     LSTPARVSTRCAAVDVAQVAIAGIDTSGFDQMFINGLKVGIPLYGAVVGAVFIFGTIA
                     KVAFPEKYDAALYGAEAKKEVEKIDLDNLSEEDAKAVAELEAELRKEGKL"
     gene            complement(<38460..>39404)
                     /gene="HDA3503"
                     /locus_tag="OSTLU_5838"
                     /db_xref="GeneID:5003623"
     mRNA            complement(join(<38460..38766,39010..>39404))
                     /gene="HDA3503"
                     /locus_tag="OSTLU_5838"
                     /product="predicted protein"
                     /transcript_id="XM_001419649.1"
                     /db_xref="GeneID:5003623"
     CDS             complement(join(<38460..38766,39010..>39404))
                     /gene="HDA3503"
                     /locus_tag="OSTLU_5838"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419686.1"
                     /db_xref="GeneID:5003623"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="JGIDB:Ost9901_3_5838"
                     /translation="IGTIDGDTAVCSQSFNAALAAAGATIEAVEKIVSGETNKVFCAV
                     RPPGHHSGPLGPVGTPSEPIGTGSHGFCLINNVAVAAAYARCVHRKTLRRIALVDFDV
                     HHGNGTEACVQNTAPSAPQFKYSLPIGGGTGEQPWVLDVGMEGTGKKSERGAAWRRVW
                     KGKILPAINAFEPELIIISAGFDAHAKDDIQGPVNLGVKEQDYEWLTTELMKIANSHA
                     KGRVISVLEGGYRIQG"
     gene            complement(<39720..>40217)
                     /locus_tag="OSTLU_34894"
                     /db_xref="GeneID:5003624"
     mRNA            complement(<39720..>40217)
                     /locus_tag="OSTLU_34894"
                     /product="predicted protein"
                     /transcript_id="XM_001419650.1"
                     /db_xref="GeneID:5003624"
     CDS             complement(<39720..40217)
                     /locus_tag="OSTLU_34894"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419687.1"
                     /db_xref="GeneID:5003624"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="JGIDB:Ost9901_3_34894"
                     /translation="MSGFEKHEAFAIEAVKALLPHVENECTQDDYGRTALSVAAQHGV
                     LPIVQHLVSEFTPPNEEDTVEVYVNLRDKTRNRPVHWACAYGRGDVVDFLLKNGADPT
                     LKNDNKDNALHCAVRGGDVKCVELLLKSHGALTKDKNAQQQTPGELAAARGQPTIAKL
                     LKATVL"
     gene            complement(<41025..>42242)
                     /locus_tag="OSTLU_33328"
                     /db_xref="GeneID:5003625"
     mRNA            complement(<41025..>42242)
                     /locus_tag="OSTLU_33328"
                     /product="predicted protein"
                     /transcript_id="XM_001419651.1"
                     /db_xref="GeneID:5003625"
     CDS             complement(41025..42242)
                     /locus_tag="OSTLU_33328"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419688.1"
                     /db_xref="GeneID:5003625"
                     /db_xref="InterPro:IPR004396"
                     /db_xref="JGIDB:Ost9901_3_33328"
                     /translation="MPPKKKTADDGADDVGAAKFGRVRNNLRMGIVGLPNVGKSSLFN
                     ILTEQSIAAENYPFCTIDPNEARCPVPDARYDRLVSMWKPASEYPAFLSVTDIAGLVR
                     GASSGAGLGNAFLSNIMATDGIFHVVRAFDDPEVVHVDDEIDPVRDLETITAELCLKD
                     LETVKRAIADEERDVKKNPTMKLSALFKDTMARCTEMLENNLAIRTGEWNTPEVEMIK
                     DKLPALLTTKPMIYLVNLSKRDYVRKKNKWLPKIHAWVQQHGGGIMIPFSVEFEQELF
                     DLGDDESLRSAFYEENEGAKSALPKMVTQGYKELNLMYFFTAGEKEVRCWTVYNGALA
                     PQAAGVIHTDFEKGFIKAEVCSYDDFAAIATKPSMAEVKEAGKYRQEGKAYVVKDGDI
                     IHFQIGQLTKSKK"
     gene            <42506..44511
                     /locus_tag="OSTLU_33329"
                     /db_xref="GeneID:5003626"
     mRNA            <42506..44511
                     /locus_tag="OSTLU_33329"
                     /product="predicted protein"
                     /transcript_id="XM_001419437.1"
                     /db_xref="GeneID:5003626"
     CDS             42506..44500
                     /locus_tag="OSTLU_33329"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419474.1"
                     /db_xref="GeneID:5003626"
                     /db_xref="JGIDB:Ost9901_3_33329"
                     /translation="MTSYDAVTEEALRRAVRDAFGGERGVRVGRRVSRRFDALREALK
                     RSSGGRVVNALETSAGELDAKQLDGRSASEVGATRGLEGGALASWDDDIEWGARLSKR
                     KLRRVESPVDVERAGEKSSVEVKYDELDAAVYAVMRSPMTMGALKRILYETRDRLGTS
                     FKPRSVLDFGSGPVPTTLFAVRAVFGDDVGTHGGRDTDVKVAFVDSNPGMMRFARRVT
                     GYAKNIEQERRTTAALERASTTSEDKIGVSEELSDVLDDVDASVTRVLDFSDFEAVED
                     ERHGFRPASALRLKTPHPWHESEGIRTSASLRGANRRGGFDVVVSSYALGEIPDNHVV
                     NARGREVRNQRQLDVTIRQLWDKVAPGGILVLAEPGTPRGSLLIRRARAMLLDVARRD
                     MEQDARRLDFEPSEDAVEAYVVAPCQHDKACPLKDVNAEDGFSTWCHFPQRTLRSAYV
                     REMKHGARPYQDEKFSYVVLRKMRRSAARRDAERATQAARDALAAQKSATPNDERNGD
                     EEDEEDEDEEYHESLARESFEDWSRVIRQPMKRKGHVVFELCAPSGELERVTVARSHG
                     DLIGRDGYKYARKLRWGDLWPFTHKTVVKPGDQRAFELEASRFESDFLRSLRRDRAAR
                     LVASPAPLDPIARDEIEIELDDDELDDELVDLWNSRAGAR"
     gene            44601..>47418
                     /locus_tag="OSTLU_33330"
                     /db_xref="GeneID:5003721"
     mRNA            44601..>47418
                     /locus_tag="OSTLU_33330"
                     /product="predicted protein"
                     /transcript_id="XM_001419438.1"
                     /db_xref="GeneID:5003721"
     CDS             44770..47418
                     /locus_tag="OSTLU_33330"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419475.1"
                     /db_xref="GeneID:5003721"
                     /db_xref="JGIDB:Ost9901_3_33330"
                     /translation="MAREDGARRKERKDERTVAMEKMVMELAAAAAVVDGNKTSVSER
                     ASGASGGSSLTRAPDAEREREEGQALTLDALVMASAGSNKRAKSAGVKVAKRKKMEDK
                     GERRWYCCSCKQTLTPEHFDPNLETCRLCLAKRRAKDRAKKRLRGLQLKHHLLSADEK
                     DVAAFLLGVYHPALTQQGPRSSSFNSIQMNVQRASMEVSAFVEDFRSFLEDKPKEQAD
                     RLVRTFLGLDDAGERLTPHQVINEKGSAKRNTMSSKANSAKATHNYRAPASSMGGRQE
                     LTKSLDTVYDKYDALLKNTSDDQTWVRFAAENEQDTDLDAEKVNYSAPIHESAAETGT
                     NEKDDVYSAIMHGADPTVSHYLYQFLFMNQPTIGGEHSTMVVESDLPQLTGQLPLRAV
                     DSLSEGSSLNGATNVSSESDNVYNTLDEEELNGNAYAFKGSLVMGWIGGARDGKRELL
                     AKENGILPDDMHPQAVFSHGRLFDARTPGKLVPLTETENLHGFSEDLAIFPVKDSSSD
                     IVRIHIPPGSFSEELGVRALHDGHYIDSELRHRRNGGAEVILYPNGRDDRERNAIVIL
                     GAVHLQCFVRSGTAKQMPIGCNIPALFIPSQAHAKEISDGVEHIAQVKGTKAARQFLS
                     SLAYVLVHGEPKSAKFEFVVEMAHILALTRTLDLLERLAMLAKSSLSSDDSDTSISEV
                     ARLEVYKPSDNFWQHAGHTDSFLGILLCLVAGFIRLIASAVSGARLNYGFYATLLAAA
                     ALSATNPKTRVDIKSIAFNMLFIWAHAASMHSDDLTNQMTSYGKALVITLALSALNAS
                     HSRMSSSSSFVLPQLAFAGSGYNPHTIFRFMKQALPQDGSIPQNALRAHAWTVHISCA
                     LLAPAILISCISQLPGARVRSKSKLA"
     gene            complement(<47510..48550)
                     /locus_tag="OSTLU_50402"
                     /db_xref="GeneID:5003722"
     mRNA            complement(<47510..48550)
                     /locus_tag="OSTLU_50402"
                     /product="DMT family transporter: CMP-sialic
                     acid/UDP-N-acetylglucosamine"
                     /transcript_id="XM_001419652.1"
                     /db_xref="GeneID:5003722"
     CDS             complement(47510..48400)
                     /locus_tag="OSTLU_50402"
                     /codon_start=1
                     /product="DMT family transporter: CMP-sialic
                     acid/UDP-N-acetylglucosamine"
                     /protein_id="XP_001419689.1"
                     /db_xref="GeneID:5003722"
                     /db_xref="InterPro:IPR007271"
                     /db_xref="JGIDB:Ost9901_3_50402"
                     /translation="MVSYLFLQVAGTIFASLSRNSDDDYPYDTVVLAFTMESVKLVLS
                     FIFLTTSRACGGVEEVTWSAKRFTSFALPALCYFVANNCMLLIIQELGPSTYQIMNNL
                     KILSTGVLMWTLLGRRLTSLQWRALFLLLLGSVTAEITDSNQLRGSVYGYVLVVINTF
                     IAASGSVLSEKLLKGSNQDGATDSIHWQNMQLYFWGVICGAIPIVWKGEALKNGLFTG
                     FNFYAWVSLVVLSFGGLAVSFILKYLDNIYKCFVSALSMLVVAIIHVCIEHETMPLRI
                     IISIALVSLAMELYTTGAAT"
     gene            48616..50031
                     /locus_tag="OSTLU_33332"
                     /db_xref="GeneID:5003627"
     mRNA            48616..50031
                     /locus_tag="OSTLU_33332"
                     /product="predicted protein"
                     /transcript_id="XM_001419439.1"
                     /db_xref="GeneID:5003627"
     CDS             48663..49955
                     /locus_tag="OSTLU_33332"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419476.1"
                     /db_xref="GeneID:5003627"
                     /db_xref="JGIDB:Ost9901_3_33332"
                     /translation="MECVDSLDDTAHAEDGHEEYCADTAVSTARVRTLPKTRIVARNA
                     CAITGASDFEPLLTLRDFPVGMYCVPEEWDGVEYVADMRWCVSKSSGVIQLAELIEAE
                     TLYDCQHESGAIGGLWKRHHEEFCEFIDAYGCESVLEIGSGHGHLAKEFVARRRGKCR
                     WTMVEPNLPSWLLTGDHPSEIHPISAWFCDSFELPKDVPKIDAVVHSHTFEHIYDYDE
                     FLRNVARMEPKFQIFSVPHQREWLARGWQNSIMFEHPQLLTPKAIEYIMSRHGFELQG
                     KKVFADGHSMFYAFSYAGNASKSETSQQSLDEYAENKRLFRNWLKSNVDFVQNVNDRI
                     DEATMNGEKPTVYMFGAHIFTQYLVSFGLRISAVEAILDNAEGKQGKRLYGLPLLVHS
                     PKILSNVERPIVILRVGAYAEEIKRGILEVNARTVFWE"
     gene            complement(<51115..>51618)
                     /locus_tag="OSTLU_10396"
                     /db_xref="GeneID:5003723"
     mRNA            complement(<51115..>51618)
                     /locus_tag="OSTLU_10396"
                     /product="predicted protein"
                     /transcript_id="XM_001419653.1"
                     /db_xref="GeneID:5003723"
     CDS             complement(<51115..>51618)
                     /locus_tag="OSTLU_10396"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419690.1"
                     /db_xref="GeneID:5003723"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="JGIDB:Ost9901_3_10396"
                     /translation="AFLFDLDGTLVDTTDAYVAAWREILAPMGAFVDEEFFLKHISGQ
                     SDAQVAQRFKLQISSEQKDEAFLRYIEKTKEIPGAVEFVQKCRALGPVSVVTNSNRTA
                     AKALLKHLALDDLPLISASDVRFGKPNAEPYLKAARRLGVSIGNSIVFEDSRCGLISG
                     RAAGCQYV"
     gene            complement(<52573..>54376)
                     /locus_tag="OSTLU_25000"
                     /db_xref="GeneID:5003628"
     mRNA            complement(join(<52573..53216,53410..>54376))
                     /locus_tag="OSTLU_25000"
                     /product="predicted protein"
                     /transcript_id="XM_001419654.1"
                     /db_xref="GeneID:5003628"
     CDS             complement(join(52573..53216,53410..54376))
                     /locus_tag="OSTLU_25000"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419691.1"
                     /db_xref="GeneID:5003628"
                     /db_xref="JGIDB:Ost9901_3_25000"
                     /translation="MTDEATPLIGDDGSRSARRTRVGSLLSLIAAVAIVVASATARRD
                     ALGAQSCAEGRADVAFLIGGSVRGMVLDHVSKGLKTNVLDWMAERCVNVHPIMLLSIA
                     DVSGWRDRSAMFPKVYPHVLQRALDVIRPVAVSFYTASAYDLDTKDPWGQHCAARGFK
                     VKKDDYFSPATTYAQFDLSKRLLCMARKVEQEKNIHFSWFVRSRPDYFWYGPPPVDFA
                     TTLWDGRGTDSAHAFIFDEDWRHKYNDALYAVHSSHADGILGPGSSILSKLPCRAEIP
                     ATGHVFLERMTPETALHKVVDLVGAASRAVGIGFERSARPTAKPGQAQKLLCMARKVE
                     KEKNIHFSWYMHGRPEYFWYAPPPVDFARTLWDGRDTNHDTDAVQPTLIFDEDWYWKY
                     NDAFYVVHSSRANAFWGQGTDVLKSVACVSPRSQMSPEASIFHVADYAHCNVRRGISL
                     GHSAWPDRDGMGVHWCHGISEGNTTMINACNAANKISTEANAKYRERAKDWLEKRAAA
                     AAAEAEAAGSAAAKPAPPERPAARGPTC"
     gene            complement(<54615..56028)
                     /locus_tag="OSTLU_33336"
                     /db_xref="GeneID:5003629"
     mRNA            complement(<54615..56028)
                     /locus_tag="OSTLU_33336"
                     /product="predicted protein"
                     /transcript_id="XM_001419655.1"
                     /db_xref="GeneID:5003629"
     CDS             complement(54615..55286)
                     /locus_tag="OSTLU_33336"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419692.1"
                     /db_xref="GeneID:5003629"
                     /db_xref="JGIDB:Ost9901_3_33336"
                     /translation="MLATPSTTPFAALRASKFERSPREMLCASLSLILASRGRAQCRL
                     RTRVGLCRSVGHLSATELQLQLGYTYSYWGDSLVPHGSAFQTREPLFARDGKDADGEL
                     ARDATPTEKKSDGRTETPLSIKVLSMVSYLFLQVAGTIFASLSRNSDDDYPYDTVVLA
                     FTMESVKLVLSFIFLTTSRACGGVEEVTWSAKRFTSFALPALCYFVANNCMLLIIQEL
                     GPSTY"
     gene            complement(<56764..>56979)
                     /locus_tag="OSTLU_33338"
                     /db_xref="GeneID:5003630"
     mRNA            complement(<56764..>56979)
                     /locus_tag="OSTLU_33338"
                     /product="predicted protein"
                     /transcript_id="XM_001419656.1"
                     /db_xref="GeneID:5003630"
     CDS             complement(56764..56979)
                     /locus_tag="OSTLU_33338"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419693.1"
                     /db_xref="GeneID:5003630"
                     /db_xref="JGIDB:Ost9901_3_33338"
                     /translation="MRCIGVALCRAPSRARCGDAKTDARLGLLHLIRADTVLAYQRIR
                     LFVWANSMKTVVFDTYREIPNTGFKHP"
     gene            <57191..>59695
                     /locus_tag="OSTLU_249"
                     /db_xref="GeneID:5003631"
     mRNA            <57191..>59695
                     /locus_tag="OSTLU_249"
                     /product="predicted protein"
                     /transcript_id="XM_001419440.1"
                     /db_xref="GeneID:5003631"
     CDS             <57191..>59695
                     /locus_tag="OSTLU_249"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419477.1"
                     /db_xref="GeneID:5003631"
                     /db_xref="JGIDB:Ost9901_3_249"
                     /translation="GYRRPPDALTQFTERPQSPNVTVSPDRRRLLYLHKPPPLPDVAT
                     LAREEVKLAGVRIDAAQNSTSRMGHQTKLAIGAMPAREEEIGAAEDFVGTPENALINY
                     VSWSPDGTKIAFTTRSSGEPGEPERGPLTLWIADAHTRQCRVLLPDRGLNTIFESYSW
                     LNDDVIVACCIPENRPKEAPKRPQTPFGPRIQTNRGGNVAQARTYADLLKDSHDADLF
                     DYYCSSELVAVDVSTGATKTWGDGKARIYTRCDPSPDGKYAIVEAIHRPYSYSVPCGR
                     FPKKVWVADSDGKVVREVADLPLAENVPIVHNATRKGPRAVNWRSDKSASLYWTEAQD
                     EGDPRVEVSPRDVTYTVDVGKDPAATPKTLFQTDYRYGGVAWGGDDMSILYESWYKTR
                     TSRVWVTSPGDADPNATKRMLWERDYEDSYNAPGSFATRRTEDGSYILARVVGPTPLG
                     EGKPTGPGVKLLLQGDGANPEGDRPFIDLFDVDTGAKHRMWESKPPYLEHPGSLISDY
                     GGPEAAPVTLETMRILFSRESPSENSQFFSLQMTADGSPGKEVKISNFPHPHPDLKEL
                     PKEIIKYKRDDGVELNGTLYTPPGYDAAHDGPLPLLMWAYPREFKTKEAASQLRDSPY
                     RFTGIGPSSALVWLARGYAVLDGPALPIIGEGEGVEPNDTYVEQLVAGARAAVNEVVA
                     RGVADPERIAVGGHSYGAFMAANLLAHAPDLFACAIARSGAYNRTLTPFGFQAEERTL
                     WEAPETYNAMSPFMNAHKIKKPILLIHGEEDQNSGTHLMQSERFFSALKGNGAEVKLV
                     ILPHESHGYRAKESINHMLAETSDWLDAHCAPGAKKA"
     gene            complement(<59877..>60641)
                     /locus_tag="OSTLU_16650"
                     /db_xref="GeneID:5003901"
     mRNA            complement(<59877..>60641)
                     /locus_tag="OSTLU_16650"
                     /product="predicted protein"
                     /transcript_id="XM_001419657.1"
                     /db_xref="GeneID:5003901"
     CDS             complement(59877..60641)
                     /locus_tag="OSTLU_16650"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419694.1"
                     /db_xref="GeneID:5003901"
                     /db_xref="JGIDB:Ost9901_3_16650"
                     /translation="MSYVRVKRKRGDASHARVVVEVVEAHDGFGDGARGANAARAAAL
                     ARALDDALDGALDATSEARGARKRRRRARRVAEGVARDDAETRAADDGAGRETRVYDA
                     MVDSLERARAMESALMCNCAPMVREYLASRGEANAEAGPPPFEGEEAFARTSTSASEG
                     EDEWVYDVYEMMDEDARDSDDDDFDDGYAPVIRVRDFHDVADDEDAESDYGDSDSNAA
                     GYFDDYPDTESDSSEHSDRFEDDDSGFGDDDDDDWS"
     gene            <61142..>62491
                     /locus_tag="OSTLU_35051"
                     /db_xref="GeneID:5003632"
     mRNA            <61142..>62491
                     /locus_tag="OSTLU_35051"
                     /product="predicted protein"
                     /transcript_id="XM_001419441.1"
                     /db_xref="GeneID:5003632"
     CDS             61142..62491
                     /locus_tag="OSTLU_35051"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419478.1"
                     /db_xref="GeneID:5003632"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="JGIDB:Ost9901_3_35051"
                     /translation="MGVEGDFDEETARLSARVAAAERRDALGGGGARRKRKEDAVADA
                     ARIHLLEPIDARTRGRETERVREQTPRRVWLGRHAFDVDERYDPIKTIGRGAYGVVCS
                     ANNRVAPLGARNTVAIKKLTNCFDSPVEARRALREVHLLRRLKHENVIKLEDIMMPVG
                     DNGRMDDVYLVYELMDTDLHQIIRSKQALLDEHCQYFIYQILRGLKYVHSAKVLHRDL
                     KPSNILLNANCDLCICDFGLARSMVERGRMMTSYVVTRWYRAPELLLNSEEYAASIDM
                     WSVGCILAEIIDRKPLFPGKDFIHQMRLIIETLGSPEEADMDFISSPYARKYIASLPR
                     KPKVDFAVLYPDANPLAIDLLERTLVFDPQRRISVDDALAHPYLASLHDASMEPTYTP
                     AADDPHFKSLDEPDAHIPDEYLREAIYNQMLDMKSERAAARASSTSFAFAPRAQAFL"
     gene            <62576..>63403
                     /locus_tag="OSTLU_34729"
                     /db_xref="GeneID:5003902"
     mRNA            <62576..>63403
                     /locus_tag="OSTLU_34729"
                     /product="predicted protein"
                     /transcript_id="XM_001419442.1"
                     /db_xref="GeneID:5003902"
     CDS             62576..63403
                     /locus_tag="OSTLU_34729"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419479.1"
                     /db_xref="GeneID:5003902"
                     /db_xref="JGIDB:Ost9901_3_34729"
                     /translation="MKRDVVVTSVAFAGAAVACSLVALRITRKIRTRTGLDPFAVPNG
                     SSREKGADGRKAALVLTSHPDDESYFFAPTIQALKAANVETHLVCLSDGGAGGDGETR
                     KKELLRVKELFELEGMCIVEAEDLMDGMTNAWPAKTVMTVLDEYTGGAPTTFDYVVTF
                     DAGGVSGHLNHVCTYEGTKQWIEERKVSISSDRGGCPQVWVLETTNAARKLSGALDFA
                     TSYLESLIDSRRVFVPSASPMQVLKAVRLHASQFVWYRKIFVVFSRYTYMNTLRRID"
     gene            complement(<63510..>64481)
                     /locus_tag="OSTLU_5471"
                     /db_xref="GeneID:5003903"
     mRNA            complement(join(<63510..63875,64056..>64481))
                     /locus_tag="OSTLU_5471"
                     /product="predicted protein"
                     /transcript_id="XM_001419658.1"
                     /db_xref="GeneID:5003903"
     CDS             complement(join(<63510..63875,64056..>64481))
                     /locus_tag="OSTLU_5471"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419695.1"
                     /db_xref="GeneID:5003903"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Ost9901_3_5471"
                     /translation="LFSASADKTIRAWDISSRRCVQVLEEHTRPVLCLAVCVKHDKLF
                     SGSYDCTVRVWNLSTYRRITYLPGHTDAVRALQVYNDTTLYTASYDHTIRAYDIESLE
                     LLKVLRGHNGPVRTLVTVNDYVFSGSYDRTVRVWPAYTADCVQELKGHGDNVRVLTVD
                     DRHLYSGSWDKTIRVWDLETFSCKHIINGHTEAVLALCVMGGHLVSGSYDTTVRLWGV
                     QPETEFECVGVFQGHHDAVRVLTSAGRNATTVFSGSYDGSIGFWRL"
     gene            complement(<64725..>64928)
                     /locus_tag="OSTLU_9923"
                     /db_xref="GeneID:5003633"
     mRNA            complement(<64725..>64928)
                     /locus_tag="OSTLU_9923"
                     /product="predicted protein"
                     /transcript_id="XM_001419659.1"
                     /db_xref="GeneID:5003633"
     CDS             complement(<64725..>64928)
                     /locus_tag="OSTLU_9923"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419696.1"
                     /db_xref="GeneID:5003633"
                     /db_xref="InterPro:IPR003613"
                     /db_xref="JGIDB:Ost9901_3_9923"
                     /translation="EIPAHFQCPITMELMQDPVMIATGHTYDRPAIQRWLDQGHRTCP
                     VTGVRLRHLELIPNHAIRTAIQSW"
     gene            <65923..>67338
                     /locus_tag="OSTLU_33344"
                     /db_xref="GeneID:5003634"
     mRNA            <65923..>67338
                     /locus_tag="OSTLU_33344"
                     /product="predicted protein"
                     /transcript_id="XM_001419443.1"
                     /db_xref="GeneID:5003634"
     CDS             65923..67338
                     /locus_tag="OSTLU_33344"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419480.1"
                     /db_xref="GeneID:5003634"
                     /db_xref="JGIDB:Ost9901_3_33344"
                     /translation="MSDVCLYSPATIERARSALPRTASTWRGTVSVAVLADLKTPGDA
                     LDLSAMASELEGDAGRIAITMVEALPEYENRFPVNFLRNLAREKCVAELGAKYVLAHD
                     VDFEVFVAPDEDAFLNDVRNVLGKRSGEKVRRALVVPAFQLHAVWSQRVNAKRDAILN
                     ARRVQRQTKSRRNEGKDDDESIDAVVDSIATKGDVRRLNPMSLYETLVERDRTRTVDS
                     KATAINLTLPYSTRERLDRLVRERRLANGFQINYFPIAHAPTNYTAWFENTTTGADST
                     YRVATPKHPWYYEPYVIVRADLALPFDESFVQYGFNKISFVHELAAAGFDFHVTKNAH
                     TVHTNTHPTRAMANMQGQDLARCRAHPAASNDFRIARVGHSCIPAFLRRMECAYGFTL
                     DDLEFGGVSNAPPPDDLLFRLQSDDNIVCFGGCITDLEDAPRTPATVTVRGGRFVGVT
                     QGSDARRRKRGPCERFDVALQ"
     gene            complement(<68400..>69240)
                     /locus_tag="OSTLU_34891"
                     /db_xref="GeneID:5003904"
     mRNA            complement(join(<68400..68803,68986..69043,69163..>69240))
                     /locus_tag="OSTLU_34891"
                     /product="predicted protein"
                     /transcript_id="XM_001419660.1"
                     /db_xref="GeneID:5003904"
     CDS             complement(join(<68400..68803,68986..69043,69163..>69240))
                     /locus_tag="OSTLU_34891"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419697.1"
                     /db_xref="GeneID:5003904"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="JGIDB:Ost9901_3_34891"
                     /translation="RRARVASRKIGGPTRRSAKGGWTPEEDELLRGAVAVYGGRNWKK
                     IAVYFSDSRTDVQCLHRWQKVLNPELVKGPWTAEEDARIIELVTELGAKRWSKIAGEL
                     PGRIGKQCRERWYNHLDPEIKREEWSADEDRQLIIAHAQYGNRWAEIAKSFKGRTDNA
                     IKNHWNSTLKRKVDQALNQG"
     gene            <69938..>70696
                     /locus_tag="OSTLU_33346"
                     /db_xref="GeneID:5003635"
     mRNA            <69938..>70696
                     /locus_tag="OSTLU_33346"
                     /product="predicted protein"
                     /transcript_id="XM_001419444.1"
                     /db_xref="GeneID:5003635"
     CDS             69938..70696
                     /locus_tag="OSTLU_33346"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419481.1"
                     /db_xref="GeneID:5003635"
                     /db_xref="JGIDB:Ost9901_3_33346"
                     /translation="MGNKREGEARARAEVEARARAEAEAKALAAERGALTERERALRA
                     FVEDKKAHDEALRRAREECARLTVALESERADMERAFAARTGAMRAECDARVAKAKKQ
                     AESTMTARMERSVKRILAQNRKMSDELRVQVNETDALHRRFAKANAEAESLRRRAAAA
                     DDVERERAELGAMRARDLRRAEEKITTLERGIRELMEAFETQKLEWERETNDLRRAND
                     EEVTHLKRSLALKSRELVNIRRLAKEVVCHYEDL"
     gene            complement(<71757..>73586)
                     /locus_tag="OSTLU_93203"
                     /db_xref="GeneID:5003905"
     mRNA            complement(<71757..>73586)
                     /locus_tag="OSTLU_93203"
                     /product="predicted protein"
                     /transcript_id="XM_001419661.1"
                     /db_xref="GeneID:5003905"
     CDS             complement(71757..73586)
                     /locus_tag="OSTLU_93203"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419698.1"
                     /db_xref="GeneID:5003905"
                     /db_xref="JGIDB:Ost9901_3_93203"
                     /translation="MGARCCRPRADDGDAVARADADVDALHDAFHDARHDAFEIDWDD
                     DVRCDANFDVARARREWIGRADALTTVDACANDAERLAALGELEAALWMVAREDATGS
                     ARDEASTRRREAWRDVYEQAIALNDVELEEHHDGWKPVDKGAKRAAHHRRQASVEVDA
                     EVIIGANHSRRASSVDFGMRRTSSVDFGRMRASESGSRRTSSIDLGRGLSRQWASSVD
                     FERGGANDARRSLRQSGAEVEVSLGRTDREKRGVIDFGELTDLASSRASMSDGEEDPL
                     APRYGRRRRSRHSRSGSVSSSDGAVIATQPDPLSGSESGGESSVRGTAGVPGVVQETF
                     EADPDLDERLVIYYGRFKGGTVHSIKLSATFDAPPHRLVAIAREWDLMTLWNVYAIET
                     SIMLVRGLTHLVVYSAIWLPWPLSARDKIIVIDSTYVGQPPTRAYDHLNIPGMDDFES
                     EVPHSCAILITRTNKSGDDLGSGAPPSAKSRKRIEFVGNCGMRMRALPPVAGSKSIRT
                     RGDIVVHADVKMRFIPTTVVRFVLRVMAPWVHRMIDKMLKSPKYFGASDSLFQPRIDA
                     NPDLYRMVRRRLGEPEFDDVTAEVIVPDALARARPVVASASSS"
     gene            <74192..>74776
                     /locus_tag="OSTLU_33348"
                     /db_xref="GeneID:5003636"
     mRNA            <74192..>74776
                     /locus_tag="OSTLU_33348"
                     /product="predicted protein"
                     /transcript_id="XM_001419445.1"
                     /db_xref="GeneID:5003636"
     CDS             74192..74776
                     /locus_tag="OSTLU_33348"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419482.1"
                     /db_xref="GeneID:5003636"
                     /db_xref="JGIDB:Ost9901_3_33348"
                     /translation="MPFRPSPNGNKGKGFLELWFGRDEANEGKIRPAPYLRILAVIPF
                     VIPLMGTIAFTHSAYEFLPLFKHAMFIFAPAMQLFYGNSFIPFMTFFALFLLVVRNEK
                     IPYFVRYCTMQAILLDICCMLGGLIMQYMPIFIMVSWVGEWMELWIFVNSFFALGYSI
                     FNALQGLIPEAPLISEAVYAQVQEARDTGYMEEE"
     gene            <75042..>76316
                     /locus_tag="OSTLU_93205"
                     /db_xref="GeneID:5003906"
     mRNA            <75042..>76316
                     /locus_tag="OSTLU_93205"
                     /product="predicted protein"
                     /transcript_id="XM_001419446.1"
                     /db_xref="GeneID:5003906"
     CDS             75042..76316
                     /locus_tag="OSTLU_93205"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419483.1"
                     /db_xref="GeneID:5003906"
                     /db_xref="JGIDB:Ost9901_3_93205"
                     /translation="MHAFAPFANASATPTVRQTTSKRQQTSSRSNAIARVVRANARSN
                     DAEDAVGDATTRRRAIATLFAGAVGTAGAVGSAKADVQDYLSNLLVEKPPPPKREILL
                     PDLEVKPLTREEGYRGTTGANKSKAQIEFAQFIAPIIEENIDMDFGSYFRLALADLGT
                     FSVVGKKNGLNGSIRFELDRPENAGLKPAFNSIEKIKKAVDAKTTQPITYADLIAIVP
                     HFAARRQFKADYMEEVGDDKNYEFLFIGTNPFLGAKIRIGRRDADGPDPEGLIPLVDG
                     NAEDFIAWFRRMGLGPNELAALAPYIYEDRQKGIDICAQDGTCARLLDVYETQRILGK
                     RAPGPAVTIIKNLKQCTDQCIPGGPLSVAPAQLDPLYVDYAFIKGGGEIPRISASGAY
                     PGSIYDSGSKLAMQLRASQAEQRAQAAAAAGN"
     gene            complement(<76439..>76918)
                     /locus_tag="OSTLU_33350"
                     /db_xref="GeneID:5003907"
     mRNA            complement(<76439..>76918)
                     /locus_tag="OSTLU_33350"
                     /product="predicted protein"
                     /transcript_id="XM_001419662.1"
                     /db_xref="GeneID:5003907"
     CDS             complement(76439..76918)
                     /locus_tag="OSTLU_33350"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419699.1"
                     /db_xref="GeneID:5003907"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="JGIDB:Ost9901_3_33350"
                     /translation="MASVALARLGEERRNWRRDHPPGFFARPEKTASGETNLFRWRCS
                     IPGARGTRWEGAFVPLTMEFPREYPAKPMKCKFPAGFYHPNVYPSGTVCLSILNEDEG
                     WRPSVTVKQVALGIQELLDNPNEKSPAQSDAYVTYTTDRAKYERRVREEVAKYPPPE"
     gene            <77019..>79247
                     /locus_tag="OSTLU_16659"
                     /db_xref="GeneID:5003637"
     mRNA            <77019..>79247
                     /locus_tag="OSTLU_16659"
                     /product="predicted protein"
                     /transcript_id="XM_001419447.1"
                     /db_xref="GeneID:5003637"
     CDS             77019..79247
                     /locus_tag="OSTLU_16659"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419484.1"
                     /db_xref="GeneID:5003637"
                     /db_xref="InterPro:IPR000413"
                     /db_xref="JGIDB:Ost9901_3_16659"
                     /translation="MARGAHARTRSMRALAVTLTLTLSRWRVGAAMTTDGLTSSDHRS
                     RRARGDEDARRARGRPATWTACAGPSRAALELAWRAETHASVYATPLAEDVDRDGRGA
                     AVTQTTSARVRAHDGATGIDLDGESWGARLGAASRGGVVRIGEAYASASLAGEARTFD
                     GERTRAVARLAPLAMAVDWFGDDGSGKSDAGDPREVERRHEARRRAPGSRRLLDVEDE
                     DEEEEPTTMSAEEEARSDRGWDAIDSGGDSTRDVASGSVEARRAVDGRVFVDAHALCT
                     PAVGDVDGDGEPELVLAVSYYFDSSVRFEDDVDPKQYAATALVVLNGEDLSTKRSIAL
                     DQSAATALFKARAYAPPTLVDVDGDGRLDIVIGTYAGVLHVVDGVSGNPLPGWPRRLG
                     QMEAQVTAADVDSDGDIELIACDVRGTVAVFKSNGVELWNKHVESRIAVAASVGDVDG
                     DDEIEIVVGDTSGAVHAFRAKDGTAREHWPVYVGDKILAPIVLTKLRQTKRGLDVIVA
                     THDGVVHVLEGRSRCRDVFDIAEKIYAAPFVTSFAGFGELDVIISTMEGHVRSFKAKG
                     SKFNALALTSSDHVSRYDYFGVALYDRTYRVIRGTYVDVVYEIIDRRVLDHAKARKSS
                     LAPYKVAITVTSLDGFKKIVSARHDRAGRYTLRVGVPSTKTRGEIRVRVQDVNLIADE
                     DAYSVSFHENYEIALKWLVALPFLLASAAAIRRASEDALEMDVFGASASIPTTTKGMH
                     EE"
     gene            complement(<79256..>79861)
                     /locus_tag="OSTLU_33352"
                     /db_xref="GeneID:5003908"
     mRNA            complement(<79256..>79861)
                     /locus_tag="OSTLU_33352"
                     /product="predicted protein"
                     /transcript_id="XM_001419663.1"
                     /db_xref="GeneID:5003908"
     CDS             complement(79256..79861)
                     /locus_tag="OSTLU_33352"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419700.1"
                     /db_xref="GeneID:5003908"
                     /db_xref="JGIDB:Ost9901_3_33352"
                     /translation="MAKKDPYARLRELIKRRASQTHDCLETCLENVSRGPQRDADGLV
                     CSKLAELGYLEQLKEARRLDFPWNEWTSANAAMNGHLKCLKYAHERECPWDWRTCYYA
                     TRNGHLECLKYAHEHGCPWDERTCMNAARSGQLECLKYAHENGCPWNEWTCALAAMDG
                     ELECLKYARERGCPWDETQEMAAENGHEFMSMDTYVQYTNN"
     gene            complement(<80306..>80734)
                     /locus_tag="OSTLU_7997"
                     /pseudo
                     /db_xref="GeneID:5003638"
     CDS             complement(<80306..>80734)
                     /locus_tag="OSTLU_7997"
                     /pseudo
                     /codon_start=1
                     /db_xref="GeneID:5003638"
     gene            <80819..>81508
                     /locus_tag="OSTLU_33354"
                     /db_xref="GeneID:5003639"
     mRNA            <80819..>81508
                     /locus_tag="OSTLU_33354"
                     /product="predicted protein"
                     /transcript_id="XM_001419448.1"
                     /db_xref="GeneID:5003639"
     CDS             80819..81508
                     /locus_tag="OSTLU_33354"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419485.1"
                     /db_xref="GeneID:5003639"
                     /db_xref="JGIDB:Ost9901_3_33354"
                     /translation="MTPTPIFGRVFLGARAPTRADARLACEHGLRCGHNYPSELVGTS
                     DCDEEAPGQRARLEGQRRRSWAIDRTRARVGRGARAYERAVKALKSWEHFDLGWARVS
                     RESGTAVGDAVCVEARVAGVWMRNPLRIVELREREKRASGGASSSSGARAKARFAFAH
                     GTLGGHLLAGEERFSVELAEDGEVFYEAYAFSRPAHALSVVSYPFVRLLQKRFHWDSS
                     RAMRKILSEAE"
     gene            complement(<81602..>81826)
                     /locus_tag="OSTLU_9218"
                     /db_xref="GeneID:5003909"
     mRNA            complement(<81602..>81826)
                     /locus_tag="OSTLU_9218"
                     /product="predicted protein"
                     /transcript_id="XM_001419664.1"
                     /db_xref="GeneID:5003909"
     CDS             complement(<81602..>81826)
                     /locus_tag="OSTLU_9218"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419701.1"
                     /db_xref="GeneID:5003909"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="JGIDB:Ost9901_3_9218"
                     /translation="EHYAVLGVSSRATKADVSKAYKSLALKFHPDKAPSDAVRPASEA
                     LFKRVAEAYAVLKDASKRASYDATRIRRTHS"
     gene            complement(<83812..>85140)
                     /locus_tag="OSTLU_33356"
                     /db_xref="GeneID:5003640"
     mRNA            complement(<83812..>85140)
                     /locus_tag="OSTLU_33356"
                     /product="predicted protein"
                     /transcript_id="XM_001419665.1"
                     /db_xref="GeneID:5003640"
     CDS             complement(83812..85140)
                     /locus_tag="OSTLU_33356"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419702.1"
                     /db_xref="GeneID:5003640"
                     /db_xref="JGIDB:Ost9901_3_33356"
                     /translation="MPSFAGVGAGDVGDAATAFLTALDTSLARAWREEDRQWRKEERQ
                     WRREDLEFRVEERDWWELEHVHRDEQRKWRRQDVEQRVLENARWVWNRYAEKNRRDVE
                     EKGEQLRTTSNLSALISGFAVVALVELQFSDPTVKAFQSEALIAAYAGATAVTVALML
                     NAMVLCSFMLSNILRNGKSYVSEDEEAEFLYACRKFALSYAPGDTPPQPQRSFERYWE
                     TRCEADWRKAFRMFTYGVPMFLTTLTLSAWLKFWYSTVTCSIVTGVAAVAIGLWWRTQ
                     SAWGWHLMKRSEQQFSKSRYFPPEGLPFDWHARPRKKPTDSDLGSMRNNSGASDEDFF
                     AASPSVSRSESLSRAEPPSDASAARVDASTIAHHNGTTTKQNASGAKRDPYAGLKIDT
                     RLRAVAVEAVSDREREFLRDSSPRAIETTKREYEKVGLKSKLVDQRAGAS"
     gene            <85409..>86162
                     /locus_tag="OSTLU_35127"
                     /db_xref="GeneID:5003641"
     mRNA            join(<85409..85570,85812..>86162)
                     /locus_tag="OSTLU_35127"
                     /product="F-ATPase family transporter: protons
                     (mitochondrial)"
                     /transcript_id="XM_001419449.1"
                     /db_xref="GeneID:5003641"
     CDS             join(85409..85570,85812..86162)
                     /locus_tag="OSTLU_35127"
                     /codon_start=1
                     /product="F-ATPase family transporter: protons
                     (mitochondrial)"
                     /protein_id="XP_001419486.1"
                     /db_xref="GeneID:5003641"
                     /db_xref="InterPro:IPR001469"
                     /db_xref="JGIDB:Ost9901_3_35127"
                     /translation="MEKFDVAKTSPTMDRPSTPTTFASAPVEESAKGTADKLKLNFYL
                     PHEVAHDEEEVDMVLVPATTGDFGILPGHVPTVSQLRPGVVSVHLNDKDVKKYFVSSG
                     FAFVHADSTADICAIEAVPVEQLDGDAVRKGLAEHQAKFTNAKDDFEKANAQIGIDVC
                     NAMVAALDAK"
     gene            complement(<86213..>88552)
                     /locus_tag="OSTLU_33358"
                     /db_xref="GeneID:5003910"
     mRNA            complement(<86213..>88552)
                     /locus_tag="OSTLU_33358"
                     /product="predicted protein"
                     /transcript_id="XM_001419666.1"
                     /db_xref="GeneID:5003910"
     CDS             complement(86213..88552)
                     /locus_tag="OSTLU_33358"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419703.1"
                     /db_xref="GeneID:5003910"
                     /db_xref="JGIDB:Ost9901_3_33358"
                     /translation="MTLDLSREDQSTIDALKEELEKAWAMVDESHESELASKREASEL
                     KMEIERLTRDEDKLGGCETTTSDGLFMERASARRANSREIESLLSAKESLTAERDELL
                     EQTIRLREDIDKLSERTRKAESTKLDLDVELQNARDLSHASAMEVERQKRTKERLERE
                     MREVQERSEERDIEIREYKARITKADEMIIKLEKDTCLQERRTEAAQKELNVLASKSD
                     KLHRELDEARASNKSAEDANTAKMHEIRALNDEIKTLEREKESTLKKSTQLESKLRAA
                     EQTKLNADDAKNALKREIQLLKQRLEQQKRDLDNEQRRKEDLMRERDVLLKTTTQAQN
                     ATSRQQDLLRIHEAQRQTLENEIKSYKREQVKQEMQIKSLDQERAKLLADIAAAVRRQ
                     EKLEDDVHDRQSQIVDLRQELQDAESKIKQAEHAYDVVCAERNQQSKSLVEAQSQIAE
                     IKRDFKAKTVAMEGLHEELRMKDAVIAGERFEHRKLDKEHDALRRQNDKLNSTLRETQ
                     ESLKHTSDESKTLRSSVASLRESREAHRKQLDVIKRDRDVLNAQLVQRNQECALLYEK
                     VKVQQKILNQGQAEYRERVREIKTLKLRLASHAQELTSLREAAASIDALKHEVQTLGR
                     ELLHERTKVKALSEELENPMNVHRWRQLKGSDPTMYELIQKVQMLQRKLITKTEEVTT
                     KDILISEKTKVLAELRVVLSRQPGPRAFEELRETHAHIKEKSRQIKGLRSELKMFIAH
                     KDAYTHELTMLHDELALLRKKKSGVNGADRSIVIASAAG"
     gene            complement(<89074..>92392)
                     /locus_tag="OSTLU_16663"
                     /db_xref="GeneID:5003642"
     mRNA            complement(join(<89074..91171,91344..>92392))
                     /locus_tag="OSTLU_16663"
                     /product="predicted protein"
                     /transcript_id="XM_001419667.1"
                     /db_xref="GeneID:5003642"
     CDS             complement(join(89074..91171,91344..92392))
                     /locus_tag="OSTLU_16663"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419704.1"
                     /db_xref="GeneID:5003642"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="JGIDB:Ost9901_3_16663"
                     /translation="MSALSSVARARASGTTVRTRRRSRRARGTRRATNEDDADAGFDV
                     EIAEKPTHWRVVDGFVSDFANDLRAVYDGRTRDPLRVDPERFVWDYWHVPNQYTLLRT
                     PAEDYFGAERYGELEKALLEYGRRELGCSAITPVWMSCYVHGMRQELHADVPHGPWAF
                     VLSLTKNDAEDGSYGAHFRGGETQIMRPERLNYWKNFDAGEVVERSQIMETIAPTFGR
                     LVAFDPRLPHGVTEVFGTQDPRHGRLVLHGWFKDPEPSFSGALTEEDASPTLEGALGE
                     LYGRLVELPRASGMVCAALTVAPDGAVTNLRWTCDTLTPIPLPELPSETDIRDAIMLD
                     IASALLELKFPARDADTEMTPTASDGADDDIVDVHAFKTPRGVVRVRTRRPKLFPEDT
                     STAECDETGRVAWRALPALCAYLASDEGYSIVVERSRVLELGAGLGTPGMLCWLSGAA
                     RETTLTDGNADVASDLRRSIEMNRNFVDDNVLTSLGSATAGTLEWGRGDADDFARKTF
                     PLVVASDVVYSEASARDVLDVVHTKLERDNGMLLLAYVSRWAHVDRALYEAIVAGGWT
                     ATLIPVADFDELARKESLEGRPCLFEITRGGCGARGQIRARMPKRAREWFDAELNVLK
                     ITPADAFTERFADDLCSTLETHGGAIESLEINAKGPFRIHQDTLRCLLDVFAKHASRV
                     KLIRLKLCETWLDVDGWRALGDFLCESDVRDLEIIGEDVDEEILHAMTNSSGNVANSW
                     VSRLKSLKFSRCDRLNAQAIVALRQSWFPPPALARELECFEVSFCPIGDEGIKSICDI
                     EFVGLRELRLANVGVSAIGGADVASRLVARCEQLRNLDLSGNDCFDANGAAELSTYLE
                     TIGKSLVILDLSGCSLGDNGLIWLCEAPRGLKTLRRLETLRLGSNGIGDSAMPALANL
                     FQNGHFPMLKCCDLSMNVISWRGTYDFTEAFDVAAAAAGASPTPLEILSLRGNHIGDD
                     GIDAITDILPNLPHLHTLDVSDCDLTAVAVRRLAESSSSRTFAATLSRNPGIDRTAVA
                     ALAREFDDLAFARGLDGF"
     gene            <92490..>92783
                     /locus_tag="OSTLU_34929"
                     /db_xref="GeneID:5003643"
     mRNA            <92490..>92783
                     /locus_tag="OSTLU_34929"
                     /product="predicted protein"
                     /transcript_id="XM_001419450.1"
                     /db_xref="GeneID:5003643"
     CDS             92490..>92783
                     /locus_tag="OSTLU_34929"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419487.1"
                     /db_xref="GeneID:5003643"
                     /db_xref="InterPro:IPR003958"
                     /db_xref="JGIDB:Ost9901_3_34929"
                     /translation="MPPKGKTNLLAARIKRVMQKDEDVGKIAGPAPIVMGKALELFVK
                     QLVTTANDVAVLHGSKTVNGSHLKGAVAMVPEAFDFLSDIVEKAKDLGPPPDLR"
     gene            complement(93411..94762)
                     /locus_tag="OSTLU_50484"
                     /db_xref="GeneID:5003911"
     mRNA            complement(93411..94762)
                     /locus_tag="OSTLU_50484"
                     /product="predicted protein"
                     /transcript_id="XM_001419668.1"
                     /db_xref="GeneID:5003911"
     CDS             complement(93507..94658)
                     /locus_tag="OSTLU_50484"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419705.1"
                     /db_xref="GeneID:5003911"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="JGIDB:Ost9901_3_50484"
                     /translation="MEKKTTRARAGRANDADGHLRYALGDALTNEYKIISLLGEGTFG
                     RVLECWDAISERRCAIKVIRNVQKYRDAAMVEIEVLKTLAEGDASRRDGERFNCIALR
                     RAFDYQGHVCMVFDKCGPSLYDFLRSNRYKPFHPKTVQSFCEQTLVAVRYLHTLGLVH
                     TDLKPENILLMSSSYLENATYRVPVDHTIRLIDFGSTTFVERHHSAVVSTRHYRAPEI
                     ILGLGWSYPCDMWSIGCIMIELLTGEALFQTHDNLEHLAMMQHALESAIPVAVARRAP
                     KDKHSEFFTTNGSLNWPNDQTDNESYAALGKTGIVRNLIDKQLAGEARELFYDLISRL
                     LNFDPKRRLTSNQAVAHPFFSVNLDQMDWKINTRNGSQLRPKSLEKSRS"
     gene            <95695..>97047
                     /locus_tag="OSTLU_16666"
                     /db_xref="GeneID:5003578"
     mRNA            <95695..>97047
                     /locus_tag="OSTLU_16666"
                     /product="predicted protein"
                     /transcript_id="XM_001419451.1"
                     /db_xref="GeneID:5003578"
     CDS             95695..97047
                     /locus_tag="OSTLU_16666"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419488.1"
                     /db_xref="GeneID:5003578"
                     /db_xref="JGIDB:Ost9901_3_16666"
                     /translation="MAMAMAMATATATRARALETDAVMRAIDERAFATEEGARLAFTH
                     DVDAERRAIDASGAGVDSDGKGNPGMIYARVFDGNGASGFRLGGEDALCVALRAPPEA
                     RYFSFAPYVYRRGARVVSAQAGHSINNANAKRDGDVLIFVATHSRETFEAMRTAFGDA
                     GYDEGAVNLVPLFDDVRYGGGFGDFGDLLSISFRVAFWPSRLNATGEDALGEWSRLEW
                     PAFFARRASSGAARGGSTVSQALPTPTLNLTVEVDKQHESSTIVAPVVVVDGAARVGS
                     TTLVVMPVDHARCRRDPFYSPWSTAGVSVRSACFGATTDALYSISRDFMRVASLRQFL
                     IVVRGRDVVSRGRAAFTTIALYATGGPISSFASARDVRVLAAVDDRAFIVDERSSLFA
                     VAFGSSLAACARVAVPCVVAASPPARSTLFVVCRDYLNPRTATAPASRPALVVDAFAL
                     "
     gene            97242..98128
                     /locus_tag="OSTLU_33363"
                     /db_xref="GeneID:5003912"
     mRNA            join(97242..97357,97467..98128)
                     /locus_tag="OSTLU_33363"
                     /product="predicted protein"
                     /transcript_id="XM_001419452.1"
                     /db_xref="GeneID:5003912"
     CDS             join(97249..97357,97467..97780)
                     /locus_tag="OSTLU_33363"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419489.1"
                     /db_xref="GeneID:5003912"
                     /db_xref="InterPro:IPR007529"
                     /db_xref="JGIDB:Ost9901_3_33363"
                     /translation="MPSAAPCVACAAETSSYKCPTCRSPYCSVACYKSHRETTCEPVR
                     ASTAPAVAERANETREQPSRAFEEDSEDELGTRARREDLQRVADDASVREKLRSERLR
                     EIIRAIDAAKDGEKALAKAREDPEFRAFTEDALSLFER"
     gene            99682..>100817
                     /locus_tag="OSTLU_50546"
                     /db_xref="GeneID:5003913"
     mRNA            99682..>100817
                     /locus_tag="OSTLU_50546"
                     /product="predicted protein"
                     /transcript_id="XM_001419453.1"
                     /db_xref="GeneID:5003913"
     CDS             99813..100817
                     /locus_tag="OSTLU_50546"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419490.1"
                     /db_xref="GeneID:5003913"
                     /db_xref="JGIDB:Ost9901_3_50546"
                     /translation="MQVMRPSVPVIFNGICQLFELALVKTFNAFGRTEALLPESHDMT
                     PRLRGTLSRLGNSGGAMAIRPTIRGQGDVDILSSGNLYGLKERGIALESLSRVADEFK
                     RIKARVKRSLPLKDAALADRFYSHTVAAVDDLREHVYKNVASLLLNIEFCAEAIGDGD
                     PNFALVNSTFVGKYNIRETPSRHNKWVDDVQAELLQFTTKLACADVAPEALDVLWQHA
                     ASVIQDSLVDGFSKVKKCTDAGRALMALDVETLRGEFAKLAPSQSLAFDWRYVSTYIN
                     AFYVPEKDVEKWMQIHPEFSKKQKLALVAHNASADRDRRWTAKFRQDLLNAIETDTLL
                     "
     gene            <101010..>101243
                     /locus_tag="OSTLU_33365"
                     /db_xref="GeneID:5003914"
     mRNA            <101010..>101243
                     /locus_tag="OSTLU_33365"
                     /product="predicted protein"
                     /transcript_id="XM_001419454.1"
                     /db_xref="GeneID:5003914"
     CDS             101010..101243
                     /locus_tag="OSTLU_33365"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419491.1"
                     /db_xref="GeneID:5003914"
                     /db_xref="JGIDB:Ost9901_3_33365"
                     /translation="MTADDKKLHTHGFWARFWFGKKHKHQPSAPLPGYINEMMNPEHH
                     TGDSKNDLGEFIRRRSMDERCTPRTSASSEEEQ"
     gene            complement(<101801..>102220)
                     /locus_tag="OSTLU_10568"
                     /db_xref="GeneID:5003915"
     mRNA            complement(<101801..>102220)
                     /locus_tag="OSTLU_10568"
                     /product="predicted protein"
                     /transcript_id="XM_001419669.1"
                     /db_xref="GeneID:5003915"
     CDS             complement(<101801..102220)
                     /locus_tag="OSTLU_10568"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419706.1"
                     /db_xref="GeneID:5003915"
                     /db_xref="JGIDB:Ost9901_3_10568"
                     /translation="MVFHALDLGLSYKKATGTKLVEGNVMVHDAARALFRAPFACASH
                     DGNDVFNYGNQAALELWEMEWDAFVGMSSKKSADEADEATQAERRALLDRAASDGVIM
                     NYSGVRVSSRGAKFRIEDATVWTMKDGDGNKTGQAVRF"
     gene            <103527..>104447
                     /gene="CYN14"
                     /locus_tag="OSTLU_16669"
                     /db_xref="GeneID:5003579"
     mRNA            <103527..>104447
                     /gene="CYN14"
                     /locus_tag="OSTLU_16669"
                     /product="Peptidyl-prolyl cis-trans isomerase,
                     cyclophilin-type"
                     /transcript_id="XM_001419455.1"
                     /db_xref="GeneID:5003579"
     CDS             103527..104447
                     /gene="CYN14"
                     /locus_tag="OSTLU_16669"
                     /note="Peptidyl-prolyl cis-trans isomerase (rotamase),
                     cyclophilin type (PMID: 15051864, 15047905); C-terminal
                     domain of unknown function; no clear ortholog in
                     Viridiplantae, but distantly related to CM271C in
                     Cyanidioschyzon; location ?"
                     /codon_start=1
                     /product="Peptidyl-prolyl cis-trans isomerase,
                     cyclophilin-type"
                     /protein_id="XP_001419492.1"
                     /db_xref="GeneID:5003579"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="JGIDB:Ost9901_3_16669"
                     /translation="MTKFEPLAKGERGRDRARPSAAERRSRMETFKRTGAHPELEIDP
                     DDARRAKRLANVARKNASNVKAFVDVEVAGENRGSVVIEVLEEAAPRAARRFAERLEA
                     TEGDRDGVSYRDSCEMTTVDDELRVSFGVSGKRVKTTIEVEGELTHAAAGVVGVDRRS
                     GEFCVTTAACESLDESAQVVGRVISGLEILRALTHREKGEKVPTPVRVTACGVVRGGA
                     DVSALVGVAARGRAEAAAKARAEAEKIRNESQHDTLKRLRAESAQKGAEMNEIVRSTL
                     GKKLKEAPKKKPGAGMLDSMLGSSSSDSED"
     gene            complement(104490..105593)
                     /locus_tag="OSTLU_33368"
                     /db_xref="GeneID:5003916"
     mRNA            complement(104490..105593)
                     /locus_tag="OSTLU_33368"
                     /product="predicted protein"
                     /transcript_id="XM_001419670.1"
                     /db_xref="GeneID:5003916"
     CDS             complement(104507..105445)
                     /locus_tag="OSTLU_33368"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419707.1"
                     /db_xref="GeneID:5003916"
                     /db_xref="JGIDB:Ost9901_3_33368"
                     /translation="MIRVASSSASSARVCVVGARSLTGRLIAGMLARRGGDGVALVVE
                     DADSYVPRDMPEDVFERRFGTSAAAMMKCALVNENDDEAVERAMRASDVVIVAHESGA
                     RSEAAAASVRRGATKAKRVVALSRVGVNRRDENPFKEQNRPVQKMVKVGQMNLPIGGD
                     VDGSKGLLDSYAAAEATLERGAKELGYALTVVRSGQLRGNGPLLLGDYSARLVDNMYD
                     VKFQDLYLKRGDTSEGYTKRLNLAQFIAHVSTTRVDDAPDDVEVLSVVTKTNFFGEQS
                     LTPPTDRERRKGYDMAKGKAPAAIDVEIIDALLAEI"
     gene            <105812..107658
                     /locus_tag="OSTLU_33369"
                     /db_xref="GeneID:5003580"
     mRNA            join(<105812..105825,106022..107658)
                     /locus_tag="OSTLU_33369"
                     /product="predicted protein"
                     /transcript_id="XM_001419456.1"
                     /db_xref="GeneID:5003580"
     CDS             join(105812..105825,106022..107651)
                     /locus_tag="OSTLU_33369"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419493.1"
                     /db_xref="GeneID:5003580"
                     /db_xref="JGIDB:Ost9901_3_33369"
                     /translation="MASQRMNGQGAKFGRFVSIGRVGEPKPAQLPSERREGGDEDRSA
                     RPTPGRDEGRWRDENESIDPRRRESGDGGARRYDDGYGRERGYGDRDRGFGSASFDGG
                     ARRSRDDDGGYGGSWRSADRRMSGERAGRDYGSGGWQDRDDHRGFGRQARESPDREKS
                     WRRREEPATATATRPVATAPVVRRSLDVNHNAEGALDKLHIPHGAHEWGQEDDDFDDL
                     APPAWLLQDERGASGGDDRRAQHRVPEPRQSSRSPPTSRVKALVRPKGDGGHFNSAKL
                     PDHLKNLKREPGEEKKLWTPPEPVGGAVKKRPEKVHSTPPKAVPKVTPRSVPEPKTRR
                     SMDISPVSRTPPQPRKSSASKRQPSPSAPHLPPPHPLQQTPPPAPPGAPPPGASRAPP
                     PVPPGVPPPATRAPPLPPTPPPPLPPGAPPARPPLPAGPPPAMPPLDAALKAKLAVSE
                     KSAPAKAAKKKKKKSNISRTASSSENLEDAAENKTPPPKAKIVKGKSKGKNSKSSSHD
                     NLAAAAKKDGGSPPKPNLLPKAKDSPVGNASRAESKISI"
     gene            complement(<107746..>108474)
                     /locus_tag="OSTLU_33370"
                     /db_xref="GeneID:5003529"
     mRNA            complement(<107746..>108474)
                     /locus_tag="OSTLU_33370"
                     /product="predicted protein"
                     /transcript_id="XM_001419671.1"
                     /db_xref="GeneID:5003529"
     CDS             complement(107746..108474)
                     /locus_tag="OSTLU_33370"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419708.1"
                     /db_xref="GeneID:5003529"
                     /db_xref="JGIDB:Ost9901_3_33370"
                     /translation="MSLRARARLFLIALVVARVRFAAAAIDIANTSTVSSSVPVDARG
                     LRLDVFTYPVAPTRVPDVRGAAPAHTANVTSIDVSSLPLASGQTVDANALARFRGRLR
                     ANVTGAHLFALEANAGGALRVNGGVVASSESGGNITGWKYLEANVDVEIEAITYNGAS
                     GTFSAKLYWRAPLSAALAVVPAEHFYASADSCCSCKCGTKPCRVSSDQAVVECFDVVD
                     TSGVSSATAATSLESIFGVTTPYS"
     gene            complement(<108580..>110991)
                     /locus_tag="OSTLU_34710"
                     /db_xref="GeneID:5003581"
     mRNA            complement(join(<108580..109152,109318..109777,
                     109853..>110991))
                     /locus_tag="OSTLU_34710"
                     /product="predicted protein"
                     /transcript_id="XM_001419672.1"
                     /db_xref="GeneID:5003581"
     CDS             complement(join(108580..109152,109318..109777,
                     109853..110991))
                     /locus_tag="OSTLU_34710"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419709.1"
                     /db_xref="GeneID:5003581"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="JGIDB:Ost9901_3_34710"
                     /translation="MNEVFDSSGGESSEDEAERDEAKTTDVLSEDAVEAKTEVDDDDD
                     DDEAWAKKQTAKLSKTERLGTVNHDEIDYEPVKKNFYIEAKEIASMTKAEVKQLRVEL
                     DGIKCRGKKVPKPIKTWAQAGLNNRVHELIRRSGFEKPMPIQAQALPVIMSGRDCIGV
                     AKTGSGKTLAYILPMLRHINAQEPLASGDGPIGMIMGPTRELVTQIGKDCKRYGKAMG
                     FSAVSVYGGSGIAAQIGDLKRGAEIVACTPGRMIDLLTTGSGKITNLRRVTYMVLDEA
                     DRMFDMGFEPQITRILANLRPDRQTVMFSATFPHTMEALARAALDNPIEIQIGGKSVV
                     NSDIEQLVELRPEEDRFLRVLELLGEWYERGKIIIFVASQDKADSTTISDFKSDVCNI
                     LVATSVAARGLDVKDLRLVINYDTPNHLEDYVHRVGRTGRAGQKGTAVTFISEDEEKF
                     APDLVKALKESKQNVPQDVQAMADEFTRKRKEGLVGAAGSGFGGSGFKFNQEEQDLLR
                     KQKRDAARAAGLDVDDGESDSDEEPAAHTPGALVAKGGLTPAQIAQAAAQSVFAKMKQ
                     PQKQAAGAQNTKAIALAQSYALAHGASAGAAKAAALAAALNAQHAKTSRGPTQSGSHF
                     ETELEINDFPQFARYKVTHKDTLVQIMEHTGAAVTAKGQYAAPGRPLAPGDRKLYLLI
                     EGPTERVVKEGKNYVKNIIETAIAKQALPGAAGQPQGRYRI"
     gene            <112125..>113192
                     /locus_tag="OSTLU_34773"
                     /db_xref="GeneID:5003582"
     mRNA            <112125..>113192
                     /locus_tag="OSTLU_34773"
                     /product="predicted protein"
                     /transcript_id="XM_001419457.1"
                     /db_xref="GeneID:5003582"
     CDS             112125..113192
                     /locus_tag="OSTLU_34773"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419494.1"
                     /db_xref="GeneID:5003582"
                     /db_xref="InterPro:IPR004854"
                     /db_xref="JGIDB:Ost9901_3_34773"
                     /translation="MFSRFGVGQARFNASYRAYPVSFIDRPQLELGDKVILPPSALER
                     LTRMQIDDYPMLFEVTNAKEGKSTHCGVLEFVADEGVVYLPYWMMQNLLLGEGDIVKF
                     SYSTLPKGTYVKLQPQTQDFLDISNPKAVLETTLRQYTCLTVGDTFVIHYNNKQYHID
                     VIEAKPGDAIGVVDTDCEVDFAPPLDYVDPYGPDTTKFEDTNSGAINAPKTADKADAG
                     ASGDAATNGETLAAPQPVVNTFLAFAGGGHRLDGKAISEIAPKEVEIPTSSLNVTKEW
                     QQLRQGGVLGGETSKEPEKPAPDADIDRKRSGKVVFGGARAAAIARKKEKAAVAKKDD
                     SSKDKPTSTFQAFQGSGNKLR"
     gene            complement(<113284..>113814)
                     /locus_tag="OSTLU_33373"
                     /db_xref="GeneID:5003530"
     mRNA            complement(<113284..>113814)
                     /locus_tag="OSTLU_33373"
                     /product="predicted protein"
                     /transcript_id="XM_001419673.1"
                     /db_xref="GeneID:5003530"
     CDS             complement(113284..113814)
                     /locus_tag="OSTLU_33373"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419710.1"
                     /db_xref="GeneID:5003530"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="JGIDB:Ost9901_3_33373"
                     /translation="MASSEEMRILKDTTTKLRECAKRGAAATAVDLLVGLGREGVTPD
                     AFAATACISACVNGKNMELAQKVYDEIFEKEVCAPDEVAVAELAKGYLNMDPPGWGRA
                     MQLVNGAREKHDIALTSVTYNVLLNCCSASNDLLRAEEIVDRMVDEDVVADMWTLKAV
                     EKRRAIRAYVKKQLLV"
     gene            complement(<114123..>114716)
                     /locus_tag="OSTLU_93214"
                     /db_xref="GeneID:5003583"
     mRNA            complement(<114123..>114716)
                     /locus_tag="OSTLU_93214"
                     /product="predicted protein"
                     /transcript_id="XM_001419674.1"
                     /db_xref="GeneID:5003583"
     CDS             complement(114123..114716)
                     /locus_tag="OSTLU_93214"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419711.1"
                     /db_xref="GeneID:5003583"
                     /db_xref="JGIDB:Ost9901_3_93214"
                     /translation="MRAVTATTTAVLHAARAPCRAPCRASSPPPRASTSRRAFEADVA
                     DAAPRAISAVDPIAAAYVPTPIDPALLRDELVVLGAIGAMTAYWWLVLVPSARVRLAK
                     NKKSGELRAYLDDLARSDGKGLEKWFYAQWLTKIDPETRYLLRDDAPAAARRVETLED
                     VARAARRAPKFWSGDNPVLVGTALTIGLAALFSGVAP"
     gene            complement(<114843..>115661)
                     /locus_tag="OSTLU_33374"
                     /db_xref="GeneID:5003584"
     mRNA            complement(<114843..>115661)
                     /locus_tag="OSTLU_33374"
                     /product="predicted protein"
                     /transcript_id="XM_001419675.1"
                     /db_xref="GeneID:5003584"
     CDS             complement(114843..115661)
                     /locus_tag="OSTLU_33374"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419712.1"
                     /db_xref="GeneID:5003584"
                     /db_xref="JGIDB:Ost9901_3_33374"
                     /translation="MPTTEYRAHVTGDPETCACILRESWPDAAAWPRGQTLSFGTGAF
                     CDFTTLLATRRGHIRCLKYAVENGCALHPNLLREATDVPTQMQCFKYALELGLEVDYD
                     AVHTACQNTSVTRITLLIEAYQEQTKRRKRKREDDAKNMIVERGSAFIGAVCANAARG
                     QPGEVIQCIDFLRECGCGWSETATWNVARKGVVRVLKHLVENGCPWDDETLASAEKSG
                     DAETIAFAKRHDKKVKQRKSLETMFNVIESRKEQMTEQEYIDACRAAKDLHDSL"
     gene            complement(<115867..>117963)
                     /locus_tag="OSTLU_16678"
                     /db_xref="GeneID:5003585"
     mRNA            complement(<115867..>117963)
                     /locus_tag="OSTLU_16678"
                     /product="predicted protein"
                     /transcript_id="XM_001419676.1"
                     /db_xref="GeneID:5003585"
     CDS             complement(115867..117963)
                     /locus_tag="OSTLU_16678"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419713.1"
                     /db_xref="GeneID:5003585"
                     /db_xref="JGIDB:Ost9901_3_16678"
                     /translation="MRGGGVASARCAPIARALPRVDRARASTTARALPRVAPPWRAPV
                     ALESLGARRARGLVGTAAARAGRVVASASDDAEEDDVDRVVDANDFESEDADEGAVRA
                     ADEAVVGARVDADVDELLSSVRTTTTWGGDWAEFVIFLARLQALGYSGVNADEIVVAA
                     GDSKTPEWARGVSGGGDDAAAGADSESKFESDEEDLTPSDPGEIKRLALSFARDRPDL
                     FSRLPESLVYQLIDWPLPRRLNNRKLNAGLQRLRASMSMDVSHLRGKCSACDKLQDRQ
                     ENPALQLSDLLRVLLVLNDIDDPDEFADLPSKELASDCVRRLLRLAESPKPPPEEMPI
                     DTSKVSTAKSSTGRRSFDDRPPRYDDRGRGRGRGDSFRGQRRDDWGRGGGSYERRDDR
                     APRFERRDDRGGYERRRDDGPPRFERRDRDDRREEFGSRFDDRRSDDRFGDRGGRGRG
                     GYEGRGGRGGRGRGFDDDRRQSFDRFDDRPPRFERRDGGGRGGDFGGRFDDRGGRGGG
                     RFEDRGERFGGRDGGRFGGRGGDRFGDRDGSRGGGRFGDRGGGRFGDRDGGRGGGRFG
                     DRGGRGGRDSFRNRDNFDDRPPRRSFDDRRSEDRGEFGRRFDDRRPERDSFRPRERFD
                     DDSRPRYDNEGYRARPQRRSFNDDDRRSPPRDDRRRSFDDGRRPPPRDSGERRPADDV
                     QVWRQDAGDDVDRGGW"
     gene            complement(<118169..>119797)
                     /locus_tag="OSTLU_33376"
                     /db_xref="GeneID:5003586"
     mRNA            complement(<118169..>119797)
                     /locus_tag="OSTLU_33376"
                     /product="predicted protein"
                     /transcript_id="XM_001419677.1"
                     /db_xref="GeneID:5003586"
     CDS             complement(118169..119797)
                     /locus_tag="OSTLU_33376"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419714.1"
                     /db_xref="GeneID:5003586"
                     /db_xref="InterPro:IPR000031"
                     /db_xref="InterPro:IPR003135"
                     /db_xref="JGIDB:Ost9901_3_33376"
                     /translation="MLAIAGAPMGVRLKALDPTERAPASIAATQVVGSFRDKAAVKAF
                     AETCDVVTVEIEHIDVEALRELSAAGVDVQPTPETLATIQDKYAQKVHFTNAGVPLGP
                     YADCPNEAALQSAASEFGFPLMLKSKRLAYDGRGNAVAKTAADLADAVAKLGGFEQGL
                     YCEKWVPFEKELAVMVVRAKNGETRAYPVVETVHENNICDTTTTPAPIPNKVAEAVQA
                     AAKRAIGSFTGAGIFGVELFLLKDGSILLNECAPRPHNSGHYTIEGCACSQYENHLRA
                     ILGWPLGDTSLKVGGAVMKNILGDGDGDEAMGRAHRLMGAALATPGASIHWYEKPDMK
                     LARKMGHLTVVGPSAAVATERLDTLLRAASGDKTPPKKAAQVGIIMGSDSDLPTMSAA
                     AEVLESFGIGCEVTVISAHRTPERMNEYARSAHTRGLRAIIAGAGGAAHLPGMVAAMT
                     PLPVIGVPVPLKYLDGMDSLLSIVQMPKGVPVATVAIGNSANAGLIAARIVAAFEPDV
                     CSKMLAYQDDMENVVLNKASKLEELGYGAYLDQM"
     gene            120441..122283
                     /locus_tag="OSTLU_46664"
                     /db_xref="GeneID:5003587"
     mRNA            join(120441..122140,122218..122283)
                     /locus_tag="OSTLU_46664"
                     /product="predicted protein"
                     /transcript_id="XM_001419458.1"
                     /db_xref="GeneID:5003587"
     CDS             join(120517..122140,122218..122258)
                     /locus_tag="OSTLU_46664"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419495.1"
                     /db_xref="GeneID:5003587"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="JGIDB:Ost9901_3_46664"
                     /translation="MATARGDDDARAATTRREDDDDDDGTRARTRDARDAAMREELAK
                     RFPTCDWREARAMDDACLVLVRAAVAAERHGARALSCGARRVAGEDEDDASQRMARGG
                     SNSSSASAGTSFSREAYELEQLTAAVRGAGLKTPEETEYKLVFCGADVGGMLTRTMQV
                     VDRIGLEVKDAQAHKSVDGMALNFFTVVGYEGEDERALEEAVEAALVNEESEEKKPPV
                     PLIINAAPPKSGVKRRRDARARGGEAFSPSTSAEHHGKSQRAAASFGGRASSRRSHSR
                     SGSELSMNDSFNNTASATDTPGSEEATEEPMSEDNSDGALSVGSDIDSKKLQIGRKIG
                     EGTFGTLYHGIYPSRTREGRVVHIEVALKYVTLKRDDVKSARLDFFQEVKMLRTLKHA
                     NLVGYVGSVVEGSELCLVTEFMAKGPLLEYLRENGPMRKVEAIRVAVGITRGMTYLHE
                     VGVIHRDLRAANVLLSGSFDAKISDFGLARRVPRNRSRMTAETGTYRWMAPEVITHGE
                     YDVKADVFSFAITLWEIVTGGANPYGELNPLQAELLENRAAVAASF"
     gene            complement(122213..>123914)
                     /locus_tag="OSTLU_33378"
                     /db_xref="GeneID:5003531"
     mRNA            complement(join(122213..122490,122546..123753,
                     123863..>123914))
                     /locus_tag="OSTLU_33378"
                     /product="predicted protein"
                     /transcript_id="XM_001419678.1"
                     /db_xref="GeneID:5003531"
     CDS             complement(join(122609..123753,123863..123914))
                     /locus_tag="OSTLU_33378"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419715.1"
                     /db_xref="GeneID:5003531"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="JGIDB:Ost9901_3_33378"
                     /translation="MCVEDFEPLKLIGRGAFGEVRLVRQKSTGEIFAMKKLKKSEMVR
                     RGQVDHVKAERNLLAEVNSRAVVTLYYSFQDDQFLYLVMEYLPGGDVMTLLIRRDTLT
                     EEETRFYLAQTVAALETIHRHNFIHRDIKPDNLLLDKDGHMKLSDFGLCKPIDPAYQQ
                     AVLPEILENEAAMSRDGEGNLPNTIETDQKRAEELANWQKNRRRLAFSTVGTPDYIAP
                     EVLLKKGYGLECDWWSVGAIMFEMLMGYAPFYSDEPMTTCRKIVHWRHHLRIPDDATI
                     SPEARDLIERLLCDVDQRLGTSGGVEEIKSHKFFSGIDWDTLYTRKPPHSPVVSHQLD
                     TRNFEDFEEDESMRKKSELGETDAGKDSNFVGYTYKNVEVVGDQVVKVNPTRPSLTTL
                     FPSTKK"
     gene            <125623..>126426
                     /locus_tag="OSTLU_6704"
                     /db_xref="GeneID:5003588"
     mRNA            <125623..>126426
                     /locus_tag="OSTLU_6704"
                     /product="predicted protein"
                     /transcript_id="XM_001419459.1"
                     /db_xref="GeneID:5003588"
     CDS             <125623..>126426
                     /locus_tag="OSTLU_6704"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419496.1"
                     /db_xref="GeneID:5003588"
                     /db_xref="InterPro:IPR001737"
                     /db_xref="JGIDB:Ost9901_3_6704"
                     /translation="ARRWLGQHFLVDASVVTDAVEAARLGAGERVLEIGPGTGNLTNE
                     MLKRGARVLAVEKDRNLAEKLREGLCVEYKDAFELVEGDFLKWDGLATAFERATPETP
                     RAKVVANIPYNITTDVLKVLLPMGDTFEDMIFMFQEEVAQRLVRDDAGGGDYRAMSVR
                     VHYYSKPYYIRPVLRDCFMPPPNVESCLIGFKPKEPHELLPLNGTDKQFFTFVQACFA
                     QKRKMLRNNLKAVCDEATMDGAFALLDRGLKVRPQELTMEEYVKLFNFVR"
     gene            complement(<126495..>126767)
                     /locus_tag="OSTLU_33380"
                     /db_xref="GeneID:5003532"
     mRNA            complement(<126495..>126767)
                     /locus_tag="OSTLU_33380"
                     /product="predicted protein"
                     /transcript_id="XM_001419679.1"
                     /db_xref="GeneID:5003532"
     CDS             complement(126495..126767)
                     /locus_tag="OSTLU_33380"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419716.1"
                     /db_xref="GeneID:5003532"
                     /db_xref="JGIDB:Ost9901_3_33380"
                     /translation="MSDTLKKIQDFLRKTHDDALVKAKKPIAIVAMVLNIIFPGVGTL
                     VACVTANKTFEGLKCFAMMWLMCFVFFVGWVWSIVHGVQLFMKASA"
     gene            complement(<127856..>128287)
                     /locus_tag="OSTLU_10590"
                     /db_xref="GeneID:5003589"
     mRNA            complement(<127856..>128287)
                     /locus_tag="OSTLU_10590"
                     /product="predicted protein"
                     /transcript_id="XM_001419680.1"
                     /db_xref="GeneID:5003589"
     CDS             complement(<127856..>128287)
                     /locus_tag="OSTLU_10590"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419717.1"
                     /db_xref="GeneID:5003589"
                     /db_xref="InterPro:IPR001748"
                     /db_xref="JGIDB:Ost9901_3_10590"
                     /translation="RRLKGKQPPEGFDMIEHAIEDFENQMKDAVNEEHEGKRKNELSW
                     RIHRIHWEKNRFVFDLMYKRKALKRELYDYLCREKIADQALISKWRKPGYENLCSLLS
                     IQKSATNFGTASICRVPMASRAPQQRLTPNVKTGCISCCSGD"
     gene            complement(128526..129975)
                     /locus_tag="OSTLU_33382"
                     /db_xref="GeneID:5003590"
     mRNA            complement(128526..129975)
                     /locus_tag="OSTLU_33382"
                     /product="predicted protein"
                     /transcript_id="XM_001419681.1"
                     /db_xref="GeneID:5003590"
     CDS             complement(128550..129938)
                     /locus_tag="OSTLU_33382"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419718.1"
                     /db_xref="GeneID:5003590"
                     /db_xref="JGIDB:Ost9901_3_33382"
                     /translation="MAWGKSAPEGDRPSWLARIEANDAALRSVHVLRVRAFDEATQIA
                     TAKALEENEHVREFYASGHRVSAPAARAWAACLAINTSIKSMCVGDETFGDDGDDGTE
                     SALETTLRGAAHGAALERLDLEYKGVRDEHGRALGKCMAQCAMRELRLGRNEKLGAVG
                     YAATFNGASEGATLETLDLTDNALDTASASALGEFLKSPCPLKRLGLTRCAIGAEGLR
                     AVGAGLASRASVEALEMNGVKLGKGGAHACFGDGLFTIGTQKLSITAVEFVQCEIEDA
                     KDVEALDSFLAACPNLVSANLRGNAFGDAGLATLAKGAFGTRVPESLDLGACAITVDA
                     ADSLGFVLKASKSLALFDNAGLGDAGVAKIFGAGQGSSLTLLDLGAVGLTVEGLRAVV
                     KAFENPQTFSDLRTLVVGGNPGAQDDEWERLVNNLRAIRPELDVAWRAADGGDDSKLT
                     RDATGRVISVDN"
     gene            <130216..>130872
                     /locus_tag="OSTLU_16685"
                     /db_xref="GeneID:5003591"
     mRNA            <130216..>130872
                     /locus_tag="OSTLU_16685"
                     /product="predicted protein"
                     /transcript_id="XM_001419460.1"
                     /db_xref="GeneID:5003591"
     CDS             130216..130872
                     /locus_tag="OSTLU_16685"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419497.1"
                     /db_xref="GeneID:5003591"
                     /db_xref="JGIDB:Ost9901_3_16685"
                     /translation="MNPVRVRFIRDGLVGQYGDVLGGNGPGAALRGLKILDVGCGGGI
                     LAESLARLGAQVTAIDAGAANIAIARAHAELDPDLVKNLKYEAVTAEELVERGETFDC
                     VTSLEVIEHVTDPLEFTKSIAKLVKPKGALFVSTINRTARSFAFAILAAERVLGLVPP
                     GTHQFSKFLTPGEIAMMAGHANCEMVELAGMVYDPLRNKWSLSSDTQINFIAHCVKSS
                     "
     gene            complement(<130955..>131347)
                     /locus_tag="OSTLU_33384"
                     /db_xref="GeneID:5003533"
     mRNA            complement(<130955..>131347)
                     /locus_tag="OSTLU_33384"
                     /product="predicted protein"
                     /transcript_id="XM_001419682.1"
                     /db_xref="GeneID:5003533"
     CDS             complement(130955..131347)
                     /locus_tag="OSTLU_33384"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419719.1"
                     /db_xref="GeneID:5003533"
                     /db_xref="JGIDB:Ost9901_3_33384"
                     /translation="MDARAIASLACVELAAYKAALACERGAMVTRAVHSELVFCLSPT
                     RHISEAFRRFGGDENTRALIVCKFDANDEDLERVRSVVKGELVAFDARPAVDEAALKK
                     WYKVHENELEIGSLADAVLSRIAIRDVA"
     gene            <132271..>132591
                     /locus_tag="OSTLU_34652"
                     /db_xref="GeneID:5003592"
     mRNA            <132271..>132591
                     /locus_tag="OSTLU_34652"
                     /product="predicted protein"
                     /transcript_id="XM_001419461.1"
                     /db_xref="GeneID:5003592"
     CDS             132271..132591
                     /locus_tag="OSTLU_34652"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419498.1"
                     /db_xref="GeneID:5003592"
                     /db_xref="InterPro:IPR010625"
                     /db_xref="JGIDB:Ost9901_3_34652"
                     /translation="MSDEEARASAVPASAMLFAVHKHLQTRCAEKTSAFLKCKKGDQD
                     PEKCLRQGAAMTGCLVEVLRDLKATCGDELNAYAECLDYRSNNFEKCRREQEAFETKC
                     SLGK"
     gene            complement(132516..>134693)
                     /gene="MIF2"
                     /locus_tag="OSTLU_33386"
                     /db_xref="GeneID:5003534"
     mRNA            complement(132516..>134693)
                     /gene="MIF2"
                     /locus_tag="OSTLU_33386"
                     /product="mitochondrial translation initiation factor 2"
                     /transcript_id="XM_001419683.1"
                     /db_xref="GeneID:5003534"
     CDS             complement(132642..134693)
                     /gene="MIF2"
                     /locus_tag="OSTLU_33386"
                     /codon_start=1
                     /product="mitochondrial translation initiation factor 2"
                     /protein_id="XP_001419720.1"
                     /db_xref="GeneID:5003534"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="JGIDB:Ost9901_3_33386"
                     /translation="MAKGRDGTGATSATAREKPRVGYKGKKLTADEEEDDGDGKRSKK
                     TKEKISKYRKFSVAGKGTVRAKRKDAAGENAREARSLESPRAGGAAEIAEGTTLVELA
                     RVLEMETRDLETVLANLGESLASSEDAVPTDVMELVGLELNVDISVSPDPNADATEVV
                     RRRGVVAVMGHVDHGKTTLLDSLRKTSVAAGEAGGITQHIGAFVVELPGGHGSLTFLD
                     TPGHAAFSAMRQRGATATDVAVLVVAADDGVMPQTREAAAHIQAAGVPMVVALTKIDR
                     ENADPRRVKSEIGSMGIELEEFGGKVQCVPISAITGEGLAELEECLVLEADALELKAS
                     LSGKVNGVVLEAKLDKGQGPTATGLLRSGTLKVGSYVVVGNQYGKVRSLRNAKAEQIS
                     HVGPAEPFELVGLKGVPSAGDSITMVESESRAKRISEAREEREARMKGEDEEAAPANQ
                     SEIDPEERGHLNVIIKADVQGTAEAVRDALLGLASEAVGLKVVFMGVGAITESDISLS
                     AAIGAPVLGFNVREPPNSLAKLAKQKGVRIVRHRVIYHLLDEVGEMLTGLAPMEEHEQ
                     IEGEANVVQIFDMSGAKGNNATIVAGCVVGQGAMKAGEKFRLIRDGVCIHEELLDCSS
                     MRRHRLEVDAVGKGSDCGIALADVVDIRMGDVIQCVSLVRRPLRSVKVESGGARVVKG
                     D"
     gene            <135099..>136256
                     /locus_tag="OSTLU_33387"
                     /db_xref="GeneID:5003593"
     mRNA            <135099..>136256
                     /locus_tag="OSTLU_33387"
                     /product="BASS family transporter: sodium ion/bile acid"
                     /transcript_id="XM_001419462.1"
                     /db_xref="GeneID:5003593"
     CDS             135099..136256
                     /locus_tag="OSTLU_33387"
                     /codon_start=1
                     /product="BASS family transporter: sodium ion/bile acid"
                     /protein_id="XP_001419499.1"
                     /db_xref="GeneID:5003593"
                     /db_xref="JGIDB:Ost9901_3_33387"
                     /translation="MRRGRSVSTPREGRHRRRVDARSRASEDDPDGEDDTSDARGSDD
                     GVRAVKAWLRENFFFAGVGAAACASASPEFRDVVESFGGAAGGSWGSGGLEKYAIAAL
                     FFIAGVGLPVRALKEAASDVSLNAFTQAFIFVFPTIVIAAAAPVLIESGWLSENVVDG
                     LFVLACLPTTVGSGVAFTRSANGNVEAALLNSMAANLAGIFLTPALIHFYLGADSSVD
                     PIASSSKLLVQAFLPVALGMSLRLIPGVASAAEGGLKEPSKLLGDAILLAIIAKTFVT
                     AEQSEAGMLDFNSSAHLVSVLLVFMLLHKGSIFLAASRVGAFSREDVVCALYMGSHKT
                     LAFGLPLISTTFEGDPNLASYVLPLVIYHPLQIFASSLLARPLARYEKRRE"
     gene            complement(<136529..>136699)
                     /locus_tag="OSTLU_33388"
                     /db_xref="GeneID:5003535"
     mRNA            complement(<136529..>136699)
                     /locus_tag="OSTLU_33388"
                     /product="predicted protein"
                     /transcript_id="XM_001419684.1"
                     /db_xref="GeneID:5003535"
     CDS             complement(136529..136699)
                     /locus_tag="OSTLU_33388"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419721.1"
                     /db_xref="GeneID:5003535"
                     /db_xref="JGIDB:Ost9901_3_33388"
                     /translation="MTFTVKAARHVRKKATKGHTDTRPKKHRPSDRNRKAVEYPTVDP
                     ATAPAVMTVVSK"
     gene            <137320..>139362
                     /gene="HDS"
                     /locus_tag="OSTLU_12863"
                     /db_xref="GeneID:5003594"
     mRNA            <137320..>139362
                     /gene="HDS"
                     /locus_tag="OSTLU_12863"
                     /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
                     synthase, putative chloroplast precursor
                     (1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase)
                     (ISPG)"
                     /note="Has EST support. complete coverage"
                     /transcript_id="XM_001419463.1"
                     /db_xref="GeneID:5003594"
     CDS             137320..139362
                     /gene="HDS"
                     /locus_tag="OSTLU_12863"
                     /codon_start=1
                     /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
                     synthase, putative chloroplast precursor
                     (1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase)
                     (ISPG)"
                     /protein_id="XP_001419500.1"
                     /db_xref="GeneID:5003594"
                     /db_xref="InterPro:IPR004588"
                     /db_xref="JGIDB:Ost9901_3_12863"
                     /translation="MDERGVLMPTGKYCVNHAETVRRKTRTVHVGNVKIGSEHPIVKQ
                     TMTTSDTRDVEKTVAEVIRCADAGAEMVRITVQGMQEAKACKIIKETLVAKGYDTPLI
                     ADIHFAPKVAMMVAECFDKIRVNPGNFADGRKTFENILYETDEEYNAELAEIEEIFTP
                     LVLKCKERGVAMRIGTNHGSLSARTLSRFGDTPMGMVESAFEFARICRKHDYHNFVFS
                     MKASNPLVMVQAYRLLSHEMYKLGWDYPLHLGVTEAGEGEDGRMKSSIGIGALLLDGL
                     GDTIRVSLTEASELEIEPCTRLANLGMKACAENIGVEQFEDSVRDFKTFTRRTGDLPE
                     QKDSDAIDFRNILHRDGSVLAAVTTAQLASEDGFYRELGAKLAVGMPLRDIATCDSIL
                     LSEVPAASEEKALRSIRRLQEIGCGVVVPADLLRATPLENAIALVSADEVGAPLPAGA
                     ARKAVTLNGFETVEQLKAVAASDAVMVLIKTKDGESRLHSSRRIAEVMAQVGAKMPVI
                     HHMYMPTGDKSDIVIQSGSQVGGLLVDGFGDGVLIQYAGSDKDVSLDFLRTTSFGLLQ
                     GSRMRNTKTEYVSCPSCGRTLFDLQEVTAQIQEKTGHLPGVAIAVMGCIVNGPGEMAD
                     ADFGYVGGAPGKIDLYVGKEVVKRGIAMETACDELIQLIKDNDRWIEKEVEEAVAA"
     gene            complement(<139529..>140963)
                     /gene="CGS1"
                     /locus_tag="OSTLU_33390"
                     /db_xref="GeneID:5003536"
     mRNA            complement(join(<139529..140676,140810..>140963))
                     /gene="CGS1"
                     /locus_tag="OSTLU_33390"
                     /product="cystathione gamma synthase"
                     /note="Has proteomic evidence"
                     /transcript_id="XM_001419685.1"
                     /db_xref="GeneID:5003536"
     CDS             complement(join(139529..140676,140810..140963))
                     /gene="CGS1"
                     /locus_tag="OSTLU_33390"
                     /codon_start=1
                     /product="cystathione gamma synthase"
                     /protein_id="XP_001419722.1"
                     /db_xref="GeneID:5003536"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="JGIDB:Ost9901_3_33390"
                     /translation="MSAAMSAKARTVVKLSATTRKSRGGTGRRGATTRAANGEKPWGD
                     STQCVQNGERKEGRPRVSDSLTTPIVCTSTYHFKDTEELIAYQEGRYGSFEYGRYGNP
                     TTKACEEKIRQLEGGEDALLSASGMCTATTMLLALVPAGGHIVTTTDCYRRTRQFIQT
                     FLPKMGITSTVLDPSDYDGLEKALKENKCSLYFSESPTNPYLRCVDIERIVNLCKPTG
                     CLVCIDGTFATPCNSRALDFGADLVIHSASKFMGGHNDVLAGVIVGKKEAVAACRQFH
                     NILGGVIDPHAAYLVLRGLKTLSLRVERHNDSAMRLAQYLEKHPKIDKVHYPGLPSHC
                     DHEVAKKYMKGFGGVVSFEVKGDLWATAKFIDSCELPYIAPSLGGVESLIEQPTVVSY
                     WDQGPEKRAEIGIKDNLVRFSTGIEDYVDIEADIAQALEKI"
     gene            complement(141440..>142650)
                     /locus_tag="OSTLU_25015"
                     /db_xref="GeneID:5003724"
     mRNA            complement(141440..>142650)
                     /locus_tag="OSTLU_25015"
                     /product="predicted protein"
                     /transcript_id="XM_001419686.1"
                     /db_xref="GeneID:5003724"
     CDS             complement(141466..142650)
                     /locus_tag="OSTLU_25015"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419723.1"
                     /db_xref="GeneID:5003724"
                     /db_xref="JGIDB:Ost9901_3_25015"
                     /translation="MEDAPLLTRDGDGDRRHRSSRARASTSVFRPTFALGVTLACACA
                     LAKTNGVGRTIARDWMSGDDARERASANERGKMSAFGSAAALATSGDGTTPFAVVSDP
                     FVTGGGDDDGASEEYSLVRKSQMSSSGDIEVNHREDVEMIPRAAATMVHLTLLTACAQ
                     LGSLTFAPGAWEDVVGARVTTKSMSNDFLFSQAQEMTQTRCGTFEVDVMLGAGEQFGF
                     YLYPLDNTSDEATVSDIGCLHRGGGRCPKFATPSALEGMEVCTSVIEEGDDIFYNRVF
                     DGKTFTYVYGSCDEGCALKAPSGCPASHMPEVTTLDTGVCTDPAHAGIYNALCAQSCG
                     AGTTDCDASCRAASDAGVSLSCVPGARGADACRCAHVAANATTECTVPGYDCCTCESI
                     IV"
     gene            <142767..>144131
                     /locus_tag="OSTLU_34724"
                     /db_xref="GeneID:5003725"
     mRNA            <142767..>144131
                     /locus_tag="OSTLU_34724"
                     /product="predicted protein"
                     /transcript_id="XM_001419464.1"
                     /db_xref="GeneID:5003725"
     CDS             142767..144131
                     /locus_tag="OSTLU_34724"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419501.1"
                     /db_xref="GeneID:5003725"
                     /db_xref="JGIDB:Ost9901_3_34724"
                     /translation="MTTTRGRGRARAANATTTTTTRHRRRHRAVRARASEDANEASER
                     TTTTTTTTTTKVVVLGGTGRVGSATAAALVRGANGGVEVTLGGRSRERDAEAKARHRG
                     LANASFVEVDVCDKASVTRAIQGADLVINTAGPFQRRKSCAALEAALESGVKYLDVCD
                     DASYGAEAKKLSEKAKAAGVAAITCAGIYPGVSNLMARDIVESMKAEFRATEENEGKE
                     PEVEYVLYNYFTAGSGGVGTTILATSYLLCGEDVVCWEDGQRIVEKPASQRKVVDFGK
                     GVGRREVFLYNLPEVASTREIFGARTVKARFGTSPGIWNGAMVAIANLVPKSLLENQD
                     AMKGLANFSAPIVRSVDAIVGETTSIRVDVKLKDGKQSVGLYTHPRLSECVGTCTASF
                     ATAMLNGECAPGVWYPEEVEAISDRDALFERAKEGTSLFALNQAPWMVESKPVNLGFG
                     LYWT"
     gene            complement(<144284..>145312)
                     /locus_tag="OSTLU_35082"
                     /db_xref="GeneID:5003537"
     mRNA            complement(<144284..>145312)
                     /locus_tag="OSTLU_35082"
                     /product="predicted protein"
                     /transcript_id="XM_001419687.1"
                     /db_xref="GeneID:5003537"
     CDS             complement(144284..145312)
                     /locus_tag="OSTLU_35082"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419724.1"
                     /db_xref="GeneID:5003537"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="JGIDB:Ost9901_3_35082"
                     /translation="MVDAEATRPQRAEAHAPWVEKYRPRVVKDVASQEQIVGVLENAL
                     KTGNMPHCLFYGPPGTGKTTTALAIAKELYGPELYKQRVKELNASDERGISVVRNKIK
                     TFASQAVGAPAPGYPSPPYKILILDEADAMTGDAQSALRRMMETYSKVTRFFLLCNYV
                     TKIIDPIASRCAKFRFSPLAQETMGARLKFIGEQEGLEMSDDVFAMCSKHSGGDMRKA
                     ITLLQSAARLFAGKISGASIVEVAGHIPDEKIKKMYDLCREGKFEEAQAHMEDILRDG
                     FSGLKILDQYSDYVLEADCSDEVKAEIFIKLGEVDRFLAQGADEGMQLATLVSTSIKA
                     LAKMASAA"
     gene            <145834..>147012
                     /locus_tag="OSTLU_33394"
                     /db_xref="GeneID:5003726"
     mRNA            <145834..>147012
                     /locus_tag="OSTLU_33394"
                     /product="predicted protein"
                     /transcript_id="XM_001419465.1"
                     /db_xref="GeneID:5003726"
     CDS             145834..147012
                     /locus_tag="OSTLU_33394"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419502.1"
                     /db_xref="GeneID:5003726"
                     /db_xref="JGIDB:Ost9901_3_33394"
                     /translation="MREYWQKKPLLMRQAIPNFRPPLDGNEIAGLACEEDASARIFVR
                     EGDDEQSWRKKIGPFEESDLTSLPEDKPWSLIVNDLDVQAQPFGDMLELFNCFPRWRI
                     SDIQASVSPDGGGVGPHSDHFDVFLLQAEGEKVWAVADNEEYWPDNDAAFVPECEIRV
                     LKSFVEDDSFTLVPGDMLYLPPKIAHNGVATNSKPGVSVTLSIGFLAPTTDELVLSYT
                     QRASEKLKGSRWSDPWLKPVEDVGAISAESITYASEIIKRTYPKNDAEVARWFGCHTT
                     ARTGEDDDADENEVSIEELLAAWEHQGLVAREDLRFAFVEKVADDSLKNALFFANGEC
                     WDVVSPAAVKTATVIANRGELYEEDTQTEECDFDDEALKLALTLFERGYLYFPEDEDD
                     "
     gene            complement(<147029..>147892)
                     /locus_tag="OSTLU_33395"
                     /db_xref="GeneID:5003538"
     mRNA            complement(<147029..>147892)
                     /locus_tag="OSTLU_33395"
                     /product="predicted protein"
                     /transcript_id="XM_001419688.1"
                     /db_xref="GeneID:5003538"
     CDS             complement(147029..147892)
                     /locus_tag="OSTLU_33395"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419725.1"
                     /db_xref="GeneID:5003538"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="JGIDB:Ost9901_3_33395"
                     /translation="MGALPEALLARLAKRGIAVPSDGDGDGDGDDDDATTKRRREDED
                     EDEDEDGTGTDVDAKLPRGWRAKVDPTYGQTYYYNKALNKTQWERPVEAEKTRPPPPP
                     PPAATPLPPGWRATTDPASGREYFFNPHTQRTSWERPRDGATAVGMRRCSGCGGFGRG
                     LVKAHGYCLHCSRILGRYPPGVSSLDVVDNPFMTKQQRAKASTATGTARVETKASAVS
                     KPASVRRDIGPSGAQGNSNHERAPKRKAIAARAPARKESEPLDPMDPASYSDAPRGTW
                     GTGIDKSREAQ"
     gene            <148229..>150194
                     /locus_tag="OSTLU_94665"
                     /db_xref="GeneID:5003727"
     mRNA            join(<148229..149422,149572..149662,149717..149982,
                     150033..>150194)
                     /locus_tag="OSTLU_94665"
                     /product="predicted protein"
                     /transcript_id="XM_001419466.1"
                     /db_xref="GeneID:5003727"
     CDS             join(148229..149422,149572..149662,149717..149982,
                     150033..150194)
                     /locus_tag="OSTLU_94665"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419503.1"
                     /db_xref="GeneID:5003727"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="JGIDB:Ost9901_3_94665"
                     /translation="MEESDGCATSRDFASVKMEYFKTRAREALGNGNYKEAYATYTKC
                     LEELAPRDAGERAKLLCNRSMAYAKSANFKAALEDASAAVSLMPTFAKGWWRKATAHV
                     GLRQFPDALAAYRQSFECQDEGDAGVIDEHVKAMNKTITSFTREQLANWILETLQDME
                     NRELIEHAHLENVTSLEMAEGMFCQIKGINEGSKPRGDYYRFVQHWNVHGMSVPMAYT
                     QRASMYRHALCFMQARADAAAALTLLQDDASLSDKETEMTFTYKVDDFSPFKEDTVIT
                     KAWAWYEMGKAFEGRENGDTQAAAKCFSAITHLDTKYPMFTNAFKNVCSRMTDVEAGK
                     ILSDINDQYGVAEYGVRTVPDALATYVVTVSLLFKTGKLVGFNSKVRDSFRENVAKGA
                     NVIKEKKMLEKIQAHDLMLLGGAETEAAMGTASDVQGELKELKSEDLVDRINNLQGII
                     LSTLKSGKEIVVAKRPPTDMELPYRTYKLVYNDGTPVERVNKTGYQMSQVHYSAQGMH
                     KREVWAEMMDKSCRWHQSSSEIAVQALQVPKDAKKQDLDVCITPSTVRVSCRNTGRTY
                     LEVI"
     gene            <150401..>150886
                     /locus_tag="OSTLU_33398"
                     /db_xref="GeneID:5003539"
     mRNA            <150401..>150886
                     /locus_tag="OSTLU_33398"
                     /product="predicted protein"
                     /transcript_id="XM_001419467.1"
                     /db_xref="GeneID:5003539"
     CDS             150401..150886
                     /locus_tag="OSTLU_33398"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419504.1"
                     /db_xref="GeneID:5003539"
                     /db_xref="JGIDB:Ost9901_3_33398"
                     /translation="MNLELFKDKNAAPSDSWWERLFNSHGDIAFDDYDKDFTDLPTPI
                     AEVSVLVCLYLLFEHRTDQLHCARHSPSQPPKMRQVYCRREKRKNIRSAKPHANVMTS
                     ESARDKCAWLNFAGASICRGLSSTDAIPRRILWHNAASLRNSSMFSTILPQNDHNQRL
                     S"
     gene            complement(<150984..>152038)
                     /locus_tag="OSTLU_16696"
                     /db_xref="GeneID:5003540"
     mRNA            complement(join(<150984..151535,151589..>152038))
                     /locus_tag="OSTLU_16696"
                     /product="predicted protein"
                     /transcript_id="XM_001419689.1"
                     /db_xref="GeneID:5003540"
     CDS             complement(join(150984..151535,151589..152038))
                     /locus_tag="OSTLU_16696"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419726.1"
                     /db_xref="GeneID:5003540"
                     /db_xref="JGIDB:Ost9901_3_16696"
                     /translation="MTVMQVMMQPFGIMNALRGKISVPISATAALAAALTAPKSTALY
                     SFCGELTMSQSNSRHSRHFAEWWTLLVSSFMMFFSVTCFVLLETGRYEGIRAVFDTKP
                     WQNAAPLLEDSDELTKAESKLMCPFTGQEGSGTCPICHSIVSHNGYYHGDPPILHTVV
                     GDSILEHRLAMQASEIDDKPRLARVQLDNFIKYRGNFLFATISPSCKGCYMKAWCWTV
                     GYRMVWQSTILGFNTMLCSHLFGEEVLLFDLKSMLLCLSMFFSISTVCMLLSLLATAV
                     VFIREHTFMHTAEVPKFVTQDMGVVEVLLRIMADPRARYGVNPSKTYWSWLWTVKKA"
     gene            complement(<152242..155190)
                     /locus_tag="OSTLU_33401"
                     /db_xref="GeneID:5003728"
     mRNA            complement(join(<152242..154723,154852..155190))
                     /locus_tag="OSTLU_33401"
                     /product="predicted protein"
                     /transcript_id="XM_001419690.1"
                     /db_xref="GeneID:5003728"
     CDS             complement(join(152242..154723,154852..155141))
                     /locus_tag="OSTLU_33401"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419727.1"
                     /db_xref="GeneID:5003728"
                     /db_xref="InterPro:IPR002015"
                     /db_xref="JGIDB:Ost9901_3_33401"
                     /translation="MVTKKPNDAVAAASAKKGKNAAGDDKDDKNGDGVVGDGKSSTTK
                     NRKDKKNEVELSEEDAALKENLELMVMRASDPKAGVAKLALETMRREIRTATSSMTSV
                     PKPLKFLRPHLQTLKEVYDKTKNGENKLLLADIISLLSMTNAPVAGEIPESLKYRLLG
                     SKEDIGNWGHEYVRNLAAEIGTEYHRRIEQDGDKASMEDLMGLVHEIVPFHMQHNAEP
                     EAVDLLLEVEKLDILLDNVNDANYSRTCLYLFSCANYLPEPEDAIVLKTAHAIFMKVG
                     KMPDAMRVALKLCEQSIIEETFNACTNLAIKKQLCYMLARHGHPLKLDEGPCEVEEDN
                     LDMLQNIMSHSDLTKNYLMLARDLDVMEAKLPEDIYKSHLMEVRAPSGAAVDSARANL
                     AATFVNAFVNAGFGQDKLLTSSEAADGSTSNVSWIFKNKDHGKMSAAASLGSILLWDV
                     EGGLPQVDAYLYSEEPNIVAGGLLAVGLINTNVRNDCDPAYGLLYESVTKENSAVRIG
                     AIMGLGLAYAGTQKEEVSELLTEVIHDDSAPLEVVAFAALSLGLVFCGTCHEESVSTI
                     VQTLMMRPEKELDNTFVHFLCLGLGLLFLQRQAEVEATLEVAKTLPARISGYLQTVLD
                     VCAYAGSGNVLKIQSLLAKCGEHPEADEGDEWIADPQSVAVLGIALVAMGEELGADMA
                     VRAYDHLIQYGDAAVKKAVPLAFALLHTSNPKLDVTDLLGRLSHDSNEEVAQSACLAL
                     GIVGAGTNNARLASQLRQLSSYYYKEPSCLFLVRVSQGLVHMGKGLLTLSPAHSDRAL
                     VSNVALAGLIITAFAGLDMKHTILGKHHYMLYYLFVAAQPRMLMTVDEQGEPLQVSVR
                     VGQAVDVVGQAGRPKTITGFQTHNTPVLLSVGDRAELASEKYIPLTPVLEGVVILKKN
                     PEWVEEMEK"
     gene            complement(<155396..>157444)
                     /locus_tag="OSTLU_34867"
                     /db_xref="GeneID:5003729"
     mRNA            complement(join(<155396..157093,157184..>157444))
                     /locus_tag="OSTLU_34867"
                     /product="predicted protein"
                     /transcript_id="XM_001419691.1"
                     /db_xref="GeneID:5003729"
     CDS             complement(join(155396..157093,157184..157444))
                     /locus_tag="OSTLU_34867"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419728.1"
                     /db_xref="GeneID:5003729"
                     /db_xref="InterPro:IPR001656"
                     /db_xref="JGIDB:Ost9901_3_34867"
                     /translation="MSHAPSSASWRENDAIEHVEERLVGLELYANAAAGFDGVLKERY
                     SDFIVREIDIESGEAVVLNELSATCDVEIDARERKKFEAMKAKSIEEAMKEFEALCGA
                     EDARRLREFLATPGVTRRSQKTHDGKAETPQPLVLEPTTDKAKRTQIHQFFKKHFLLP
                     TDNVVESNEEEKEALKNLKKPSSSVRVHAAVKQGKKRTRVEAMDHRAVGNFWPEGVPE
                     HVRFAFCKENKESYEMLNVIARALKVNFKSIGVAGTKDKRGVTTQHVTVHRVRAKRLA
                     KLVLYGCKIGNYTYVDRQLGFGDHCGNEFEITLRGIDPDVVGNVEEAVRALKSSGTIN
                     YYGLQRFGSAGGKHATHKIGIELLRGEWQAAIDALLLPREGERDDVMKARLKWMETKD
                     PNETLKLMPRWCAAERCVLERMSKVRSTDLVGSLLAVPKQIRLMYIHAYQAYLFNRVV
                     SERIRKYGVNTVVEGDLVLEEGNCAGDEGEDDMNGDTRVSMPRVRVVTAEEAALGAID
                     SSLVVLPLPGNSITYPTNLGDVYDRFAAEDGISLNTTTHSVREFAINSFTGDYRRCFL
                     KPTNVSHTVISYADAAADLVLTDLDRINGITERTIEDGPLRAVTVKFTLPPSSYATMV
                     LRELMKANTSVSSHKRKTLDARAAASVE"
     gene            <157579..>158295
                     /locus_tag="OSTLU_16699"
                     /db_xref="GeneID:5003730"
     mRNA            <157579..>158295
                     /locus_tag="OSTLU_16699"
                     /product="predicted protein"
                     /transcript_id="XM_001419468.1"
                     /db_xref="GeneID:5003730"
     CDS             157579..158295
                     /locus_tag="OSTLU_16699"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419505.1"
                     /db_xref="GeneID:5003730"
                     /db_xref="JGIDB:Ost9901_3_16699"
                     /translation="MGASIEGEVDEIIARHRACVLRGRAFFVAWHGTLTLAFQAWSED
                     FARLKRALNEIDAMQAEAFGSKWPKISLGCLKSDDAGGRLTMEEYEALRDVCDGFRGR
                     AERDARVRASELKVVVFGSRCCERRVSVKRVKLRPEECGEEASRESVALVESVLSEGR
                     RDEEYLNRVNAPGHRACHYEQGSGVTLVADALEGNTSDVSDLTALLLEFRSAVEKILP
                     GRFRWFRDDSLHVTVRGLVN"
     gene            complement(<158556..>159257)
                     /locus_tag="OSTLU_5654"
                     /db_xref="GeneID:5003541"
     mRNA            complement(<158556..>159257)
                     /locus_tag="OSTLU_5654"
                     /product="predicted protein"
                     /transcript_id="XM_001419692.1"
                     /db_xref="GeneID:5003541"
     CDS             complement(<158556..>159257)
                     /locus_tag="OSTLU_5654"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419729.1"
                     /db_xref="GeneID:5003541"
                     /db_xref="InterPro:IPR002142"
                     /db_xref="JGIDB:Ost9901_3_5654"
                     /translation="ALNPETDQNSKIKKKHVFVLNFFGDVRASQAEQLREEVTGLLRS
                     AKKERGDEVVLRLNTGGGTVTGYGLAAAQLMRIKDAGLKLTICVEQVAASGGYMMACV
                     ADEIVASPFAVLGSIGVISEQPNVYERLQREGIEFQTVTAGKFKRTLTPTKKVTEEDL
                     EKSKKDIEDVLVLFKGFVAENRPTLDIDNVATGETWFGKDALSRNLVDKLKTSDDVLL
                     DLLSAGAEIFSVQLKQ"
     gene            <160621..161742
                     /locus_tag="OSTLU_33405"
                     /db_xref="GeneID:5003731"
     mRNA            <160621..161742
                     /locus_tag="OSTLU_33405"
                     /product="predicted protein"
                     /transcript_id="XM_001419469.1"
                     /db_xref="GeneID:5003731"
     CDS             160621..161679
                     /locus_tag="OSTLU_33405"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419506.1"
                     /db_xref="GeneID:5003731"
                     /db_xref="JGIDB:Ost9901_3_33405"
                     /translation="MRARRSHRAGTSSRSSTPTRRVVAARRGRRPALASDDATTTTAG
                     TGTGTGTTRAATTAPLAHELVQGALVRWSVEKPDGPHPPTCVLVHGILGSRRNLQSLA
                     KRLAEKFPSWQFLLVDLRNHGESNTALEKKPEGANTVQNAARDVLGVLNHLKIYPYTL
                     IGHSFGGKVAMSMVHQFGRALPRPVQVWVLDTVPGDVWCDDVGDHPRDTIRFCTTLDR
                     PIESRRSLVESLTGAGFTVEGAQWMTTNLRADGNGKFDWTFDLDGIAEMYASYEACDL
                     WPMVETQPAGLSLDFVQAERSAFVWTPEDVARIRGTGANVHLLRNSAHWVHIDNPNGL
                     LDILAPSFENMERNSKAR"
     gene            complement(<161772..>162113)
                     /locus_tag="OSTLU_16702"
                     /db_xref="GeneID:5003542"
     mRNA            complement(<161772..>162113)
                     /locus_tag="OSTLU_16702"
                     /product="predicted protein"
                     /transcript_id="XM_001419693.1"
                     /db_xref="GeneID:5003542"
     CDS             complement(161772..162113)
                     /locus_tag="OSTLU_16702"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419730.1"
                     /db_xref="GeneID:5003542"
                     /db_xref="JGIDB:Ost9901_3_16702"
                     /translation="MVAEGDIPSGTYQVSAWWAGARNDGKGNAPRCDSERQRGCEVRC
                     ELTGEGELVCEGIESGTYVVVNVADLDEACAVTFDGESIECEGAGEPLVSDTGDLDLK
                     DSSQHGIRMGG"
     gene            <162612..>163502
                     /locus_tag="OSTLU_88171"
                     /db_xref="GeneID:5003732"
     mRNA            <162612..>163502
                     /locus_tag="OSTLU_88171"
                     /product="predicted protein"
                     /transcript_id="XM_001419470.1"
                     /db_xref="GeneID:5003732"
     CDS             <162612..163502
                     /locus_tag="OSTLU_88171"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419507.1"
                     /db_xref="GeneID:5003732"
                     /db_xref="JGIDB:Ost9901_3_88171"
                     /translation="VTRTNATETTTHRKVRVLVIGDSGAGKTTLTRALVGGGRRGREE
                     HGRTSGCSAEVMRASEEGAEGTTGTRDAATYFVELWDVGGHRQYKRERGIFYDQINGV
                     IIVHDASMRASGARCEAWAREVATRGTFSAPTPTAESFASGEQPCVMYGFGGLPVPCL
                     IVANKVDLESAANDGFGRGDGLLRRALDFFGDKSRRRRSILPETIGEAARASASAAHR
                     RQPSFGATALAKLPPGGGLRTSATLGRIDVDVMHGFFRELVRRRYDAAVIDAGASRTS
                     ERLLHAKPAALVDDDLDDLT"
     gene            <163632..>164639
                     /locus_tag="OSTLU_88172"
                     /db_xref="GeneID:5003543"
     mRNA            <163632..>164639
                     /locus_tag="OSTLU_88172"
                     /product="predicted protein"
                     /transcript_id="XM_001419471.1"
                     /db_xref="GeneID:5003543"
     CDS             163632..164639
                     /locus_tag="OSTLU_88172"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419508.1"
                     /db_xref="GeneID:5003543"
                     /db_xref="InterPro:IPR002641"
                     /db_xref="JGIDB:Ost9901_3_88172"
                     /translation="MSSRAATQLTATSRASSASSRSGRRSLARASASRRVAASSSTST
                     ATDGVGFSAAGFFFPYHVGVWEELVALKVMRSDETPCAGASAGSLVAAMHCCGLTPAD
                     GKRILMDVLADCRANGVVGRVGAVLENALRKELPSDAHERCSRGNLFISVSSPMMRDG
                     KFALDGELVSAFESFDDLVGALLASCHIPLYCGWPARRYRGKWCVDGGWHNLTPTPPG
                     SERSVRVCAFPLLDAWRKAEPGDGKESGDVFAQQASFWAGWGDDDARNLLVAPDAAGG
                     KPEWDYSEAIRFALLPGSNDVLEEMIVMGRMDARRWAKSVGFDVKLAMRGAVGESKIT
                     M"
     gene            complement(<164652..>169544)
                     /locus_tag="OSTLU_33410"
                     /db_xref="GeneID:5003544"
     mRNA            complement(<164652..>169544)
                     /locus_tag="OSTLU_33410"
                     /product="predicted protein"
                     /transcript_id="XM_001419694.1"
                     /db_xref="GeneID:5003544"
     CDS             complement(164652..169544)
                     /locus_tag="OSTLU_33410"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419731.1"
                     /db_xref="GeneID:5003544"
                     /db_xref="JGIDB:Ost9901_3_33410"
                     /translation="MAPSPLLAHVARADGDGDDDDGATARVAARGLARELAEATTTGR
                     EDVARAVRTLCEATTHARAQDELARGIVAIARSGNASASALATELASGAASARTRANV
                     RALTRALVELCCAFGDGELAGECARGSGHPLVRALKAHSDAGAGLLEATASKLARGSI
                     SDFNALRQFVFRALLEHPAPAPRSSFAMLLHARLMGIASGRGENARAVLGVCVEALGA
                     YRAPTSESRSWIACAAAEIIDAIECRLFDVEDASAREVVPLLAEGLVRQTRAAARSGD
                     SVVPFVGALTRLSELGDVSVCGELLPCLSLVHSAEETSALLALLAPYFPTSGPARALG
                     AMHASAAFMLPGESGARLALSLATLRNDDSVRNVENSRLMGYATRDGFVSAALAANWD
                     DGDATETLAACIRNDVDVRSPSLELACLSHPVPSIRECAAETLGRKLGGKRPQGLSNI
                     TATLLHLRAACEKSSNARHAKSTLASLNALAAGASNFMAAPAVLRAISPLMSTNPGEK
                     SPDARLHALALRLLAEMWIHNRELGPRLRGALEEASHSHEREVTVGCAAAVAAAAKAH
                     PFRAAELVIPMQGCLKSDWPEAQALALEAIDSMCAHDALDFLPAFKVVTRHIPSLPQH
                     PLVARKWIRLIRHGGRDGASFPEATATLIDTVWNAIKTSKDARVRHEAWNSLSEYDPE
                     FIIENDSPTPAEIAASALSESFGEESFVGATRMLRTMTKHEASLLSRTALVARESQQV
                     SHPPPSDPLIYRVTQTLPKKLLDSQLCSCARLLLFRPHKGKSEATRSVDENSQRRSRA
                     EAYRTEFKRAIRQVFWSGSWHVNLVTRAWTRFARRWFDAEVSARTAENGLDELYAEVR
                     ASINATAMEALQDVSMPDELQNIALLLATPVLVGNGGLGAALVDLLLSLLEEKSSIVG
                     AERGLYVALGLAAGTLEDRGDAQRPNKVAEIMMKQISDCRIDGALTMGVTAEALGLMC
                     RELSSNVLPGGSSSSWRLDLVRRIYSFLGATLVALGEPFIDVLKVQPANDIISPPKGD
                     LSDAVCGVYTGLSRAACALDVFEDDKAMTNTLAIINWLIGATSCGRFPGSIALPVAVK
                     SLLNHRHNTESEVLALKALRTTHDSEQPAIRAVAGIILGVTLDHGCAIPIQTVQEIIA
                     RVTSTVRDDMATSFDRSIGVLSLSGVLGSAWDGHDVSVAGTFDEGAVFSAPLLWGGDK
                     SKIEAKRVLKTLESIAYAPGDIVSKALRDLTIWTLAGVSDRAAQIAVTIGPRSTDSKS
                     SVPKDTIIGFIMHALLDNVVSCPSREQLNGATLALDVLRELARLPNAGWSNALHRWWR
                     VATSSGDADKVEKNALQCACLRMCRAHPEASIGRDVLELLVALSDADFFNLAPETQRL
                     AMLSAPYACALRSETGASAIKRFTQMAFSPHASDGCVESLWNGLIDVSESETATAAVC
                     ELVSRLSLTDTRTLDAVSTCVSQFTSSVLREQVVKKLALDVKPIVCARLYNAGQVASE
                     TLTSLATWPKATRTVTLRAMVGHLTTSSNSLRAQMIHEAANLTDVDAIPCIAILAAAW
                     GPTSALLSMTSIEQCILALPYTLSHLLRGELSGMMETLVSCLLRNLNGKYSKVATDTL
                     LELRDDVTLALWSQIVDSTH"
     gene            <169720..>171870
                     /gene="CHR3514"
                     /locus_tag="OSTLU_35059"
                     /db_xref="GeneID:5003733"
     mRNA            join(<169720..170926,171011..>171870)
                     /gene="CHR3514"
                     /locus_tag="OSTLU_35059"
                     /product="predicted protein"
                     /transcript_id="XM_001419472.1"
                     /db_xref="GeneID:5003733"
     CDS             join(169720..170926,171011..171870)
                     /gene="CHR3514"
                     /locus_tag="OSTLU_35059"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419509.1"
                     /db_xref="GeneID:5003733"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="JGIDB:Ost9901_3_35059"
                     /translation="MRAVAASTPVDADATSPGVVRETPTKTTRARVASAHDAEARDAL
                     VFATETECERYAEATNGTARAASVTCDPFVSGKLREHQRAGARWMYRALHGIGEDAAS
                     EGGTRGVLLADEMGLGKSLQVLAVLWTMLRQGPCGKPTARRAVFVCPASLIGNWGAEF
                     TKWLGGVRVQASLAEGNAEAVDAACDRWCAEPAKGSKSSFDRWPVLVMSYETARRLAP
                     RVRAMKPELMVCDEAHRLRNAMGSQTMTALREINAPMRVLLTGTPIQNNLNEYAAVLD
                     FAQPGILGPLEDFQRDFTQPIQRQYERGASKEQIAQGRKVADELNRRTKGKILSRKSS
                     TNAAYLPKKTELVVLCRLTSAQRQAYEAGAKLVESWTSSDTSASSGAAALCAIGILRQ
                     TANEVDQILARTSGKSVDDLKAAMAKALPRDYAGGIDGSGKFTILRRMLEALKERGDP
                     TERVVVVSGYSASLATAEDICKKLNVTTSRLDGTVAVDLRTSIVKNFNSGQGGQVMLL
                     SVVAGGAGLNLVGANRLILMDVSWNPAHDRQAMGRIWRDGQTKPVTIYRLVSAGTVEQ
                     KVFERQLGKEVLKNTVESGYTGYEGDGFTTKDSLVGIVKFTGDELSEIVDWGRPLDVH
                     DACPLLGAARSHGAAFQVIDVDDGTAADEARANIPKKEPIEVRAKKLAPKRTAFEDLF
                     SAKRAR"
     gene            171934..>172785
                     /locus_tag="OSTLU_33412"
                     /db_xref="GeneID:5003545"
     mRNA            171934..>172785
                     /locus_tag="OSTLU_33412"
                     /product="predicted protein"
                     /transcript_id="XM_001419473.1"
                     /db_xref="GeneID:5003545"
     CDS             171973..172785
                     /locus_tag="OSTLU_33412"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419510.1"
                     /db_xref="GeneID:5003545"
                     /db_xref="JGIDB:Ost9901_3_33412"
                     /translation="MSEATDATRSSSGLAATCSRERSRAARTVLNEFFYPVADGARYA
                     LDLGCPFSHARDLFYEHETHKEPVRHSKLYWRSLYSGKVFKSEYYVDKHMERRHGDKI
                     PSTADVCLADYCDVLQCDKHAEYVKNGRGSKPTRCDEEQMSLVRDKCHEMLTQCFPNE
                     NGSTRDNAGKLNVYFTKYYCDQMTCADVDGVFELMSAHHDSPGVGYYIALAFLFFIVA
                     MYYLTVYSWTNGRRVSSDIKRARVRARASWSDYLPRPVARRFNLERRKRKTY"
     gene            complement(<173243..174191)
                     /locus_tag="OSTLU_33413"
                     /db_xref="GeneID:5003546"
     mRNA            complement(<173243..174191)
                     /locus_tag="OSTLU_33413"
                     /product="predicted protein"
                     /transcript_id="XM_001419695.1"
                     /db_xref="GeneID:5003546"
     CDS             complement(173243..173452)
                     /locus_tag="OSTLU_33413"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419732.1"
                     /db_xref="GeneID:5003546"
                     /db_xref="JGIDB:Ost9901_3_33413"
                     /translation="MDGVHLEAYVDDRGCACVALHCEKGSPVRDRRACVRALAERVGP
                     DVEAWDSTSTPWTILPYFKHPKCPV"
     gene            complement(<174298..>174771)
                     /locus_tag="OSTLU_16707"
                     /db_xref="GeneID:5003734"
     mRNA            complement(<174298..>174771)
                     /locus_tag="OSTLU_16707"
                     /product="predicted protein"
                     /transcript_id="XM_001419696.1"
                     /db_xref="GeneID:5003734"
     CDS             complement(174298..174771)
                     /locus_tag="OSTLU_16707"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419733.1"
                     /db_xref="GeneID:5003734"
                     /db_xref="JGIDB:Ost9901_3_16707"
                     /translation="MVCPNVDRHRVLALVDDLHEKHRFKDKDYKDVVEALSGKSDPLD
                     VSDAKVVKIYFDEHRVTWNRTDYAVRQFQNKILQVVDTLDDPESTCPARVNWACSSIE
                     RSTLADIADLVARHGCTHLLTHSCSCCYTEQVFIRKIELIQDGSRPHRQHVRWTE"
     gene            <175224..>175808
                     /locus_tag="OSTLU_34965"
                     /db_xref="GeneID:5003735"
     mRNA            <175224..>175808
                     /locus_tag="OSTLU_34965"
                     /product="predicted protein"
                     /transcript_id="XM_001419474.1"
                     /db_xref="GeneID:5003735"
     CDS             175224..175808
                     /locus_tag="OSTLU_34965"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419511.1"
                     /db_xref="GeneID:5003735"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="JGIDB:Ost9901_3_34965"
                     /translation="MTSRVGNPAVNADTKVYVGNLPYGCSWQDLKDHFSNAMGGESVR
                     FADILTSRDGRSKGCGIVTFNSSEDAKKAIETMHDTEIGERKIFVREDREGERGNDLR
                     NRIGPSATSPDASVYVGNLPWSTRWQELKDIFRKVGNVAHADVTMGFDGRSRGWGVVT
                     FMDPQCAQVAIERLNGTMLNDRALIVRRDERARS"
     gene            <175959..>181163
                     /locus_tag="OSTLU_33418"
                     /db_xref="GeneID:5003547"
     mRNA            <175959..>181163
                     /locus_tag="OSTLU_33418"
                     /product="predicted protein"
                     /transcript_id="XM_001419475.1"
                     /db_xref="GeneID:5003547"
     CDS             175959..181163
                     /locus_tag="OSTLU_33418"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419512.1"
                     /db_xref="GeneID:5003547"
                     /db_xref="JGIDB:Ost9901_3_33418"
                     /translation="MESRSDNDDIDAFVDRFERSLCLINDDIDGAYEEATTSKLLSET
                     QRTIESCGWTPRSMRLDDGDGWRTMTTDAFDRALAALLRARARTKSESTLRLWWLSVL
                     EITSARGVKSANDSSKKSDALEELCRTLVDDVARLAASKQAPDRERWGEIMEELALTT
                     PDVATREETLALAMRALYAIAPDVVLNCAREALKSRQSQATREAVYWLLFALSAVDPV
                     ADDACTQLLRLVVEFSPMKWAPSYRKSDFRHSLSTTLTVVTTRYLSRGRPSPGSVDVA
                     VVNKVLAEVVKWSNENEKKHNTAGLPLRAILIGLGLTQEVISADAIPIWRLLLESRVK
                     AGIEQKMKISSLLAAIRGVVMGISDQHITVMECAKQSLSACISAIKYGSGSEDIERPL
                     ALANCVMAIHGVNPVEGSNVLKMFLDETDESIRAASCISCAKMTQEMSADEVRSSSFL
                     CEYVDGVLPKYLTGLSASASAATIAGALQCSKFTSPKYIAPSSVEFACSWVKSDSVAV
                     RNAVEEYLLHVIRSNVSLRNATLQAVASAVLNMRDFAPAARLSAINVLVGVCKIWQDC
                     LQNGANSKCECSDERAEAAALLLVCDADFSVRTGAVQALREISNLRERVDSMNGDNAT
                     SRAALYPVLQKYLNITDIPTLIREISRTTALECAAVHTTTHAQAYQRIQAMMVAEGDG
                     KLLVVPVKPSEYRYNLWQNYMLFVCSTDGAAGGGGGLDARQVVTIGQRGSLAGLLQTV
                     IPRLGQSNVEVDAIMRLFQLVPAQSKATILSALLPLQSGLMRYTLMRRKRREDLNMVI
                     RFGELYQDYALHGVFASTADATKNLNAAIDFVLMVCSYLKTNAKAECSPTEIIQLRFS
                     AAAIIGAVLTDAEKVRALPVVTHAELWDNFYAWQESPNPKALDESGDSTSRMHVQTLI
                     DDLARDHTRKPTERDVGFASREALAALSLSEHFTRESAKKIFDWVNRLAELGDSKSLE
                     LSKRVVVEMLRSTTSVFEASLDFCYSASATVSRMYVVILAEMSDAVVDNLSCPQLISL
                     VLYMTMHEDDAIRSAAGVLLRAVNRECGLIDGHLPLQIDNKAQLIEECERLVKTDTQQ
                     IEDVLLEVWKRQLNKAKQMKSDSNPSHLSACLVPWISALHLPHLVAAGKADEVLLGLY
                     NVMTHSDESTWAELGELWSAIGVQARNIAPTLRFLQERTITSTDRDAISFRAAKAACG
                     WIARTSPQQVIDQLVYTISFRALESDDSDATKPLPQDSATSKISSADVGIILLSELAL
                     DHREDFRFHLPVLAHAVVVTLIVTHEQTVREHCGELLCNLAMGQTSEIRALKKKSPAY
                     RLGKLFVDDSSQAWTSGKIRTLINTLPHAIDLDENLPQRWANEARRWILRSPSFSLAC
                     ASAETLMSLNVPLDDEAFEALLAATCMCASMSGEVEDQRNNEMSKKLTQHLLKTLGAS
                     LCDMSAHATLMYTQVFWCGAMCLRTMDVSLYSSALDLSYLFLYKTLDHSTMAFDVITS
                     CAPLPRGSFYPDIPMVETYEELLSIVPAKMPSPEISWADFVLLVIKGLFQRETFVRAI
                     RVLAMLVPYLPDHDRWNGLQLNVLISYALIPLALVAVEVESSAVIGDSEARAIAHRLA
                     QGLHGDEPDLAKALAKFASIKHDPRGEFLASEFAATMARRQSNAAHLPAHCLREFSLC
                     SDSATAKKILQILSKAPKASKSFNRDFSGSWSADSASTIAAASYGVLLSARLETDNKG
                     AVPSCLEY"
     gene            complement(<181302..>181490)
                     /locus_tag="OSTLU_9692"
                     /db_xref="GeneID:5003548"
     mRNA            complement(<181302..>181490)
                     /locus_tag="OSTLU_9692"
                     /product="predicted protein"
                     /transcript_id="XM_001419697.1"
                     /db_xref="GeneID:5003548"
     CDS             complement(<181302..>181490)
                     /locus_tag="OSTLU_9692"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419734.1"
                     /db_xref="GeneID:5003548"
                     /db_xref="InterPro:IPR002696"
                     /db_xref="JGIDB:Ost9901_3_9692"
                     /translation="LLDFYKREVSPILPKSCRFVPTCSEYARQAYRKYGTSKGFVLTA
                     WRIMRCNPFGDKGYDPPMW"
     gene            <181891..>183132
                     /locus_tag="OSTLU_12867"
                     /db_xref="GeneID:5003736"
     mRNA            <181891..>183132
                     /locus_tag="OSTLU_12867"
                     /product="predicted protein"
                     /transcript_id="XM_001419476.1"
                     /db_xref="GeneID:5003736"
     CDS             181891..183132
                     /locus_tag="OSTLU_12867"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419513.1"
                     /db_xref="GeneID:5003736"
                     /db_xref="InterPro:IPR001048"
                     /db_xref="InterPro:IPR002478"
                     /db_xref="JGIDB:Ost9901_3_12867"
                     /translation="MSRDDGAKDKRPIVVIKVGTSSLLKTNDGCVHLSQLCALCETVA
                     NLKRHGYHVVLVSSGAVGAGMVKMGIKPSATKPSLARKQALAAIGQPYLMRYYTDVFS
                     SLGASCAQVLLTLENLSNRTQYQKAKQTFEQLFELGAIPVVNENDTVAVEELRFGDND
                     TLSAQVAALVEAQYLFLLTDVDGLYTSNPASDPAAKKIETVEDINALDVDVNSGAGSN
                     VGTGGMVTKLTAARIASAAGCQTVICLASVQGTAIMDVLAGKSGIGTRFLAAKKSARG
                     KKRWLLSVPIKGEVRVDEDGAKAVLNGMALMVSKCVAVEGTFGLQESVRILDENGAEL
                     GRGLSNYIIGAMRDFLQRGPATSDDEWEDDLDGPPELIHSNNVCITNAETLAKSFVLR
                     NIGTYGSMMMDGGASSGDDER"
     gene            <183648..>183995
                     /locus_tag="OSTLU_8744"
                     /db_xref="GeneID:5003549"
     mRNA            <183648..>183995
                     /locus_tag="OSTLU_8744"
                     /product="predicted protein"
                     /transcript_id="XM_001419477.2"
                     /db_xref="GeneID:5003549"
     CDS             <183648..183995
                     /locus_tag="OSTLU_8744"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419514.1"
                     /db_xref="GeneID:5003549"
                     /db_xref="InterPro:IPR002777"
                     /db_xref="JGIDB:Ost9901_3_8744"
                     /translation="LSQEVNLARGKIGELAVSLREHVNVLENVKNLDPSRRCFRSVGG
                     VLVERTVKEVIPAVESNAANLRRAIEAIKEQCAVKEAELEALRKKYKIRVQGEDAMPT
                     DARESSSGGGVLA"
     gene            <184073..>184591
                     /gene="CYN19-2"
                     /locus_tag="OSTLU_35139"
                     /db_xref="GeneID:5003550"
     mRNA            <184073..>184591
                     /gene="CYN19-2"
                     /locus_tag="OSTLU_35139"
                     /product="Peptidyl-prolyl cis-trans isomerase,
                     cyclophilin-type"
                     /transcript_id="XM_001419478.1"
                     /db_xref="GeneID:5003550"
     CDS             184073..184591
                     /gene="CYN19-2"
                     /locus_tag="OSTLU_35139"
                     /note="Peptidyl-prolyl cis-trans isomerase (rotamase),
                     cyclophilin type (PMID: 15051864, 15047905); cytosolic;
                     similar to At4g38740 (ROC1, AtCYP18-3) and At2g21130
                     (AtCYP19-2)"
                     /codon_start=1
                     /product="Peptidyl-prolyl cis-trans isomerase,
                     cyclophilin-type"
                     /protein_id="XP_001419515.1"
                     /db_xref="GeneID:5003550"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="JGIDB:Ost9901_3_35139"
                     /translation="MDDPIVFLDIAIGARPIGRIEIALDVAAAPKTCENFRALCVGER
                     ASPSTRKPLHYASSVVHRVIPGFMIQGGDFTNHNGTGGESIYGRTFRDENFTLKHDAR
                     GVVSMANAGANTNSSQFFITLAATPHLDGKHCAFGRVLRGMDVVDAVEAVGSQSGATS
                     EAVAVTDSGQLS"
     gene            <184824..>185447
                     /locus_tag="OSTLU_33423"
                     /pseudo
                     /db_xref="GeneID:5003551"
     CDS             join(184824..185003,185040..185447)
                     /locus_tag="OSTLU_33423"
                     /pseudo
                     /codon_start=1
                     /db_xref="GeneID:5003551"
     gene            complement(<185658..>185996)
                     /locus_tag="OSTLU_16713"
                     /db_xref="GeneID:5003552"
     mRNA            complement(<185658..>185996)
                     /locus_tag="OSTLU_16713"
                     /product="predicted protein"
                     /transcript_id="XM_001419698.1"
                     /db_xref="GeneID:5003552"
     CDS             complement(185658..185996)
                     /locus_tag="OSTLU_16713"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419735.1"
                     /db_xref="GeneID:5003552"
                     /db_xref="JGIDB:Ost9901_3_16713"
                     /translation="MDEHVVPLLDEASIAYKIDIVPYDTNVSSVGEIMVEKSTLIDDA
                     VAVVLASSSKGRIREFFIGSVCNYCLHRCKKPVIVYKPSEADEKAEEERVQTTQKAAS
                     SDDKEKAKDK"
     gene            <186861..>187526
                     /locus_tag="OSTLU_12869"
                     /db_xref="GeneID:5003737"
     mRNA            <186861..>187526
                     /locus_tag="OSTLU_12869"
                     /product="predicted protein"
                     /transcript_id="XM_001419479.1"
                     /db_xref="GeneID:5003737"
     CDS             186861..187526
                     /locus_tag="OSTLU_12869"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419516.1"
                     /db_xref="GeneID:5003737"
                     /db_xref="JGIDB:Ost9901_3_12869"
                     /translation="MRALGVDDAARALSQGAEARVFALEFCGRDAICKQRFAKKYRLP
                     ALDERLTRARLVGEARAIVRARKLGVRAPMVLHVDANEACVYMERVAGVALKEALRRE
                     TCTREDIARYGREIGEAISKLHDGGLVHGDLTTSNFMVRDDDGAVVVIDFGLSYPSAV
                     PEDKGVDLYVLERAINAAHPSQTELFDEIIATYKKTSKMWCATLNRFAEVRARGRKRS
                     MVG"
     gene            <187674..>188813
                     /gene="TAB2"
                     /locus_tag="OSTLU_88180"
                     /db_xref="GeneID:5003669"
     mRNA            <187674..>188813
                     /gene="TAB2"
                     /locus_tag="OSTLU_88180"
                     /product="psaB translation factor"
                     /transcript_id="XM_001419480.1"
                     /db_xref="GeneID:5003669"
     CDS             <187674..188813
                     /gene="TAB2"
                     /locus_tag="OSTLU_88180"
                     /note="Required for translation of chloroplast psaB mRNA;
                     conserved in Chlamydomonas, higher plants and
                     cyanobacteria"
                     /codon_start=1
                     /product="psaB translation factor"
                     /protein_id="XP_001419517.1"
                     /db_xref="GeneID:5003669"
                     /db_xref="InterPro:IPR009472"
                     /db_xref="JGIDB:Ost9901_3_88180"
                     /translation="LAIHTSYPTARHRATSIRVFAFPRPSARAHRTMEAMSCVTRARI
                     ACVAPTASKPRASCAAARRSMTTPIAQPRSSTKRTAVTSNATNEATESEIKKLTTDWQ
                     IDFCSRPLRDDRGKKVWELLVTDDARTFEHAEYFPNNRINSVELARALERVMAEKKEK
                     PRRFKFFRAQMQTIISRACNEVDVQPLASRRCQTMTKWLNERVENVYKKHPGYDASAP
                     PLMAFEATAPKRLPDALRGESWAFVALPLVGVREEMEQVKRGRVFGATLEIDENLPDD
                     TLIPGIAVYTSRAAALAGWTKGLELACISSDTQTSSIVLETGVNDSWSYAFFRKSPEL
                     TKEAKEWEEVKRACNGLHFLAIQTDEEAEATDGFWILQDSDPAKF"
     gene            <188869..>190725
                     /locus_tag="OSTLU_88181"
                     /db_xref="GeneID:5003670"
     mRNA            <188869..>190725
                     /locus_tag="OSTLU_88181"
                     /product="predicted protein"
                     /transcript_id="XM_001419481.1"
                     /db_xref="GeneID:5003670"
     CDS             188869..190725
                     /locus_tag="OSTLU_88181"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419518.1"
                     /db_xref="GeneID:5003670"
                     /db_xref="JGIDB:Ost9901_3_88181"
                     /translation="MSASPREKIKRLAVACVRRGSFISLCLYVLGLVVASLAPSLARD
                     VYVDENAFLVGSTHATFDDLDGARADDYVETLTKITFDARSRARTTRERLEWVLNALD
                     ERGFESYKSWLDGAGDLFNVHGVARAARGNGRESMALVTVLGDGDADAEAATVGLALR
                     AFEKIGRAPWLAKDLMWVCVDGSRGEIDGTMAWLKTYYSSSVGDLGGGFERAGAIQQA
                     FVFRAANRGAAASAVRVKLEGWNGAYPNQDIFTMFRSIVETYPVSMRVSLESDVEVRE
                     DDLSRWSLMKSTARFMWRAATGIPSGAHAAFKAHSIDAISFEAIERQQDAYVRSGLRA
                     YVTLGQMLELTFRACNNLLELLHHSCFYYILLGPNKFLGIAEYIAPQAILLVSLLLTA
                     LKMTTFGMEDTSSTSDGETRMSHDWFAAISKLSLALVFGAIVGTSCVSLHLRELNHVT
                     VTLGTVAVAFIAFITFLRLTLDGEASPVRSTTKVCDVTIVRQEQWVGVKVINIAWLLF
                     TMSACTFFNFALAFLTTVALAPACLLCAPSGDAAKRNRAVAVLGALPPTWMFVLSRFA
                     GSPVYESFGLLAEHHVRWKTFALPVVFGIAFPVLLICFDVARSPVKSKTKKA"
     gene            complement(<190801..>192111)
                     /locus_tag="OSTLU_35027"
                     /db_xref="GeneID:5003671"
     mRNA            complement(join(<190801..191724,191827..>192111))
                     /locus_tag="OSTLU_35027"
                     /product="predicted protein"
                     /transcript_id="XM_001419699.1"
                     /db_xref="GeneID:5003671"
     CDS             complement(join(190801..191724,191827..192111))
                     /locus_tag="OSTLU_35027"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419736.1"
                     /db_xref="GeneID:5003671"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="JGIDB:Ost9901_3_35027"
                     /translation="MAVAATACAAWCALGSARETSEVRVTARRTKRNAYVLDKCGAIL
                     ERGYDAVAWLKNRHASTILSSLLRRDLNVAYQREVLAMPDGGHATLDWPMSSALVRRR
                     LAVHHARIAADAPVLVLMSGIAGGSHDKYLKHFLKRARARGFRCVAFNCRGTSESPLT
                     TPQFYSASYTGDIRHVVNTLRERYPDAPLFAIGWSLGANILTNFLGEEGENAKVTGAA
                     ALCNPFDLNACDTALESGFFGKVYSQAMAKNMRKLFAPHENLFAGLPKYNPELVKAAK
                     TVRDFDEAITRVTFGFPSVDAYYEYSGSKNKIGDVRVPLMTVQARDDPIAIADSIPRA
                     IIEENPNVILLETESGGHLGWEAGPEAPFGAPWPDAVVMQFFEALLELKKSPNAKVET
                     DTKVDPVPAR"
     gene            <192863..>193597
                     /locus_tag="OSTLU_33429"
                     /db_xref="GeneID:5003738"
     mRNA            <192863..>193597
                     /locus_tag="OSTLU_33429"
                     /product="predicted protein"
                     /transcript_id="XM_001419482.1"
                     /db_xref="GeneID:5003738"
     CDS             192863..193597
                     /locus_tag="OSTLU_33429"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419519.1"
                     /db_xref="GeneID:5003738"
                     /db_xref="JGIDB:Ost9901_3_33429"
                     /translation="MDAECGEEEEGSDGDAREEDQGNKTNARKRGRKPKAANEEGARG
                     DADAEASLPKRTEVTITGNARTKAELIGMKGVVKKSLPSGGWHRLVLENGREVRVRRS
                     ALTASETGRGDEEGEQGEDDDDEDDEDEDDGDDKDNMATRARRPTRVPGNGPPSQAAA
                     AAMKRLQERRRSARPNCQSNFERLTLSTLQKYKKAYEMEANPETDGDKNALVHEVGKH
                     FMQQKLDEQKVLQAFMCAVADTTQIG"
     gene            complement(<193639..>194376)
                     /locus_tag="OSTLU_35071"
                     /db_xref="GeneID:5003672"
     mRNA            complement(<193639..>194376)
                     /locus_tag="OSTLU_35071"
                     /product="predicted protein"
                     /transcript_id="XM_001419700.1"
                     /db_xref="GeneID:5003672"
     CDS             complement(193639..194376)
                     /locus_tag="OSTLU_35071"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419737.1"
                     /db_xref="GeneID:5003672"
                     /db_xref="JGIDB:Ost9901_3_35071"
                     /translation="MHADANAASDRLTADVIADADRRYNPLGEHEIDLRGRRIGRLEN
                     LATARDQYDAYDFTGNDVVRLENLPSMPRCKTLMFGNNRIARVNGEELARATPALTTL
                     TLTNNALRNLGDCDGLGSLKKLKMLTLCGNPVCAKENYRLYVIYKCKALKTLDFQKVR
                     ASEREEAEKTFGADDGAAQRAKTFTPGDGLEETKDETKKDAKPSGPTPEQLTALKVAI
                     ANAETLEEVSRLENALKSGVVPSDLRI"
     gene            194580..196154
                     /locus_tag="OSTLU_33431"
                     /db_xref="GeneID:5003739"
     mRNA            194580..196154
                     /locus_tag="OSTLU_33431"
                     /product="predicted protein"
                     /transcript_id="XM_001419483.1"
                     /db_xref="GeneID:5003739"
     CDS             194697..196109
                     /locus_tag="OSTLU_33431"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419520.1"
                     /db_xref="GeneID:5003739"
                     /db_xref="JGIDB:Ost9901_3_33431"
                     /translation="MTRAEATESTEMEDDCDFVRELPGASGGLEEATLAAMRGVSLGD
                     ACAAAGVRTLARETRDGDAVIDRDAAAATTERALDAAMREKALVLERYEGRTHSVKAK
                     EGSVQGAFQRAVFAKKLHERITTRVREEVRRRAESDLRTARRAAQERQLSGRRDAKAA
                     MDAKREAPHKPWFLLETPKDEQMRLRKAAMVDAANAEAGADAGADASSSSWTMPGNVT
                     IEPVPDTTDESVLGAVRMCIYMVQSHPRPIQKVLDYLFGYSPAVDGEDLEEIDAYSKG
                     LPVSRGRMPADLAYSYAANLDKTLGERDKVALKALIKDVKEEWSSHIKAGFDAVKELE
                     STPLDSAEDIRVQNRDSWLRAMFPTLDWPTRNEKNYKFMEHLREQQALDARTAVSTSR
                     PVPLALSRANRAKQAQEQIQTYDLGGSKIHYSKDGVPIIAPDGFFPKANTAPSKRAET
                     ARIRLAASDAERRLAERRRL"
     gene            <196241..>197413
                     /locus_tag="OSTLU_33432"
                     /db_xref="GeneID:5003673"
     mRNA            <196241..>197413
                     /locus_tag="OSTLU_33432"
                     /product="predicted protein"
                     /transcript_id="XM_001419484.1"
                     /db_xref="GeneID:5003673"
     CDS             196241..197413
                     /locus_tag="OSTLU_33432"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419521.1"
                     /db_xref="GeneID:5003673"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR003903"
                     /db_xref="InterPro:IPR006155"
                     /db_xref="JGIDB:Ost9901_3_33432"
                     /translation="MIYFERQTSRLCGVHAINALLQGPFFSASDLAAIARALDDEERS
                     LLDQSSLRRSSGSHAERSENVGDDGNFSIQVLCKALDVFGLSARYASADEERGTDSAK
                     ELAFVCNLSEHWFALRRLGDAWWDLNSMHAAPKKIGTFYLDAFLNQLTAEGYSIFVVR
                     DLAAAALPEMLGQNGEYGEWLTEEECLRLTSEAETAQASGRARLAAESAMKTLSDGPS
                     RLVVDGGVASDVVDLTADRELQAALEASMEDYGKLDASGTDTDADLKAVLAASLEEIE
                     GGDASIEAAIAASLRDEEAKMDVDVARFAEEPDAGDGIVSLAFRLPDGDRIARRFACA
                     SSIADVEKWLEVAKRLDMRSNCLALAFPPRALADASTSIRDAGITDREVLAVRPRP"
     gene            <197519..>197939
                     /locus_tag="OSTLU_33433"
                     /db_xref="GeneID:5003674"
     mRNA            join(<197519..197615,197782..>197939)
                     /locus_tag="OSTLU_33433"
                     /product="predicted protein"
                     /transcript_id="XM_001419485.1"
                     /db_xref="GeneID:5003674"
     CDS             join(197519..197615,197782..197939)
                     /locus_tag="OSTLU_33433"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419522.1"
                     /db_xref="GeneID:5003674"
                     /db_xref="JGIDB:Ost9901_3_33433"
                     /translation="MGATALTAVFGAVSGVGCAAFANGLRKLPPFSQPWKHAVAAGVG
                     AAALMYNADLETSLKEDVERLRATRAEQNAEYMAEIRAKR"
     gene            complement(197952..199724)
                     /locus_tag="OSTLU_33434"
                     /db_xref="GeneID:5003675"
     mRNA            complement(join(197952..199282,199400..199449,
                     199659..199724))
                     /locus_tag="OSTLU_33434"
                     /product="predicted protein"
                     /transcript_id="XM_001419701.1"
                     /db_xref="GeneID:5003675"
     CDS             complement(join(198068..199282,199400..199449,
                     199659..199716))
                     /locus_tag="OSTLU_33434"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419738.1"
                     /db_xref="GeneID:5003675"
                     /db_xref="InterPro:IPR000315"
                     /db_xref="InterPro:IPR010402"
                     /db_xref="JGIDB:Ost9901_3_33434"
                     /translation="MPACAACRARDADIFCLADEAFLCATCDARVHGANAVAARHERI
                     TVDEWYKRTLEAGLSEAKECGDWKAAASATASARREDEDGRGRGTSESLREKSFSLFK
                     RDDAKTTTHDSTSSMDATISAWDVGVFLNLGENGEEDTSPRAPRMSSNSDTMIFDLDD
                     DPLASLLEMPETESALLFDGDAASISAALEAVADQIQAVSPNQAAAKAYVSKSARDNF
                     TPRPSPLGLGLPAAQRGPAETVGSYPPGAFPPIMMPMSSDLFGIPRRVVSKERQAQLD
                     RYRAKRERRLMGLKKVVRYECRKTLADARVRVKGRFVKANPDEKTSALKSFQSCPDLS
                     ALVEDEDNAKPLSFAPMKHTTLDDQQLHQQNSKRRISDDRLSNSDASHDDKLDVQSMR
                     YEILRDSGAPALHPPTIPETLPLPSGLRRTKQMRHCQSEINLMDLAGY"
     gene            <200065..>201198
                     /locus_tag="OSTLU_12872"
                     /db_xref="GeneID:5003740"
     mRNA            join(<200065..200886,201028..>201198)
                     /locus_tag="OSTLU_12872"
                     /product="ArsAB family transporter: arsenite (ArsA)"
                     /transcript_id="XM_001419486.1"
                     /db_xref="GeneID:5003740"
     CDS             join(200065..200886,201028..201198)
                     /locus_tag="OSTLU_12872"
                     /codon_start=1
                     /product="ArsAB family transporter: arsenite (ArsA)"
                     /protein_id="XP_001419523.1"
                     /db_xref="GeneID:5003740"
                     /db_xref="InterPro:IPR003348"
                     /db_xref="JGIDB:Ost9901_3_12872"
                     /translation="MLDGRERKYYMVGGKGGVGKTSLSSSLAVKFASAGHETLVVSTD
                     PAHSLSDSLAQNVRGGQPVEVNDTDGMLYALEIDPESAKAEFTQFARATDMSGGARDF
                     MSSVGLGGFADSIADLKLGELLDTPPPGLDEAIAIAKVLQFTKDEKFSKFTRIVFDTA
                     PTGHTLRLLSLPDFLDASIGKIVRLRQKLTSATDAVKGIFGVGEDKQDDAVEKLEKLK
                     AQVKEVRTLFRNKDTTEFIIVTIPTVLGVSESGRLLQSLRDEDVPCKRLIVNQVLKAA
                     VTFCSVKEKDQTRALQMCEEDAGLNSLNRTDAPLFDMEIRGVPALKFFGDQVWR"
     gene            <201333..>202129
                     /locus_tag="OSTLU_7408"
                     /db_xref="GeneID:5003676"
     mRNA            join(<201333..201368,201518..>202129)
                     /locus_tag="OSTLU_7408"
                     /product="F-ATPase family transporter: protons (vacuolar)"
                     /transcript_id="XM_001419487.1"
                     /db_xref="GeneID:5003676"
     CDS             join(201333..201368,201518..>202129)
                     /locus_tag="OSTLU_7408"
                     /codon_start=1
                     /product="F-ATPase family transporter: protons (vacuolar)"
                     /protein_id="XP_001419524.1"
                     /db_xref="GeneID:5003676"
                     /db_xref="InterPro:IPR002842"
                     /db_xref="JGIDB:Ost9901_3_7408"
                     /translation="MNQADVDKQINQMVQFIKQEANEKAREIAIATEEEFNIEKLSMV
                     DGEKIKIAKEYERKETTVDTAKKIEASTGRNAMRLKVLSARAQAMETVVEEARAKLAE
                     TSADAGRYRTLMTALIVQGARKLGDASVRVRCRECDAAVAREAVAAAAAEMPGTTVTL
                     DESSSLPAAPACSGGVEVANSTGKIVCDNTLDARLRIAYENGTPAIRAKIFGESSA"
     gene            complement(<202275..>202610)
                     /locus_tag="OSTLU_33437"
                     /db_xref="GeneID:5003677"
     mRNA            complement(<202275..>202610)
                     /locus_tag="OSTLU_33437"
                     /product="predicted protein"
                     /transcript_id="XM_001419702.1"
                     /db_xref="GeneID:5003677"
     CDS             complement(202275..202610)
                     /locus_tag="OSTLU_33437"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419739.1"
                     /db_xref="GeneID:5003677"
                     /db_xref="JGIDB:Ost9901_3_33437"
                     /translation="MSEKNATMTHLKQRRAKIEADAAEIERQVYDLETSLLTDHSSGG
                     NVLRGFELALAQSKQQAQKRVKPFKTEERTFSVSSASSQVVEELAAEAEQIRTTASGR
                     LAKAPTTFK"
     gene            complement(<202773..>203870)
                     /locus_tag="OSTLU_33438"
                     /db_xref="GeneID:5003741"
     mRNA            complement(<202773..>203870)
                     /locus_tag="OSTLU_33438"
                     /product="predicted protein"
                     /transcript_id="XM_001419703.1"
                     /db_xref="GeneID:5003741"
     CDS             complement(202773..203870)
                     /locus_tag="OSTLU_33438"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419740.1"
                     /db_xref="GeneID:5003741"
                     /db_xref="JGIDB:Ost9901_3_33438"
                     /translation="MRQMSNALASTAASRGDVGWLDDEAAETTIDGESAFEEALEGVL
                     ARPGSVLATGAEYFYLLVPGLFGSYYPRYYADVEQAFRDRGAQCRISRLVDGEGAVVT
                     NAKALAREIEDIHAETGKRVVIIGHSKGGVDGGAALALHDDRLRKLVRGLIAVQSPFG
                     GSPIATDLLSAPLADPVASLLEILVSAPKGDGARLLEPIRDLTYRERRAFLAAHPIPS
                     HYPVVSFATATKSAAAGLFPSARYIDNRYGEPSDGLVCVRDAQIPRAVCVNVKFENDH
                     ADCVFPSRHPSDMVDAHARAQAENLALRQRLGLCDSPRRGPPLPPPVGVSVVAAQRAL
                     ADALPERLKSSPASVDYHEALVGVLLARPGP"
     gene            complement(<204352..>206442)
                     /locus_tag="OSTLU_33439"
                     /db_xref="GeneID:5003742"
     mRNA            complement(<204352..>206442)
                     /locus_tag="OSTLU_33439"
                     /product="predicted protein"
                     /transcript_id="XM_001419704.1"
                     /db_xref="GeneID:5003742"
     CDS             complement(204352..206442)
                     /locus_tag="OSTLU_33439"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419741.1"
                     /db_xref="GeneID:5003742"
                     /db_xref="JGIDB:Ost9901_3_33439"
                     /translation="MDARRGTTTTTTGETRTYDAAALAALRREQATLRDRPEDRGGAA
                     ASGTAGRSASDVFGGTSAEAWTPPPPARETAGGVGTVIPDAKTIAEAKAKREAARAKS
                     TAADYVDLDSSGGRRERVAFKSVRDGGARDRYAGYVEGDILPGSDDDEFERAQLQRVF
                     RDEPEMRRSARDARATMERAGTGVSIERGGMEAFESLKRALEAAESSSETARREATRA
                     DENAVKSQEALAFYEKELKDASERYVFTQKLRDYFRDACAMLHEKKLILDELEEHYRK
                     FHAERAQALTQAMNAEFEESAIEAEAAAEAVNAVLQRSGSQTEAKATAVTAIRDAVFN
                     AKGLHGEKLDDMGRDLNIAMREKVKARSKRRESSDTAMAVAEDEREVGLLHKDWADAR
                     DAASSMLKDASEEFSTLSAVKRHAEEWKRTHLGSYKSTYMSVSVPNLFAPFVRLELIG
                     WSPLFPLAGKTAPGALDAMSWYGQLFDYGVIDGKIDEGDEDANLLPNMVQHVVLPIAS
                     EAVEEWWEPRDPAQSRALASTLKDIFVYVEPSANEEAKEIVIALQRRLKRCAEECAVP
                     TYSPIVATCAPNAARHAQAQFRLALDLVRSAFAFEDIVDRAALQRIVADGIIGAQVIP
                     YVRLQLVDPAACAASLQAVVDVLPADWLRAAPPAVAPARDIIRALKQSIAHNDRVESS
                     AIEAIEAIAKSFRV"
     gene            <207408..>209894
                     /locus_tag="OSTLU_33440"
                     /db_xref="GeneID:5003743"
     mRNA            <207408..>209894
                     /locus_tag="OSTLU_33440"
                     /product="predicted protein"
                     /transcript_id="XM_001419488.1"
                     /db_xref="GeneID:5003743"
     CDS             207408..209894
                     /locus_tag="OSTLU_33440"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419525.1"
                     /db_xref="GeneID:5003743"
                     /db_xref="JGIDB:Ost9901_3_33440"
                     /translation="MASPNARVGVGSRDWALSVGAALATAARWNDVAATELFELIDDK
                     IQGGAGERVVGLTLLHAALAVDGLVASDDLVVAVHKALTAVSGAPVENGFACASVGMR
                     CVCAAARNLSMGDVRTLRSAWLEPRLRAQGFTWHSAQSDESRATLSLIEYLKIPRDER
                     LGATAMSAFLIADLDLVGYVDAEEFKRKVVHGSVDLDSPAFRALAASERAVGRTVAAA
                     IIATQMNLIHTLYVAPGQEDDADELRMKVATEGGRILCGKALDLLRLERANTASLTEN
                     AQMKVEELTTDAQPSTFFGVLSYALTTNVIDIDENERAKLVSWCCDKLSEKFVTATDA
                     SMRAMITSGCLSALLRLAETSENAAMADACMQCVSVLIDLILVPSTLYDFVEIIAFKT
                     PSLDLLGVESKSEDDKRATYVVAALNWSVSRIRASSTVAQADKSLNLFRRLFVLLPET
                     EHTTWLEYFTDAYASAALWAGCVEKEVAVDTDRVLADDAARKCVESFEADISRETSKK
                     TPEWLGNLQTRARWLNEAFAALGEDAYLRAHFTADLAAIVSKSVDVGLQGSTDPKVNA
                     SYWPYESKRPLIVPRAPLGPGGILATSAATFDLIAKQLESQFLAIETSLQKSLMEHTG
                     LIHMMTTVTSAVAAAGVAIKTPGGASAGRVAAAAARALVLVAQSITHLHVTVNCSEMQ
                     LRNEERELLLLTKQLLEASNVMEQRKTLEAAPGVHRRRYAAARAALARALSLTDASSE
                     DIKFELNKIRKRRHSKRWTEKHQRPPTAPRPASAVNFTAREAEPDDFVDEDGVSILEA
                     FEPSTDEESDSGDNDDDAFVVRGMQDFDEP"
     gene            <209960..>210922
                     /locus_tag="OSTLU_88189"
                     /db_xref="GeneID:5003678"
     mRNA            <209960..>210922
                     /locus_tag="OSTLU_88189"
                     /product="predicted protein"
                     /transcript_id="XM_001419489.1"
                     /db_xref="GeneID:5003678"
     CDS             209960..210922
                     /locus_tag="OSTLU_88189"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419526.1"
                     /db_xref="GeneID:5003678"
                     /db_xref="JGIDB:Ost9901_3_88189"
                     /translation="MPFTSPPLQRAFAAVVYVSEGRRTAVLDVIERVAREATAPRRPV
                     ALVNVFRDAEYNRTGFTLAGRDVDDVRRAALDVAQVSLREVDMRAHDATHPRVGVVDH
                     VSCHALAGERAGAAKLAKSIGEGLGTLGVPVKLYGDAASDGIGLDEIRRRSGYFSGAA
                     GGRWTGEFAVERGFAFDYGPSDVPEREGFGMVGAVPWVCNYNVPLAFTFADEGLDAET
                     RMTRAMAFGRAVAKRVSARGGGLPSVQSMALPHGGKVEVACNLLDVDASSTADVQRAT
                     AAAVAETDALKILGAGASAMVEDGYVTNQTPESIIRAIDAIDAR"
     gene            <211041..>212039
                     /locus_tag="OSTLU_33442"
                     /db_xref="GeneID:5003679"
     mRNA            <211041..>212039
                     /locus_tag="OSTLU_33442"
                     /product="predicted protein"
                     /transcript_id="XM_001419490.1"
                     /db_xref="GeneID:5003679"
     CDS             211041..212039
                     /locus_tag="OSTLU_33442"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419527.1"
                     /db_xref="GeneID:5003679"
                     /db_xref="JGIDB:Ost9901_3_33442"
                     /translation="MPDAELDDRDCLTRFAAHHRDVFNKEILSKMKTPRRACPCGRAN
                     EVPSCRIHYAVLRCVNRTFRKLLPPYEEVMAKKNELLVWDRVTGRPGVSKSELQRYVC
                     MHAAPKLMEKTIRARDEAGDRLWWAVKETLDDMAAGRDNPKYECEVCGKFVCVFCGAA
                     CACPECNDVRTCRECAETYENFTFCKSCKIAYCNDGDEYDDESNCDKDIVYCSECDRF
                     RCSDDCQNDLMFCEICSDADPFCLDCTWRHHVNCDGCGGHLMCEGHNEVDEYLTYVGD
                     DDDQPEGYWYLCDSCLNPRPWKPPIEKPPRKAPIKKPRSPSVSPRMSFSSCTDDID"
     gene            complement(<212090..>212599)
                     /locus_tag="OSTLU_33443"
                     /db_xref="GeneID:5003680"
     mRNA            complement(<212090..>212599)
                     /locus_tag="OSTLU_33443"
                     /product="predicted protein"
                     /transcript_id="XM_001419705.1"
                     /db_xref="GeneID:5003680"
     CDS             complement(212090..212599)
                     /locus_tag="OSTLU_33443"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419742.1"
                     /db_xref="GeneID:5003680"
                     /db_xref="JGIDB:Ost9901_3_33443"
                     /translation="MEPEGELELGLQPPGRVRGCPREHNCVSTSSRESDKYASPWTAP
                     NTFRDAKDAANALVDATLESVENSKLIMREDRAEGSFVGFSVPGKLGDDVVEFWVKNE
                     PVSDRNWSGDEGNGPLVLYRSFAMDVKYVYPFMTPVSDLGEQSKRLRRIRESLGWQIL
                     GCELVECFQ"
     gene            complement(<213035..>213925)
                     /locus_tag="OSTLU_4992"
                     /db_xref="GeneID:5003744"
     mRNA            complement(<213035..>213925)
                     /locus_tag="OSTLU_4992"
                     /product="predicted protein"
                     /transcript_id="XM_001419706.1"
                     /db_xref="GeneID:5003744"
     CDS             complement(<213035..>213925)
                     /locus_tag="OSTLU_4992"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419743.1"
                     /db_xref="GeneID:5003744"
                     /db_xref="JGIDB:Ost9901_3_4992"
                     /translation="FENVIIDEAGHASEPELLTAIVSVLEPKKGRLVLAGDARQLGPL
                     VQAKESRALEVSMLERLCLPPAPYTETPYSVRADGTFEPSKVCMLTKNYRSHACIIEI
                     PSKLFYFDRLECCADPMRTNIFKGWEELPNPSFPVVFDGVMGEELREANSPSWFNPDE
                     ILRVSSWITKILDRKNTGLTAKDIAICTPYHKQKLKMMKHLEAKKISGVTVGSTELLQ
                     GQEFSVVILSTVRSDTAHLKFDARHRLGFMANPKRFNVAVTRAMSLLIIVGNPHILSH
                     DVHWRSLIDYCRLNDSYTGCD"
     gene            complement(<214485..>215878)
                     /locus_tag="OSTLU_16728"
                     /db_xref="GeneID:5003745"
     mRNA            complement(<214485..>215878)
                     /locus_tag="OSTLU_16728"
                     /product="predicted protein"
                     /transcript_id="XM_001419707.1"
                     /db_xref="GeneID:5003745"
     CDS             complement(<214485..215878)
                     /locus_tag="OSTLU_16728"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419744.1"
                     /db_xref="GeneID:5003745"
                     /db_xref="JGIDB:Ost9901_3_16728"
                     /translation="MPVDGARAPTRCEVCDCDVPARLMPTHERGARHRAKLRTRDSLT
                     WRCVACDASMPARARFEHERTRAHRSNARDARDALLGAYRCDVCDVDVPACGREEHER
                     GAKHRAATFRRSAEAGAEATPKETLVPRKISSASDLKSASVVLKLPIDAGEKVTVLFG
                     AFGLARDDLGDRVLEEPTLKTFEGEVKEGGMLEVENAVCLRDDWAKDLKAGVHDVSLV
                     FSYRTYQDDVESGEITLSVLVLRLRARESAQESAERIALGPTSAFAYPKQQKNSSLVK
                     GSKKVVDPGPSKEVLNAKTKFFWPAPLSVPMADIRKALDGEEPQASSVTEMLETGQKY
                     LSKTNYAQFFRQLLMMEEVQATKNVRLYDMHNVALSQTNSKAMYRLFVPGLAEARPSV
                     LRGDSIIVDLSTAKSSFRGKVEFVEAEHIVCRFHPGFTKAYINGVKADVSFEVSRTAI
                     ELMHGAIKDSLKSSS"
     gene            complement(<216250..>218874)
                     /locus_tag="OSTLU_16729"
                     /db_xref="GeneID:5003746"
     mRNA            complement(<216250..>218874)
                     /locus_tag="OSTLU_16729"
                     /product="predicted protein"
                     /transcript_id="XM_001419708.1"
                     /db_xref="GeneID:5003746"
     CDS             complement(216250..218874)
                     /locus_tag="OSTLU_16729"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419745.1"
                     /db_xref="GeneID:5003746"
                     /db_xref="JGIDB:Ost9901_3_16729"
                     /translation="MTHASASAPAPSSIKQRARKARGSVERFIRRLPVPEIYWARERY
                     LEFKGPVWMAYGGAVTMHTLATLAFIGSLFYYADEARWVTDTIISDSTAIAGYDCAPL
                     SPDEFYGLNYTYEECLTKIVPLTESAIGFDIANAEAIAAGGYLTRTDYSNGGTIPYNC
                     SVKNSVYYNPFGSVQAHRGIWPKLPESRTPEIETYINQVVNNGDCRQYPNPSGATCNA
                     GQIRRSGGGSTNGIVGDCETFNTSAAHFLQLFSKTIEYVNGGDVCEFTKHNLPYKCLK
                     SKRMTALEMIGLSNNNAGLVITVFLATLPTFIGFFRKAPKATNEKTWIEKLSFPPEFY
                     DEEPLEFVSNTLVVGFFSLTICAVGVGTFAWFYQYFSSTSQYITDIQITGSWAMPGYN
                     CTPLTTDNLGYGVRYTFDDCKAALQDITVDNINFESWQGDPLNMPNPVPIKAKYVPFN
                     ASKEGVSSQAFWGKERPNATLTQYSATTDLDHWEDPASFLVGGKPQSTRILINAPSNS
                     WTDALKADAVEVWKAMMDVAGDEVCLFTKENSPYECKKSGPPDTLTRLSLSYGNAQFI
                     AASLMWIVAIIIKRLPASNPLGWKARLPMEDKWFRVTDLDLVMSPIRTLLVCFVLGAA
                     SLIVFALLLQFYATQEFTETVVENVLEKEGFTCRPLKDAIWYGKNWTYDECLAKIEEP
                     SLTNSGLSELEQSTPSFGPGQGILSYSDADYGRQPSAYLRPWGRFGPSYKYYANMMGT
                     VNATFDTFFQNQQTNFTNHISGTVHGSLILTTDEYKAGGIAVSYTAVMDRNDALVLNT
                     FRTIFDEIGRDRMCAWTKENFPYSCTRKYKLPPLQVLSQAGGNAAFFFLLVSIASVEL
                     LAIVKTRRVTVENLLAFS"
     gene            complement(<219437..>220165)
                     /locus_tag="OSTLU_4354"
                     /db_xref="GeneID:5003747"
     mRNA            complement(<219437..>220165)
                     /locus_tag="OSTLU_4354"
                     /product="predicted protein"
                     /transcript_id="XM_001419709.1"
                     /db_xref="GeneID:5003747"
     CDS             complement(<219437..>220165)
                     /locus_tag="OSTLU_4354"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419746.1"
                     /db_xref="GeneID:5003747"
                     /db_xref="InterPro:IPR002016"
                     /db_xref="JGIDB:Ost9901_3_4354"
                     /translation="DADFGPTLVRLAWHSSGTYDRMGKTGGSGGGTIRFKEELAHGGN
                     AGLDKAIAKLEPIKKRHPDVSWADLIAFVGVVAIEEMGGPKLKFSYGRVDEMDPEAVT
                     PDGRLPDADKGDGPGPKTRQGLRDVFYRMGFDDREIVALSGAHALGRCHADASGYVGP
                     WSGTPLLFNNSYFVLLKGLKWEPNPDAKKFQYKDPSGNLMMLPSDIALIEDADFKKYV
                     DVYAKSQKVFFEDFAAAFEKLETLG"
     gene            <220622..>221701
                     /locus_tag="OSTLU_33447"
                     /db_xref="GeneID:5003644"
     mRNA            <220622..>221701
                     /locus_tag="OSTLU_33447"
                     /product="predicted protein"
                     /transcript_id="XM_001419491.1"
                     /db_xref="GeneID:5003644"
     CDS             220622..221701
                     /locus_tag="OSTLU_33447"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419528.1"
                     /db_xref="GeneID:5003644"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="JGIDB:Ost9901_3_33447"
                     /translation="MRDVAGVYAVSDVHVDHEKNAAWVRALRRRDDVDVACVCGDVSD
                     DLDALEETLEGFKRAAFAEVFYTFGNHELWLGEADETRGTKDSKAKIEEVFAMCARIG
                     VRTSPMKVCDGLWIAPVHSYHHKAFDTEPEVAEAVPPVERVMNDFRFSKWPDGMDDRD
                     SDDVARYCDSLNDGAAWETFLRSIERGDRVVSFSHFLPRLELLPEKRMLFYPKLAQAS
                     GSVHLRKRVEEIKSRINDGDMTHVFGHTHFGWNTQIDGVRYVQASLATPKEWQKRPRS
                     LIIGNWTNAQPEPMCVYTKARSLGVVDDAKAMWSEYYAKNRRTPEDVELAPHAREFVQ
                     RRWGDRRLESNGADAPLPGATGRVK"
     gene            complement(<221807..>222556)
                     /locus_tag="OSTLU_33448"
                     /db_xref="GeneID:5003681"
     mRNA            complement(<221807..>222556)
                     /locus_tag="OSTLU_33448"
                     /product="predicted protein"
                     /transcript_id="XM_001419710.1"
                     /db_xref="GeneID:5003681"
     CDS             complement(221807..222556)
                     /locus_tag="OSTLU_33448"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419747.1"
                     /db_xref="GeneID:5003681"
                     /db_xref="JGIDB:Ost9901_3_33448"
                     /translation="MTDAATRALGRAKELSTTITLALFVLPLGVVAHAAAFAALPMQL
                     ASAMLRELTMSRGTDVRALLRGLYALALKPSLAAACAAEIKDDGEIFREYSRSSSEKI
                     EAFRKMSEIEREKFIAACAKLKEEEQIRERLREQLNATRDELKRERAANFAQGKFSKG
                     KEETGSGGVYLTTALLGVMLLYFHDMDTVHTLDKKLAASIPAFWMFVMTFKTRSVQTL
                     CTALNLVLAGYFLHIVLNHRRLLGGEARVVA"
     gene            <222727..>224070
                     /gene="HAM3502"
                     /locus_tag="OSTLU_34656"
                     /db_xref="GeneID:5003645"
     mRNA            join(<222727..222979,223070..>224070)
                     /gene="HAM3502"
                     /locus_tag="OSTLU_34656"
                     /product="predicted protein"
                     /transcript_id="XM_001419492.1"
                     /db_xref="GeneID:5003645"
     CDS             join(222727..222979,223070..224070)
                     /gene="HAM3502"
                     /locus_tag="OSTLU_34656"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419529.1"
                     /db_xref="GeneID:5003645"
                     /db_xref="InterPro:IPR002717"
                     /db_xref="JGIDB:Ost9901_3_34656"
                     /translation="MARDDAGRRKSESTSDRAGALDVGARVWAKASFDEKRRLGEIVD
                     VRREDGVAVAYYVHYSELNKRLDAWVPVEDVETRKEGEGEVNGKQPKTLTRNSKRRYN
                     EIHNVDAPVEDLPPMDQMFERMHEEKTKVKNVHSIELGRHEMDTWYYSPYPDDFGKCS
                     KLYLCQYCFKYMRKAKTCVRHKAECEMKHPPGKRVYRHPQGEGEPLLSFWEIDGAHFK
                     MYCQNLCLMAKLFLDHKTLYFDVEPFMFYVLTESMDGDETHDIVGYFSKEKVSVDDYN
                     LACILTLPAYQRKGYGSFLISMSYELSRRQGVYGTPERPLSDLGQVSYRSYWSRVVLD
                     VLHKHRGNLSVKDLSSMLMFREADIVSALQSLNLVKYWKGQHIISSSPKIVEEHLSSF
                     EKKSAIAGTRLEFNPEYLNWTAPPM"
     gene            complement(<224200..>225510)
                     /locus_tag="OSTLU_93229"
                     /db_xref="GeneID:5003682"
     mRNA            complement(<224200..>225510)
                     /locus_tag="OSTLU_93229"
                     /product="predicted protein"
                     /transcript_id="XM_001419711.1"
                     /db_xref="GeneID:5003682"
     CDS             complement(224200..225510)
                     /locus_tag="OSTLU_93229"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419748.1"
                     /db_xref="GeneID:5003682"
                     /db_xref="JGIDB:Ost9901_3_93229"
                     /translation="MTHASPTRETREPLFPGARRGKVATSAGLSGKSDDRRRPTARRL
                     GFASEKDKAIDDELEARERSGTKEAEVYCVSRPFQEWGKGIFSALPRGAREALLTAGV
                     AHFMLVYRDLKTGEMRQFDFGPVGGDVHDRWLALAGGKTLRSSEQGARETVYAMTRGR
                     VGRHRARRKSSCVQGEIRDHKVRSLPDGAYLVGTTHLSLDDIRGFNDARDMVYELHVN
                     DCRHYLNDLCYYLTRETAVSSKFVKHGIMKRLEENKGRIWEHHLWLTKALTDVENVEN
                     WNKAGRFASATLMFGMGTRFMPFVPAKRFVTWGSGVVAGTSENVPIVREVLSFGGFLV
                     ETGRSALSLALDAQNSVTKSIAKGVEAQLLRTRWKLPMPRGAKLTRAKSVEDSSPLKI
                     GLRVSPSSLTLPAVAASATKAVRSVVSNGAIRRLQRQGRVEISS"
     gene            complement(<225837..>226379)
                     /locus_tag="OSTLU_16734"
                     /db_xref="GeneID:5003646"
     mRNA            complement(<225837..>226379)
                     /locus_tag="OSTLU_16734"
                     /product="predicted protein"
                     /transcript_id="XM_001419712.1"
                     /db_xref="GeneID:5003646"
     CDS             complement(225837..226379)
                     /locus_tag="OSTLU_16734"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419749.1"
                     /db_xref="GeneID:5003646"
                     /db_xref="JGIDB:Ost9901_3_16734"
                     /translation="MAYAETATAELGAMKSRLEQVERKSEEDARTIDELRARVERATT
                     STSTSNTDATAGIRAAFEAETRRLGERARVAERERDDALRSLERAVAPRAREESVETP
                     VGGEDASRITEEALLRRRCDDADGLLRQYAAEGAALAEEANEAARRNRVLEAFASDAF
                     ALVEDARALVDRRRRERAAT"
     gene            <226551..227979
                     /locus_tag="OSTLU_25031"
                     /db_xref="GeneID:5003647"
     mRNA            <226551..227979
                     /locus_tag="OSTLU_25031"
                     /product="predicted protein"
                     /transcript_id="XM_001419493.1"
                     /db_xref="GeneID:5003647"
     CDS             226551..227975
                     /locus_tag="OSTLU_25031"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419530.1"
                     /db_xref="GeneID:5003647"
                     /db_xref="JGIDB:Ost9901_3_25031"
                     /translation="MPGGAEDAACAATRVRGELNASWPRGRTPASGSTPLVALAKNMS
                     SVLQHFEAVKTTDADDETTQVASLRAFSEREVVVDVYDRSGGATRAVREKLGAVGGTR
                     VREARDASGDGDVGLVVVDGQEEESFEAIGKILKQSGVASTRVIVLVYGAAVGTLEEA
                     RARAARETRAPIENVFATFGILDESTSERLDSLLKNPPLRSTLETSAEVRVSVPEPVS
                     AFALDDEDEDEDEGLTSIALSDAKVEREEWETIVREHAERCFEDAVDATMEQTRQFCL
                     RRAEKLALQYEPLRSSLYQRIRGERSKTKIVEPSIQARVAPPSQYVEEMTTTRPYKLN
                     SAASQPLGIDMIKLQSVAISGVEQGAVVASQAAEKVGSFLNWIVSENEESEDERRRRV
                     EHERVWHERRQKLWDAERAQRVETQNRGKHSPTASFVETTSKLVDIIDGSLGGESQLD
                     QANARIRALEAALARYDPSHELLR"
     gene            complement(<228012..>228683)
                     /locus_tag="OSTLU_34665"
                     /db_xref="GeneID:5003683"
     mRNA            complement(<228012..>228683)
                     /locus_tag="OSTLU_34665"
                     /product="predicted protein"
                     /transcript_id="XM_001419713.1"
                     /db_xref="GeneID:5003683"
     CDS             complement(228012..228683)
                     /locus_tag="OSTLU_34665"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419750.1"
                     /db_xref="GeneID:5003683"
                     /db_xref="JGIDB:Ost9901_3_34665"
                     /translation="MKFKIFGDRDAPDWFLAEIFTVSKLSSVRVRLLCSHLVAVRASA
                     ASNAQPFGTLKSTDDNDATAPAETPRVQVDYSKFRKVVDDAITPEDAEAVVAALEYAI
                     ANATRFDVDETTLGRELEQLGLPKEHAEAMCKSYGKDRDGLRRAALGATVRVNGLRDL
                     GWGVTFGSSDGDDENRAPGDSLGVRLTLDTVDDGRLDMEMSEEKFRVLLSELKAVRAL
                     MDDDT"
     gene            complement(<228728..>229705)
                     /locus_tag="OSTLU_88195"
                     /db_xref="GeneID:5003648"
     mRNA            complement(<228728..>229705)
                     /locus_tag="OSTLU_88195"
                     /product="predicted protein"
                     /transcript_id="XM_001419714.1"
                     /db_xref="GeneID:5003648"
     CDS             complement(228728..>229705)
                     /locus_tag="OSTLU_88195"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419751.1"
                     /db_xref="GeneID:5003648"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Ost9901_3_88195"
                     /translation="VWITGASQGLGEATARACARLGARVVVSGRRAERCAEVAEECAR
                     LGAASAKCVVFDVCGTRSELSEACERAFEAAGGTVDVFVNAAGGSQACSALAGDDEDV
                     DKALFQLNAIGAISLTKEVAKRMVAAARRRKAGSIAPKIVGVCSVASKVPAPGQSVYA
                     AAKSAYAAFLNSLRSEIANTGVKVVCVYPGPIATGMNGQERVIFRKNMADSTPSPSAS
                     KTAISRTAARPPSTKGRMNVDYVAARIVRSALADVDELVLAPQPIMALTYCVRFFPTL
                     AYAALDVIGPKRARRADAGENMYDLLEKTREILESIGDVDSKDSKGKLA"
     gene            complement(<230047..>230985)
                     /locus_tag="OSTLU_33453"
                     /db_xref="GeneID:5003649"
     mRNA            complement(<230047..>230985)
                     /locus_tag="OSTLU_33453"
                     /product="predicted protein"
                     /transcript_id="XM_001419715.1"
                     /db_xref="GeneID:5003649"
     CDS             complement(230047..230985)
                     /locus_tag="OSTLU_33453"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419752.1"
                     /db_xref="GeneID:5003649"
                     /db_xref="JGIDB:Ost9901_3_33453"
                     /translation="MKRAITLDELAVIARASLGLVAEGVSARDDVVRATVDEEKIWFA
                     ARRSSDGAGTRKGRFLTFAHDAIVADGGADVWDVPGVTRREVRVEGAVGLSNAAKAIA
                     DGEGDGCERAKTKALFDREACFGSDDLKVLKKSDVDALGRAKGYVERELRCFEEGARA
                     FALEGGDGAEFAYVALEGATYASKKFGSKSEIAKWAVVETRASVARVLRAMRAEKGIE
                     FNALALTSRASEQTARAAERKLLGIDVRRQLTTTNATANENDPEVVAQFVRKGVQWGV
                     TIILVGAAAGGVFALLGMPLAREPFLYAPIPGFKLD"
     gene            <231659..>234514
                     /locus_tag="OSTLU_33454"
                     /db_xref="GeneID:5003650"
     mRNA            <231659..>234514
                     /locus_tag="OSTLU_33454"
                     /product="predicted protein"
                     /transcript_id="XM_001419494.1"
                     /db_xref="GeneID:5003650"
     CDS             231659..234514
                     /locus_tag="OSTLU_33454"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419531.1"
                     /db_xref="GeneID:5003650"
                     /db_xref="InterPro:IPR007810"
                     /db_xref="JGIDB:Ost9901_3_33454"
                     /translation="MGRGDGAGDGARYWRRGWAAARPLAGLRGVHCTCATFVKGKDGD
                     NDGARILLGSSDGRVFDVRVDAADTRRFEKSCEVALELRDGKAITGVCATKDRASDGS
                     ERFGALITTPSKLYAFVGSYSLESVLAMARARPSGFEAAVEMPVESDRSKLCVWRKRR
                     SSTPDRMAWLTGAGVYRGKLNFKVDDASSVLEQHGALPFPKLEDDESGNDAPISLAMT
                     EHHILLLYSTRLVAMNSITGDVEGTIKLPLGGASTFAFTDPATSVPYAANAENLLQIV
                     VTNEDANMWRVYCDQNDYDQAITACKSDLQRQFVYTARAERALKLKRFDEAATAFANA
                     GIAHAIETIAKTFVDLNAKDALYAYMEGRLRGLPQDDAARRLIIAMWLLEEYVKIASF
                     SRNEANDFKVREFLRENFESLDEREALRILSEAGRIDDEIYFAELCGDYDRVLDHFMQ
                     IGDARKTLEIAASPKVPRSTLNRVLPTLIKALPKDSIDFMLSRPKTDDDVKIIEALAR
                     DDASYAASETSESLAAYLTRYLESITAKPDGAARGDATVHDLLLDVYIKQLESSPTVV
                     ATLNKYILDAVDESTNAPYYDVHYAIRMCEKHGAHRSAVYAYCVSRDFDMAMHVALTT
                     LQDVELAKTVTKKAAESKSDDPNEDEITQKKLWIEIAKWSIRKSGALDKAMASMDEDE
                     KRTAIRSALSFLNETNGALRVEDILPLLPDFTIIDDVKDLVLQSLTEHRTEIEQLKEG
                     LEEITAFTQDVQDDIEEMEQKTIVISKDTKCFECGKPVVRLRLMETADDPNLLAPFYV
                     FPCEMAYHTECLLRRTLPLMLIDQRKRALALMRALKVPLPRRLKPETKFWGAPPKSAT
                     GLTTAEAVSELEDILCADCPDCGAHDLRLINLPILTPEEEALDEELVRLLPPEWFEPM
                     HAAINMNDPAETYLTMEDFKKIDLGEGWPDHDFFRTF"
     gene            <234749..>235795
                     /locus_tag="OSTLU_5767"
                     /db_xref="GeneID:5003684"
     mRNA            join(<234749..235330,235385..>235795)
                     /locus_tag="OSTLU_5767"
                     /product="predicted protein"
                     /transcript_id="XM_001419495.1"
                     /db_xref="GeneID:5003684"
     CDS             join(<234749..235330,235385..>235795)
                     /locus_tag="OSTLU_5767"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419532.1"
                     /db_xref="GeneID:5003684"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="JGIDB:Ost9901_3_5767"
                     /translation="SREPHFRFGLLADIQYCDGDDRKNITGTQMRRYRNTLNVAERAV
                     EYFNTHECDFLVHNGDITDHQCAFDFASDDFKPIERGREDLGAVMRILSRAKCAEWLF
                     TVGNHELYNFTREELRQGVASPGNSLNLKCSNADGEFYYSFKAGPGWRVMVLDPYAVS
                     IYRKGRQQGLCEEAVELLRKHNPNVDLFVKENPDGLAGRWVPFNGGLGKEQIAWARET
                     IRAASAADEKVLIFSHLLIHPHSTAKRSGKTLMWDYDEILEIIEAEETRGCVKCVVSG
                     HQHEGTKWQCEKTGVHYIGMESPMLAMDVSPGPFAIVEVFDDEIVFKGYGRNEDS"
     gene            complement(<236065..>236496)
                     /locus_tag="OSTLU_34811"
                     /db_xref="GeneID:5003685"
     mRNA            complement(<236065..>236496)
                     /locus_tag="OSTLU_34811"
                     /product="predicted protein"
                     /transcript_id="XM_001419716.1"
                     /db_xref="GeneID:5003685"
     CDS             complement(236065..>236496)
                     /locus_tag="OSTLU_34811"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419753.1"
                     /db_xref="GeneID:5003685"
                     /db_xref="InterPro:IPR002569"
                     /db_xref="JGIDB:Ost9901_3_34811"
                     /translation="FWGPDASFSALKGVKNVRVGYTGGESDFPTYSAVCAGGTGHTEG
                     YYVAYDAATTSFDKLLEQFWSEHQPTYESKAQYKSAIWAQTPEQYEKAVASKEAREKQ
                     VQRKFFTDIYPPEVSLATPWWDAEEYHQKYYNKPRVSRFGW"
     gene            complement(<236846..>237400)
                     /locus_tag="OSTLU_88199"
                     /db_xref="GeneID:5003651"
     mRNA            complement(<236846..>237400)
                     /locus_tag="OSTLU_88199"
                     /product="predicted protein"
                     /transcript_id="XM_001419717.1"
                     /db_xref="GeneID:5003651"
     CDS             complement(236846..237400)
                     /locus_tag="OSTLU_88199"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419754.1"
                     /db_xref="GeneID:5003651"
                     /db_xref="JGIDB:Ost9901_3_88199"
                     /translation="MPTYRSSDLAFSKYNNAPGTGGSGATATIPPNGGYPWYEEDERY
                     APATRGEGGVSSEWTPMYDPTREEYLKDKAEAVAKGIPLGSFIDAKVAAMRKPPKTLR
                     LLVTSMLHVDCEYGGPFWIDVSDTTRVNEVKKLIADKTGVMPGLVRLAYAGKKFDDNS
                     RTLAQMGVRYWNAKFPDWSLVILR"
     gene            <237582..>238628
                     /locus_tag="OSTLU_35123"
                     /db_xref="GeneID:5003652"
     mRNA            <237582..>238628
                     /locus_tag="OSTLU_35123"
                     /product="predicted protein"
                     /transcript_id="XM_001419496.1"
                     /db_xref="GeneID:5003652"
     CDS             237582..238628
                     /locus_tag="OSTLU_35123"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419533.1"
                     /db_xref="GeneID:5003652"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="JGIDB:Ost9901_3_35123"
                     /translation="MTRASICRAVPARAARAAPRARANARRAGRIATTTRAASTTDFP
                     SFFPPEVRELEEPAAIAMARRCRSVSVDVPGRAKAVLTSCAGDAGPAGSDAAPFVLLH
                     GFDSSCLEYRRLFPKLAAKAETWAVDLLGWGFTDAQDGGIGDYSPEAKRAHLYAFWKA
                     NVGRPMVLCGASLGGAAAIDFATNHPEAVEKLVLIDAQGFIEGLGPMGALPRPVAKMG
                     VNILRTTALRNAANQMAYYDKATFATDDALRVGRLHTFAPQWCDATLSFMQSGGFKVR
                     NSIAKVPMETLVLWGREDKILEPSYAEKFMKELPNARLVWVEKCGHVAHLEQPEFMCQ
                     TLWDFAGKTSAATA"
     gene            complement(<238717..>239838)
                     /locus_tag="OSTLU_33459"
                     /db_xref="GeneID:5003686"
     mRNA            complement(<238717..>239838)
                     /locus_tag="OSTLU_33459"
                     /product="predicted protein"
                     /transcript_id="XM_001419718.1"
                     /db_xref="GeneID:5003686"
     CDS             complement(238717..239838)
                     /locus_tag="OSTLU_33459"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419755.1"
                     /db_xref="GeneID:5003686"
                     /db_xref="JGIDB:Ost9901_3_33459"
                     /translation="MKKAGTALLVLAALGCATAASARTLDDRTSDSEYTSAIARRKLL
                     GSQGDGTPVLDWILARQSGEETATPVLDWILARQSGEETSTPVLDYFLDFATDNTLFG
                     PTTFVERVVNRATTFFFSELLRFNLTATVERQSDESARAALAPTSWNSTFAQNLYSYV
                     DDDGQFGYNPLNVSKFVENDVCGSDFLRANLDDTAMDDAYWQAADFSGTEIPRGRYEG
                     CILGTGTYEAIARAYGVRRTFNFDSWRGKVFDQIDPASVRNLIQLNYGTLLNSVFPRL
                     AEPIELYPGRAEISSSNFQPGTNAVVVDYSSFNHDFTYFRDELRPIYPGVFLGKMYAM
                     PGMSMFGGALQVPIGAAPVYTVSFILVGEPQTTMPLQVV"
     gene            240018..>241103
                     /locus_tag="OSTLU_33460"
                     /db_xref="GeneID:5003653"
     mRNA            240018..>241103
                     /locus_tag="OSTLU_33460"
                     /product="predicted protein"
                     /transcript_id="XM_001419497.1"
                     /db_xref="GeneID:5003653"
     CDS             240072..241103
                     /locus_tag="OSTLU_33460"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419534.1"
                     /db_xref="GeneID:5003653"
                     /db_xref="JGIDB:Ost9901_3_33460"
                     /translation="MSASPASLVALARRVAQWRAVDDDARGGGVVARANPKASRRARQ
                     RREPNESHPKRKYTIEERLKHKGVDVERARMGGARDRDDAGGGAASSAAVSTSGDVPK
                     GEDVCERVAELAFRQDAEGWPAQKTEAWAFARASALTASDVGRVLSGDGAKVLMRKQR
                     TRAAEQALERDRATSALVREVTEAPVATGSSKKERKGKGGGTSPAIRHGNEFESEALA
                     HYEAVLGTKCLEFGLKIHDVHYWLGASPDGVHPSGRIVEIKCPYSRPIIARRRAMEHY
                     AQIQTLLEVFDLDYCDFVQYKPAGRGKGRSGDPDAPEFLCETIARDAEWWSTHFDELQ
                     TFAASLPSP"
     gene            246841..249907
                     /locus_tag="OSTLU_46542"
                     /db_xref="GeneID:5003687"
     mRNA            join(246841..246933,248149..249907)
                     /locus_tag="OSTLU_46542"
                     /product="predicted protein"
                     /transcript_id="XM_001419498.1"
                     /db_xref="GeneID:5003687"
     CDS             248203..249840
                     /locus_tag="OSTLU_46542"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419535.1"
                     /db_xref="GeneID:5003687"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="JGIDB:Ost9901_3_46542"
                     /translation="MGLTEASMRAIHEVMGFTHATAVQDSTLPHIMRGLDVLARAKTG
                     SGKTVGFLLPAIERLAKQGAPRKGDVSCLVISPTRELASQIGEEAKSLLTYHPFNCQV
                     VFGGTNINSERKRLTSQGVEFLVATPGRLIDHFESSNLARACQNLDVLVLDEADQLLD
                     MGFRPSLEKILSYLPTQRQTLLFSATVPKTVHQIAANALRPGHQYIDCVGDDAPATNL
                     QVKQSLIVASFHDHLTLMTQAIEEHQAEEPNHKIMVFFPTARSTQLASEMFEACGKPV
                     FEIHSRKSQAVRTKAADKFREARAAVMMSSDVTARGMDFPDVTMVIQIGVPSAREQYI
                     HRLGRTGRAGKTGKGLLMLDPAEKFFLNGVRDLPIEVLNPAIDSQVDQRVRKAISRIN
                     PDTKAQAYSAWLGFYNGSSGKMKWSKDDLIFAANNYALETLQCESLPGLLKKTVGKMG
                     LKGFTANLNIVSELGGGGGGGRGGGGGGRGGGGGGRGGGGFGGDRGSGGFGGGGGGRG
                     GRGGGRGGGGGRGGGRGGGRGGGANATSMNWQQQSFY"
     gene            complement(<249959..>251419)
                     /locus_tag="OSTLU_16744"
                     /db_xref="GeneID:5003688"
     mRNA            complement(<249959..>251419)
                     /locus_tag="OSTLU_16744"
                     /product="predicted protein"
                     /transcript_id="XM_001419719.1"
                     /db_xref="GeneID:5003688"
     CDS             complement(249959..251419)
                     /locus_tag="OSTLU_16744"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419756.1"
                     /db_xref="GeneID:5003688"
                     /db_xref="JGIDB:Ost9901_3_16744"
                     /translation="MRDDDRTYDAAVRELAKTITGKKRADPGAVTWEAQFAQLETYVS
                     RLDLRGRVDALDVVHVAGTKGKGSTCAMVEGMLRASGTRVGTFTSPHLMDVRERFRID
                     GAMVDEETFAREFWWTRDAIAARCGDLGMPAYFRFLTLLGLRIFSSAGVEACVLEVGL
                     GGRLDATNVVRAPAACGITSLGMDHVDILGDTLGKIATEKAGIMKPGVRTFTAPQKPE
                     AMVALERRAAEVGSPLVVARDLDSYEGGSEIEVGLAGPHQRVNAAVAVELVREWANAT
                     NQPWAEEMEASFARNELPESFRVGLEKTTWPGRSQVMHDPDVMNLTFYLDGAHTIESM
                     RHSAEWFTSTARAVTAEHNIMLFNCMDDRKPEDLLEPVADVFHTTSNVQLERAIFSPP
                     DSTTSGLDKCGDAKATSWQDRCARTWDDIIVKRANVLAEKAQDTRGVVVSSIHQALSL
                     IRHRAREVAPARVNVLVTGSLYLVGDVLRHLKKCVK"
     gene            251748..>252855
                     /locus_tag="OSTLU_50433"
                     /db_xref="GeneID:5003654"
     mRNA            join(251748..252429,252475..>252855)
                     /locus_tag="OSTLU_50433"
                     /product="predicted protein"
                     /transcript_id="XM_001419499.1"
                     /db_xref="GeneID:5003654"
     CDS             join(251815..252429,252475..252855)
                     /locus_tag="OSTLU_50433"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419536.1"
                     /db_xref="GeneID:5003654"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="JGIDB:Ost9901_3_50433"
                     /translation="MASPARRTRETDDATVNAMGGDRNVFASRACDACRALGSFMVLV
                     VLAIVGLTYYATVVVVYGPLAAEGGEDAGVATGALCAYHVFAFMLLWSYFACVLTAPG
                     DVPRGWTPAPEDPEEAASEAKKSNSEKRRRFCKKCAAWKPTRTHHCSVCKRCVLKMDH
                     HCVWVANCVGAYNYKFFLQFLAYTFLATVLDAILLLSNFIDFFKDVDPAEGTELAVVF
                     VTFIVNVAFSASLLGFLVMHGNLILSNMTTIEMYEKKKTLPWKYDLGRFRNFKEVFGE
                     NVFMWFLPVHSSSHLEKMRVNTGISDGECLEGAAYARACESAQREATIGNRKGRA"
     gene            complement(<253000..>253620)
                     /locus_tag="OSTLU_16746"
                     /db_xref="GeneID:5003689"
     mRNA            complement(join(<253000..253195,253313..>253620))
                     /locus_tag="OSTLU_16746"
                     /product="predicted protein"
                     /transcript_id="XM_001419720.1"
                     /db_xref="GeneID:5003689"
     CDS             complement(join(253000..253195,253313..253620))
                     /locus_tag="OSTLU_16746"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419757.1"
                     /db_xref="GeneID:5003689"
                     /db_xref="JGIDB:Ost9901_3_16746"
                     /translation="MDALSSTLSTAASAVSDTVTQGAMHALVGGGDGAGGGEVASFIA
                     KRGTHFVDGFARACVDATAANVRDAAEVLRTTTLNAAIQSEASATSDLPTLERAVKAM
                     SSSAKTAIENYDRRSRAMPQLRYELLENLSEKKLALEKKIEAANAPRELARRQMLKEI
                     MSKPRRG"
     gene            <254983..>255759
                     /locus_tag="OSTLU_6758"
                     /db_xref="GeneID:5003655"
     mRNA            <254983..>255759
                     /locus_tag="OSTLU_6758"
                     /product="predicted protein"
                     /transcript_id="XM_001419500.1"
                     /db_xref="GeneID:5003655"
     CDS             <254983..>255759
                     /locus_tag="OSTLU_6758"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419537.1"
                     /db_xref="GeneID:5003655"
                     /db_xref="JGIDB:Ost9901_3_6758"
                     /translation="VDGTLLDSKQRLSERTAAALREAAELGVRTVVATGKTRGPWARK
                     LYDELGRDNKKMPGLFIQGLITCDGLGKTIKSRTLDKAYVKDILRFAQARDCTIVAFC
                     DTKIVCSTRNELTDKVLDYGEPEPVECGDLLAKSDEYDVNKLLLFCDDADVQRYRLEV
                     RGSSLSDACDVTVAVSGMLEFLPKGASKGAAVRELCESLEIDLANVLALGDGENDKEM
                     LTYAGVGVAVGNASDATKAVADIVLDETNDDDAVAVAIERY"
     gene            <257331..259928
                     /locus_tag="OSTLU_33467"
                     /db_xref="GeneID:5003690"
     mRNA            <257331..259928
                     /locus_tag="OSTLU_33467"
                     /product="predicted protein"
                     /transcript_id="XM_001419501.1"
                     /db_xref="GeneID:5003690"
     CDS             257331..259892
                     /locus_tag="OSTLU_33467"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419538.1"
                     /db_xref="GeneID:5003690"
                     /db_xref="InterPro:IPR001401"
                     /db_xref="JGIDB:Ost9901_3_33467"
                     /translation="MSNPLEERFRRSWFEHLSRLREVEAACAPEIEGDPALRYSVPRI
                     VCIGEESSGKSSTLERVAMMSVFPSDERLCTRVPIELRLRHRDRESLAKEEERFRDGY
                     VVMKMAPGEDSKLNADVSSQMHPDEVPAQVRTWMEELVAAANGKVTGVTDDRIIIELY
                     SPLCVNLDLIDLPGIVAGSIPGEPTDMMDRTRNLSASFLNDKAHPHTFVIAVASAREA
                     RIRNSQAMELVQRYNKVQFTIGALTMADLSADSRRESPYTRLIERLNAQADDTPELGL
                     GYVALKNRDTVTATRENQSREELEKANQDEKEWFAEHLSGHTERCGIESLVDRLVQKV
                     DEYTRGPWIVAERERIETELVKVRQELSDMGEFLPNDLNELISYFSSEIEKQCKPSFE
                     TLLEFVPTVTSGSAGLQDIYDAANFTIWQHSDIHSLMPSISPTTLKTFDGRMFYGEPT
                     FTKRWSPFVKITHKHLFGQDTQTPETPSHASSNGVWTMRRDAINTISDHFNQTFCNGS
                     LLFVGRRCSYDDDGCGGDKLVGFFITQDMIQQRRHDIQTMLAALGKRVPTDNRSPWTK
                     RENHESDSQDSNSQSPNNVGTGTGFDFAPNLFTQRAERGPFRRARRSTRGGLEQDGEV
                     VVLYHPARPAFRAKLEISEDLEKYYENVLHLRESVVRIFQTNARAFFKSSITDVLDVL
                     KAKDARFSVFFESLSVILDDWCEVCVRNVTTEFAEWLTRTGAVSENRDAHFQITASYF
                     TNSITRKMREMIFFHYADSSIAKVFESGELNEIMRRHCDEHNIDVDDLYVENCVEQRK
                     KAVMKMEMLTTMKNSLHQIFTSEVDEQSNEQLPNTPEADAAPVPTLSHSLSRTSI"
     gene            complement(<259970..>261526)
                     /locus_tag="OSTLU_16748"
                     /db_xref="GeneID:5003595"
     mRNA            complement(<259970..>261526)
                     /locus_tag="OSTLU_16748"
                     /product="predicted protein"
                     /transcript_id="XM_001419721.1"
                     /db_xref="GeneID:5003595"
     CDS             complement(259970..261526)
                     /locus_tag="OSTLU_16748"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419758.1"
                     /db_xref="GeneID:5003595"
                     /db_xref="JGIDB:Ost9901_3_16748"
                     /translation="MLLCVSRHQQELVGYAFRGMRACLRRDKRGEVVASEATERAMGS
                     FWSYFEEKWTTHLSDGDDAIVKDFMLEVHDGEYIVAASATPLDGSSVAAGGAMREDED
                     GAPARAAARARGRRGTETQETSGGISGAPSMQRIVLHLVRTKTGEKLDSFTFRDDFMH
                     LPRNGAVSLRGDTLAVLSMKHQRVIFLRVHEEGRFEEVASIGEHITNEDKETVAAQDA
                     RERAWMDAEPQAAEKARTRATGFAASGRSMLTGLTQRLVTSLYHDARRSSSPDALRLL
                     HRNFERYVSLVMLRVRILDANLLLIKFGTPEYALARRGDNVIGPTMYGVFDLSKNAFT
                     QTATSMSDTNGMVDEELNAPPRGDFPWARFAGSQGEALAVCNTSTAEIDDDDEDAFNT
                     IATRLFRTQDYPPQFRSLSPYFDKRLFSYDERTITAIDRLQPHVDFGIKFVSAQQGQR
                     RRVSFKLMLNNSLANNGRSKRRVQYVFHPVYPFAMSISIAYMQPTLVNFHVRSAPGDE
                     LLEITRAGLL"
     gene            <262185..>263615
                     /locus_tag="OSTLU_88208"
                     /db_xref="GeneID:5003656"
     mRNA            <262185..>263615
                     /locus_tag="OSTLU_88208"
                     /product="predicted protein"
                     /transcript_id="XM_001419502.1"
                     /db_xref="GeneID:5003656"
     CDS             262185..263615
                     /locus_tag="OSTLU_88208"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419539.1"
                     /db_xref="GeneID:5003656"
                     /db_xref="JGIDB:Ost9901_3_88208"
                     /translation="MRSASARVARSATRGARCRRRRARVARSTRAARPTAPSIAFVGW
                     EWIEPSSSAAGARSVALVAEALRRGWRVTCVASAEARAGQEDALRAMGAETRRMKANR
                     GDELRALVEAARPDCVVFDRFLAEEAYAGRLREIAPSVVRVLDMQDAHALRRARERAA
                     KAAKTRGEDAAKEVLKSAPNARDEDLMREIASVQRSDLTLVCSPVEKEWLTRECGVAE
                     RKLRLASFFVDSVDAEAMKRDFSARKDFATIGTFMHKPNVDSVEWLCEEVWPLVRKQL
                     PNATMRVYGSYATENHRRRFHKPAQGFLFEGFAEDLGETLRAHRVLLAPLRFGAGIKG
                     KILDAWRYGLPACTTPIGSEGCVPDVVEFWSPTSSAPIDPEHGWGGFGDFTNPQDIAD
                     AAVRLHEDENLWRLARGNGADLLDRLFSARVNLPDVFDAIERVIDDVDAVRDADYFGQ
                     CLWREDVRSTTYFSKWIEAKETGATN"
     gene            complement(263650..265167)
                     /locus_tag="OSTLU_33470"
                     /db_xref="GeneID:5003596"
     mRNA            complement(263650..265167)
                     /locus_tag="OSTLU_33470"
                     /product="predicted protein"
                     /transcript_id="XM_001419722.1"
                     /db_xref="GeneID:5003596"
     CDS             complement(263655..265139)
                     /locus_tag="OSTLU_33470"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419759.1"
                     /db_xref="GeneID:5003596"
                     /db_xref="InterPro:IPR002319"
                     /db_xref="JGIDB:Ost9901_3_33470"
                     /translation="MSDADAIERDVLAAIARDGIADTASASARHGVDHQAVVGVVKRL
                     TAANMVVARAIERSRTTLTAEGERCVDEGSPEARAFACVPEEGIELDAFRTRAGPGAA
                     DVGFKQAMQRNWLAMVKGATPRVERRVETIEDDVREALRALRGGETVDAKTLETLTKK
                     RKLAKEERWKEYELTKGAEFALERKVLPADLTKEMMNEGSWRGQAFKAYNLVPGAGAQ
                     PASGHVHPLLKVRQAFREIFFSLGFSEMPTNNFVESGFWNFDTLIQPQQHPARDAHDT
                     FFMKTPATMNFAPEDYVERVRKMHETGGNGSIGHQYAWKRAEADKNILRTHTTAVSAR
                     MLYDIAQTGFKPARMFSIDRVFRNEAVDRTHLAEFHQVEGVICDKDLTLGDLIGVLYQ
                     FFERLGMTQLRFKPAFNPYTEPSMEIFAFHPMLDKWVEVGNSGMFRPEMLEPMGLPED
                     VNVIAWGLSLERPTMIMYGIDNIRDLFGSKMQITSVKNNPICTI"
     gene            <265504..>266544
                     /locus_tag="OSTLU_4642"
                     /db_xref="GeneID:5003657"
     mRNA            <265504..>266544
                     /locus_tag="OSTLU_4642"
                     /product="predicted protein"
                     /transcript_id="XM_001419503.1"
                     /db_xref="GeneID:5003657"
     CDS             <265504..>266544
                     /locus_tag="OSTLU_4642"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419540.1"
                     /db_xref="GeneID:5003657"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="JGIDB:Ost9901_3_4642"
                     /translation="AFAFASDRKAHALVTGGAGFIGSHCAEALLRRGYAVTTVDNMSR
                     GNAGAVEALRRMAPKGSLRAVRGDLGVVEDVDAAFGNTNMPVDAVFHFAAIAYVGESM
                     ADPVRYYSNITTNTVNLLRVMQAKDVRKMIYSSTCATYGNVEKLPITESTPTRPINPY
                     GKSKLYAENAIKDYALANPKFKASILRYFNVFGGDPEGVLGELPRAELREHGRISGAC
                     FDAAMKNIDKLTVMGTKHPTRDGTTIRDFVHVVDLVDAHIAVAEKNKFDNPPSLYNVG
                     TGSGVSMREFVETCKKVTGVDIEIHYRAEPRPGDYAEVYANVDKIKHELGWEAKYTDL
                     HESLTHAWKFRKT"
     gene            complement(<266804..>267538)
                     /locus_tag="OSTLU_16752"
                     /db_xref="GeneID:5003597"
     mRNA            complement(<266804..>267538)
                     /locus_tag="OSTLU_16752"
                     /product="predicted protein"
                     /transcript_id="XM_001419723.1"
                     /db_xref="GeneID:5003597"
     CDS             complement(<266804..267538)
                     /locus_tag="OSTLU_16752"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419760.1"
                     /db_xref="GeneID:5003597"
                     /db_xref="JGIDB:Ost9901_3_16752"
                     /translation="MATASDAASRPRAARAPREDASKTLVLVLCGLPGVGKTTLARAL
                     ARRARESGHDAHHARYDARELRAMTREDGTTAFEPARWRAARAEAAADVDAATRRGNA
                     REDGVKTVVIVDDNMYYRGMRWEVFRAAREARASCACAHVTAPTKEARRRNRNREGAE
                     AVPEEVFERMTRAFEAPAVTTPGDGATFPAFVVDATEETDVDAAWSRALEFWGPAPDV
                     PASEAERELEREAARAETAKSALHALD"
     gene            <267986..>268498
                     /locus_tag="OSTLU_33472"
                     /db_xref="GeneID:5003658"
     mRNA            <267986..>268498
                     /locus_tag="OSTLU_33472"
                     /product="predicted protein"
                     /transcript_id="XM_001419504.1"
                     /db_xref="GeneID:5003658"
     CDS             267986..268498
                     /locus_tag="OSTLU_33472"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419541.1"
                     /db_xref="GeneID:5003658"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="JGIDB:Ost9901_3_33472"
                     /translation="MAAVHKGEGNRAFQEKRFEDAVASFSRAAALEPKNWVFFSNRSA
                     AYAELGRYDDALDDAKETIRLNCEWTKGYVRLATACSALGRLSEATAAWRRACELDDE
                     NASLRESLAKAEAAEESSLKEGKFKFQGSKRKETAGDGEDVAGGDVTEAKKKKKKPPP
                     ATLSFADDDG"
     gene            complement(<269618..>270562)
                     /locus_tag="OSTLU_10093"
                     /db_xref="GeneID:5003598"
     mRNA            complement(<269618..>270562)
                     /locus_tag="OSTLU_10093"
                     /product="predicted protein"
                     /transcript_id="XM_001419724.1"
                     /db_xref="GeneID:5003598"
     CDS             complement(<269618..>270562)
                     /locus_tag="OSTLU_10093"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419761.1"
                     /db_xref="GeneID:5003598"
                     /db_xref="InterPro:IPR003409"
                     /db_xref="JGIDB:Ost9901_3_10093"
                     /translation="LEYTNGDEYVGECVDETRHGRGRHVCSTGDVYDGYWRDDKRHGR
                     GTMTFKSGLKYEGEWEDDKTCGRGRCEYVNGDVYEGEWKNDHRWGWGTQRFASGDVYE
                     GEWVDDIVEGNGMYTYADGSTFNGATLSGSRVRGRYAAKDGSVEYDGEWRGDYRHGRG
                     KFAAVGSYKYIGQWRDDLRHGRGKCELATGSTYDGEWRDDQYHGKGVLKTATFEYVGD
                     FEGGRRKGQGVCKFTDLGEEYRGAFDEDAENGKGKRLYADGTIYQGEWCDGKRHGKGA
                     CTYANGDEYQGEWVRDERHGYGVCVFADGTKYRGEWERD"
     gene            <271468..>272220
                     /locus_tag="OSTLU_33474"
                     /db_xref="GeneID:5003659"
     mRNA            <271468..>272220
                     /locus_tag="OSTLU_33474"
                     /product="predicted protein"
                     /transcript_id="XM_001419505.1"
                     /db_xref="GeneID:5003659"
     CDS             271468..272220
                     /locus_tag="OSTLU_33474"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419542.1"
                     /db_xref="GeneID:5003659"
                     /db_xref="JGIDB:Ost9901_3_33474"
                     /translation="MRTERYANCRVHKNCGDAYCEFRKLAWEFRAVRDRAEAKGSKAK
                     AVAEAWVRAAMKEDDAWNEAAERERKRLRAEAAKVTKAMELAARSAPTERELRRARAK
                     ELKRLDGDADVSEEPSRAGTPPPETEEEKKTRQAMEIYEKRMQRVRDLTKRRAMLLAR
                     ASTVVVHPGTNKVIALSTPEELSIVLKIEAKKKAQMEQRRRQRGLKRPMKGPNIGDMY
                     RMPRLFEEVWLYEDSNVDEPTISDLIHMNIGM"
     gene            complement(272259..274403)
                     /locus_tag="OSTLU_33475"
                     /db_xref="GeneID:5003599"
     mRNA            complement(272259..274403)
                     /locus_tag="OSTLU_33475"
                     /product="predicted protein"
                     /transcript_id="XM_001419725.1"
                     /db_xref="GeneID:5003599"
     CDS             complement(272260..274359)
                     /locus_tag="OSTLU_33475"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419762.1"
                     /db_xref="GeneID:5003599"
                     /db_xref="InterPro:IPR003010"
                     /db_xref="InterPro:IPR003694"
                     /db_xref="JGIDB:Ost9901_3_33475"
                     /translation="MRVVAVACCALNQWALDFDGNYARIRESILRAKRLGARYRVGPE
                     LETCGYGCEDHFHERDTETHAWEVIAKLCEEKELMRGAVVDVGAPATTRGARYNCRVI
                     IVDGAIAFVRPKRALADDGNYRESRWFTAWTRANEVEEFTLPESCARFGMDGKTSVAF
                     GDGAVVFDDAGLGCETCEELWTPDAPHIALALNGIEIVSNGSGSHHQLRKLDARMNLI
                     KSASGKAGGVYLYSNQRGCDGGRLYYDGCACIAVNGEIVAQGKQFDVSDVEVVAATVD
                     LDEVQSHRGAFQSMSVQAASVKRIPTVRVSGKLCVSENLKVTPKRAISFHAPEEEIAL
                     GPACWLWDYLRRSGASGYFLPLSGGADSASTAAIVGSMCQLVTRAASAGDAIVADDIR
                     RVAQLASDVPIPSAEELAKMIFTTVYLGTDNSSAETRARAAALANDIGASHLSVAIDV
                     VVTAVVTFFTTVTGKTPKFKVDGGSNAENLALQNIQARVRMVLSFLFAQLLPWVRGKS
                     GFLLVLGSANVDEGLRGYMTKYDCSSADVNPIGGISKADLRSFLRWGAMNLGYPTLAE
                     VEKAPPTAELEPIRDDYVQTDEEDMGMSYDDLGVYGRLRKIARLGPVAMFKRLYTVEW
                     ADRGLSASEIAEKVKKFFFFYSCNRHKMTTLTPSYHAENYSPDDNRFDQRQFLYNVRW
                     PWQFRKIDEIVEREKSS"
     gene            <274583..276638
                     /locus_tag="OSTLU_33476"
                     /db_xref="GeneID:5003660"
     mRNA            <274583..276638
                     /locus_tag="OSTLU_33476"
                     /product="predicted protein"
                     /transcript_id="XM_001419506.1"
                     /db_xref="GeneID:5003660"
     CDS             274583..276637
                     /locus_tag="OSTLU_33476"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419543.1"
                     /db_xref="GeneID:5003660"
                     /db_xref="JGIDB:Ost9901_3_33476"
                     /translation="MRRRARERDRARSAAASRVVALALALAGAANARARAANAGGGGR
                     PSFEAAVLPPSAFAGRTSAVTVHGLNFLPGRDAACADCNANGAATTRCAFGDARDNGA
                     VSAFDGSDASAFECAVNAVDGATGTPRLGFARGSWSANGGYDWAVFGGESGGGEDGSV
                     HFMKIPSVDDVIASVAPMGMPTYATGGDFARGALGCYFESRNDAGSWVMRATGTAAEA
                     AEHRGLFVSSALYRCESPTYERTTPSKATLARFAVGVLGNDGGSLTNVVSYKENYWLT
                     PGAATVSSGTYGLTGGETISVGVSDSDGDWANIGCLVGTTRVSARSVSTSTVTCVAPA
                     RAEDDIANVPIMVGVRYAEQSASVVTRSTDVTTYSGGTPKPTSPYELLNDELFLFGRG
                     KQVMQVSSEEDFTCVLTTVVDNVTSVFKSTTANASPFDQILNCLLPLNVEVGFVAMGI
                     TGGKYEGVTQVMFVDPPRAISASPRRSPSEGGGIVWVYGSNLNAGTDPYSSCVFTADE
                     SSSFKWAVGTGARASSALVACELPPAASVVVQNNQRTTAVAVVMRPASASANALDSGA
                     SIEYAVNVASASISPVRGSLEGGTPVRLDPTMTWVVSQSSSGTPDTDDFGTGGCRFSA
                     VTVSARVADSGAIECVSPSLGNFPYANAPVAIAVDWRTSSSPLVFFTSTNTFLNFSYV
                     RF"
     gene            complement(<276679..>278313)
                     /locus_tag="OSTLU_16756"
                     /db_xref="GeneID:5003600"
     mRNA            complement(<276679..>278313)
                     /locus_tag="OSTLU_16756"
                     /product="predicted protein"
                     /transcript_id="XM_001419726.1"
                     /db_xref="GeneID:5003600"
     CDS             complement(276679..278313)
                     /locus_tag="OSTLU_16756"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419763.1"
                     /db_xref="GeneID:5003600"
                     /db_xref="JGIDB:Ost9901_3_16756"
                     /translation="MGEATLELGEAARRAKNDDAFEALRRDAEARAREDPLSDGDVIV
                     VRRVRGARSAREAFGEAVLDETTAPRLTAVRITRGDEGGNGKEGAKYAFVVRDGNFDA
                     GCYGKYVTVHKGETVMRFETKAVTREAQWALAGGTRRDGKITLRSCARKDVILEGRVE
                     RKCSALVAFRAWSAYERASETEAQYQVDVELECETLLETLADGFAKELRAIEADIIDA
                     GRAKLGPRVIPDEMPSPIVPVNPFARASPMAASPEPHVVELDPLPSLEKRSNDVNPST
                     PAGAIGSWRGKHVFNDMDDYPSPTDAEIAAVRDEAWRFTSTAKKSTAARGNPFEDTPA
                     SSKSTRVPQATPGMSDYWEFDNTVDESIYEDARTPSSFNAREDSTSSFEFDAKETRTT
                     TTTTLAGKYNQFESDDMESAAIRKSGIDPRNVVSTPGTTSAMLKYVGQMYVSEFRSEM
                     NILNVPYVTLDEVVVDFVEHAARKRGDPTFNDPRVQINEALSEQYIMSMKTDDFLLLL
                     HDYGDEPGYAEVATLKRALAIAITTKGALSSSDSEI"
     gene            <278998..>279426
                     /locus_tag="OSTLU_33478"
                     /db_xref="GeneID:5003661"
     mRNA            <278998..>279426
                     /locus_tag="OSTLU_33478"
                     /product="predicted protein"
                     /transcript_id="XM_001419507.1"
                     /db_xref="GeneID:5003661"
     CDS             278998..279426
                     /locus_tag="OSTLU_33478"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419544.1"
                     /db_xref="GeneID:5003661"
                     /db_xref="JGIDB:Ost9901_3_33478"
                     /translation="MTLDCAAANLRELDADEARGRLQRALARHLAGCSRDEDGAVVVL
                     HDVANMSPEHVPALLPALSEDGAYAYDGESISTTRGVFVLTAHLPATRAAAAAPTDEK
                     TFTNAAKMALLDAMRAKTSDDDATALAFRRRIDVAVPANA"
     gene            complement(<280130..>281485)
                     /locus_tag="OSTLU_35010"
                     /db_xref="GeneID:5003601"
     mRNA            complement(<280130..>281485)
                     /locus_tag="OSTLU_35010"
                     /product="MFS family transporter: hexose"
                     /transcript_id="XM_001419727.1"
                     /db_xref="GeneID:5003601"
     CDS             complement(280130..281485)
                     /locus_tag="OSTLU_35010"
                     /codon_start=1
                     /product="MFS family transporter: hexose"
                     /protein_id="XP_001419764.1"
                     /db_xref="GeneID:5003601"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="JGIDB:Ost9901_3_35010"
                     /translation="MSCGGETAACGTDGANEDEIATLQAALFLGAIVGAARAGWGCDR
                     FGRRRTVVAATIPAILGWALAACAPAFSTTAMVGRVLAGISVGIVTTAAPLLLIEASS
                     KSMRGAHAILPNLAIVKGVLFMYLSPLSPVTMHWRHLAGVCAMFNVIALIIAIICVVE
                     SPRWLLAREMRIEAVEAFTTLRGAYKEREAMEDVANIVARENAKTSPPGAFAAFRWYD
                     LLLDSHLSRSMMIACALVGIQQLGGLSLAVHDDGEIPSNGAVPSSTETRIAYVVTLLF
                     GIMVCSRMVDYMGRKPCMLASLAGMCLCNLAMASAAAGYALGSARDALDVAIISFAFF
                     YGLGMAAIPMLIAAELFPQHARGTAISLTLTLYWSYVFVETFAYELALDAFGASAIHV
                     FFAVVCVVGAIYVKYAVLETANRALEDTVALVIPHNDVRVATAPSRPSRRKEAKRVVI
                     L"
     gene            complement(<282249..>283931)
                     /locus_tag="OSTLU_33480"
                     /db_xref="GeneID:5003662"
     mRNA            complement(<282249..>283931)
                     /locus_tag="OSTLU_33480"
                     /product="predicted protein"
                     /transcript_id="XM_001419728.1"
                     /db_xref="GeneID:5003662"
     CDS             complement(282249..283931)
                     /locus_tag="OSTLU_33480"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419765.1"
                     /db_xref="GeneID:5003662"
                     /db_xref="InterPro:IPR008429"
                     /db_xref="JGIDB:Ost9901_3_33480"
                     /translation="MYGFAVRLTRSLTTVSAPKAFQDVATTTTTTTAYADVCRNLWRR
                     DEVVDVRVHALAEDYEASSVNFHAETPLWGTTAPLASATRDVELDLGVALVDAVARNV
                     SVKLHAIVSRLGASLDPADEGYDDGDVLRVSFDATIWRRRRVARRRKLLGEDSARAEP
                     REDGTEGLEDGMEYYQAYYKPNATLTVVDDFAAYRGATIPDILARRMRFSDERRSGYY
                     PTVYFNEFWIIKSHLRELNETSAREMKINLNLETISQFRWQMEESMEQTWSTQRAFGA
                     AGEHDADNMKRVFLEGNPTLLAVTTVVSLLHTIFDFFAFKHDVQFWRNRKSLEGLSAR
                     SVLLNAFCQLVIFLYLCDNETSWMILISSGLGVVIEFWKVTRAMDVSVDRDGRFPRLR
                     VADKASALKSDTARHDADAMRYLSYALYPLVGVYAVYSLRTHEHKGWWSFVLSTLVGA
                     VYTFGFISMTPQLYVNYKLKSVAAMPWKQMGYKFLNTIIDDLFAFVIKMPTLHRISVF
                     RDDVIFLLFLYQRRVYRVDETRANEFGYVADAGAEDESKKDDATENESKKER"
     gene            <285157..>287680
                     /locus_tag="OSTLU_94690"
                     /db_xref="GeneID:5003663"
     mRNA            join(<285157..287347,287387..287625,287651..>287680)
                     /locus_tag="OSTLU_94690"
                     /product="predicted protein"
                     /transcript_id="XM_001419508.1"
                     /db_xref="GeneID:5003663"
     CDS             join(285157..287347,287387..287625,287651..287680)
                     /locus_tag="OSTLU_94690"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419545.1"
                     /db_xref="GeneID:5003663"
                     /db_xref="InterPro:IPR005532"
                     /db_xref="JGIDB:Ost9901_3_94690"
                     /translation="MYADVRERRRRAMEDLTPLQRRARASGGVNPFDWSDGHVGHFYE
                     FMVAENAASERGAKSRAMVFERQDESGQNVVEELFDSFRADYADRWRAEVVCGIDASA
                     GACERYRDAAAEACEALLGDDDAREMGACETYLHTYGIVHEHWHVEDYVQARNTLGYS
                     KPKMEAPKRYPANLWGDSVLARSRNGECSACSTQVITLQGYVDVDVGTTYSLGAERED
                     KWVFDAERWAHDVPMTKFKIAKTCCTNAQFACFVETGGYADRSLWSHEGWRWVEKRRA
                     AGELLAPLGWKVSPCVKFLSNGEEAPACESWRCAYFDEAPRALHPQHPVCHVSWYEAE
                     AYCNWIGARLPTEAEWEAAARTTTSWSTDKQTTKRRTYPWGEESPSEDKANLGGHFGG
                     TIDVSALGAGDSAHGCRQMLGNVWEWTASAFLPFPGFQMDYPYRENSCPWFGYRKVVK
                     GGCWATSAPIARAAYRHSFWPHMHNTFSGFRAAIGGSQKRALCILPQKIQSGAKCGNV
                     VTMERISSHLEKNHIMSITRSIFDLPQSKEDLANIIHAMNVDLIIVLHAFKCGAVIDT
                     VQAYKDMLPPIVLVLGGTDVNVDSRKSALAEEQFRRRVDVATKVVSFSLSMIEAAPKG
                     ALKFIESDSTSKTKLIPQGVMLPSTLKASKRKRLADETVETPGELQGTSRPADLSIPI
                     MFLPAGLRPVKDVCFINDALTAYNSNGIKAHLTVCGPFLDSAYAKRVRCVDRATLVRF
                     IGEAKVLLNTSVSEGQSGTIAEAMMVGTLVFARDIPGNRQLFELCEARALAALGPATI
                     KEMKGDGWEVHPRVACALSKH"
     gene            complement(<287939..>290725)
                     /locus_tag="OSTLU_16762"
                     /db_xref="GeneID:5003602"
     mRNA            complement(<287939..>290725)
                     /locus_tag="OSTLU_16762"
                     /product="predicted protein"
                     /transcript_id="XM_001419729.1"
                     /db_xref="GeneID:5003602"
     CDS             complement(287939..290725)
                     /locus_tag="OSTLU_16762"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419766.1"
                     /db_xref="GeneID:5003602"
                     /db_xref="JGIDB:Ost9901_3_16762"
                     /translation="MATAAATDDVADVVVVDGADADVVELRAVERRATRATSRAATTF
                     GALEDGPVARADAAMTAARRAHARAGVLEYDVDHRGVQVPSSARRFSMTASHRRVGAS
                     SVSLALYLDTVLQFGLLAVVLAGINAYSLTTNVTDRAFTASYAVTGWDATAGADATTT
                     CARTYETGGFVLSTSQGSRCGVPTLASFYNCPMRCDYEGAIGTFDATNACQTHYPCTL
                     EKVLTTTQTAVCCVPRVAATVNKTPKEFQAVSIVVTVVFLLFDMFYTRNRATAAAIIK
                     SSVVTASDYSVLVTGLGKGNEWTRQQIADFFSHYGEVVSVCHLTNTRRLVTMEREIKN
                     AVQRRNEIQAILDDNEGANMDEKINKSILLRRQLYRMIALKGTKPTREALVKLDAKIA
                     ELKAKVVALGENGNSHLGSAVVTFNYEQHAINCCEDHCGDYGESIIDRCTGKHSPDFN
                     GRRLIVTRAPEPSDINWQHLRRRDSNWEVVATAIGAKFVLAGALCVGGVIQYVFEVLR
                     SNQLETITNEVAFQSTASTTSSIRLQLVASSTSLVVVIINGLLDRLTVYLAQLEVYKT
                     KTIETNMLIATLTFVNLLNYVVVPIITNRCSSKADGVCNWYVPGGFVEYAFYLQVFNV
                     LLLPLRNMNIKHIIQVKILAPMSKTLSMQESLVQPPAFQLARSYAELLKILGLSAIYA
                     PALPVSYAVGVFGIFVLYWSKKYQGLYLTTAPPKLREDSFGITITARVINLLQILFGC
                     LVFYRFDDGISTTLWANIGIWAVALIPIRRIRRLCIAQTQLANSTDDVSFVKNAGLHG
                     GSTDDKTDHEMPEMRVTQSPEVTETRSRRVRTAFLCRMYQCEKSELMSKGRLGLYHPP
                     IPTHASPEQLERLLKNYEPFGALVPANANYLPGQTQSTGGDNTAPPFSEKTRAKLDIL
                     ASFQRRKSQQEHHL"
     gene            <290773..>291360
                     /locus_tag="OSTLU_93237"
                     /db_xref="GeneID:5003664"
     mRNA            <290773..>291360
                     /locus_tag="OSTLU_93237"
                     /product="predicted protein"
                     /transcript_id="XM_001419509.1"
                     /db_xref="GeneID:5003664"
     CDS             290773..291360
                     /locus_tag="OSTLU_93237"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419546.1"
                     /db_xref="GeneID:5003664"
                     /db_xref="JGIDB:Ost9901_3_93237"
                     /translation="MRRCARRALERATRAATATTRRGRASSSGDAPSKATKATTTTRD
                     DGGTENPLRGVMFPWERAVLHSERWAGELKPWQKAYWAAFALGCAFVVGARAKRYHDD
                     QESEEARRRTMEANKRALRGALEGRSFIGASGEDEEDEDEDPFDGMSPEEIEALVKRE
                     AGPSGDVYDGMTPEEINEHEEKFRGKGNLTWKTKA"
     gene            complement(<291459..>292223)
                     /locus_tag="OSTLU_93238"
                     /db_xref="GeneID:5003603"
     mRNA            complement(<291459..>292223)
                     /locus_tag="OSTLU_93238"
                     /product="predicted protein"
                     /transcript_id="XM_001419730.1"
                     /db_xref="GeneID:5003603"
     CDS             complement(291459..>292223)
                     /locus_tag="OSTLU_93238"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419767.1"
                     /db_xref="GeneID:5003603"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="JGIDB:Ost9901_3_93238"
                     /translation="VDVDGIPDRILRSTDDPERRVEKARLFAEWRERFDIDFILRTPK
                     PYFKIIKRYYPHAFHMTGKGQNACSIQIEKPGQFGHLLDAVRREAEEIGRPDDDPVHA
                     VVEHVSFVMTFLFEHIDTRPWPRGKTIRIVDMSRLGMNDIGFEVFDFLRVMSQVSKRA
                     FVERIHKIYIVHPPASFAFIFNTCKPLISERTLKQIVVCSTLDEFTSKVKREADLSSV
                     PREYGGSCECADCWRDCDRERRLRELARELNANGAR"
     gene            complement(<292618..>293646)
                     /locus_tag="OSTLU_33485"
                     /db_xref="GeneID:5003665"
     mRNA            complement(<292618..>293646)
                     /locus_tag="OSTLU_33485"
                     /product="predicted protein"
                     /transcript_id="XM_001419731.1"
                     /db_xref="GeneID:5003665"
     CDS             complement(292618..293646)
                     /locus_tag="OSTLU_33485"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419768.1"
                     /db_xref="GeneID:5003665"
                     /db_xref="JGIDB:Ost9901_3_33485"
                     /translation="MFAVEYEAVPRLSGEGMRAGAKIALTDPYVGEDGTIWLERATTE
                     LLGGVVERLERARTRAMAVFEAPNRPGVGEGDRVKAATRAAWEEEANEARALDGARDV
                     EGAAPRVVVTPNAARGVVPDSQVVDILEIGGEDDALAGDARAMGAVASPRRSTRSSLQ
                     ASGEPIFSSRERSSVPSSSAPALDDRTMALVQRVNESAVKGLWTYLGCLRAARASLDD
                     KSAMATVHAWITRTGRLEVQEDARPPLWRVKIQISDPTGAASAYLRNAPLDAFAGTTA
                     TAYVAADARERESIEASIRKRLEEFCGRIRLASLKEKIMVVQKLDAQPTGFKPSVVGA
                     LRARKAYL"
     gene            complement(<295237..>296007)
                     /locus_tag="OSTLU_3550"
                     /db_xref="GeneID:5003666"
     mRNA            complement(<295237..>296007)
                     /locus_tag="OSTLU_3550"
                     /product="predicted protein"
                     /transcript_id="XM_001419732.1"
                     /db_xref="GeneID:5003666"
     CDS             complement(<295237..>296007)
                     /locus_tag="OSTLU_3550"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419769.1"
                     /db_xref="GeneID:5003666"
                     /db_xref="InterPro:IPR001406"
                     /db_xref="JGIDB:Ost9901_3_3550"
                     /translation="RAFDFSKHAARKIALHVCYLGWDYHGFASQGAANAAAPRTVEQA
                     LFDALAKTKLVESARDVFKVADYARCGRTDRGVSGLGQIVTLRARSNGAEGVDEELDY
                     VALLNRALPNDVRALGWAPVDDELNARFDCEWRQYKYFFEKTNGLDLGAMREAARAFE
                     GVHDFRNFCRMDAENVKSFTRNVLECTIEESHDGKLMYINVRGTAFLWHQVRCMASVL
                     FMVGLGHESPTVVTELLDLERTPRKPQYPMAPEHALLLW"
     gene            complement(<296266..>297450)
                     /locus_tag="OSTLU_33487"
                     /db_xref="GeneID:5003667"
     mRNA            complement(<296266..>297450)
                     /locus_tag="OSTLU_33487"
                     /product="predicted protein"
                     /transcript_id="XM_001419733.1"
                     /db_xref="GeneID:5003667"
     CDS             complement(296266..297450)
                     /locus_tag="OSTLU_33487"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419770.1"
                     /db_xref="GeneID:5003667"
                     /db_xref="InterPro:IPR004097"
                     /db_xref="JGIDB:Ost9901_3_33487"
                     /translation="MATRANVDDGAREANALRTFLRDAKEAFARDPGACDVSVGNEAC
                     DLDSVACAVATARAASAKRGRDDGERETRAVPIVSCAREELKLRPDVVLALANAGVKL
                     GDLTCAEDVAAAATKATPRSVTLVDHNALSARLFPDAWQARVVRVIDHHEDSGMYAER
                     ADRVIELIGSCSSLVYRDVVAKAADEGVARDVARLLLGAIVLDTRMLDATTTRAAPVD
                     FAAAESLRDILGWDEDATRAEYESLSRARHDQSSFSCAQLLAKDYKQWTMGSLEVGIA
                     SFGVRFQDLLARQDASSVNDEIVAFVDARRIDVLFMMSSFEDADADGAFARQIDVTKS
                     SACSIELEAVMRDLGERTPLAPLRLPENDFGVFKSARAQLDVKASRKKVQPILLEILA
                     RF"
     gene            <298012..>299283
                     /locus_tag="OSTLU_33488"
                     /db_xref="GeneID:5003668"
     mRNA            <298012..>299283
                     /locus_tag="OSTLU_33488"
                     /product="predicted protein"
                     /transcript_id="XM_001419510.1"
                     /db_xref="GeneID:5003668"
     CDS             298012..299283
                     /locus_tag="OSTLU_33488"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419547.1"
                     /db_xref="GeneID:5003668"
                     /db_xref="JGIDB:Ost9901_3_33488"
                     /translation="MELREAREALERAQTTGRGLEALERAVAERDLEIFKRDDELRAL
                     REEVGRLRTREDDAGETMMVSASIADANTRAANAEEGARAMREALKDAETKNARERAA
                     LMDELRESRALAAKHAREAHAREEANASSSGRIDEVVFMRKELDAMAKKVSIAEAVAE
                     KLERIVAQKSEEVFNATQERDALRKKLKTTSETIDSLEREWLEFNRQGLSAQKALSAE
                     NEELHKIVDDLKSAEKDGFAEAAGEIEELKARLRTFESESGVSNRSVDRNLARESITS
                     LRSKVRELKGDIEAKDAQIEDLRNALSQKSIIEAVNAEKDAVITALQAQINASNSAAP
                     RSDSEFAVSTQNDGDIDVLDELQTVAKTLRRENAGLRRELEDVDPDVLEECIALSRRV
                     TAQNSLLASYEERLVRYTDQLGIPFTPEARP"
     gene            <299487..>300623
                     /locus_tag="OSTLU_93240"
                     /db_xref="GeneID:5003604"
     mRNA            <299487..>300623
                     /locus_tag="OSTLU_93240"
                     /product="predicted protein"
                     /transcript_id="XM_001419511.1"
                     /db_xref="GeneID:5003604"
     CDS             299487..300623
                     /locus_tag="OSTLU_93240"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419548.1"
                     /db_xref="GeneID:5003604"
                     /db_xref="JGIDB:Ost9901_3_93240"
                     /translation="MRDVAEADDAPPRPWRPDDDGAGGDDARADVDDPDEWLRGQLAG
                     MPIEKDYPELVDAAVRCMGEWKKRMPKSVWLRVTKSGRLAKELNESAPVLAKTMEYVR
                     DIDVRTPSERVVVVDLCSGFGYLAMFLSEILPKEKVAEIVLVDKMWSMMNRTPKPHHI
                     SWSHIYGEGDWKYDWPIELSTRKVDLKDYAQVNQMSVHLFSRWNGPFIVLGIHLCGTL
                     SIKAVEMFNKNSNVKHLILKPCCLPDWSWTYRAESGYFPPVGAHKHLIPTKAVCSKGK
                     WKKNKWIGPPRSHLKIKFESWNDHLCRSINDEDGNISTSLQEIQVQASHFQNLFIFGD
                     RQRIRKCHVREATGVEFPTPSGVDAKRWSPTGTGYGTHTRTLAN"
     gene            complement(<300671..>301186)
                     /locus_tag="OSTLU_35145"
                     /db_xref="GeneID:5003605"
     mRNA            complement(<300671..>301186)
                     /locus_tag="OSTLU_35145"
                     /product="predicted protein"
                     /transcript_id="XM_001419734.1"
                     /db_xref="GeneID:5003605"
     CDS             complement(300671..301186)
                     /locus_tag="OSTLU_35145"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419771.1"
                     /db_xref="GeneID:5003605"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="JGIDB:Ost9901_3_35145"
                     /translation="MNEFSVFVPVTTGAMMFASDLLRQTYVTQRTLRAELDRPYDRPV
                     IACATCASYGDGTVSGEAKTAHAPSEATVRGKRCVIIEDIIDTGKTVVALAKELYARG
                     AEEVAVIALMDKQARRDEACAKWMREKDMKIAAAFMCPDEFVVGYGLDYRGKYRELPF
                     VGILKPEIFQS"
     gene            <301434..>302345
                     /locus_tag="OSTLU_5638"
                     /db_xref="GeneID:5003553"
     mRNA            <301434..>302345
                     /locus_tag="OSTLU_5638"
                     /product="predicted protein"
                     /transcript_id="XM_001419512.1"
                     /db_xref="GeneID:5003553"
     CDS             <301434..>302345
                     /locus_tag="OSTLU_5638"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419549.1"
                     /db_xref="GeneID:5003553"
                     /db_xref="InterPro:IPR006662"
                     /db_xref="JGIDB:Ost9901_3_5638"
                     /translation="IVHFWAPWCEPCAAMDVLLETLAKRHPDVAIARCDAEAVEAVAA
                     RENVSAVPFFVFARDGRRVDAVEGADAATVTNKTRQYFPANANATTTTNAAMAKASGT
                     TDLKTRLKSLIESQPVVLFMKGHPEEPKCGFSRKVVDALAAANVKFGSFNILADEEVR
                     QGLKEHADWPTYPMLFVDGEFVGGCDIVLEMAEAGELAEACAASNGKVKNALDERIKS
                     MLGAQDVILFMKGSREAPRCGFSAKVVSALNATGVDYETFDILGDEPIRQGLKAYSNW
                     PTYPQLYYKSELIGGCDIILELAESGEL"
     gene            <303366..>306125
                     /locus_tag="OSTLU_164"
                     /db_xref="GeneID:5003606"
     mRNA            <303366..>306125
                     /locus_tag="OSTLU_164"
                     /product="P-ATPase family transporter: calcium ion"
                     /transcript_id="XM_001419513.1"
                     /db_xref="GeneID:5003606"
     CDS             <303366..>306125
                     /locus_tag="OSTLU_164"
                     /codon_start=1
                     /product="P-ATPase family transporter: calcium ion"
                     /protein_id="XP_001419550.1"
                     /db_xref="GeneID:5003606"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="InterPro:IPR006068"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="JGIDB:Ost9901_3_164"
                     /translation="GGVDAIAAALGCDLKRGLCDRAWASEERKESYGVNEFEYPPPKS
                     FWELCKDALGDLTVRILIAASVVSLAVGAGMKSHREEYGYLEGIAIVLVVFVVVFLQA
                     FIDYAKEMKFRQLNSVKDNYQVKVHRDGKSVAVPAGEIMVGDLVELAAGDKVPADALF
                     VEGSKFKANEAAMTGEPIDISKSREKDPWVLSGTSISEGSGKALIIAVGSRSQWGVIL
                     KTLIVEPSDTPLQERLERLVLLIGNFGIGAAVLTFLASMIRWIADSAKSGKWDGTLVL
                     EFLINAVTIVVVAIPEGLPLAITLGLAFAMRKMMADQNLVRRLEACETMGSATQLNAD
                     KTGTLTQNRMTVTACWLGGKVCEQVPPPSVSETFSDTLCQSMAVNSDANLSYKDNGTV
                     EHLGSKTECALLQLVEQMQPPTDDTQTYIKLREKFPVAQLYHFTSARKRMSTAISNGS
                     GTRLHVKGASEIVVKLCTKMMGADGKVSSLTTPMLKEAEAAIEAFARQGLRTLCIAYT
                     DLGKSPSSLGETPPESDLTLLGIMGIKDPIRPETAEAVRLLRGAGVTVRMVTGDNAIT
                     AEAIAREAGILEDGDDGLVLEGPDFRKMSDAEKEAIAMRIRVLARSSPSDKLVLCNLQ
                     RKLGEVVAVTGDGTNDAPALKDADVGFALGIAGTEIAKEACDIVILDDNIKSMAKAVL
                     WGRNVYQSIRKFLQFQLVVNVVAVSLNLIAAIAGIKELPLAAVPLLWVNMIMDSMGAL
                     ALATEPPSPELMKRKPFGRTAPLINKHMWRNIIGVSVYQLTVCMVFMFDGKRLLDIPC
                     KYVAASGSVAAHYDCHHQTLELNGFIFNAFVFMQVFSEINSRRIADVNVFANIHNSPI
                     FCGIIALTVGVQVLFIQAVGGTVVGPAIGFVEQNTKEWITAIILGVIILPVGVVTRLL
                     PLKWFP"
     gene            <306597..>308120
                     /locus_tag="OSTLU_16768"
                     /db_xref="GeneID:5003607"
     mRNA            <306597..>308120
                     /locus_tag="OSTLU_16768"
                     /product="predicted protein"
                     /transcript_id="XM_001419514.1"
                     /db_xref="GeneID:5003607"
     CDS             306597..308120
                     /locus_tag="OSTLU_16768"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419551.1"
                     /db_xref="GeneID:5003607"
                     /db_xref="JGIDB:Ost9901_3_16768"
                     /translation="MRVPARDGIKRVIIIAFFFAASAVEFGTYPVASVVEFRVQAPRF
                     PTSSHRKSFLSARARERATATASATRFGEAFGYSWTVEARTRETDGRNEVEVRAARTR
                     GLGLTSTRMFAFTVVTRTGVSAQSMRDRLVGTSGRELPTSAHIEQSLVESTLSTAELT
                     KIPGASGEHGDVDLVIRVRLWSNPFHVVFKDEVYDVATILGLTTYASVLILRGLSELR
                     DERERRRAARKVRLMRSEIAQLESVANEKADKLRILSAIARVPFVAVFETVQIPMRVV
                     DWTASAISDILIETANLVLIVILLLMPPSRENAPMASSENHAKQATGSKHNRKHRQRP
                     PRSPKRRSELDPKSEHARKESMDILLKRFVIAEEDMDEERQRAAKDAIGHAQAQMRAK
                     MKRDRITDMRLRDSKQREGEDFAAELFANVPGLSVGTRDMRPMSSSSSDTHERQASWE
                     LHNRQKSLIHHMLQEIDGLELPPDSKTTVPIEEPVTPKSSHTKNPSFARVWNAPTGF"
     gene            <308641..>309246
                     /locus_tag="OSTLU_16769"
                     /db_xref="GeneID:5003608"
     mRNA            <308641..>309246
                     /locus_tag="OSTLU_16769"
                     /product="predicted protein"
                     /transcript_id="XM_001419515.1"
                     /db_xref="GeneID:5003608"
     CDS             308641..309246
                     /locus_tag="OSTLU_16769"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419552.1"
                     /db_xref="GeneID:5003608"
                     /db_xref="InterPro:IPR003323"
                     /db_xref="JGIDB:Ost9901_3_16769"
                     /translation="MHAIRRVIASDNSCLFNAVGYCCEKSLRESTRLRKVIVDAIRAD
                     PATFDEAFLGKAPTEYADWISKPNSWGGQVELFILAKALRVEIAAYDIQTERCDVYGQ
                     DADYEDRIMVIYDGLHYDSIVLNPSSIGADVEKDVSRVPASTPALASVAALVRSQHAA
                     KKFTDTANFSLRCLVCQKGLTGQAEAVAHAKSTGHANFGEY"
     gene            <309592..313291
                     /locus_tag="OSTLU_46490"
                     /db_xref="GeneID:5003609"
     mRNA            <309592..313291
                     /locus_tag="OSTLU_46490"
                     /product="predicted protein"
                     /transcript_id="XM_001419516.1"
                     /db_xref="GeneID:5003609"
     CDS             309592..313221
                     /locus_tag="OSTLU_46490"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419553.1"
                     /db_xref="GeneID:5003609"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR003405"
                     /db_xref="InterPro:IPR010935"
                     /db_xref="JGIDB:Ost9901_3_46490"
                     /translation="MHIKQVIVEGFKTYREQTVVDFDDGLNCIVGANGSGKSNLFHAI
                     RFVLSDVFGNLRAEERQRLLHEGAGHAVMSAYVEIVFDNADGRLPVEREEVRLRRNIG
                     LKKDEYYLDKKHVTRAEVVNLLESAGFSRTNPYYVVQQGKIMKMATMQDEERLDLLKE
                     IGGTSVFEAKRKESLKGLDETKSKREQVQETVEFIESRLAELDEEKDELQKYTDLDKT
                     RRSLEYTIYEQDLSDARSKLDEIEQQRSATNESSRVDDDKMNTMSENLRTHEKELKDS
                     SRAAAQLKRELTTAEEELRGIVARRTTAELDVKDLRETIQTGEESLAGIAGQKTDVEK
                     ATLETQKKLDAVREKYNAEVAVEEAKDREIAEIERRSQSLYQKQGRSERFKTKGERDT
                     WLKSQIKDATATKKQKTKEVETLENDLKEIRATQSSDEKDRASMEAELIVEEEKLADF
                     EAQYKKAMTERNEAQNARKDLQRKDNEVDNSLASCEEEVKKRDKQLEFSMPRDLQRGM
                     AAVQRIVKEHNIEGVHGPLIELMETDERFHSAIEASAGNQLFHIVVDHDEIGSRVIEF
                     LNKEKGGRVTFLPLNRMNPPNVTYPEGSDAFPLLSKLKYDAKFDAAFKQVFARVLICR
                     NIDVAVSKALSSQLNCVTMDGDTVSNKGSMSGGYQDTSRSRIAAMTALRELNVNRDDL
                     KETSAGVKKSLQAAEQKMSAVLGDISRLESQRRHSAQRVDRLKHELRFYGDTGTRASS
                     LLEQTEKSIAVMRADIEQVDTHIADLTSEIGSSLDATLSQAEVQELEKLTSHATTLKQ
                     EKVTIAARRLDVYTQLSELQTALETNLNRRAKRIALTSGELDINSLRAELAKLEGQLK
                     TVQNDEAIVRKNYDGIAEKLRTVQANIEAANTEIEKLRAFKESMSSSLGEREKVMETL
                     MSKAATLSQKREALQKKIRELGSLPSDAFDRYRGESLKSLHKLLSKTNNQLSKLGHVN
                     KKALDQYQQFTEQREELEKRRSEINKAFDSITQLIDHLDHKKDEAIERTFKQVSMNFK
                     DVFHRLVPGGRGELVMQRKRAANRDPEEEGEPAANPTTFSEKYSGVKIKVSFGQGETM
                     QMKQLSGGQKTVVAVALIFAIQRCDPMPFYLFDEIDAALDPQYRTAVAHMVKGQANNK
                     TQFIATTFRPEIVKEATCIQGVSHSHKVSTVQKVALEEALQFVGEDTAQVQQVAPTER
                     GPPTP"
     gene            complement(<313329..>314318)
                     /gene="SRT3501"
                     /locus_tag="OSTLU_16771"
                     /db_xref="GeneID:5003610"
     mRNA            complement(<313329..>314318)
                     /gene="SRT3501"
                     /locus_tag="OSTLU_16771"
                     /product="predicted protein"
                     /transcript_id="XM_001419735.1"
                     /db_xref="GeneID:5003610"
     CDS             complement(313329..314318)
                     /gene="SRT3501"
                     /locus_tag="OSTLU_16771"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419772.1"
                     /db_xref="GeneID:5003610"
                     /db_xref="InterPro:IPR003000"
                     /db_xref="JGIDB:Ost9901_3_16771"
                     /translation="MLELMERLAAERLGESSAAAAATALETFDLRGIAKHIERGGVKN
                     VVVMTGAGISVSAGIPDFRSERGLYARLGEYDLPYPQAIFELGYFREKPEAFYKLAKD
                     LYPGLYAPTPTHYFIKLLHDRGLLRRCFTQNIDSLECATGLPKDKVVAAHGNFDSAKC
                     LNGHDANIYEVERACRAGTPMTCAKCGEFVKPDIVFFGENLPRRFFECAQKDFEVCDL
                     LIVIGTSLVVHPFAGLIERPKEHVPRLLINLERCGEAQNTRVTKLYRMAGLGRGTGFD
                     FDEATNYRDALFLGQCDDGVAELCSMLGWKDDLDALIANCTIKKRLQASKISN"
     gene            <314827..>315879
                     /locus_tag="OSTLU_16772"
                     /db_xref="GeneID:5003554"
     mRNA            <314827..>315879
                     /locus_tag="OSTLU_16772"
                     /product="predicted protein"
                     /transcript_id="XM_001419517.1"
                     /db_xref="GeneID:5003554"
     CDS             314827..315879
                     /locus_tag="OSTLU_16772"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419554.1"
                     /db_xref="GeneID:5003554"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="JGIDB:Ost9901_3_16772"
                     /translation="MAIVERRNMAATYATLCERFAWRADAALTAKMADANAKRLGEIE
                     AKIEDAKENLGDVEIRDAMCERAEFYASVGEMEKSERAYEETEAKTASIGQKMDCAFA
                     LMRARFSRLELHEVKKLIEKIKDMLDQPGGGDWERKNRLKVYEGLHAVATRNFETATK
                     LFLDSLSTFTSYELLSYDDFVFYTVVCAVVSLPRTELKAKVIDSPEVLSVLNRLPGLG
                     DFLNALHKCDYRTFMSAFPVVAAQVEKSVWMNPHFRYFLREVRVVAYAQYLQSYKSVT
                     VKSMADSFNVSEDFIDRELSHFIVSGRLNCKIDKVSGVLQTNRPDLKNSLYQTLIKDG
                     DALLNNVSKLSRVIDL"
     gene            <316096..>317031
                     /locus_tag="OSTLU_88222"
                     /db_xref="GeneID:5003611"
     mRNA            <316096..>317031
                     /locus_tag="OSTLU_88222"
                     /product="predicted protein"
                     /transcript_id="XM_001419518.1"
                     /db_xref="GeneID:5003611"
     CDS             316096..317031
                     /locus_tag="OSTLU_88222"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419555.1"
                     /db_xref="GeneID:5003611"
                     /db_xref="InterPro:IPR001537"
                     /db_xref="JGIDB:Ost9901_3_88222"
                     /translation="MYDDSDSDSDIAYVRHVLRYMYPGSTPKNGRVIVLPAGTLGDGK
                     YGDEEIDGEFCVALLMDDGVNVDRWRVRVYDNSFDGWRLLGVGITSLCWNHVGPSLRR
                     CELQLEEKPQPASTSAMDALDLNTCRAPAVGEQNGYFGIGIYNGKNTQNLGTLWRSAY
                     QLGAAFAFVIGRRFKKEASDTPKSWTQIPTFEYSDWDDFVRKSPVSAVWVGVEMGGTP
                     LENFEHPRNAVYILGSEDTGLNTTMLRACQHHIALPTTGTRSPSFNVAVTGAIIMYDR
                     ELKRRAAAAKLAALPTQNRRDGIDSVKPLKSSASH"
     gene            <317646..>317975
                     /locus_tag="OSTLU_35077"
                     /db_xref="GeneID:5003612"
     mRNA            <317646..>317975
                     /locus_tag="OSTLU_35077"
                     /product="predicted protein"
                     /transcript_id="XM_001419519.1"
                     /db_xref="GeneID:5003612"
     CDS             317646..>317975
                     /locus_tag="OSTLU_35077"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419556.1"
                     /db_xref="GeneID:5003612"
                     /db_xref="InterPro:IPR001610"
                     /db_xref="JGIDB:Ost9901_3_35077"
                     /translation="MDSCAEGITIADFTQPDQPLIYANVGFEVMTGYSVQETVGHNCR
                     FLQGPGTDQNELNKLRNAIKKGEAVTVVLKNYKKSGEEFMNQLSLTPIRDADGQVMYY
                     VGIQSDVT"
     gene            <317979..>320102
                     /locus_tag="OSTLU_1394"
                     /db_xref="GeneID:5003613"
     mRNA            join(<317979..318500,318675..319085,319386..>320102)
                     /locus_tag="OSTLU_1394"
                     /product="predicted protein"
                     /transcript_id="XM_001419520.1"
                     /db_xref="GeneID:5003613"
     CDS             join(<317979..318500,318675..319085,319386..>320102)
                     /locus_tag="OSTLU_1394"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419557.1"
                     /db_xref="GeneID:5003613"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="JGIDB:Ost9901_3_1394"
                     /translation="LFKRRDDELNALKMMARAEAATEAKSRFLAHMSHEIRTPLNGLI
                     AVGQLLEDTNLDRLQREYVSTVRTSGETLQALISDILDFSRVEADKLVLQCEPFHPEV
                     VIGNVMEITAMQSAKKKINIGYHVDIGVPKIVMGDAMRLQQVLLNSISNAIKFTDAGN
                     IMIRLYLGREDTTEPTDDMTSDNESWFLHFYVKDTGMGLDQSTIHKIFQSFQQVETGA
                     TRKYDGTGLGLAISRKLCEAMGGTMWAESQGLGKGSTFHFCIKCKAVSEDWMKENQKS
                     RKQLASGAESLRQLERDLSVDYAAHFKRPGEKLSVLPPFVLSTWPVVQSTGFDTSDPR
                     CAWAKDSVEGTESSIDSVKGTAVRDFFSSIRSHLISRPVRHNRLRRTLETVLDEKAHH
                     ADAADTARTDSPTRASGCTRRKVDFEDGVSGQHVSGQHLRILLAEDHPVNMKVAKAVL
                     SRLGHSDVTGAKDGADALAKVQADPAGLDAFDIVLMDLHMPIMGGIECTQQLRKLYPD
                     CKVPIIAVTADAIEESRQECFDAGFDSYLTKPFRIEQIQKAI"
     gene            complement(<320209..>321678)
                     /locus_tag="OSTLU_93242"
                     /db_xref="GeneID:5003614"
     mRNA            complement(<320209..>321678)
                     /locus_tag="OSTLU_93242"
                     /product="predicted protein"
                     /transcript_id="XM_001419736.1"
                     /db_xref="GeneID:5003614"
     CDS             complement(320209..321678)
                     /locus_tag="OSTLU_93242"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419773.1"
                     /db_xref="GeneID:5003614"
                     /db_xref="JGIDB:Ost9901_3_93242"
                     /translation="MPRRGGTAPGARASAAHDDDEFAFPTSTSAPRESDDTPSPSRPF
                     NFNENLSPSPIFAPGHHTASARDVTVITMGVAVIASACACWLLQVLAYLLRPLVTATG
                     AALLLRPLVDFVSDAAYQRETLRRNRLRLCCPRVFTVPRIVAIVLALVVVCAVFGTLV
                     WALYLGRVYFLVHWNDPDWNSRFTSRINDLGRSMSEMAKRVFKKDDVAEEAWARLLAN
                     IEATLKDEEFWETLGVGVFHYMQDIMLMLFYTLFLLAPRRELSRARSLVARRIHKATR
                     RFVSIMVQIAVVRALSVGSLLGLCGVPWPLAIAVAIVSFWLFFIPTLGSIVASILPLP
                     MIVLLPDLTERQRVAGSIIPNLVSFLVGDLIGPVVYRKGLDLNEVTVLLALVFWYSVW
                     GAAGAVLGVPLTCALKIVLEEMPHEGAHALAAVMAPVQNDTTVNGDTASAVRVPMTLT
                     FIAWLKRTCGRLFRPSGTTQPRRRADEEALLAESSSDSE"
     gene            complement(<321801..>322805)
                     /locus_tag="OSTLU_33502"
                     /db_xref="GeneID:5003555"
     mRNA            complement(<321801..>322805)
                     /locus_tag="OSTLU_33502"
                     /product="predicted protein"
                     /transcript_id="XM_001419737.1"
                     /db_xref="GeneID:5003555"
     CDS             complement(321801..322805)
                     /locus_tag="OSTLU_33502"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419774.1"
                     /db_xref="GeneID:5003555"
                     /db_xref="JGIDB:Ost9901_3_33502"
                     /translation="MPTVPFAPPSARDVAPARPSARVDRRAVVVATVCAPLLARARRA
                     EAKSSLIDDLRVKRLNKPVFNGGRPRAQAYPDWLEGEWRATIDFAGYEFPSAVVAREA
                     VAREATTPGFQKLSLAYAPDVGREGKTEYRMRFARDGGDVIEDRGFNLREIVDAYVGE
                     GAVEAVEYDARRDANRTTIRLKRGASNNAERIELFTNARDSETRESDGTFFALESLRQ
                     VTLGYSTSYGVARMVPTDYTHVWTFTPLPDVDGVDGASAGEPRIGVTGVKVVNRVKAT
                     LSTAGYLQPNDALKYTASDAANPNGAPVPRVGAASQVAFEPVVLYSHVLYLERVGCVP
                     "
     gene            <323393..>323788
                     /locus_tag="OSTLU_33503"
                     /db_xref="GeneID:5003556"
     mRNA            <323393..>323788
                     /locus_tag="OSTLU_33503"
                     /product="predicted protein"
                     /transcript_id="XM_001419521.1"
                     /db_xref="GeneID:5003556"
     CDS             323393..323788
                     /locus_tag="OSTLU_33503"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419558.1"
                     /db_xref="GeneID:5003556"
                     /db_xref="JGIDB:Ost9901_3_33503"
                     /translation="MVIPSRKDEESRATRAMDTRELIEHQTAQIRGQDDALEGLDKLV
                     ENLKTTSEAIHGEVVLQAKLVEDLEADFSHTSDRMKKLRKQGFKLAGEKNEEERERLD
                     RNEVIEEMRAKLGREQRAAESADGGCVVQ"
     gene            complement(<323847..>326150)
                     /locus_tag="OSTLU_33504"
                     /db_xref="GeneID:5003615"
     mRNA            complement(<323847..>326150)
                     /locus_tag="OSTLU_33504"
                     /product="predicted protein"
                     /transcript_id="XM_001419738.1"
                     /db_xref="GeneID:5003615"
     CDS             complement(323847..326150)
                     /locus_tag="OSTLU_33504"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419775.1"
                     /db_xref="GeneID:5003615"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR011108"
                     /db_xref="JGIDB:Ost9901_3_33504"
                     /translation="MPDDDAHAGDLLEIIPLGAGSEVGRSCVIARYKQKTLMFDCGIH
                     PGYAGLASLPYFDEIDLADVDALFVTHFHLDHCAAVPFLCGRTDFNGRIFMTHPTKAI
                     YHMLMQDFCRLLKNQEPSEQLFGEKDLEASMKKIEVIDFHQEVDVDGVKVTPYRAGHV
                     LGACMFNVDIGGLRVLYTGDYSRIADRHLPAADVPAIPPHVVIVESTYGVSPHSPREE
                     REIRFTEKVQTILRRGGRVLLPVVALGRAQELLLILEDFWAQNPDLQRVPIYQASALA
                     RKAMTIYQTYINVLNSDMKAAFEEANPFVFNHVKHVSKSSELDDVGPCVVLATPSMLQ
                     SGLSRELFESWCEDPKNGVIIADFAVQGTLAREILSDVNKIIARDGRELQLNMSVDAI
                     SFSAHADYPQTQAFLDALAPPHVILVHGEAGEMGRLKRALDNKAAADDKKMSVYTPKN
                     CQPVEIIHKGERIAKITGLLAEQEIEEGDHVAGVLVQKDFGTMLIAPEDVNNYTKLRT
                     SLVTQRQLVPSKIPISTLRFALEALFEGLHVVSTLAPEEDEEEEEDAEEEANKPAAKK
                     KAAPKKKATTSRAKKAKTEPSEVEAREGEDKFDVDKADGLSINDGMVTIRKRFADEIT
                     GVEHVVIEWNSDPLTDMIVDATLSAILQLESEPEALKEAEAGLRDAIKKKDETSAEKW
                     RLRVVAAMLSAQFGELKVNEKKATLSLNIDGIDAVLEYRTRTVLCDNDALKQRVETTV
                     SRIDEAIGDAAYAHAVHSLSASSTKFA"
     gene            complement(<326672..>327700)
                     /locus_tag="OSTLU_2187"
                     /db_xref="GeneID:5003557"
     mRNA            complement(<326672..>327700)
                     /locus_tag="OSTLU_2187"
                     /product="predicted protein"
                     /transcript_id="XM_001419739.1"
                     /db_xref="GeneID:5003557"
     CDS             complement(<326672..>327700)
                     /locus_tag="OSTLU_2187"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419776.1"
                     /db_xref="GeneID:5003557"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="JGIDB:Ost9901_3_2187"
                     /translation="VKALLMKTLDGYASAVFAYGQTGSGKTYTMLGRAGARRGASESA
                     SSTRDDVETASTSSPTMNDVGSDDGLIGRSIEYLFDALGREAAGGGEKAPTKVVVSVT
                     SYEIYKEKVIDLLADESSKSLRVRWRSRDGFYVPNLSRRECANAGEALDCVREGAARR
                     RVRSHKMNAESSRSHAVLTVHVERYFGAPRANGGGDRDDDVGASCDDSGDVEITRGKM
                     TFVDLAGSERLKHSGSEDAGSRETSLINKSLFALGKVISILADESRDAKATTPHVPYR
                     DSKLTKLLMDSLGGRSLTLMIACCSANERHVEETIRTLQYAARVTSIVNIPESNTSRT
                     TETIDARAS"
     gene            <328274..>329167
                     /locus_tag="OSTLU_33506"
                     /db_xref="GeneID:5003558"
     mRNA            <328274..>329167
                     /locus_tag="OSTLU_33506"
                     /product="predicted protein"
                     /transcript_id="XM_001419522.1"
                     /db_xref="GeneID:5003558"
     CDS             328274..329167
                     /locus_tag="OSTLU_33506"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419559.1"
                     /db_xref="GeneID:5003558"
                     /db_xref="JGIDB:Ost9901_3_33506"
                     /translation="MCAASTATVARVDDVDVGARVKETRANARANAKVATCETVRAYA
                     RTAAIALEATRTYVEEHRGRYKGASDRERDAFEAETSESIRECQRCVASARDAVENAR
                     DGGALARAPQCAAHLHGIGLILSESLNDVARAFDKVRETRFAATLERAERERQRKRAA
                     TRARYDDAGTGASGADDDGVARAVRVEGVEMRQEQVHAERQDGLEEELTQLLDEVRMA
                     EKNVIEMSALSSLFATHVQAQAEQIESLYQDAIESSRHLDMGNVEMKKTIARKGSAQR
                     YVALILLVATLGLLFLDWYSG"
     gene            complement(<329419..>330075)
                     /locus_tag="OSTLU_16779"
                     /db_xref="GeneID:5003616"
     mRNA            complement(<329419..>330075)
                     /locus_tag="OSTLU_16779"
                     /product="predicted protein"
                     /transcript_id="XM_001419740.1"
                     /db_xref="GeneID:5003616"
     CDS             complement(329419..330075)
                     /locus_tag="OSTLU_16779"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419777.1"
                     /db_xref="GeneID:5003616"
                     /db_xref="InterPro:IPR006145"
                     /db_xref="JGIDB:Ost9901_3_16779"
                     /translation="MENDADGNRVEKTRFTPRWDGDASCEDWLNLKYPGKHHRFCHQL
                     DTATSGVVLTAHTREAAGNAAKLFRDRLAKKKYLAVVFGWPKEDEWTVNAKLGKDPTD
                     VKGFRERVDEENGKASETSFKVLQRGYCTLDGANRGVEVSRLECRPVTGRRHQIRLHL
                     MHSGHPILGDMAYSDDTDSYRMFLHALELVMPFEEETLTFATEPPESFNDVMSAERTH
                     "
     gene            complement(<330595..331738)
                     /locus_tag="OSTLU_25043"
                     /db_xref="GeneID:5003559"
     mRNA            complement(<330595..331738)
                     /locus_tag="OSTLU_25043"
                     /product="predicted protein"
                     /transcript_id="XM_001419741.1"
                     /db_xref="GeneID:5003559"
     CDS             complement(330595..331704)
                     /locus_tag="OSTLU_25043"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419778.1"
                     /db_xref="GeneID:5003559"
                     /db_xref="JGIDB:Ost9901_3_25043"
                     /translation="MRATRSVDSNDFCEFKSHRDSSRRVASRLSRVARVSASRASDMS
                     VEDLRARFGLPRGASSAALERALRQMRDGDDDRATTTATTNARASDGETTALRRECET
                     LRRENRALRHARVRATVRATASTTRRAREETRADASTATRDDGDDARALERIAALEAR
                     LKTAREEMRALEDREKELRGALGKAEAIADAEAEEKLALRKRLTETLGERAALKVECE
                     TQRETIESMRANERRLRDDALELEKRLARAASTRETCRKTARALEASERESAERGERL
                     ALVEAECVMLAEMVREMNKLSGVDPREFMAVAERALLGADVAPVAPSSERSPSPAASD
                     DGYATPDEDDFPSPPISGIVQRGTPDSAGSTAFNF"
     gene            <332033..>333172
                     /locus_tag="OSTLU_33509"
                     /db_xref="GeneID:5003560"
     mRNA            <332033..>333172
                     /locus_tag="OSTLU_33509"
                     /product="predicted protein"
                     /transcript_id="XM_001419523.1"
                     /db_xref="GeneID:5003560"
     CDS             332033..333172
                     /locus_tag="OSTLU_33509"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419560.1"
                     /db_xref="GeneID:5003560"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Ost9901_3_33509"
                     /translation="MFDAETGRMLAKMMGHGASVKAVATAPTQREVFASGGRDGRLIL
                     SDARTRRGAANEAEDADAGEVTPTRTVRRAHRAPGAGTRASAALHSVTSVAFDGSGSV
                     VLSSGGSDGLVKMWDARKMKGAIGVLEDEREDAFVRGSFYDVGLGARFGGEGARATRA
                     SRGISGIAVDPTSSRVVVSYLDDHMAMFDANDPRGKPLRHFVGHRSRSYYIKPTFSPD
                     GDRVACGSLDNDVHVWDVRDASAPSVALDGHTASVSCVHWSPTDPHALASCCDDGEIR
                     LWRFDGARKPSVRARVDSRAKRPAPPLHPNILRALGRAPTFDDSASADHDIAIPGAFA
                     PASPSAPTRVLAADVPPAKRRERVEPSPRRPFRDVANVRGRRALS"
     gene            <333809..335927
                     /gene="HDA3504"
                     /locus_tag="OSTLU_33510"
                     /db_xref="GeneID:5003617"
     mRNA            join(<333809..334886,335114..335927)
                     /gene="HDA3504"
                     /locus_tag="OSTLU_33510"
                     /product="predicted protein"
                     /transcript_id="XM_001419524.1"
                     /db_xref="GeneID:5003617"
     CDS             join(333809..334886,335114..335910)
                     /gene="HDA3504"
                     /locus_tag="OSTLU_33510"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419561.1"
                     /db_xref="GeneID:5003617"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="JGIDB:Ost9901_3_33510"
                     /translation="MVRRATEGGARREPSWPPSKAALNRIDSLGDCRSAPRGVDAKNA
                     NGDTALAVACALEDGKACEEMVKILVDAGADASALSNGMAPVHWACALGHRDALACMV
                     DASSTSIVNLRAEDGSTPLLVAAEHGKIEVIRWLLERGDVDAMARNAHGRDVLGALGA
                     KMRRQSQSARSELRAEIFELIPSLRLAFLSHPDCEEHVSFKPHQESPERIVAILAELQ
                     RVIDRGELAMGELDKTCTFGAAEPSDILRAHDENYVRVLAELSDRVGQTPIAFTPYCQ
                     NHNGVPEKLQKPAENSDTFFSPGTLQAALRAAGGVIHAVDRVLDGKNRSAFVCCRPPG
                     HHAGINGATEGAPSSGFSILNNAMIGALHAIDVRKCMRVAVVDFDVHHGNGTEEIARH
                     WLTKQRARDDYHRHKSPDLFFASIHLADDGTSSGMLPFYPGSGVQDDLMNNIVNVVVP
                     PMWLAKGASATAHAETGERARKKTKRFADSEDAAAAPPPKTIAIEPEQQQGGRLEWMK
                     AFRERLIPALRAFGPELIIVSAGFDAAASDVGNLGVDPRRNTRHQGANLRAEDYEDMT
                     KLLVNVSNVCDGRVVSILEGGYGHLMSVGKSSDGAQNALTLGRDVFAKCVKAHVQALI
                     "
     gene            complement(<335974..>337032)
                     /locus_tag="OSTLU_94705"
                     /db_xref="GeneID:5003618"
     mRNA            complement(join(<335974..336629,336651..>337032))
                     /locus_tag="OSTLU_94705"
                     /product="predicted protein"
                     /transcript_id="XM_001419742.1"
                     /db_xref="GeneID:5003618"
     CDS             complement(join(335974..336629,336651..337032))
                     /locus_tag="OSTLU_94705"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419779.1"
                     /db_xref="GeneID:5003618"
                     /db_xref="JGIDB:Ost9901_3_94705"
                     /translation="MNEATLKPFDAESPLWDCVVVTRKKTSAAWDGDAKTSPEPPVVM
                     FRVSHAIGDGIALVDVLKKVSTALDGGDMRLLDFKRRAAKAHKSVLAVIWAFITFIFV
                     CIYGALKAVFTAAGPYDTKTTFKGSRKRRVVVCPPIPMEDVKKIKNGSGCTVNDIVVA
                     ALAGAIQQYLEEMGDKSAAKKPLIRAATPYAFPNRVVGALTNSWTFVSLTFPMGVMSA
                     AERLSKAQKVCNFMKRSPEPYVTRALNEVVATAGPDVQRQVVFDYMSRHSMVFTNVPG
                     PTEPILLMGSRVRDIVFACSNLVNQVSVFSYAGNLRLTLVVDPDATPDADYIGEAFAR
                     EIQTLRANVSN"
     gene            <337727..>338980
                     /locus_tag="OSTLU_35070"
                     /db_xref="GeneID:5003561"
     mRNA            <337727..>338980
                     /locus_tag="OSTLU_35070"
                     /product="predicted protein"
                     /transcript_id="XM_001419525.1"
                     /db_xref="GeneID:5003561"
     CDS             337727..338980
                     /locus_tag="OSTLU_35070"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419562.1"
                     /db_xref="GeneID:5003561"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="JGIDB:Ost9901_3_35070"
                     /translation="MERLTTTRAVCDDAQMPATHANASGATTTSEGSSTTTDLYARLK
                     SLQRELELVEIQEEYIKDEQKNLKIELLRAQEEVKRIQSVPLVIGQFLEMVDAETGII
                     SSTTGSNYYVRILSTLNRELLKPSSSVALHRHSNALVEILPPEADSSISLLSDAERPD
                     VKYSDIGGADVQKQEIREAVELPLTHFDLYRQIGIDPPRGVLLYGPPGTGKTMLAKAV
                     AHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDSIATARFDA
                     HTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIECPH
                     PDRRQKRLVFQVCVNKMSLSDEVDLEDYVSRPDKISAADIRSICQEAGLQAVRKNRYV
                     VLPKDFEVAYKTNVRKPDNDFEFYR"
     gene            complement(<339169..>339585)
                     /locus_tag="OSTLU_8690"
                     /db_xref="GeneID:5003619"
     mRNA            complement(<339169..>339585)
                     /locus_tag="OSTLU_8690"
                     /product="predicted protein"
                     /transcript_id="XM_001419743.1"
                     /db_xref="GeneID:5003619"
     CDS             complement(<339169..>339585)
                     /locus_tag="OSTLU_8690"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419780.1"
                     /db_xref="GeneID:5003619"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="JGIDB:Ost9901_3_8690"
                     /translation="RRPGDWTCARCNAHCFASRNSCFRCKRGKDEGAEGSFSPPGGTS
                     KASSEAGGPGAGVFRAGDWICGSCSAHNFQSRDHCFKCSNAKTGNEAPPQSEGSRDGG
                     PQTENFRSGDWICGSCSAHCFSSRQTCFRCSSARPAG"
     gene            <342631..>343464
                     /locus_tag="OSTLU_34943"
                     /db_xref="GeneID:5003562"
     mRNA            <342631..>343464
                     /locus_tag="OSTLU_34943"
                     /product="predicted protein"
                     /transcript_id="XM_001419526.1"
                     /db_xref="GeneID:5003562"
     CDS             342631..>343464
                     /locus_tag="OSTLU_34943"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419563.1"
                     /db_xref="GeneID:5003562"
                     /db_xref="InterPro:IPR003402"
                     /db_xref="JGIDB:Ost9901_3_34943"
                     /translation="MLEAKGLNVNLAQEAPTRWEKLGDLVLLPANAFTASDFSAFGAE
                     LYACVARVLGASRVARQAPVSQGPKRESRAVMLYPEGADGWVETKELGVTYGLDVTKV
                     MFSSGNGTEKNRMGAVGANGETVVDLFAGIGYYTLQLLKNAGAAKVYACEWNPNSCEA
                     LRHNLRVNGVESRCEVLEGDNRRTAPTGVADRVLLGLLPHAEMSWETAIKALKPKGGV
                     LHVHSNVNSGDEDEWMVRLVSELKSLAETNGRGDLDIVVEHLERVKWYGPRIRHVVCD
                     VR"
     gene            <343510..>344631
                     /locus_tag="OSTLU_34749"
                     /db_xref="GeneID:5003770"
     mRNA            <343510..>344631
                     /locus_tag="OSTLU_34749"
                     /product="predicted protein"
                     /transcript_id="XM_001419527.1"
                     /db_xref="GeneID:5003770"
     CDS             343510..344631
                     /locus_tag="OSTLU_34749"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419564.1"
                     /db_xref="GeneID:5003770"
                     /db_xref="JGIDB:Ost9901_3_34749"
                     /translation="MAPKSAVLARQPARTSGTNVRRVHRPLPADFKNTIAAQRVPAVI
                     SGLDIGQAPWTWTPSYLASLDGVPEKLVSVHVSRDPKLDFVRKNFKYVVMPFGELLAK
                     VNDASDDNFYYLRSIGENPRKEPAHALLQFPSFARDLKLPSEFWGSEDNYFSAVVRVS
                     SGDLQLWTHYDAMDNMLIQLHGEKRVLLFPPSVSGDLYLEGSSSVVRDVDDHDRESFP
                     RFARARKAALEVILQPGDVLYIPALWAHHVTALHGPSIALNVFFRHLPTSGYPSKDLY
                     GNADPIAAASALKSINSAIESLKELPLDYRVFYAGVAAARLESELGVESARRALATVN
                     DDTPKSRGMNSRATKGTGVVGTVLSALACLLITRRASRK"
     gene            complement(<344684..>345520)
                     /locus_tag="OSTLU_88233"
                     /db_xref="GeneID:5003771"
     mRNA            complement(<344684..>345520)
                     /locus_tag="OSTLU_88233"
                     /product="predicted protein"
                     /transcript_id="XM_001419744.1"
                     /db_xref="GeneID:5003771"
     CDS             complement(344684..345520)
                     /locus_tag="OSTLU_88233"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419781.1"
                     /db_xref="GeneID:5003771"
                     /db_xref="InterPro:IPR000850"
                     /db_xref="JGIDB:Ost9901_3_88233"
                     /translation="MFARRLSVVTARALSRKYASTPFDATGAAVDALRDELASTCDGV
                     LEQGKKLNWVFLGAPGVGKGTYASRMAKQMGVPHISMGDLVRAEIKGETALGKEMKAI
                     AARGELVPDALVLDILDKRVKRGEAEGERGFLLDGFPRTVPQAETLSTMVEVTQVLNL
                     TLREDILVEKCCGRRECGECGKSFNIADIRSEKAGEQTIIMPPLNPPQECFAKLTQRP
                     DDTEEVVRARLEVYKKSTIPVENYYRGKGLLSDFPIMGGIPETTPVLLKHIIDILKAS
                     TR"
     gene            complement(<345848..>346234)
                     /locus_tag="OSTLU_8121"
                     /db_xref="GeneID:5003563"
     mRNA            complement(<345848..>346234)
                     /locus_tag="OSTLU_8121"
                     /product="predicted protein"
                     /transcript_id="XM_001419745.1"
                     /db_xref="GeneID:5003563"
     CDS             complement(<345848..>346234)
                     /locus_tag="OSTLU_8121"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419782.1"
                     /db_xref="GeneID:5003563"
                     /db_xref="InterPro:IPR007248"
                     /db_xref="JGIDB:Ost9901_3_8121"
                     /translation="EHDFERTARFFVVGAALHGPFFHVAFRALERAMGASTNAATVAR
                     KVAVGHTVLFPTYTAGFFFFMSALEGETMTAAYDRFRDKAAETFISGTCYWPFANAFN
                     FAYVPRAGRILFLNAAGVAWNAYMSHV"
     gene            <346943..>347359
                     /locus_tag="OSTLU_16788"
                     /db_xref="GeneID:5003564"
     mRNA            <346943..>347359
                     /locus_tag="OSTLU_16788"
                     /product="predicted protein"
                     /transcript_id="XM_001419528.1"
                     /db_xref="GeneID:5003564"
     CDS             346943..347359
                     /locus_tag="OSTLU_16788"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419565.1"
                     /db_xref="GeneID:5003564"
                     /db_xref="JGIDB:Ost9901_3_16788"
                     /translation="MVAGELDAELAALADEAQAARERNARVKKEIEELAEELLGSGQR
                     VNNDSKPAPGSLSELKMKAVEAEADAVDKRMQATLQDTQRATTYTMVLLLLSFLGFTL
                     VAEGAYDKFAAVAGAFALVAYQSRAELQAKSKGKQR"
     gene            complement(<347528..>347875)
                     /locus_tag="OSTLU_7981"
                     /db_xref="GeneID:5003772"
     mRNA            complement(<347528..>347875)
                     /locus_tag="OSTLU_7981"
                     /product="predicted protein"
                     /transcript_id="XM_001419746.1"
                     /db_xref="GeneID:5003772"
     CDS             complement(<347528..>347875)
                     /locus_tag="OSTLU_7981"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419783.1"
                     /db_xref="GeneID:5003772"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="JGIDB:Ost9901_3_7981"
                     /translation="DFERLNALFVSVGFSSRACDKLQKAVDNSYLALWVTTTRDSRFA
                     KEGEVVGFARATSDGTFHATVWDVVVSPAWQRHGIGQGLMERIVDKILEEDICNVGLY
                     SENKVVGLYERLGF"
     gene            complement(<348346..>348885)
                     /locus_tag="OSTLU_93247"
                     /db_xref="GeneID:5003565"
     mRNA            complement(<348346..>348885)
                     /locus_tag="OSTLU_93247"
                     /product="predicted protein"
                     /transcript_id="XM_001419747.1"
                     /db_xref="GeneID:5003565"
     CDS             complement(348346..348885)
                     /locus_tag="OSTLU_93247"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419784.1"
                     /db_xref="GeneID:5003565"
                     /db_xref="JGIDB:Ost9901_3_93247"
                     /translation="MPRGRRARAPRDDARDDDELRDVSPSEAYGFAGMALTTLAFALW
                     LVGVFASEAALERLGAPSGAAARHYARALPMWLIASCLYAFVGYECLNLMSTPDDAAT
                     TFGATDPDPSEYVLDGGRRANETFDLDEGLRSSIPLFRDISQAEVTARMFRERGDAAA
                     DAEAKSRTRTTRSRSKKAS"
     gene            <349144..>350157
                     /locus_tag="OSTLU_33520"
                     /db_xref="GeneID:5003566"
     mRNA            <349144..>350157
                     /locus_tag="OSTLU_33520"
                     /product="predicted protein"
                     /transcript_id="XM_001419529.1"
                     /db_xref="GeneID:5003566"
     CDS             349144..350157
                     /locus_tag="OSTLU_33520"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419566.1"
                     /db_xref="GeneID:5003566"
                     /db_xref="InterPro:IPR004820"
                     /db_xref="JGIDB:Ost9901_3_33520"
                     /translation="MDGCFDTMHYGHANALRQARACGDKLLVGVVNDAEIRRCKGPPV
                     CDERERVEAVEACKWVDGVITDVPYEVTDAFTDELFAKHEVDYVIHGDDPCLLPDGSD
                     AYAYPKRIGRYKEIKRTEGVSTTDIVGRLLRMGARAAGEEVKEEEAKEATFCTTSARI
                     AQFGTNAGVPTDAKVVYVHGAFDVFNRGHIDLLRQAKTRGDFVLVGVHADAEVRARRG
                     AEHPVLNEKERALSVLACRYADEVVIGAPAMITNDLLTTFNVKVVIAEDDEPYAVGGV
                     DVNALAVERGLYERVPRRHDCSVLGVAKRIMENRAEFEARNARKTKSESAYYAEKKHV
                     AES"
     gene            complement(<350296..>350664)
                     /locus_tag="OSTLU_94712"
                     /db_xref="GeneID:5003773"
     mRNA            complement(<350296..>350664)
                     /locus_tag="OSTLU_94712"
                     /product="predicted protein"
                     /transcript_id="XM_001419748.1"
                     /db_xref="GeneID:5003773"
     CDS             complement(350296..350664)
                     /locus_tag="OSTLU_94712"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419785.1"
                     /db_xref="GeneID:5003773"
                     /db_xref="InterPro:IPR003197"
                     /db_xref="JGIDB:Ost9901_3_94712"
                     /translation="MSRAMRKMLEPMLKSMSVNYRRTVGDELRKYGLRYDDLLDEGQD
                     LDVGEALKRLTAEERDMRAQRLKRAIDLSMKHSYLTKEEQATQTPFDFYLTPIVERVK
                     AERAERTALGGSQPYNRQIP"
     gene            <352287..>353585
                     /locus_tag="OSTLU_33522"
                     /db_xref="GeneID:5003567"
     mRNA            <352287..>353585
                     /locus_tag="OSTLU_33522"
                     /product="predicted protein"
                     /transcript_id="XM_001419530.1"
                     /db_xref="GeneID:5003567"
     CDS             352287..353585
                     /locus_tag="OSTLU_33522"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419567.1"
                     /db_xref="GeneID:5003567"
                     /db_xref="JGIDB:Ost9901_3_33522"
                     /translation="MASAHETILEEFSVLEDQLLAAQTREDEAVQYAEQVAADLAVTS
                     RWCETLEAEQASAKALAEKAAKDAARVAETRAVELENRIKELELELLRNSVPEMERTR
                     DEAEKAAREAREKYQEAHDQRESALEALENETAAKRELMEQVATLQRQLEDVERVRAN
                     DRAEIDRTREELRARYQAEKDSQDRFAKAQREHELELKTAREAVAEREDQLIKMRRDR
                     DDVLHKLHLKEEEVVEARANMRASLLNVEALQTATNEAKETRQASNKELEDLRLCNSD
                     LLVQVKHAKRELEDTSVALNKLTEKLQDLEDGSESAIRKRREAEDEIHDLKHSIIDLE
                     AKNKALEMDREVAYQAADVARTENAKVSASVLDLTEEVARLKSALVAAQDSTRALLDE
                     EAARLQRLAPTVQDSDYVSPAWLHDNSWQQPSVTLVSSSS"
     gene            <355116..>355742
                     /locus_tag="OSTLU_6754"
                     /db_xref="GeneID:5003774"
     mRNA            <355116..>355742
                     /locus_tag="OSTLU_6754"
                     /product="predicted protein"
                     /transcript_id="XM_001419531.1"
                     /db_xref="GeneID:5003774"
     CDS             <355116..>355742
                     /locus_tag="OSTLU_6754"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419568.1"
                     /db_xref="GeneID:5003774"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="JGIDB:Ost9901_3_6754"
                     /translation="LGDVLHSIVDLQESILRELREEILAHASLMRDISRCVSEIDVLL
                     AFADIAVNYNMCRPTLRDDDAFEVAGARHPLYESFIEGEFIGNDVHMPTDRDRVIVLT
                     GPNGSGKTVMMQTIGLITYLAHCGSFVPATRAVIGLTDRIYTAMTALREDAERKTRVP
                     ESGFTYALHQVARMINNATRRSLCLLDEFGIQTQSTDGAALLAAIVEHF"
     gene            <356625..>357164
                     /locus_tag="OSTLU_6819"
                     /db_xref="GeneID:5003775"
     mRNA            <356625..>357164
                     /locus_tag="OSTLU_6819"
                     /product="predicted protein"
                     /transcript_id="XM_001419532.1"
                     /db_xref="GeneID:5003775"
     CDS             <356625..>357164
                     /locus_tag="OSTLU_6819"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419569.1"
                     /db_xref="GeneID:5003775"
                     /db_xref="JGIDB:Ost9901_3_6819"
                     /translation="ISRKVARTARACKSLGRWSFWSQLVLTTVAAVIVVFSFLYKGLT
                     KSTDAGLYFILFGLVAGYFTTVWSLGVVRLGDKLRKGSKDLDLVPPRTDVIRTLSTGL
                     TVNVIGLGATIVGLQATTGMLFAKTLTAAAQMPMYGAPVVGTGVALDIFLVQAASNAM
                     LGHWFGLATSLWLLRTVNLP"
     gene            complement(357266..>358784)
                     /locus_tag="OSTLU_25047"
                     /db_xref="GeneID:5003776"
     mRNA            complement(join(357266..357800,358047..>358784))
                     /locus_tag="OSTLU_25047"
                     /product="predicted protein"
                     /transcript_id="XM_001419749.1"
                     /db_xref="GeneID:5003776"
     CDS             complement(join(357300..357800,358047..358784))
                     /locus_tag="OSTLU_25047"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419786.1"
                     /db_xref="GeneID:5003776"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="JGIDB:Ost9901_3_25047"
                     /translation="MTRSSSDTSSSDARDVDDVDSRSASSSDEDEGTDGYKRGGYHPV
                     SIGERYNDDRYVVVKKLGWGHFSTCWLVEDARARGASGEDGAVKTLRALKIQKSSGSY
                     TEAARDEIEILKQVKEGDTGDGDEATNVVCLYDSFTHEGPNGTHVCMVFDVLGDNLLT
                     LIKRYEYLGVPLLGVKALTRAMLKGLRYLHGKKNIIHTDLKPENVLLTFKLPEKKRRR
                     KKRGKSSKKKATEDEAKPTIESQIEALDNLDAKICDLGNACWVDRQFTQDIQTRQYRS
                     PEVILGAKYDTSADIWSLACIVFELATGDVLFDPRSGKDYDRDEDHLALMMELIGRMP
                     KHLALSGKYSKEFFNRNGELRHIRSLKFWPCERVLMEKYNMSETDSKELSDFLSPMLD
                     FNPSKRASAEQMLEHPWLQF"
     gene            complement(<358911..>359672)
                     /locus_tag="OSTLU_16795"
                     /db_xref="GeneID:5003568"
     mRNA            complement(<358911..>359672)
                     /locus_tag="OSTLU_16795"
                     /product="predicted protein"
                     /transcript_id="XM_001419750.1"
                     /db_xref="GeneID:5003568"
     CDS             complement(358911..359672)
                     /locus_tag="OSTLU_16795"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419787.1"
                     /db_xref="GeneID:5003568"
                     /db_xref="InterPro:IPR003675"
                     /db_xref="JGIDB:Ost9901_3_16795"
                     /translation="MRALGVACACALALAYVAALFATTAIDDDRDDARVMKRRFASLS
                     VVCALAWAPARVASDETMTLDAWRRTLGLAPPLGEARAVAYGMSVALAATLGETAARA
                     REGRRDGRRTRRTTLAAFRDYAHAPLCEEWCFRACALATLMRSGASAASASALSSALF
                     GAAHAHHYFGMRAKGADARTALRASATQFAFTFAFGLAACRVFLRRESLSAATACHCV
                     CNYVGAPSARAFRDARAVAASALGVSLALVLLVFA"
     gene            <360122..>360748
                     /locus_tag="OSTLU_33526"
                     /db_xref="GeneID:5003569"
     mRNA            <360122..>360748
                     /locus_tag="OSTLU_33526"
                     /product="predicted protein"
                     /transcript_id="XM_001419533.1"
                     /db_xref="GeneID:5003569"
     CDS             360122..360748
                     /locus_tag="OSTLU_33526"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419570.1"
                     /db_xref="GeneID:5003569"
                     /db_xref="JGIDB:Ost9901_3_33526"
                     /translation="MLTLELESAKGQGGERELRQCVYAEIAPEMVPEDEERGEEVSFR
                     DEANAFMLPTATLKEIVDDLEWPNGDVLLECDVDMLKFSAHGAEIGDLAVDVDVGATG
                     RLTEFSCAQPSASRYKYRFLKSATAVGGSFLGGGGAGAGGGGGDDTVTMTRVSISNVG
                     FLKIVHLLHLSRGQVSFGAEGGLNAFMVPVTYILHPIEADADEYADEE"
     gene            complement(<360820..>363327)
                     /locus_tag="OSTLU_16796"
                     /db_xref="GeneID:5003777"
     mRNA            complement(<360820..>363327)
                     /locus_tag="OSTLU_16796"
                     /product="predicted protein"
                     /transcript_id="XM_001419751.1"
                     /db_xref="GeneID:5003777"
     CDS             complement(360820..363327)
                     /locus_tag="OSTLU_16796"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419788.1"
                     /db_xref="GeneID:5003777"
                     /db_xref="JGIDB:Ost9901_3_16796"
                     /translation="MAATSAATIWAASLESAKRVADFARGNTKVTFEEAAVRWRGAQE
                     EVTRERAWYDACVHRVRDGCARRAREDAETRRSAAEVVGGANDAKLRALRRKIRRCER
                     ALSNLSAKLKPAYVANSSTFWNERCLNASATTAPKRSVLLAMNESGARETMARYHSSS
                     ESYTSDIERSVALLLTNIDARSKYDLEYMDNKSERLQNVSLDVKRFAESGYAAIHDRS
                     IEAIQDFNSSVGTGLNAFSYGVSTAVDTMRTNVVNASLALMMSEVGEIADEMAAYAIN
                     VDATFENVLTWFDDFETNVRPVIQSLEDSHGLNLPNTPLISLPNAPVVSVPDFQWLSP
                     DLPIGGFDGLSDDFTTLMSASATIAGSTINNALTEATSVDIGVDLGIPSLLSDYDPPP
                     FESSDGSTTDNSTQFGEETLQAIRERSDLFVESTNASSAQTSDFVRFGLNQSAAAVMY
                     LTTTNFSSPDVAPDADDFDFFNITFRGVHIHGFFSIAEFAFAGLVNIDLTYRVIRCVS
                     VVSKHLSYGALELEPLNLIDGDRDAGERKISSLEQFARFVADPAMVAFVRFTIFIAIT
                     VASLHVYRQTHRSYVKGCVESRNGTLAADYAFVFAHSYVNTAPRTRALAFDSYLAYNF
                     TKTCDARRVATAERFNVADVERHRLETTLDASRETLLAIDACVDVIHGDESEIFQTHA
                     RAAQSCALESFKLDDGGAASECQPPTCSAATSCVGPIDDLLRAHAIETTCAVERYAHD
                     WIQRALLLVLSYASMNFAREPFVDALGRVVALTQNIDDIAVIAWYDRDRDEACVADDS
                     VVRVRRALRNARVRGCVVMATCVACQLPWVLLASALR"
     gene            <363554..>364000
                     /locus_tag="OSTLU_93251"
                     /db_xref="GeneID:5003570"
     mRNA            <363554..>364000
                     /locus_tag="OSTLU_93251"
                     /product="predicted protein"
                     /transcript_id="XM_001419534.1"
                     /db_xref="GeneID:5003570"
     CDS             363554..364000
                     /locus_tag="OSTLU_93251"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419571.1"
                     /db_xref="GeneID:5003570"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="JGIDB:Ost9901_3_93251"
                     /translation="MPDERATETQKHPRIGVGVIIRREDGRIVVGRRRGSHGLGQLAL
                     PGGALEWKESIAQCASRETMEETGLDIAPEAWIAPFAMCESVIDENNHWLTVFALADV
                     AADCEPANVEPHKCEGWTFMSIGDVREADNLFLPLRKLVNDRTVAL"
     gene            <364205..>364906
                     /locus_tag="OSTLU_16797"
                     /db_xref="GeneID:5003778"
     mRNA            <364205..>364906
                     /locus_tag="OSTLU_16797"
                     /product="predicted protein"
                     /transcript_id="XM_001419535.1"
                     /db_xref="GeneID:5003778"
     CDS             364205..364906
                     /locus_tag="OSTLU_16797"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419572.1"
                     /db_xref="GeneID:5003778"
                     /db_xref="JGIDB:Ost9901_3_16797"
                     /translation="MPPKKVLGEKRLTAEEKKRKEEKEKREKDKERKERKAQLAADRT
                     FGLKNKNVSAKVAAKVDDLKRDAPTKEAERARAEARAREKKKQKDAEEAAKRELEILM
                     GVRSAIPERRKVAAEGEDALAGELESMVVTAEPKNFVRKTVETQNEATEPTKELTEEE
                     RREIIAKIELEKARVKEAELKAKVDVNPFHVDDEGWYDSDEDPFELLKMVAGNKRAII
                     MPKGYEDPDEDAMET"
     gene            complement(<364951..>365757)
                     /locus_tag="OSTLU_93252"
                     /db_xref="GeneID:5003779"
     mRNA            complement(<364951..>365757)
                     /locus_tag="OSTLU_93252"
                     /product="predicted protein"
                     /transcript_id="XM_001419752.1"
                     /db_xref="GeneID:5003779"
     CDS             complement(364951..365757)
                     /locus_tag="OSTLU_93252"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419789.1"
                     /db_xref="GeneID:5003779"
                     /db_xref="JGIDB:Ost9901_3_93252"
                     /translation="MARLERLPFECYVLRDALDARERARATESVARYASREAWARAAA
                     NDHPTIVASHARGQRERAMACVRACGLKRCTGACGGDVGALSEAPIDLFELSARVVAT
                     AKTKDDDDGALRRAFANDDPFEASHFWALVYGEAASGDGKRRETMAPHLDRGVGWVVS
                     ISLGGRPTRMTIGKPPARGSMYDAYAQSRPVEGQDLGVEIVVNDGDAVIFRGDRVFHS
                     VDGFAGEPVVGHDEWARALVGANGVDGYGVGRLALLFREERETQSKAVRY"
     gene            <365898..>366887
                     /locus_tag="OSTLU_34716"
                     /db_xref="GeneID:5003571"
     mRNA            <365898..>366887
                     /locus_tag="OSTLU_34716"
                     /product="DMT family transporter:
                     phosphate/phosphoenolpyruvate"
                     /transcript_id="XM_001419536.1"
                     /db_xref="GeneID:5003571"
     CDS             365898..366887
                     /locus_tag="OSTLU_34716"
                     /codon_start=1
                     /product="DMT family transporter:
                     phosphate/phosphoenolpyruvate"
                     /protein_id="XP_001419573.1"
                     /db_xref="GeneID:5003571"
                     /db_xref="JGIDB:Ost9901_3_34716"
                     /translation="MGAIRQRFSRAHRAQCARAVILSLLWACASSSLIFLNNHLLRER
                     GFSYPMMLCTMGMLSSWLIACALVHTGRVKLKHEAVVTRRWYARHILPIGSLGAVSLG
                     FGNYVYLYLSVSFIQMLKSAVPAVTLVVMTTAGLEKLHGTTLLGVGIVTLGTFIAAYG
                     EVKFSAIGVVMMIVSEFAEAIRMAFYQYVLGNLKFDLIEGLYVMGPAALLFLGLGIVM
                     FELRDFLDNGAWYIPMDSPHHFFAAALLGFGVNYLTLGVIKATSGLTFKVMGQVKNAV
                     VILLAVVIFGNPVTSIQLFGYTLSLVGFFIYQRGKSQQLVAAIRDRDAASAKE"
     gene            complement(366933..368241)
                     /gene="ClpR1"
                     /locus_tag="OSTLU_25048"
                     /db_xref="GeneID:5003780"
     mRNA            complement(366933..368241)
                     /gene="ClpR1"
                     /locus_tag="OSTLU_25048"
                     /product="chloroplast Clp protease, subunit of ClpP
                     peptidase complex"
                     /note="Has EST support"
                     /transcript_id="XM_001419753.1"
                     /db_xref="GeneID:5003780"
     CDS             complement(367011..368156)
                     /gene="ClpR1"
                     /locus_tag="OSTLU_25048"
                     /note="Clp protease, ClpP subcomplex, inactive subunit
                     with structural role, chloroplast-targetted"
                     /codon_start=1
                     /product="chloroplast Clp protease, subunit of ClpP
                     peptidase complex"
                     /protein_id="XP_001419790.1"
                     /db_xref="GeneID:5003780"
                     /db_xref="InterPro:IPR001907"
                     /db_xref="JGIDB:Ost9901_3_25048"
                     /translation="MLGARATSTTTQRVTLRGHIAKNALATRAVTPARANRGAVNVTK
                     SMNFGHEDFFDVVGTERDLILEERFPDVKGAGRGLTKNQIEALGLAGSEARERFSVKA
                     LDLGARAAYAKEMPSDNNEPTRYRTVMSGATMTHGGMAPAGAVAPPDLPSLLLNARIC
                     YIGMSLVPAVTELVVAELLYLGYEQAEKPCYVYINSGGSLNEKGEVVGMDNEAYAILD
                     TMRYIRPKIHTVAVGKCHGNASLILAAGDKGCRHALPHVQISTQPPKLNRTFDSTQNV
                     QIRANECALYEDTYMGFMSEFSGKDIDVVRKDLDRTRYFTPNQAIEYGLIDKVITKGL
                     NVMEAQDYERLLAQQQAQYESAGVPMPGQEQQQNDRSSHADKGTVRK"
     gene            complement(<368419..>369315)
                     /locus_tag="OSTLU_33532"
                     /db_xref="GeneID:5003572"
     mRNA            complement(<368419..>369315)
                     /locus_tag="OSTLU_33532"
                     /product="predicted protein"
                     /transcript_id="XM_001419754.1"
                     /db_xref="GeneID:5003572"
     CDS             complement(368419..369315)
                     /locus_tag="OSTLU_33532"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419791.1"
                     /db_xref="GeneID:5003572"
                     /db_xref="InterPro:IPR002076"
                     /db_xref="JGIDB:Ost9901_3_33532"
                     /translation="MAQFPLVSLCAFAVYGYATYAYAFEWSHARTPGGLANVDAQRWI
                     GDLSFALPACATTAYLMFCLVGPRVMAKREAFDPKGLMLAYNAYQTAFNVCVLGMFIR
                     EIVTLKQPTWGSKMPWSDKRSFNILLGVWFHYNNKYLELLDTAFMIARKKTNQLSFLH
                     VYHHALLIWAWWFVCHLMATNDCVDAYFGAACNSFIHIVMYSYYLMAALGVRCPWKRY
                     ITQAQMLQFVIVFVHAVFVLREKHCPVSLPWAQMFVMANMLVLFGNFYLKAYAAKPSG
                     KSSTRVSAAKPATRRTRSRKID"
     gene            <369803..>371437
                     /locus_tag="OSTLU_33533"
                     /db_xref="GeneID:5003573"
     mRNA            <369803..>371437
                     /locus_tag="OSTLU_33533"
                     /product="predicted protein"
                     /transcript_id="XM_001419537.1"
                     /db_xref="GeneID:5003573"
     CDS             369803..371437
                     /locus_tag="OSTLU_33533"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419574.1"
                     /db_xref="GeneID:5003573"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Ost9901_3_33533"
                     /translation="MAAPDWMTQLNRLWGGASEIPVADAKLEDITGLLGGGLFQPLFK
                     WMRESGPVYLLPTGPITSYVVVSDPDCIKQVLFNYGSRYIKGTIAEAGEFLFGLGVAL
                     QELEPWKIRRKAVAPSLHRKYVEAMVDRCFGPCADRMVSILEGEAGAGGVGGVNMESR
                     FSKTALDIIGISVFNYDFEALTTAAPVIQATYTALKEVETRSMDLLPTWRLPEKFLRV
                     VSPRQRDAQDAVTVIRDVTQRLVDDCKRMVEEEEKVGGAEEWARDYLNESNPSVLRYL
                     IAAREEVSSTQLRDDLLSLLVAGHETTASVLTWGTYELLKPENAEQLRLLRAELDEVL
                     GTRPFPTFADLPKMPYLERCFHESMRLYPQPPVYTRRAVVEDVLPNGMTIPKNQDLLV
                     SIYNLHRSPTSWGPTSQEFEPMRFGPLANGQPNELNTDYRYVPFSAGPRRCPGDKFAV
                     YEGIVIWATMFRRLDLELKAGHDVVMTSGATIHTKSGLLATVKARAMREVAEADRVDW
                     ANLKPAKDIGEEWMEKALFNSEATGAVSAGKCPMGH"
     gene            complement(<371564..>372554)
                     /gene="RPS9"
                     /locus_tag="OSTLU_94716"
                     /db_xref="GeneID:5003781"
     mRNA            complement(join(<371564..372120,372527..>372554))
                     /gene="RPS9"
                     /locus_tag="OSTLU_94716"
                     /product="Ribosomal protein S9, component of cytosolic 80S
                     ribosome and 40S small subunit"
                     /transcript_id="XM_001419755.1"
                     /db_xref="GeneID:5003781"
     CDS             complement(join(371564..372120,372527..372554))
                     /gene="RPS9"
                     /locus_tag="OSTLU_94716"
                     /note="Cytosolic 80S ribosomal protein S9; Cytosolic 40S
                     small ribosomal subunit protein S9"
                     /codon_start=1
                     /product="Ribosomal protein S9, component of cytosolic 80S
                     ribosome and 40S small subunit"
                     /protein_id="XP_001419792.1"
                     /db_xref="GeneID:5003781"
                     /db_xref="InterPro:IPR001912"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="JGIDB:Ost9901_3_94716"
                     /translation="MPSSTYYRNYGKTFKKPRRPFEKERLDAELKIVGEFGLRNKREL
                     WRVQFALNKLRNAARVLLTLDEKDPKRIFEGEAIMRRMRNYGLLDETQDKLDYVLALG
                     PEQFLERRLQTLVFKLGLAKSVHHARVLIRQRHIRVGKQIVNVPSFLVRTDSQKHIDF
                     ALNSPLGGGRPGRVKRKRMAAAAGGDGDEEEEDE"
     gene            <372777..>373682
                     /locus_tag="OSTLU_34904"
                     /db_xref="GeneID:5003574"
     mRNA            <372777..>373682
                     /locus_tag="OSTLU_34904"
                     /product="predicted protein"
                     /transcript_id="XM_001419538.1"
                     /db_xref="GeneID:5003574"
     CDS             372777..373682
                     /locus_tag="OSTLU_34904"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419575.1"
                     /db_xref="GeneID:5003574"
                     /db_xref="InterPro:IPR003829"
                     /db_xref="InterPro:IPR008778"
                     /db_xref="JGIDB:Ost9901_3_34904"
                     /translation="MATCGVAAPRAVVDVVLSREQGEGRGARVRRSIGTARLKHFDPF
                     VMLDEFKVATPAGFPDHPHRGMTTVTYVLPNAGNGCVEHEDSVGNAGMLRPGDLQFMT
                     AGRGILHAEVPENETTCHGLQLWVNLPAKHKMDAPEYQELRASELREASKDGVRAVVI
                     AGEAFGAESQIRTKQAPMHYIHFTMSPSSRLVQNVPEGWNCLAYTLRGRADFGRCEDV
                     DAHNTVTFSNEPGQDGVVVQTTSESAEFVLISGRPNDEPIVQHGPFVMNTREEISQAF
                     ADFQGGKNGFESVRGWRSEIQYRTR"
     gene            <373801..>374578
                     /locus_tag="OSTLU_33536"
                     /db_xref="GeneID:5003782"
     mRNA            join(<373801..374036,374101..>374578)
                     /locus_tag="OSTLU_33536"
                     /product="predicted protein"
                     /transcript_id="XM_001419539.1"
                     /db_xref="GeneID:5003782"
     CDS             join(373801..374036,374101..374578)
                     /locus_tag="OSTLU_33536"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419576.1"
                     /db_xref="GeneID:5003782"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="JGIDB:Ost9901_3_33536"
                     /translation="MANALRRLATASSRVALSRVAAGAPRAFVSDASATATPCWSCDA
                     RTTALNDDASANFFCDACGAIQPPVAADYFALLGVEPKYALESAALEDAMKRRQKLLH
                     PDKFSTKSERERRYSADQASAVNEAYGTLRDPLRRAKYILEARGWGVTERDGRDAPVD
                     PGLLMEVMEAREAIDEANGDAEKLRELLREHSARVTACEEETRAALDATPMVGESAKE
                     AVVRLTYFVRIVEEIKALL"
     gene            complement(<374634..>377303)
                     /locus_tag="OSTLU_16804"
                     /db_xref="GeneID:5003783"
     mRNA            complement(<374634..>377303)
                     /locus_tag="OSTLU_16804"
                     /product="predicted protein"
                     /transcript_id="XM_001419756.1"
                     /db_xref="GeneID:5003783"
     CDS             complement(374634..377303)
                     /locus_tag="OSTLU_16804"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419793.1"
                     /db_xref="GeneID:5003783"
                     /db_xref="JGIDB:Ost9901_3_16804"
                     /translation="MPTARRRGVAIAAVGRAAATADSDSRRGASRRRMSAETTPAASP
                     AASPSARATPGARATPRRDDAARRGTSHSPTANENATPTRADATTRRVFTVDDFMRVE
                     DVVKGERDWQSVRPCVRRAFEGMAYVLRRHERGAEATRAELEALRTRSMSAGAETAIV
                     ASNAARSEVDALKLELAEARHEAAERRVEALEDATNALREELQASRAIHAATLDRLAA
                     LETLHASTASKVAVDLFELETQISVKATEGAAAAAKAVDARLETMAGEMSDVTTLVRE
                     LEVEVQETRLKANQTALSLAAADVPSIASELEIVKARAARASQDANTVSEALLEVREL
                     ANSMERLSDDCAEDAKRVHDRCEHVDQTYARFKEALAQTEKMESMANDFVERIESRGQ
                     QTIDRIEKDVQRIGTLGDEIASTAEQHASLVQEQGEVLSSQLKEWGAKVVEKVTQKAE
                     SAVTEVMEYRIREIESSTDSAAARNAERAAQETRKCVALAEEAMRKADDENNAFKESV
                     LSSVNQMKAASERADELKQWINNQFTSFAELREESIAALRGSEKNSVDMLSKVSEEHT
                     RAMKRVLGEAEATRGITDAGHKTRIDRLDERFERFEARVAASELRVESCEVSMKLERQ
                     AAKPNAEAQAVALQTVEKRLNHAVAAVERDLREELRLASDRSTNEFRKELMMIQDAVF
                     GGVGGARSEYAYSPAGSPLGTPSKLTHLEVYSVSAYSEQSGSMQSRIANLTRKQEEQD
                     LIIHSMHESMERTIKDRPSTSTVRELFDDVSKRVEAMQESIEWDKVERSKTKRTLTEL
                     RTYVDDRCTKMETQTLRDFNKFGSENAEMHIPRSANSLDYGRKFVTHPELQAAISIVE
                     DHIRKLSKRMREESKASETSVSAVSVDDDLISF"
     gene            <377506..>378720
                     /gene="CBL1"
                     /locus_tag="OSTLU_88245"
                     /db_xref="GeneID:5003575"
     mRNA            <377506..>378720
                     /gene="CBL1"
                     /locus_tag="OSTLU_88245"
                     /product="cystathione beta lyase"
                     /transcript_id="XM_001419540.1"
                     /db_xref="GeneID:5003575"
     CDS             377506..378720
                     /gene="CBL1"
                     /locus_tag="OSTLU_88245"
                     /codon_start=1
                     /product="cystathione beta lyase"
                     /protein_id="XP_001419577.1"
                     /db_xref="GeneID:5003575"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="JGIDB:Ost9901_3_88245"
                     /translation="MSAGTSGDEPVARDPKDYKIATKLAHAKTSVTDPYGASAPPLYQ
                     TATFAQPSATENGPYDYTRSGNPTRTQLEEQMANLECADRAFAFSSGMSALMCVTRLV
                     NAGERIVTGDDIYGGTSRLLAQVVPKVGIEVVNVDMNDHDAVRAAIQGGNTTMVMMES
                     PTNPRLQVIDIKAICDMAHEKGALVCVDNSIMCPTFQAPLALGADISMTSATKFIAGH
                     SDVTGGLLACNGEELGNRIYFHQNAEGLHLGPFDCWLALRGLKTMQLRMERQQENAMK
                     LTAWLESHPRVNKVNYPGLKANVGHELHSKQASGAGSIFSFTTGDVEFSKIVVEETKL
                     HKITVSFGGTTSLISLPCFMSHASIPAEVRAARGLPDDLVRISCGIEDADDLLADLQY
                     AFAVAEKRVGKA"
     gene            <379319..>380034
                     /locus_tag="OSTLU_35045"
                     /db_xref="GeneID:5003784"
     mRNA            join(<379319..379417,379489..>380034)
                     /locus_tag="OSTLU_35045"
                     /product="predicted protein"
                     /transcript_id="XM_001419541.1"
                     /db_xref="GeneID:5003784"
     CDS             join(379319..379417,379489..380034)
                     /locus_tag="OSTLU_35045"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419578.1"
                     /db_xref="GeneID:5003784"
                     /db_xref="InterPro:IPR007571"
                     /db_xref="JGIDB:Ost9901_3_35045"
                     /translation="MCNDEPTPDGLLRSDSLLSPAWRMMLLSDGSVTRHLKLLTGRAD
                     VKTDVLWQGKIDLDHRGAREIGVPDDVHKRLLAASSGTLLQREVDLCDAHGDPLCYAA
                     SWWNTNTSDTIVLDTDADNAYGALDRPVWLKLAEDKTELFREVRRVYRGQSERLSSAW
                     GLPTDTYFWGRHYIFWLARKPLCVIHEVMSPALETYLGPAAPAPRARRARSRRT"
     gene            <380299..>382156
                     /locus_tag="OSTLU_34856"
                     /db_xref="GeneID:5003785"
     mRNA            join(<380299..380369,380779..>382156)
                     /locus_tag="OSTLU_34856"
                     /product="predicted protein"
                     /transcript_id="XM_001419542.1"
                     /db_xref="GeneID:5003785"
     CDS             join(380299..380369,380779..382156)
                     /locus_tag="OSTLU_34856"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419579.1"
                     /db_xref="GeneID:5003785"
                     /db_xref="InterPro:IPR000043"
                     /db_xref="JGIDB:Ost9901_3_34856"
                     /translation="MCVVETSTAGREYKVRDMAQADFGRMEIELAQVEMPGLMSCIAE
                     FGPAQPLAGANISGSLHMTIQTAVLIETLVALGANVRWCSCNIFSTQDHAAAAVARDS
                     AAVFAWKGETLEEYWWCTDQMLNWGEGSLDIIVDDGGDATLLIHEGYKAELEFAKSGA
                     IPDPASTDNAEMKCVLKIIAENLKTNPKRWQKIVSTCVGVSEETTTGVKRLYEMQKAG
                     ELLFPAINVNDSVTKCKFDNLYGCRHSLPDGIMRATDVMIASKTCWVAGYGDVGKGSA
                     AALKAAGARVIVSEIDPICALQAAMEGYQVAPIEDVVDQVDIFITTTGNKDIIMVQHM
                     EKMKNNAIVGNIGHFDNEIDMAGLESYPGIKRQNIKPQCDRFEFPDGHGIIMLAEGRL
                     LNLGCATGHPSFVMSCSFTNQAIAQLELWNERKSGKYEKKVYVLPKHLDEKVAMLHLA
                     KIGVKLTKLSTDQAQYINVPVEGPYKPAAYRY"
     gene            <382919..>383362
                     /locus_tag="OSTLU_8479"
                     /db_xref="GeneID:5003786"
     mRNA            <382919..>383362
                     /locus_tag="OSTLU_8479"
                     /product="predicted protein"
                     /transcript_id="XM_001419543.1"
                     /db_xref="GeneID:5003786"
     CDS             <382919..>383362
                     /locus_tag="OSTLU_8479"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419580.1"
                     /db_xref="GeneID:5003786"
                     /db_xref="InterPro:IPR002547"
                     /db_xref="JGIDB:Ost9901_3_8479"
                     /translation="KRVDVSTLDVRVGRVTKAWEHPDADKLWCENIDLGEKGVRQICS
                     GLRAFKTKEQMEGARVCVIVNVKPGKLRDVKSDGLVLCASNADHTEVDFVIPPEGAAI
                     GERVAFPGFEGEPEEVLNPKKKQLDAVCLDLKTNAEGVACYKDVPF"
     gene            complement(<383495..>384367)
                     /locus_tag="OSTLU_35160"
                     /db_xref="GeneID:5003787"
     mRNA            complement(<383495..>384367)
                     /locus_tag="OSTLU_35160"
                     /product="predicted protein"
                     /transcript_id="XM_001419757.1"
                     /db_xref="GeneID:5003787"
     CDS             complement(383495..384367)
                     /locus_tag="OSTLU_35160"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419794.1"
                     /db_xref="GeneID:5003787"
                     /db_xref="InterPro:IPR003721"
                     /db_xref="JGIDB:Ost9901_3_35160"
                     /translation="MEIITDAREMRAWTRARRARGERVAFVPTMGALHEGHLALVDIA
                     RARCACDAVVLSVYVNETQFAPGEDFDAYPRVGDADERAARARGVDCVFAPKRMYANE
                     GEGEGAAHETYVEVAELSKGLCAKTRPHFFKGVATIVTKLFNVVEPDAAVFGKKDYQQ
                     WRVIRRMARDLDFDIDVVGGEIVRESDGLAMSSRNLLLTTENREKATVIYQSLSEAKA
                     TAERAPTTSDALVTRVSERIRDGGGEVDYVQAMEPESLTPYVGVLDSPCVIAVAAKFG
                     SVRLLDNVEIMCGE"
     gene            <384565..386921
                     /locus_tag="OSTLU_33543"
                     /db_xref="GeneID:5003576"
     mRNA            <384565..386921
                     /locus_tag="OSTLU_33543"
                     /product="predicted protein"
                     /transcript_id="XM_001419544.1"
                     /db_xref="GeneID:5003576"
     CDS             384565..386880
                     /locus_tag="OSTLU_33543"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419581.1"
                     /db_xref="GeneID:5003576"
                     /db_xref="InterPro:IPR006895"
                     /db_xref="InterPro:IPR006896"
                     /db_xref="InterPro:IPR006900"
                     /db_xref="InterPro:IPR007123"
                     /db_xref="JGIDB:Ost9901_3_33543"
                     /translation="MDFNELERREGVRLSWNAWPCSRIEATRVVLPIGALVTPGRDLG
                     DAAPTLPYEPVVCEGCQAALNPYCSVDYYGKTWRCSLCDGLNKLPRNYEQISENNLPA
                     ELFPTYTSVEYTMTNKTPTAPCFVLCVDCACGSAEELQDAKDSVMQLVSLLPEDAFVG
                     LVTFGSTVRVHELAETNGAMRRSYVFRGTKDCEQEDLRKMLGLDFNRQRAGMNGMNGM
                     NGAAAMMPNGVDAKPVRRFVAPISECEFTLQSVLDEVTLDEEKTERGKRALRAMGAAI
                     SIAAGLLAESHSSQGGRVLTFTSGPCTVGPGAVVGTDMSENLRSHQDLEKNAAKHYKE
                     ACKVYNAIGIRLATNSHTLDVFACSLDQVGLAEMKIAVDQTGGNMILAEQFRAETFRQ
                     SLAKMFARDPKTGALEMKFNGTFSVFCTPQIMVCGAIGPISALAVKSQRISENEIGLG
                     QTTSWRMCSFTPTSTIAVYYEVVNQHSNPIPNGQPFFLQFCTRFKTSDGQIRLRVTTV
                     ARRWVESSLAPEIVGGFDQEACAVLMARIATFRTENEESFDLLRWLDRTLIRVGAKFG
                     EYQRDAPDSFRMPPSMSIYPQFIFHLRRSQFLQTANNSPDETAFYRIMLSRETVTNSL
                     VMIQPTLLSYSFNGPPQPVLLDVSAITPDTILLLDSYFLIVAHRGSTIAAWHKAGYQD
                     QPEHEAFRALLAAPVRDAKALAADRCPTPRLVECNQGGSQARFLLAKLNPSATHNTDL
                     GYGQSGGEIIFTDDISMNVFVDHLAKLAVSS"
     gene            complement(<386930..>389572)
                     /locus_tag="OSTLU_33544"
                     /db_xref="GeneID:5003788"
     mRNA            complement(<386930..>389572)
                     /locus_tag="OSTLU_33544"
                     /product="predicted protein"
                     /transcript_id="XM_001419758.1"
                     /db_xref="GeneID:5003788"
     CDS             complement(386930..389572)
                     /locus_tag="OSTLU_33544"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419795.1"
                     /db_xref="GeneID:5003788"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="JGIDB:Ost9901_3_33544"
                     /translation="MSPTPTPLVALVALVALCLACAALAGALALGVAIGARSSRRERS
                     ELASVVRQLSDETASGSVVANGRTLRRLIGHLPKWIKYADVDRVPWLNKAARQMWPSL
                     DKAIAVSVVEALEPTLNDLAKSTGMSMNFKKFTCGVEPPILASVKVSTESEGEVILDI
                     EFKWAAKDASIVLDVSTLGIKLPIEMNNVEAYGTFRLVFGPLVPWWPSFSALKLAFVD
                     KPAIDFSLKLVGGDITAVPLVASMLRDLIKNQLVDLMVWPARLWCAVSDWQPDEVAHN
                     SGLLRVTVHSASQLPGRLGMPPKAAVEVSLTQRADVKRSTTIKRGSDPIWEETFEFTV
                     TDIHSAKLRLNVIDTRVTVGSTIRAPSALLNRSNTRGMSSKYDGEQLRANKPSIGSAM
                     CDVSLCHDTPLQTVALQVPLVRAKDMTALSLAVAPLLYGAGLAKRALSIPTGGGSSPR
                     ASGPHGFNAPDGPTINISVSYHPFKKREQPHGEAAAHPPKTVPATTMVSAETDNKMMM
                     EQFSGVLYVRLLRGENLAGVGEAPDPFVKMRMNRQKRKSSTKFNTRQPVWEEEFEFII
                     GEQELENSNNILLEVWDRDAFGVKTSLGHLELDTRAVLSRCTLIGTPVEEVFELTNTP
                     SGSLTFEFEFLSVLLHPEVKGDVAERVAEEKAREKKTERKPSTLSRMTSRMFSRKKKG
                     LIEKKPSREDVTTYGSPIVKQVRSTPVPRHVETADSPLVVSPRSPTKKHARTRSKLGG
                     TPTDILQEQPHAAPQATPQVTVVPGKKPGVINNVGKRVRSVARSTGRALSVKKADEGG
                     NIPVKKEAGILSPRRQPTRASEIVPGLEWRQKGIAELHVEKTTTVAAFETPQRSMHKR
                     SVSVPDFATPTLDEELAPAVAWPE"
     gene            <389738..>390349
                     /locus_tag="OSTLU_93255"
                     /db_xref="GeneID:5003577"
     mRNA            <389738..>390349
                     /locus_tag="OSTLU_93255"
                     /product="predicted protein"
                     /transcript_id="XM_001419545.1"
                     /db_xref="GeneID:5003577"
     CDS             389738..390349
                     /locus_tag="OSTLU_93255"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419582.1"
                     /db_xref="GeneID:5003577"
                     /db_xref="JGIDB:Ost9901_3_93255"
                     /translation="MPTTPTTQTSRVAPRARAPRTASARANARTTRARAGKLVGESWV
                     ELSDASYAIENGRELYAAGDVASALKEFERALTLPGSGTKRDRAKPAELSNGERQAAL
                     YNIASARCALDDRSGALEALDGCFRAGYANPRAYGAARGMRDLDAMWADEDLTLATRT
                     DEFRAMVKKYKVTPNAMALQFDFNNSIIGGVVGAVSDKMTPKK"
     gene            <390583..>390927
                     /locus_tag="OSTLU_33546"
                     /db_xref="GeneID:5003789"
     mRNA            <390583..>390927
                     /locus_tag="OSTLU_33546"
                     /product="predicted protein"
                     /transcript_id="XM_001419546.1"
                     /db_xref="GeneID:5003789"
     CDS             390583..390927
                     /locus_tag="OSTLU_33546"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419583.1"
                     /db_xref="GeneID:5003789"
                     /db_xref="InterPro:IPR006157"
                     /db_xref="JGIDB:Ost9901_3_33546"
                     /translation="MEFFAKHGALAPERELGQKFTVNVELALCLRRAGASDALEDTVD
                     YARAWALVRDVVQRGPTRVTIEAVAEDVSRTLLETFADVRACVVSVDKREVAIEGHLG
                     SLGVRVARARDA"
     gene            <391053..>392036
                     /locus_tag="OSTLU_88251"
                     /db_xref="GeneID:5003790"
     mRNA            <391053..>392036
                     /locus_tag="OSTLU_88251"
                     /product="MC family transporter"
                     /transcript_id="XM_001419547.1"
                     /db_xref="GeneID:5003790"
     CDS             391053..392036
                     /locus_tag="OSTLU_88251"
                     /codon_start=1
                     /product="MC family transporter"
                     /protein_id="XP_001419584.1"
                     /db_xref="GeneID:5003790"
                     /db_xref="InterPro:IPR001993"
                     /db_xref="JGIDB:Ost9901_3_88251"
                     /translation="MASARGASGMPREVDWERLDKRKFFITGVGVFSGVTMALYPLSV
                     IKTRQMVSAHATQARVTDIAREVMRERGVRGFYRGFGTIVVGAIPIRVVYLSTLEAVK
                     AYTNAAFDAWDVPVMYRGAADAAGGATASLVSQALAVPVDVISTRQMVQGMRSGGAVG
                     AEDAVFVGYRNGFDAVRTIVAKEGVRGLYRGFGVSVATLVPGSALWWGFYGTYKRALW
                     QVAPEDWRDEATTSDAKVIAVQAASGVCAGMSSGFLTTPLDVVKTRLQVLSGQPGGEK
                     NNLSSTVSTIYREHGALGFFRGVRPRMVSVSIWGTVMVNVYEITKRMAIKE"
     gene            complement(<392773..>393867)
                     /locus_tag="OSTLU_16814"
                     /db_xref="GeneID:5003791"
     mRNA            complement(<392773..>393867)
                     /locus_tag="OSTLU_16814"
                     /product="predicted protein"
                     /transcript_id="XM_001419759.1"
                     /db_xref="GeneID:5003791"
     CDS             complement(392773..393867)
                     /locus_tag="OSTLU_16814"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419796.1"
                     /db_xref="GeneID:5003791"
                     /db_xref="JGIDB:Ost9901_3_16814"
                     /translation="MVVRMGPTTTLVGPKCAYVFEPATRVAKNIVDTLRTWVGERDAA
                     EGSAGAEARTVKDFPLAALECALEASSRYFEEKIFRLRRLARHCVDEISSDLRGDGKS
                     GIVTGGSLNYNAAQWQKLPPIRRAIKEFEQDAREASEALNAAMTTTNLVPTPMDVVFD
                     EKAAEERNDAVTDVLASHARRLAAVGGLVRELSADLDSARELWELQLDGDRNRTVQMN
                     FRATVFALSAAVAAVPAGLGGMNMPHGLETAPIGVFWSVAGGILIGSTAVWYAFMRRF
                     RKAGELTSARAGELASMQYILGNLDSLDNAFSGVDGSSVTREALRDVMRTEAGNVGAP
                     SETEVFDLLFRIFDTDRSRAIDNAEWRRSE"
     gene            394245..395508
                     /locus_tag="OSTLU_46635"
                     /db_xref="GeneID:5003799"
     mRNA            394245..395508
                     /locus_tag="OSTLU_46635"
                     /product="predicted protein"
                     /transcript_id="XM_001419548.1"
                     /db_xref="GeneID:5003799"
     CDS             394422..395501
                     /locus_tag="OSTLU_46635"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419585.1"
                     /db_xref="GeneID:5003799"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="JGIDB:Ost9901_3_46635"
                     /translation="MYWSGDRGSGGRAVVPSAEDARAMYGDGAADLRIAAREENVRWS
                     SDDAIAVGQKTALPRPLVDALIREYGREEALAFGAAINAPGPVTCRANGALARGGADE
                     VAAMLAREGIRTEKTKYGLAAPLAFVLPDGPPKNGGIFGCDVWRRGYFEVMDEGSQCI
                     ANAVGAREGERILDACAGNGGKTLAMAANMNGHGEICAFDIDKRRLLHLKANAARARV
                     DALVTTTESLDELASESFDAILVDAPCSSVGALRRTPSLRHSYDDPRELAKVQAEILD
                     GVARLLKPGGRLVYATCSVLSIENQDVAEAFERKHDDFAPWPFEDSVLTSPAVELRSH
                     ERLFLPHVHGTDGFFIARFVRRTAD"
     gene            complement(<395519..>397764)
                     /locus_tag="OSTLU_33550"
                     /db_xref="GeneID:5003792"
     mRNA            complement(join(<395519..397609,397699..>397764))
                     /locus_tag="OSTLU_33550"
                     /product="predicted protein"
                     /transcript_id="XM_001419760.1"
                     /db_xref="GeneID:5003792"
     CDS             complement(join(395519..397609,397699..397764))
                     /locus_tag="OSTLU_33550"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419797.1"
                     /db_xref="GeneID:5003792"
                     /db_xref="JGIDB:Ost9901_3_33550"
                     /translation="MDVAALDRALDDVSTSLEAFAEHGARRARDVAVSLCAEAARGGV
                     EDAIAGAQKVVDALERRRAESAARAELRRASAEGAARTLRETVKKHAVERESVCEDMA
                     RASLMTERVLERLESPANAEAASASRRADALGTLADVLECVCAFSKGGEAVAKACDGL
                     FADAARRGEAGRLAKRSLSVVERAQSCRIADEDAGAERLALKDASTALQRYCEDVENA
                     LLDKFAAACANKSYAAARADAEALFEFNGGHSVVSRYVASREMFISANAMEEIQRLRN
                     VVERSVILGEDESLCTECVRTFFAQIQSAVKREFQSITAAFDSRAIVVLNTLVHRIAE
                     QRIGAYVETFLTTELRTAASLRQRLALTALSLREIEILNRAIREMTNDDADVEAIDPD
                     VFFGIGCETLVDDECACLDSVPSDDDVLPQRDATEFSLDDLCARYKEALLRVESCVPG
                     TSIESVRARLAEAFLGRVTRLAQRHLRESIAATKSASARLNAWTTREEARADVFEPVL
                     LASRNMNAWLARARDAIDTMNSELSPGTVRQMFAVAQSRLAEEMSEVLEAMTTRGMTL
                     VDAKFRGTQRAVDFNDESSFAERETEACVAVVDALDGLAKTTLECLDSANAATLLNEI
                     GAQFYSLLFRHVCRYTYTIVGAMQLKLDVNAYVSWVRKTMTARESIERFEALSTRLNL
                     LVVPEDALDDFVYELEAHAHENIAEIRMLLRLRKTT"
     gene            complement(<398089..>398703)
                     /locus_tag="OSTLU_6293"
                     /db_xref="GeneID:5003800"
     mRNA            complement(<398089..>398703)
                     /locus_tag="OSTLU_6293"
                     /product="predicted protein"
                     /transcript_id="XM_001419761.1"
                     /db_xref="GeneID:5003800"
     CDS             complement(<398089..>398703)
                     /locus_tag="OSTLU_6293"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419798.1"
                     /db_xref="GeneID:5003800"
                     /db_xref="InterPro:IPR001303"
                     /db_xref="JGIDB:Ost9901_3_6293"
                     /translation="PPIEGYDADVWRARVELAACYQLCDKLGFNEGVCNHLTCAAPGR
                     EDAFLCAPYGLAWSEVSASNLVMIDGRGKLLEGSGEVDATAFFIHLAIHRAGVACVLH
                     THMPRASALCCVESFELAMCHQNSLRFAEDVAYDPTFNGLVLDNTEGERLVKVMDGKR
                     VLMHKHHGVIVCGASVAEAFDDLYYLERAAEVQILAMSTGSPLSI"
     gene            <399237..>401554
                     /locus_tag="OSTLU_16816"
                     /db_xref="GeneID:5003801"
     mRNA            join(<399237..400349,400658..>401554)
                     /locus_tag="OSTLU_16816"
                     /product="predicted protein"
                     /transcript_id="XM_001419549.1"
                     /db_xref="GeneID:5003801"
     CDS             join(399237..400349,400658..401554)
                     /locus_tag="OSTLU_16816"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419586.1"
                     /db_xref="GeneID:5003801"
                     /db_xref="JGIDB:Ost9901_3_16816"
                     /translation="MTGAAARREGVARLCAEMTAGASRASLAEALGARPVLIKALDRA
                     VRDDDEMMMDAIGSALGKASEMAKRESSVELRSVAGSQVGERAGAKPSTLEVRLPVSD
                     IVVRVHESEWRDAGLAWRVWGSSQIMSRCLDAAPELVRALDVLEIGAGCGLAGLTAAR
                     VGAKRVRITDGAPGAIDAIARSVSELPPECAATTKAMFLDFRDDDDILAGVVSLEQAR
                     ASNEARHWVHARSAAHKSMIESCKLPVDDVFDVVLATDVLYSDEHAAPLAASLTRRIR
                     PGGCGYILNVCRHGGILADFTHALLSRGMRLQISAIERFDGEDDVKEYQGGHLHRALP
                     PQADAWWTASAKELVKFGASTIVADEEASIAMLADVDRSRRRTAIALTVCLALTTRRA
                     FIAHVDAGEVDPAIDMVDEHSDNYRSLVYGIRCGACKAVVKEIGDTFDTVAAKHKRDA
                     GPTNVFGSRYVSLFRSTLTREVDGVCAANGAIERDWGYSEKGAENIIATSRVFDRMGK
                     NLTKEESSMIQLTVYGLGLFTKNPSERFHYQGPPGSEISGSDNFSMISNTFARQTLRT
                     ACQAVSDSLEFDDAIDAAVADMESGFDYSVQHKLCLDLDYCKVKNRKSGRSAPVQRIE
                     QDDGTVAYETEATEADEDLGDQGVRIDPEELAKRGAAVGEEKTEL"
     gene            <402322..>404796
                     /locus_tag="OSTLU_34610"
                     /db_xref="GeneID:5003793"
     mRNA            <402322..>404796
                     /locus_tag="OSTLU_34610"
                     /product="predicted protein"
                     /transcript_id="XM_001419550.1"
                     /db_xref="GeneID:5003793"
     CDS             402322..404796
                     /locus_tag="OSTLU_34610"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419587.1"
                     /db_xref="GeneID:5003793"
                     /db_xref="InterPro:IPR001098"
                     /db_xref="InterPro:IPR002562"
                     /db_xref="JGIDB:Ost9901_3_34610"
                     /translation="MTVNGAKGDAKVTDDDEIATGLRDEVQTVETVEEARRVLKILLD
                     NAGTEDQPMYHACDTEVAYISVADQTPVGHGQVTCFSVYVGPDVNFAPEGESKRSLLW
                     VDTLRGGDGVWEVFKEYFENANVKKVWHNYSFDRHVVENHHGIKLAGFAADTMHMARL
                     WNSNRKLDGGYSLEALSSSADAMSECAEMLGAGAEMMRAKRGMKKIFGKPKLKKDGTP
                     GKTMILPPIEEIQEARDSRDRWIEYSALDAQATWFLRESLEAKLRGMSCEACPILASK
                     PGYRKCVTLWDFYTFYLAEFGNLLTQMERNGLLVDKAHLAHAEKMAHEDKRVAEDYFR
                     NWAASKCEGARIMNVGSGLQVRQLLFAGAKNKRRDKPGVELTREFTQESSEWIAWDAA
                     GREGKAPKKTMKVALHGITVKPIQVQTFTATGLPAVSSVVLRALAGKPGAARAIMDTW
                     DSLADAEKTEDVLKKACGTAFEAFGGGKEGVQACAAIDALNDVAAIDTLLSNFIIPLQ
                     GDDIRGPEGRVHGALNINTETGRLSARRPSLQNQPALEKDRYGIRKAFTAGPGNILVV
                     ADYGQLELRLLAHMADCKSMQEAFEAGGDFHSRTALGMYSNIKEAIDKGEVVLEYGEQ
                     EETVDEKDRPALVKDVFASERRKAKVLNFSIAYGKTAHGLAKDWGTSLEEAANTVELW
                     YADRPEVREWQEVQKKMAVEKNLVRTLLGRVRNLPDASSKNEAFKSHALRASINTPIQ
                     GGAADIAMLAMLQIQRCPRLKELGYKLLMQIHDEVILEGPEEHKDEALALTKYHMENP
                     FPGHVNLLNVALAVDGDYAKTWYEAK"
     gene            <405178..>407568
                     /locus_tag="OSTLU_443"
                     /db_xref="GeneID:5003749"
     mRNA            <405178..>407568
                     /locus_tag="OSTLU_443"
                     /product="predicted protein"
                     /transcript_id="XM_001419551.1"
                     /db_xref="GeneID:5003749"
     CDS             <405178..>407568
                     /locus_tag="OSTLU_443"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419588.1"
                     /db_xref="GeneID:5003749"
                     /db_xref="JGIDB:Ost9901_3_443"
                     /translation="SEFACAYCGISNVSCVAQCVKTKKWFCNGRSNGLPASCLIYHLV
                     RSRNKEVRLHESSPLGDMTLECYVTGATNVFNLGFVPCKDENVVVLVTREAAQSNPAT
                     LKELNLDLALWEPLIQDKVFLPWLLQMPDKKEIDRARPVNPGKVIKLEELWKTNPEAT
                     LDDVENDDGDGEVRPVALTYEDAHLYQGVFGPLIQLEADYDKAQRESQTKDDVTVRWD
                     IGLNKRRIAYFSFGADENAVSVTLGDSLQLRLLIQTKNEQRSWQGQGVVIKFTAQEEV
                     GVEMYGMDAPVEYTNGYSVDFLWKGTSYERAQQALESFAEDETSVSGYIYLKLMGKDP
                     EDMFLSGDFPKKLTAPGLPELNQSQHDAVKTVLQRPLSLVQGPPGTGKTVTSATLVYH
                     LAKRGNGQVIVCAPSNVAVDHLAEKIEKTGLKVVRISSRSREHLVSSVEHLTLHYQVA
                     NIGGSTHKAFQKLQQLKNELGELSAGDEKKYRNAQKKLEREILENADVICTTAVGAGD
                     PRLANFRFRMVLIDESTQATEPECLIPIVMGAKQVVMVGDHKQLGPVVTCKQAYAAGL
                     AQSLFERLIALGIQPIRLQIQYRMHPCLSEFPSNTFYDGTLQNGVSAIERTLSHIDFP
                     WPVPSKPMMFWSQTGQEEMSASGTSFLNRAEASAVEKCVTHLLNAGVSPEQIGVVTPY
                     EGQRAYVVQHMTRVGVLHPQLYKDIQVASVDSFQGKEKDFIIMTCVRSNEKSGIGFLS
                     DPRRLNVAITRARSGLIVIGNPKVLNKQHLFHEMLTHFRENGCLVEGTLGSLKECMV"
     gene            <407852..>409303
                     /locus_tag="OSTLU_94721"
                     /db_xref="GeneID:5003750"
     mRNA            join(<407852..408653,408735..>409303)
                     /locus_tag="OSTLU_94721"
                     /product="predicted protein"
                     /transcript_id="XM_001419552.1"
                     /db_xref="GeneID:5003750"
     CDS             join(407852..408653,408735..409303)
                     /locus_tag="OSTLU_94721"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419589.1"
                     /db_xref="GeneID:5003750"
                     /db_xref="JGIDB:Ost9901_3_94721"
                     /translation="MPPIPRCLLTTTDPSALNQADLPRPSVSSVSSESETASESPSTS
                     RRDEKLSGTVPNLFWRAVAMDDLRAARNFVGLPEESQVTLAGAKSFAYVRQGTEVWDA
                     LHDGRLTTGVLKAALGFVEDGVDKRALGLGKRHGGHNAILSACRRLQREKWCDDDEVG
                     DVADARRRNEAATAAFNRQIDGDDDDETEDECDDVGLCDDSAGELLSGVGSNASAMDI
                     LAASLASAAKKKTSKKGKKKKKRGSGKKNRVAGDSSMLTNAQYSRALARGSTVYEAGL
                     CMLDAASDVPKAWGVGPLPPVGASPDGLITMASGERFVVEVKNSSPFRQMPGRYVVAD
                     REPYAKPPAYHMPQVQLEMLCTGTRSALLAMQSMTYGIKIFRVERDDDFIASMLRRIS
                     RLYTTYARKGKDPPMNWEVRSIEHKKMVGAAVRLAGAATVYDHIPTSLVPNDGSIHVE
                     ENAFVA"
     gene            complement(<409454..>410728)
                     /locus_tag="OSTLU_94723"
                     /db_xref="GeneID:5003751"
     mRNA            complement(<409454..>410728)
                     /locus_tag="OSTLU_94723"
                     /product="MFS family transporter: glycerol-3-phosphate"
                     /transcript_id="XM_001419762.1"
                     /db_xref="GeneID:5003751"
     CDS             complement(409454..410728)
                     /locus_tag="OSTLU_94723"
                     /codon_start=1
                     /product="MFS family transporter: glycerol-3-phosphate"
                     /protein_id="XP_001419799.1"
                     /db_xref="GeneID:5003751"
                     /db_xref="JGIDB:Ost9901_3_94723"
                     /translation="MFISYSSAYFVRKPLSVVKAPVKEALGLTTGTMGLIDSAFLLTY
                     ALGQFVMPSIGDKIGAKAVIVVGGVVSFACCLAFGYISVPYILMGLWALNGLAQAASY
                     PLHVKLLNPWFSSKERGTAMGIWATSQQVGATLATVATAFLLGKVGWRLSISLPATFA
                     LCTAALVAAMQLDPPWLQTTTYKQEALTSTKKRADIEPASKNVSFMEILAIPRLKMLM
                     LSYFFVKIVRYCLLFWLPFYLSQEYKMSVAIAGYMSCIYDLGGVLGGLACGIIGDKYF
                     EGKRTVLGALSCALLTFAIGGYQTACSMGMLTNAIVMGLIGFLVAGPDAMLGSTAVSD
                     CCEQAGYGQEVLGTAAGVVNGMGSVGAVLQGALTAVIAEKYGWGALFVTLAVLSALSI
                     VTMLASTNPKYLDADTDDDERKSTDEGEVAYA"
     gene            complement(<411356..>413296)
                     /locus_tag="OSTLU_94724"
                     /db_xref="GeneID:5003802"
     mRNA            complement(join(<411356..412558,412598..>413296))
                     /locus_tag="OSTLU_94724"
                     /product="predicted protein"
                     /transcript_id="XM_001419763.1"
                     /db_xref="GeneID:5003802"
     CDS             complement(join(411356..412558,412598..413296))
                     /locus_tag="OSTLU_94724"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419800.1"
                     /db_xref="GeneID:5003802"
                     /db_xref="JGIDB:Ost9901_3_94724"
                     /translation="MISTRFEGVRVAPFGSYVSAFHSAGSDIDISLQIDKNGPWYDEK
                     EEAQARRSQRGGVRARRQQRQGRTKRAQLLRKVASELRYRNYRDVQLISKARVPLIKF
                     KDPQTGVACDVCIENDGVYKSAVLGVVADIDQRYRDLVFLIKLWAKHYDVNNAMEGSF
                     NSYSLCLLCMHHLQRRPVPILPPTMLLTLPRPDLVESEKRELEEHLKSEDDQFDTWKV
                     SKARVVSDASRDIAAENTETLAELFVSFFAHLCAIKDLFRNAVNASTYHGTFIVGSSW
                     QAFKYPLGVEDPFAAGDNVARAVQMRTRDYVLNAFPAACADISKMLHATDNVQFMRSL
                     LCLLGDKSVPSEVLARLRPTLPGMGGAPQPPGLPGAPRPPQGPPVMLQQPAKSLNEHT
                     LDMLGRQVAPGASAEEILAMLTRQRQVQAEAQRDQSQPSEQQMLLLRRQQELLRMEQA
                     KIQQHMQQGQPPPQPGRTTQIPVASLFGQPQQQPQQQRGLPPGFGPTSQLQMPPPQPQ
                     MPMATALPSFGAPPPANGGFSNGGLGGGVFSSIASGGGGLFFDAPARQSNPPPPTAHA
                     VDEISQHFATGMSMFGSNVHAPPPDLGVRSPPDLAAGGSPPASRVVPQSELPRTRSGV
                     AIPKPRNAR"
     gene            <414541..>416496
                     /locus_tag="OSTLU_35099"
                     /db_xref="GeneID:5003803"
     mRNA            <414541..>416496
                     /locus_tag="OSTLU_35099"
                     /product="predicted protein"
                     /transcript_id="XM_001419553.1"
                     /db_xref="GeneID:5003803"
     CDS             414541..416496
                     /locus_tag="OSTLU_35099"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419590.1"
                     /db_xref="GeneID:5003803"
                     /db_xref="InterPro:IPR000642"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR011546"
                     /db_xref="JGIDB:Ost9901_3_35099"
                     /translation="MTNGAFAGAARADAFNAAPTEQVQQQRGEAVSAFADASKEAPAV
                     NADGLPEGNNWRYSEFIKAVMSGKVERVRFSKDGSALQLTAVNGARATVILPNDPELV
                     DILAKNGVDISVSEGEQQGNAASLVGNLLFPLVAFGGLFFLFRRAQGGDGGMGGMGGM
                     GGGPMDFGKSKSKFQEVPETGVTFADVAGVEGAKLELQEVVDFLKNPDKYTALGAKIP
                     KGCLLVGPPGTGKTLIAKAVAGEAGVPFFSCAASEFVELFVGVGASRVRDLFEKAKAK
                     APCIIFIDEIDAVGRQRGSGMGGGNDEREQTINQLLTEMDGFEGNTGVIVLAATNRPD
                     VLDSALLRPGRFDRQVTVDRPDVAGRIRILKVHARGKTLAKDVDFDKIARRTPGFTGA
                     DLENLMNESAILAARRELTEISKEEIADALERIIAGAAREGAVMSEKKKKLVAYHEAG
                     HALVGALMPDYDAVTKISIVPRGNAGGLTFFAPSEERLESGLYSRTYLENQMAVAMGG
                     RVAEELIFGAEDVTTGASGDFQQVTRTARMMIEQMGFSKRIGQIAIKSGGGNSFLGND
                     MGRAADYSAATAAIVDEEVKILVTAAYRRAKDLVQLNMDVLHAVADVLMEKENIDGDE
                     FERIMLGAKSELYLKADEPSVAVPYQN"
     gene            complement(<416632..>416817)
                     /locus_tag="OSTLU_33559"
                     /db_xref="GeneID:5003752"
     mRNA            complement(<416632..>416817)
                     /locus_tag="OSTLU_33559"
                     /product="predicted protein"
                     /transcript_id="XM_001419764.1"
                     /db_xref="GeneID:5003752"
     CDS             complement(416632..416817)
                     /locus_tag="OSTLU_33559"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419801.1"
                     /db_xref="GeneID:5003752"
                     /db_xref="JGIDB:Ost9901_3_33559"
                     /translation="MAMLAKTANEHFKARYGVDAFAFASRCVRRVRDDLREAFGGRGR
                     TRGKGKFRGTGRRVGKK"
     gene            <417570..>418988
                     /locus_tag="OSTLU_93261"
                     /db_xref="GeneID:5003804"
     mRNA            <417570..>418988
                     /locus_tag="OSTLU_93261"
                     /product="predicted protein"
                     /transcript_id="XM_001419554.1"
                     /db_xref="GeneID:5003804"
     CDS             <417570..418988
                     /locus_tag="OSTLU_93261"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419591.1"
                     /db_xref="GeneID:5003804"
                     /db_xref="JGIDB:Ost9901_3_93261"
                     /translation="VALNSIRRRGRPRGPVRRLGSLCASRETGKDSTGYCVMNRTTWC
                     NGCVSETSALSGPLHNPRSARPTPAMGSAIRGAISGSAVTAADAMRSIPISLNPAPRY
                     KNTNKLCVHSHAWLKVASERKNRFPFLISRLAQIRASFADTTGTNCLGLVSVSASSPP
                     STVFNTVRSANFAYCSTRSCAHGENHCASLAAAGALANANVSPHTRHAFSSTPCVRSD
                     TRCHRLRQCTCTNAAVPAHAHGLTRSPRGSKQNRQLGRAASSPSSSPSSSSSSIAVVA
                     AVFALARALDVRRRPSALANHRLARASSSPSSSSSPSRILSSARSSTSSASASASRAR
                     RDAAARSRSARALTAHAAHATSASGSMARASRCRHTSTCDGTRARGARRAMRRRRRSR
                     ARARAVVIACVVAALCAGCEVRARRRGRAKATSRTSLTRRRTTDDDDATTGARDARRA
                     RAGIKNDGSARTARIRSIESCR"
     gene            <419060..>419230
                     /locus_tag="OSTLU_33561"
                     /db_xref="GeneID:5003753"
     mRNA            <419060..>419230
                     /locus_tag="OSTLU_33561"
                     /product="predicted protein"
                     /transcript_id="XM_001419555.1"
                     /db_xref="GeneID:5003753"
     CDS             419060..419230
                     /locus_tag="OSTLU_33561"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419592.1"
                     /db_xref="GeneID:5003753"
                     /db_xref="JGIDB:Ost9901_3_33561"
                     /translation="MENCVLRCASASCYDEVYGRDALEEGEVDTERGRAFRSCAREEL
                     RRLRGYQTFGTE"
     gene            complement(<419350..>419937)
                     /locus_tag="OSTLU_88260"
                     /db_xref="GeneID:5003754"
     mRNA            complement(<419350..>419937)
                     /locus_tag="OSTLU_88260"
                     /product="predicted protein"
                     /transcript_id="XM_001419765.1"
                     /db_xref="GeneID:5003754"
     CDS             complement(419350..419937)
                     /locus_tag="OSTLU_88260"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419802.1"
                     /db_xref="GeneID:5003754"
                     /db_xref="JGIDB:Ost9901_3_88260"
                     /translation="MTTTTTTHLARVERATTTTTRATTDTDDDKTKSITDAELERNLS
                     KFVKKTATTFAPSSSGEAKKKKNPAYKGSVLYTVFEVQAYLAVIVGGLLAFNVIYPSD
                     EPSIARLMGMWSLWMFTVPSLRARDCDAKEKDALNLLFVAMPLVNVLIPFVWKSFAGV
                     FSADVLLMAVVYAQKGVFAGEADVVGDESSAVEEK"
     gene            <420184..>421055
                     /locus_tag="OSTLU_33563"
                     /db_xref="GeneID:5003805"
     mRNA            join(<420184..420186,420360..>421055)
                     /locus_tag="OSTLU_33563"
                     /product="predicted protein"
                     /transcript_id="XM_001419556.1"
                     /db_xref="GeneID:5003805"
     CDS             join(420184..420186,420360..421055)
                     /locus_tag="OSTLU_33563"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419593.1"
                     /db_xref="GeneID:5003805"
                     /db_xref="JGIDB:Ost9901_3_33563"
                     /translation="MSSFVKAGSYDPTLVDVELTAEEAKTRANRRDAFREHLRATLAE
                     KELVGAFAKMYRMNEKPKDPLQWLLDYFERDQREHIRRAEETAETYRSELLRAEQERD
                     SLIAKMEVMRQKVSNLERTVQELRDGGRKHVVGVYGGEEMPTGADAPAPAEKENDKKE
                     KKEKKEKKEKKEKKEKKEKKEKESAARPPSDDEFFGNSKETFGSMKMKTTPDMFDDSD
                     SSSLPKQQSLRDQV"
     gene            complement(<421298..>424369)
                     /locus_tag="OSTLU_50379"
                     /db_xref="GeneID:5003755"
     mRNA            complement(<421298..>424369)
                     /locus_tag="OSTLU_50379"
                     /product="predicted protein"
                     /transcript_id="XM_001419766.1"
                     /db_xref="GeneID:5003755"
     CDS             complement(421298..424369)
                     /locus_tag="OSTLU_50379"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419803.1"
                     /db_xref="GeneID:5003755"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="JGIDB:Ost9901_3_50379"
                     /translation="MSATAELECANARASEHSARARDAAKRRKATEAAADGIADGGGD
                     DDGDARARARTSCVHEVAVPRDWVGDVKALRDPRYDGARAKEYPFELDAFQRAATAVL
                     ERNESVLVAAHTSAGKTVVAEYAIAMAFRDKQRVIYTSPLKALSNQKYRELSEEFGDV
                     GLMTGDASINPNSTCIVMTTEVLRSMLYRGGDVIREVKWIVFDEVHYMRDRERGVVWE
                     ESIIFAPKDARLVFLSATLPNALEFAQWVTSLHNHPCHVVYTDHRPTPLQHYAFPKGG
                     SGLHLVVNEQSQFRSDNFARLQQAIADGAEKSGGSGGGGRGRGRGGGRARGGGGGRGG
                     GGGGRGGGSMADADILRIVRMVKEKTFFPVIVFSFSRRECEEYAKFVSKLNFNTPEEA
                     EQVREVYNAALLNLSEEDRQLTAVQAILPLLEAGIGIHHSGLLPVLKELIEILFGESL
                     IKCLFATETFAMGLNMPARTVIFTAVKKFDGTDMRVLAPGEYTQMSGRAGRRGKDDRG
                     ICIVMCDERMEEHAMKEMILGKPQPLNSEFKLSYYSILNLLKRATGTIDAEYVIARSF
                     HQFQHAKQLPELKARLTEVQQEAAKIKSVGSEEIQEYIKLRRDYREAEKVVLRTMLQP
                     ANCLRFFTSGRLVRIRDGDTNWGWGVVIQVSTVKDAKGGDVHVLDCLLRCGPGAAEGR
                     LAPADAKNLKMNTTEIVPVGTHLVDAISAMRFTLPGDLRTKEARESVWIAVETVTKKL
                     TEKGQVIPQIHPVDDMGINDVAFVRTYRSLGALRDKFHSHALYSEADALERSEMTAKI
                     DVIEQKSELLAEASRLETQIQSSELTKFRDDLSARSRVLKKLGHIDNDGVVLTKGRAA
                     CEIDTADELLVTELMFNGVFAGLSPHELVALASCFMPVEKSNTSNMDKSAKALAKPLK
                     ALQDAAREIGNVQKECKIDIEVDDFVESFKPTMVEIVYCWAKGEPFSEIVKKTDLFEG
                     TIIRAMRRLDELMMELHRSCVAVGDDGLAKKFEQGAESLRHGIVFADSLYT"
     gene            complement(<425003..>426430)
                     /locus_tag="OSTLU_16823"
                     /db_xref="GeneID:5003806"
     mRNA            complement(<425003..>426430)
                     /locus_tag="OSTLU_16823"
                     /product="predicted protein"
                     /transcript_id="XM_001419767.1"
                     /db_xref="GeneID:5003806"
     CDS             complement(425003..426430)
                     /locus_tag="OSTLU_16823"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419804.1"
                     /db_xref="GeneID:5003806"
                     /db_xref="JGIDB:Ost9901_3_16823"
                     /translation="MSLRALARAFHDSARARFDAPATTLLRAAAARIEREREASTAAR
                     DVTSAIWGVENYWRRRDVREDSEDMRALREFARVASAAAASVFVEWDSAKDKRGAATL
                     CRALKHVIAIHKITGEPVPMDFIASLVNVASHNAVAFSPMQVSFILHDVVSAKATDIL
                     TERVIASFSHIMQVDESTPFAAVSALLWSYAKMDALKSGLVSTKHTDELHFVTRAKLD
                     RGEKVASRDIAMNMYAVARLGAEHVGFADGDYHDVACKTLAKEIDTLNQRALLMIAWS
                     LNTMRPSEDNVYIHSTFLDALGGAVQRSVHAFAPFELAPTMHALTSLRVTNPKLLELA
                     RDRFRADVSGYAEKPQNLTLMLWSFAAAEYDIGEDTSRMAAYAYLDVAPIASALETKT
                     ILQSLARLHFVFDEDDARVKNILDDVIERYLDEYSEADCEVLAWSLLALRVPASERLL
                     ERVGVESVANDAGDVEYVVHKPIDV"
     gene            complement(<426915..>427547)
                     /gene="ClpR6"
                     /locus_tag="OSTLU_33566"
                     /db_xref="GeneID:5003807"
     mRNA            complement(<426915..>427547)
                     /gene="ClpR6"
                     /locus_tag="OSTLU_33566"
                     /product="chloroplast Clp protease, subunit of ClpP
                     peptidase complex"
                     /transcript_id="XM_001419768.1"
                     /db_xref="GeneID:5003807"
     CDS             complement(426915..427547)
                     /gene="ClpR6"
                     /locus_tag="OSTLU_33566"
                     /note="Clp protease, ClpP subcomplex, inactive subunit
                     with structural role, chloroplast-targetted"
                     /codon_start=1
                     /product="chloroplast Clp protease, subunit of ClpP
                     peptidase complex"
                     /protein_id="XP_001419805.1"
                     /db_xref="GeneID:5003807"
                     /db_xref="InterPro:IPR001907"
                     /db_xref="JGIDB:Ost9901_3_33566"
                     /translation="MRTTRTTRARRPHAPPGAITSGPETVPVMVPDGRGGGEDVFGAL
                     ARDRIVFLGTRIDEQVAAETCARLLQLESEDPEGEIRVWVNCVAGTQYCVTAILDTME
                     YVSCPVSTVALGCVAGPPVMLVAAGDKGKRYGMSSARIVLSQPLGGLAGTSIEVKIQA
                     TELNRNAKAQVGFIAKYTGRDADELEAMMARDTYMGVDEAIDFGLIDHAL"
     gene            <428426..>429616
                     /locus_tag="OSTLU_33567"
                     /db_xref="GeneID:5003808"
     mRNA            <428426..>429616
                     /locus_tag="OSTLU_33567"
                     /product="predicted protein"
                     /transcript_id="XM_001419557.1"
                     /db_xref="GeneID:5003808"
     CDS             428426..429616
                     /locus_tag="OSTLU_33567"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419594.1"
                     /db_xref="GeneID:5003808"
                     /db_xref="JGIDB:Ost9901_3_33567"
                     /translation="MIAEVGLMAAYTLYAMMTLDGNWVLLLVFTLLSALVAYTWRDEL
                     NLVASMISVSTISLSDNPHLVTVTIGLQCLVMAFVAPMAWFAVQASQHGSAIINQYAT
                     EFSNDACTGYYGQSVDCCKWNIDSWVGPYYALVVIACVWFTSCALEARMYVIGGVVSQ
                     WYFAPAGTKSFKGTTRTSVSNAYGPSFGTIAYGGFVITVVEIIRSMANKSRRERNNYG
                     NPLCCLFYAMLDCIFAVIEYLSRFAMIQASITGEAFCDAARSINDLLKRNFLLAYGAY
                     AFPKHILGFLVFVLAALLGYCVNILSKHVFAANSLGAIVNGIGSFFIAYIVLSFFVMI
                     LLNCVDAVFVCYALDKDRAAVHHPDLHKVFDEVTRKQRAIEESDAEGMEEPLISGKPK
                     YASM"
     gene            <429707..>431320
                     /locus_tag="OSTLU_94731"
                     /db_xref="GeneID:5003756"
     mRNA            join(<429707..430239,430267..>431320)
                     /locus_tag="OSTLU_94731"
                     /product="predicted protein"
                     /transcript_id="XM_001419558.1"
                     /db_xref="GeneID:5003756"
     CDS             join(429707..430239,430267..431320)
                     /locus_tag="OSTLU_94731"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419595.1"
                     /db_xref="GeneID:5003756"
                     /db_xref="JGIDB:Ost9901_3_94731"
                     /translation="MWRRRAGTALKATLAAYTAAELTAFVGHQRRIASVENAPTRKLD
                     PNFDVKAHAAWFARELRREPNPRRLFEEVFNDRAIETIPRNRAHAMLCFYLSAKEANE
                     FASGTYPSVITRRADSLLRELERAHGLKFARDCPVWPAKLGDERLADVVEDERKAAES
                     TVAAGAKAVGDWNHGVWRESRISSPVEGTPDFIRTNTHNITAWYKPLALRFMIWRYRE
                     RSERTLRANGFKMYRDVDTDVKLWVRIPEECSTDTVLYFLHGFGMGVPPYTSFIEKLP
                     KDRIVVCPEWPNISYGLDRSHEYPTPRELSNVLARTVERVQDEKLLLYPQIEEVDDAR
                     WYRERFGGWFRKKPSKREITKCDVIAHSYGTVVLTGFKRHFPEMLRRCVYIDPVCFLP
                     AFGSYLKYAYDDHLLEWQNLMHYVSNKLANPDEPMDLFNILLSSWFVKGDVGTQQLMK
                     RLLFPHEAWERGPMTSEDMIVLSGLDEIVASKEVSTRLRIAWPSVRMIYEKQWQHGGF
                     LLEPDPHDVVPRIIRFVSKV"
     gene            complement(431368..433161)
                     /locus_tag="OSTLU_46518"
                     /db_xref="GeneID:5003757"
     mRNA            complement(431368..433161)
                     /locus_tag="OSTLU_46518"
                     /product="predicted protein"
                     /transcript_id="XM_001419769.1"
                     /db_xref="GeneID:5003757"
     CDS             complement(431374..433113)
                     /locus_tag="OSTLU_46518"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419806.1"
                     /db_xref="GeneID:5003757"
                     /db_xref="InterPro:IPR001567"
                     /db_xref="JGIDB:Ost9901_3_46518"
                     /translation="MFDGTFARREVYEAMKAVGADAAPTSEARRASEYLMREFERNGA
                     ALSAEKQEVLMSKLGEIEALCSSFCAALNEDATCVDFAEAELDGVDVSAYAQGDMEGT
                     RRVGLIAPDIMPVLQFARRASTRKRMAEAKAKQCQDVNTDRFLRVIELRNECAQMLGY
                     ASHAEYMLKPKMASTPARAEAFLRDLLDKAQGKLHEDLTDLQKLKDEEEGPNAGPLQS
                     WDVSYYSTKYKATLGVNEAKIREYFPLEHVKHEILSTYQNLLGLTFARVDAEVWHEEV
                     ECYSVREAGGEQQVLGFFYLDLFPRPGKYAHQCVYPLRPAFEDGDDVVTAACVNIGNL
                     SKPGADGKPALLRFREVETFFHEFGHVMHCVLSKSKYSVHAWAWSAVPWPGGVEQDFL
                     EVPSMMLENFVWQPEVLRRLSKHYETGDSLPEDDIDALSASRGALEGYARSRFISMAL
                     FDLAVHGGPGPYEFEGEKHDTIDFYNVITESLSKIPSVEGAFPAASWYHPMMGYAAGY
                     YGYLWSEAFAADLFSEFEAKKPNVCDPALGRKYRETILSPCATVDGDSMLQNFLGRGA
                     SLDPFLKRMGVLT"
     gene            complement(433607..>434960)
                     /locus_tag="OSTLU_33570"
                     /db_xref="GeneID:5003809"
     mRNA            complement(433607..>434960)
                     /locus_tag="OSTLU_33570"
                     /product="predicted protein"
                     /transcript_id="XM_001419770.1"
                     /db_xref="GeneID:5003809"
     CDS             complement(433686..434960)
                     /locus_tag="OSTLU_33570"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419807.1"
                     /db_xref="GeneID:5003809"
                     /db_xref="JGIDB:Ost9901_3_33570"
                     /translation="MVLASVVEATLGRVAALGRTASSASTSASGVADAGAATLRRLGA
                     AKTRGTSSLDDLNEHAKIITDGVDFRPVTDTSCFVDAYRSSDAATAVMFVFISGCVLG
                     AVPQYLKVVVLGTSEGLSLSSLALMNVSNVCATMNVFILHYEQIRRCVAGAAGYEYER
                     CQASLLTLYYTLIYTLLWIPLYPLAAHFTSDRKTEYFGYVMSKRKAAWYGLALWAVPC
                     ALLAAPVARMLFGSTCFEFERYAIFLGLTNAVLETTRYVPQLWESVHSKGSGAMSYMR
                     LALSVAGGLGATIQKAVMHESWSTWGPPLIGHGLEMAIFCVNLFNDMTRRRERTDMRK
                     EALGLMRDSDDDYEDSRDDMETDAHAKRKAAMLESAESAARTGSPTKSESDVEDWVQN
                     IPTEGGFKAKTSFVWHRACTDKHFFTSLVRYL"
     gene            complement(435760..>437688)
                     /locus_tag="OSTLU_19676"
                     /db_xref="GeneID:5003810"
     mRNA            complement(join(435760..435775,435798..>437688))
                     /locus_tag="OSTLU_19676"
                     /product="predicted protein"
                     /transcript_id="XM_001419771.1"
                     /db_xref="GeneID:5003810"
     gene            <435918..437222
                     /locus_tag="OSTLU_50535"
                     /db_xref="GeneID:5003811"
     mRNA            join(<435918..436091,436185..437222)
                     /locus_tag="OSTLU_50535"
                     /product="predicted protein"
                     /transcript_id="XM_001419559.1"
                     /db_xref="GeneID:5003811"
     CDS             join(435918..436091,436185..436832)
                     /locus_tag="OSTLU_50535"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419596.1"
                     /db_xref="GeneID:5003811"
                     /db_xref="JGIDB:Ost9901_3_50535"
                     /translation="MSDTVSDFWRQKYETDARKNWDVFYKTHATNFFKDRHWLAREWP
                     DVFAKPPEETALEDLGCGVGNTVFPLLELDAEATVYCCDFSKRAIDMVLERAATLPPR
                     DRDRVKAFVCDATCESLLENVPAGCVDVATMVFALSAMSREKMKYCVRNLSTVMRDGQ
                     RGAICVRDYAAGDLAQERFEGKVAANQKLSENFYVRHDGTRAYYFTIEDLVALFAEEG
                     MEMREVFIHQRTITNRADSLDMNRRWIQANFASAKICPMTFAPPERLKPTTPWGK"
     CDS             complement(437029..437688)
                     /locus_tag="OSTLU_19676"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419808.1"
                     /db_xref="GeneID:5003810"
                     /db_xref="InterPro:IPR002891"
                     /db_xref="JGIDB:Ost9901_3_19676"
                     /translation="MTHARARAVDAYKVGESTNIKWHEGAVDRETRERALGQRGCVLW
                     FTGLSGSGKSTVAYTLEHELFKRGKIAQVLDGDNIRHGLNSNLGFTAADREENIRRIG
                     EVSKLYADSGMITLVSFISPYKKDRLAVRERVGDRFVEVYMKIPLSVCEERDPKGLYK
                     AARAGKIKGFTGIDDPYEEPVNAEIEMEVAKEDGVLAPPRDMAHKIIEYLDAKGFLKA
                     D"
     gene            complement(438001..>441281)
                     /locus_tag="OSTLU_25061"
                     /db_xref="GeneID:5003758"
     mRNA            complement(438001..>441281)
                     /locus_tag="OSTLU_25061"
                     /product="predicted protein"
                     /transcript_id="XM_001419772.1"
                     /db_xref="GeneID:5003758"
     CDS             complement(439092..441281)
                     /locus_tag="OSTLU_25061"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419809.1"
                     /db_xref="GeneID:5003758"
                     /db_xref="JGIDB:Ost9901_3_25061"
                     /translation="MGAACARAIDRDGARAGAPSTKRAPPGPHALPARSILKSSSIAG
                     ELASARDSHSTGTAASSAATTPCGSERDLEGRERGMTRKVSLVKFAGLSDDEGEEHGE
                     GWRGRLFGGRAVASGGGGGGGERDDDGATTTHGNGFESDSSGREVGGGTIYGMPTHER
                     RGSFTSSVPVVEHEEEAHWFLSIGVDTRLAAARVMESRLAAARVEEERLRELVIEAEA
                     ATREAEAEARAKSEGEHDEPRAGSSGGDGGEDDGAVVSTPPRVKTATLMPWDVMVTVA
                     RAREGDARAAAHKATLVVKKLAHTVALWELKSTKRAHSDIGEHLTKIKEKKGRRLASA
                     TRARATFIAAEETRDREFENTRVLEDKRLAADVNMAEASARIHAARTALQNARDRKKG
                     ILTTFRQAVRTSMDSSVDLLEFRQKEFALRASNVTKTMFTAYDEMTSRLEEALMNAID
                     AVGRKSPKKIDKVFDIEAAAALTARDRAEASLNDATSQCMAEMRALEASTRTLLDDVD
                     EEIKNGIEEYYAAADDERVCYMEAQRATIACKMAHAAVKVYEEQYNATKNMSDEAHTW
                     ASSLDDEIAQLNKDYAIAEERHLEAAKVVDAALVEVEAAEKDVLSTSAPDESNQKSAR
                     RQSVRNVFEVINRFSTMVRDKSARGDSDTFASLKQLSLQAGSDSPRNSDEQHRVSMLG
                     FSTSFPDADATMESIMEKAHELEHSRDVQTLTRNVSRSAMAYNPLQK"
     gene            <443800..>445419
                     /locus_tag="OSTLU_34911"
                     /db_xref="GeneID:5003812"
     mRNA            <443800..>445419
                     /locus_tag="OSTLU_34911"
                     /product="predicted protein"
                     /transcript_id="XM_001419560.1"
                     /db_xref="GeneID:5003812"
     CDS             443800..445419
                     /locus_tag="OSTLU_34911"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419597.1"
                     /db_xref="GeneID:5003812"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="JGIDB:Ost9901_3_34911"
                     /translation="MGRDNPLLAELGLLSHSEAVKNIHRPRNVEAVAQARERLAFEEL
                     VLLQVALLQERSRLQALPVSESTEGVCIVGTALTDELRSELPFALTRSQESSLEEILS
                     DMAGPAPMLRLLQGDVGCGKTVVAAMALLAAVGAGHQGAFMAPTEVLATQHHRVLTDL
                     LSQMRDPPKVALLTGSTKTAERAQILEDLNDGKIGIIVGTHALIHEKVVFSSLGIAVV
                     DEQHRFGVEQRAGLLAKGKLPPHMLTMSATPIPRTLAMTKFGEMALSVIDEKPAGRLP
                     IITTVCGVDEHSQAYDSMCEEVSRGGQAYVILRLVNESGSSRMSEVKGAEEEYARLVS
                     KYPNVRFGLLHGQLGADEKAAALEKFSSGETQALVATSVVEVGVDVPNASVIIIEDAD
                     GFGLAALHQLRGRVGRGARQSKCFLLHSPGAGENAELKGDRARDRLRVLEQSNNGFRI
                     AESDLQLRGAGELFGTKQSGQQVNLFHASMSTDLYLLEAARKAAAEMISRASLQQEPL
                     PAPVTVALETRPALILDNAIISGGAQAAATN"
     gene            <445946..>446818
                     /locus_tag="OSTLU_16833"
                     /db_xref="GeneID:5003759"
     mRNA            <445946..>446818
                     /locus_tag="OSTLU_16833"
                     /product="predicted protein"
                     /transcript_id="XM_001419561.1"
                     /db_xref="GeneID:5003759"
     CDS             445946..446818
                     /locus_tag="OSTLU_16833"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419598.1"
                     /db_xref="GeneID:5003759"
                     /db_xref="InterPro:IPR001227"
                     /db_xref="JGIDB:Ost9901_3_16833"
                     /translation="MAKELCEECPAAKAMFDTASGVLGYDLLDVCVNGPAERLNSTAV
                     SQPAIYVSSLAALEKMKMSDEGKAMIDSIDVAAGLSLGEYTALTFAEALSFEDGLKLV
                     KIRGESMQEAADATPSGMASVIGLSADKAEELAARAAAESGAPCSVANYLCNGNYAVS
                     GAIPAIDKVEEIAKPEFKARMVVRLAVAGAFHTDFMAPAADKLKAALEATPIKEPRIP
                     VISNVDVNPHTDAASIRATLAKQLTNPVQWETTMTTLLGKGLESATEVGPGKVISGIM
                     KRVDKAFACDNFTV"
     gene            complement(<447123..>447341)
                     /locus_tag="OSTLU_9865"
                     /db_xref="GeneID:5003760"
     mRNA            complement(<447123..>447341)
                     /locus_tag="OSTLU_9865"
                     /product="predicted protein"
                     /transcript_id="XM_001419773.1"
                     /db_xref="GeneID:5003760"
     CDS             complement(<447123..>447341)
                     /locus_tag="OSTLU_9865"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419810.1"
                     /db_xref="GeneID:5003760"
                     /db_xref="InterPro:IPR001075"
                     /db_xref="JGIDB:Ost9901_3_9865"
                     /translation="TMENVDEALDEVRPYLVADGGNVELVKIEGKIIVVRLNGACGTC
                     ASSSATMKGGIEKLLKQKFGDAVEEVVDV"
     gene            <448382..>449860
                     /locus_tag="OSTLU_1452"
                     /db_xref="GeneID:5003813"
     mRNA            <448382..>449860
                     /locus_tag="OSTLU_1452"
                     /product="predicted protein"
                     /transcript_id="XM_001419562.1"
                     /db_xref="GeneID:5003813"
     CDS             <448382..>449860
                     /locus_tag="OSTLU_1452"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419599.1"
                     /db_xref="GeneID:5003813"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="JGIDB:Ost9901_3_1452"
                     /translation="DIWRAAAYGNVDAMKRMIDADEGCVNAPDGSGFRALQWAALNNR
                     VAAATLLLERGSSINAGDNDGQTALHWACVRGSLPCAELLLRKGAELNAADSRGYVPL
                     HVAAQYGHTGMIYHFKMRWNIDVDVTDHDGRTALHWAAYKGFPDPVKLLVCMDADVYR
                     ADKEGCTALHWAAIKGKSEAAHLIVRAGGLNAMTAVDVDGNTAEALALEKGHHLLANF
                     LAKEQRALLRRDNFWTQKGLAVACLGLIVGLMLMFSHYVIFAEGVATMDVTLSFWSLV
                     SLASASCGLYYMKRVSQADPGVVTASILSSIRRGARPSSAAHDVDERLNHAELWAGNW
                     NQLCVTCKFVKPFGTKHCAVRDKCVARFDHYCPWMGNTIGKRNHRDFVIFLILESLAM
                     AIAFCVAIARFNEESPTERFRSTGGIACFAVFDALTLLPVALLTVAQLSQAARNITTN
                     ELSNVHRYAYLKSAEGRFANPFDRGSFARNLRAFFLVGKKEPL"
     gene            450187..451768
                     /locus_tag="OSTLU_25062"
                     /db_xref="GeneID:5003761"
     mRNA            450187..451768
                     /locus_tag="OSTLU_25062"
                     /product="predicted protein"
                     /transcript_id="XM_001419563.1"
                     /db_xref="GeneID:5003761"
     CDS             450874..451767
                     /locus_tag="OSTLU_25062"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419600.1"
                     /db_xref="GeneID:5003761"
                     /db_xref="JGIDB:Ost9901_3_25062"
                     /translation="MRSERVRPHFAARAMASRPRVLVLARASSASSATTRAPEYRAAG
                     YRTFVDPSPSASATRVKIDCGPVRAYTGGRYDGDTLRAPWDSAQTTPKGDGASNSTTQ
                     RTYVFDTTLAGASEVLSVTAARPLGIIFEDDADGRARVADFVKGSDAARANDVAALAP
                     FGRQCARRGDVLRAFTATQVVYRTTAALTGDLSGTKRVRTLFGADEVPWGEVSAALAN
                     GRVADGPITLVLERDGDRERAENWPRREEELEFRGLGDESTQAKRQRERFESDEDTER
                     ANIAFAGAIAAFVLLILAGFS"
     gene            complement(<451829..>453370)
                     /locus_tag="OSTLU_34718"
                     /db_xref="GeneID:5003762"
     mRNA            complement(join(<451829..452431,452546..>453370))
                     /locus_tag="OSTLU_34718"
                     /product="predicted protein"
                     /transcript_id="XM_001419774.1"
                     /db_xref="GeneID:5003762"
     CDS             complement(join(451829..452431,452546..453370))
                     /locus_tag="OSTLU_34718"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419811.1"
                     /db_xref="GeneID:5003762"
                     /db_xref="InterPro:IPR001607"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="JGIDB:Ost9901_3_34718"
                     /translation="MAHAARVERDDDDDDDDDDARRADGAPTVGATRGRVRLFKTTRD
                     DGCATTTRRNANAACVVGVPSAIAIADFCRFVAGAMATTRSVRAVAGRGDGARSTYDA
                     VLEFDDGDAADAFVENYHGRRYAMGREETCVAVRVVRVEEGAEASGTLGTEVPTCPVC
                     LDRLDAEASGIVTTICEHAFHAECLSGWADASCPVCRYAHEPESKARCATCGKDHDLW
                     VCLICGEVRCGRYAGACAVNHWTETNHTYALELGTQRVWDYVSDGFVHRLIQSKSGLE
                     ALVASKLDAIASEYDLLLTSQLESQRKYFEGLLQTANARCAGTISREDEDSRNAAVVA
                     RAMSEAKDAKRELKMLQKANASHVASIEQLRDELEHAHALSDTLAENVETLRAEATRA
                     EKRKTIELAIKDARIKELEEENRDLMLFLDTSNKLSVDASLAEEIAGGTVVGIDTDTT
                     PEPTPSRNRTHERLKGKVEAERRKL"
     gene            <454062..>454514
                     /locus_tag="OSTLU_33581"
                     /db_xref="GeneID:5003814"
     mRNA            <454062..>454514
                     /locus_tag="OSTLU_33581"
                     /product="predicted protein"
                     /transcript_id="XM_001419564.1"
                     /db_xref="GeneID:5003814"
     CDS             454062..454514
                     /locus_tag="OSTLU_33581"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419601.1"
                     /db_xref="GeneID:5003814"
                     /db_xref="InterPro:IPR007019"
                     /db_xref="JGIDB:Ost9901_3_33581"
                     /translation="MAFGRITTDDVALNSGRKKKKESKEALLRKVQARQKAIDDAGGE
                     EGGGKAVAEKFAWEAALSRASGEKVLDDPKLLQKSIKREARAKKKSREKWEERTAKVK
                     EQMDAAQTKRKSNIKARKDGKMERKMDKASNKRNRPGFEGRSDGFINK"
     gene            complement(<454572..>456722)
                     /locus_tag="OSTLU_35149"
                     /db_xref="GeneID:5003763"
     mRNA            complement(join(<454572..456377,456414..>456722))
                     /locus_tag="OSTLU_35149"
                     /product="predicted protein"
                     /transcript_id="XM_001419775.1"
                     /db_xref="GeneID:5003763"
     CDS             complement(join(454572..456377,456414..456722))
                     /locus_tag="OSTLU_35149"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419812.1"
                     /db_xref="GeneID:5003763"
                     /db_xref="InterPro:IPR007259"
                     /db_xref="JGIDB:Ost9901_3_35149"
                     /translation="MTVGSSQRRSGGLFGKPERTIVSRPTELADGPKLPDWNYKRPFL
                     TGAHLGSGAEQDRNVKALSDYGTAEQELLVLDDLLYAMMGVDGRYISAWKGTDDETSS
                     GFEVELGLEAPLAALVKNMLPLCSDAATVRAFIESRHEFKHGYVSHALAAEMRDLLND
                     WHTLIVQLEHQRNIGSLSLQAAWFYCQPAAPALRLMASVASRAYHLKGASILNLLHRE
                     GCEHAGDGAVSALVQRLSKATSAPYSRAIELWVYDGQVDDPYDEFLIVEQREMKKTSL
                     ADDYNSAYWTKRYSLREEIPQFIGKQLAQKILTTGRYLNAVRETKVSAIAELPAKPRD
                     GLGKMYFGPNMIIGTGKYADRIDDRFEHASRKLLQIMWEDGELKSRLMSMKMYFLLAR
                     GDYLVHFLDTAASELEKDADDIRLPKLQTLLDIAVKSSSTATDHHGDDLLCSIDGHGL
                     SRQLSSIDDDDSAAVTPSKATGDGDELSGFDAFVLDYDTPWPASVVLNRRAVTKYQIL
                     FRHLFNFKCAERELCAGWQRLQVMRGAQLGRMFAQAHTLTQRMLNFLQNYLYYITNEV
                     IEPHWDRMIARVDDAQSVDELIAGHDAFLEACMKDAMLFWPKILKRLERARAACLRFA
                     RDSQRFADTIERLKENSMDAMTADRLVALEEEIEAVTSDTRSQFRHFLGDLLNALNDA
                     GDVDTNVASLLSRLDFNGYYGI"
     gene            <457639..>458700
                     /gene="RPL18"
                     /locus_tag="OSTLU_33583"
                     /db_xref="GeneID:5003815"
     mRNA            join(<457639..457641,457983..458072,458233..>458700)
                     /gene="RPL18"
                     /locus_tag="OSTLU_33583"
                     /product="Ribosomal protein L18, component of cytosolic
                     80S ribosome and 60S large subunit"
                     /transcript_id="XM_001419565.1"
                     /db_xref="GeneID:5003815"
     CDS             join(457639..457641,457983..458072,458233..458700)
                     /gene="RPL18"
                     /locus_tag="OSTLU_33583"
                     /note="Cytosolic 80S ribosomal protein L18; Cytosolic 60S
                     large ribosomal subunit protein L18"
                     /codon_start=1
                     /product="Ribosomal protein L18, component of cytosolic
                     80S ribosome and 60S large subunit"
                     /protein_id="XP_001419602.1"
                     /db_xref="GeneID:5003815"
                     /db_xref="InterPro:IPR000039"
                     /db_xref="JGIDB:Ost9901_3_33583"
                     /translation="MGIDLKAGGRNKKTNRTAPKSDNVYLKLLVKLYRFLARRTDSKF
                     NDTVLKRLFMSKTNRPPLSLSKVAKFMKGKEGKVAAIVGTVTDDVRLHDVPALKVCAL
                     RFTETARARIIKAGGQCMTFDQLALSAPTGEGVVLLRGPKNSREAVKHFGAPGVPGSH
                     AKPYVRAKGRKFEKARGRRASRGYKA"
     gene            complement(<458993..>459925)
                     /locus_tag="OSTLU_33584"
                     /db_xref="GeneID:5003764"
     mRNA            complement(<458993..>459925)
                     /locus_tag="OSTLU_33584"
                     /product="predicted protein"
                     /transcript_id="XM_001419776.1"
                     /db_xref="GeneID:5003764"
     CDS             complement(458993..459925)
                     /locus_tag="OSTLU_33584"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419813.1"
                     /db_xref="GeneID:5003764"
                     /db_xref="JGIDB:Ost9901_3_33584"
                     /translation="MAPLTLLTFPQIWKNYVNVMAGDLMALGAVSWQGYGAGMLGNLL
                     LLSYFADKREPAATAAQAIGVTTSFMLLTQIAWTGNIHNVAPAVMFASSAFIIAGTSL
                     SVARYFDYAHGERGQKMWELYQAALGIIGIIATPQIISNALTPALGWLPSELAILALV
                     FASRADALPSKWSECSGWTATALFMSMPVAQIASNLSTPELLQGLSVLTSVFITSGNA
                     LMLSRALFTRDAVWIAGSFWATFVGGWGVLLTLFMAHNPLTGERYLSEMEFSTITALL
                     AAYTVVVIGGQLKTQFYTDAEEDDSSQSVEITSR"
     gene            <460781..>462355
                     /gene="SDG3518"
                     /locus_tag="OSTLU_34722"
                     /db_xref="GeneID:5003816"
     mRNA            <460781..>462355
                     /gene="SDG3518"
                     /locus_tag="OSTLU_34722"
                     /product="predicted protein"
                     /transcript_id="XM_001419566.1"
                     /db_xref="GeneID:5003816"
     CDS             460781..462355
                     /gene="SDG3518"
                     /locus_tag="OSTLU_34722"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419603.1"
                     /db_xref="GeneID:5003816"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="JGIDB:Ost9901_3_34722"
                     /translation="MARATARASTRRGAREGRARDGEGNLAREDYRRRRGRGRRRRAG
                     TIGGAASTEETTSTRGRAESARYDDAEIPRGVGSATKAELARWLEGRRLPGQKMALEV
                     NLAEGRGLVATEEIKRGEALLGVPRTTLITVERAIAEAKLGPKHAELQEWSVLATFLA
                     QQALALESGTAGTFGEYIRALPRRTGSVLDWPEDEVDKLLKGSPSRLAAAERQDSVNA
                     AIDEIRSYFPEITVGALRWAFDILFSRLIRLDAMGGELALVPWADMLNHKPGCAAFID
                     LNGDAVNLTTDRSYVKGEQVWASYGQRPSSELLISYGFAPEVGENPDDEYALTLGVDV
                     NDPLADAKAQVLRDMGLSPVETFPLRLNGYPRQLLQYASFILCNPEKPSELKGLAQSA
                     FTGSANIGQSIFDSVRGLTNGKARGKQGVILGGVAGEIAVREMLADLCAEALSAYPNT
                     LEKDKGLAQGRMPDFPGADAWTGVAPDAIRATQRSVSAARVRVSERRILAKTDSEVRL
                     QLRKLKQKSLMDDFKQ"
     gene            complement(<462579..>463145)
                     /gene="RPS7"
                     /locus_tag="OSTLU_33586"
                     /db_xref="GeneID:5003765"
     mRNA            complement(join(<462579..463073,463143..>463145))
                     /gene="RPS7"
                     /locus_tag="OSTLU_33586"
                     /product="Ribosomal protein S7, component of cytosolic 80S
                     ribosome and 40S small subunit"
                     /note="but tauri ESTs semi-support the suggested splicing
                     changes"
                     /transcript_id="XM_001419777.1"
                     /db_xref="GeneID:5003765"
     CDS             complement(join(462579..463073,463143..463145))
                     /gene="RPS7"
                     /locus_tag="OSTLU_33586"
                     /note="Cytosolic 80S ribosomal protein S7; Cytosolic 40S
                     small ribosomal subunit protein S7"
                     /codon_start=1
                     /product="Ribosomal protein S7, component of cytosolic 80S
                     ribosome and 40S small subunit"
                     /protein_id="XP_001419814.1"
                     /db_xref="GeneID:5003765"
                     /db_xref="InterPro:IPR000554"
                     /db_xref="JGIDB:Ost9901_3_33586"
                     /translation="MAMIELEASNAELKADLKDLYINSAAEVEVAGGRTAIVIHVPYR
                     ALKSYHKIQQRLVRELEKKFSGKDVVIVANRRIMPVPSNNMARSRPRSRTLTAVHAAL
                     LEDLVYPTEIVGKRQRYRLDGSRLLKVYLDPKDRSTTEYKLDTFAGVYKKLTGKECSF
                     QFPEA"
     gene            complement(463770..465596)
                     /locus_tag="OSTLU_46540"
                     /db_xref="GeneID:5003817"
     mRNA            complement(463770..465596)
                     /locus_tag="OSTLU_46540"
                     /product="ABC(ATP-binding) family transporter (Uup-like
                     protein/duplicated ATPase)"
                     /transcript_id="XM_001419778.1"
                     /db_xref="GeneID:5003817"
     CDS             complement(463804..465453)
                     /locus_tag="OSTLU_46540"
                     /GO_component="membrane"
                     /GO_function="ATP binding"
                     /GO_process="transport"
                     /codon_start=1
                     /product="ABC(ATP-binding) family transporter (Uup-like
                     protein/duplicated ATPase)"
                     /protein_id="XP_001419815.1"
                     /db_xref="GeneID:5003817"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="JGIDB:Ost9901_3_46540"
                     /translation="MSKVRKVTPNGKELIKNINLGMYLGAKIGILGANGAGKSTLMKI
                     LAGADTAFDGDVYLEPGIKIGYLAQEPDLDDGETVAENIAVGVKAVQADLDEYNQIAV
                     DMTAPDADVDALMKRMDQLQNKLDASNAWELERTVSRAMDALRCPPGDALVKNLSGGE
                     RRRVAICRLLLSQPDILLLDEPTNHLDAQSVAWLEQFLATFKGTVVAITHDRYFLDNV
                     AGWILELDRGEGIPFEGNYSTWLESKSKRLEAENKKKSSLDRQIEQELEWVRSNAKGQ
                     VKKGKARLRQYEELCQAAAQFQARQDLDSITIPAAPRLGDVVITANGVRKGYDGRGLL
                     IDDLNCIIPPGSVVGIVGGNGAGKTTLFRMVTGEEKPDGGELTVGETVKLMYVDQSRD
                     SLDPEKTVFDTLSGGAEEISLGTRQVNARAYCSWYNFKSADQQKKVGTLSGGERNRLQ
                     LARTLTSGGNCLLLDEPTNDLDVATLRCLEDAIQSWNGTTICISHDRWFLNKIATHIL
                     AYEGDSNVVFFEGSYDEYEAHRLERMGGEEPKPLKFRPMPV"
     gene            <466251..>467549
                     /locus_tag="OSTLU_33588"
                     /db_xref="GeneID:5003818"
     mRNA            <466251..>467549
                     /locus_tag="OSTLU_33588"
                     /product="predicted protein"
                     /transcript_id="XM_001419567.1"
                     /db_xref="GeneID:5003818"
     CDS             466251..467549
                     /locus_tag="OSTLU_33588"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419604.1"
                     /db_xref="GeneID:5003818"
                     /db_xref="JGIDB:Ost9901_3_33588"
                     /translation="MDVKSAMKSVSASPPTWSPPKPKPKPKPKPKPKPKPKPKPPSPS
                     PPSPSPPPPPKPTTAIEPIIDPKCDEWTAKLAAAASAPEFEYDFPAYTCSNEHEAPCI
                     QDFQFMKLQPDACDVLKRDEDWPGRFMQRAPGVKNGGDLVRALGADNTIVVIGASMTK
                     QIEIAMDCSIRRAGVDKSQSAKIMKRWGWARWSFDSQTCELDHMVAARTGGDINYWFS
                     AKEYVDGCWKDTKAFDINVLGCEGAIDDCDASSRVVVLMYNIEHYGGLGNVEFFEKET
                     EFLVKRAVSLGAKVVLATSPPKHFSADGAYSKEAYITKIKSETVCTCTPTVESIDKNP
                     AWRGYFEAIERLSRIPGVLGVIDILRSSMKEFYRSHKGGHCGYYVDEVPGENSQKPKR
                     EVKYKACCDCTHYCFDPALWDQYFLDPLVDILDRGTSPAS"
     gene            <468064..>469599
                     /locus_tag="OSTLU_1469"
                     /db_xref="GeneID:5003766"
     mRNA            <468064..>469599
                     /locus_tag="OSTLU_1469"
                     /product="predicted protein"
                     /transcript_id="XM_001419568.1"
                     /db_xref="GeneID:5003766"
     CDS             <468064..>469599
                     /locus_tag="OSTLU_1469"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419605.1"
                     /db_xref="GeneID:5003766"
                     /db_xref="InterPro:IPR003386"
                     /db_xref="JGIDB:Ost9901_3_1469"
                     /translation="GVELRERGLTPKHPVVIVPGFVSTGLELWRGKACGAHFFRRRMW
                     GTPAMARAFFSNQKCWMEHMRLDGRTGSDPESVRLRAVRGLEGVDWFLPGYFVWGKVI
                     EELSELGYDSNTLHSAAYDWRLSPTMLERRDGYFTRLKSVIETLYSVHGERVALLAHS
                     YGDTISRYFFEWVETPVAKGGGGGGKRWVDKHVHAYVDIAGPMLGIPKTIPSLLSGEM
                     RDTAILGELEGMLGGLLETAVGRLIGTQIKEVCDTFRTWGALWAMLPRGGAAVWGDDD
                     AGAPESGALNFFLQMRAAGTSRETSFNHTVDSALGFLFEQLADSVPHNVAEFSSTIDR
                     ASRERLKTRVPDLEAKTAPNFGDPLRSALPRAPNMKIFCLYGAGKPTERAYVYERFDA
                     DALRPYQLDVQSRDAALTHGVWQVDGDGSIPLASLGYVCREWRVNRALNPANVSVVTR
                     EYAHRPLPLSVGGFQGKSEGDHVNIMGNEDMIRDLLTIVAGRAHAVPPRVVSDVDALA
                     ATIR"
     gene            469898..471351
                     /locus_tag="OSTLU_25066"
                     /db_xref="GeneID:5003767"
     mRNA            469898..471351
                     /locus_tag="OSTLU_25066"
                     /product="predicted protein"
                     /transcript_id="XM_001419569.1"
                     /db_xref="GeneID:5003767"
     CDS             470118..471200
                     /locus_tag="OSTLU_25066"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419606.1"
                     /db_xref="GeneID:5003767"
                     /db_xref="JGIDB:Ost9901_3_25066"
                     /translation="MTSRGLPMDVSLRFLSDEDDGQRGGGGKPYARRGGKKASGSANG
                     KGSGGSRGTTSEANVKRSEKYGAPKPRKPRTLRLDVDEDRVEEYCVALREHQELTRVY
                     DYHAKIVDKCDESQLLAFMARVLKSVIDNIVEENTAHGQYLAKATLRCDVGALHILDA
                     FCVTLYKKAEEYNKYSPDLLLLESVMSDSRQDPDAAVDMNLLAIEFGFNARLCDCLNK
                     VIEETAEKKGLTEADKKRLQRRWRLWLKNKSFDDCRPNPFNHAQLSTYVEPPYTINYQ
                     LHTNESAVFAVLTSDQINPFAMQCKTLGEAPKNAPEEIEIYDSKTKKGKTFQEIVDIL
                     QKIVKSPRATQGAQKAKDENIFRYQR"
     gene            <471893..>472495
                     /locus_tag="OSTLU_35130"
                     /db_xref="GeneID:5003768"
     mRNA            <471893..>472495
                     /locus_tag="OSTLU_35130"
                     /product="predicted protein"
                     /transcript_id="XM_001419570.1"
                     /db_xref="GeneID:5003768"
     CDS             471893..472495
                     /locus_tag="OSTLU_35130"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419607.1"
                     /db_xref="GeneID:5003768"
                     /db_xref="JGIDB:Ost9901_3_35130"
                     /translation="MAVGTIGLAYWTSDLGTGIFHWSVDNYGSKATPLLGGVIDAFQG
                     HHKYPWTITKRQWANNVHTTCVAPLVFTTPTLLLNDRATDLIFVGVFTSLIVLSQQFH
                     AWSHMKKSELPPLVLKAQDMGLLVGRRDHGQHHKSPFEGHYCIVSGYWNPILDGSGFF
                     RALEQAVFKATGTAPRCWSDDVEFIVQESAPEGWGRGVLK"
     gene            complement(<472640..>473221)
                     /locus_tag="OSTLU_16847"
                     /db_xref="GeneID:5003769"
     mRNA            complement(<472640..>473221)
                     /locus_tag="OSTLU_16847"
                     /product="predicted protein"
                     /transcript_id="XM_001419779.1"
                     /db_xref="GeneID:5003769"
     CDS             complement(472640..473221)
                     /locus_tag="OSTLU_16847"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419816.1"
                     /db_xref="GeneID:5003769"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="JGIDB:Ost9901_3_16847"
                     /translation="MLEKREGGASAGDWAETLGRAGRAAAARAECECVRVLMAHDMDV
                     DDVLLSASCADGVEDDARASCVGLLLRGGADANCRNHHQGWKPLHAVAKRGDCASVEL
                     LVRGGADIDARYYNGKTALFSACEWGEAAAARTLLRLGASVEVGQWEADRLHTDHSLG
                     ANNAPVSPRDIALVNRHIDCVDVVDEMLALRRA"
     gene            complement(<473557..>474684)
                     /locus_tag="OSTLU_5032"
                     /db_xref="GeneID:5003819"
     mRNA            complement(<473557..>474684)
                     /locus_tag="OSTLU_5032"
                     /product="predicted protein"
                     /transcript_id="XM_001419780.1"
                     /db_xref="GeneID:5003819"
     CDS             complement(<473557..>474684)
                     /locus_tag="OSTLU_5032"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419817.1"
                     /db_xref="GeneID:5003819"
                     /db_xref="InterPro:IPR007369"
                     /db_xref="JGIDB:Ost9901_3_5032"
                     /translation="AHVALLLCALAPTVAVVDPNAQIVAVSTLSVVAGAYRSVRPASE
                     GSGEVMTKEDAQKFPLLGSCVLFGAFLAFKFLPKNVLDVCATAYFGMLGVVAMSAILT
                     PVVHKFAFGGRELVSYELFSVPEMKWVNGERWTAECTLAEAAAGVAALAGTAAYVRSR
                     HWLANNALGMSFALQGIEYLTIDSVQIGSILLAGLFVYDVFWVFCTPVMVSVARSFDA
                     PIKLLFPRVAASAIEGANRPFSMLGLGDIVVPGLYVAMILRMDNARRAAALEPRKSLT
                     RSASKKAATASRTVRDDGKTVTTYFPAVAFGYLVGIVTTIVVMNVFDAAQPALLYIVP
                     GVLGATFIRAALAKEVGVTWNYCEGLEEAQAERDAAEAKTKS"
     gene            complement(<474842..>475464)
                     /locus_tag="OSTLU_33594"
                     /db_xref="GeneID:5003820"
     mRNA            complement(join(<474842..475153,475249..>475464))
                     /locus_tag="OSTLU_33594"
                     /product="predicted protein"
                     /transcript_id="XM_001419781.1"
                     /db_xref="GeneID:5003820"
     CDS             complement(join(474842..475153,475249..475464))
                     /locus_tag="OSTLU_33594"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419818.1"
                     /db_xref="GeneID:5003820"
                     /db_xref="InterPro:IPR004345"
                     /db_xref="JGIDB:Ost9901_3_33594"
                     /translation="MPSAAIADAVLRVVVLLYPGYLTYKTLEHDRKRADNARGWCVYW
                     VVASAWMAAQPALDRAFGGRAVMYWECKVAFSVYLWHPRFQGALYVYDRFLAPILVAN
                     ESRVDHALATTFERVGTHGGAALAAARRFARRYANDALAKATEAQLQQQADAPAASGR
                     ADRVVTARTAREVRS"
     gene            <475646..>477097
                     /locus_tag="OSTLU_16849"
                     /db_xref="GeneID:5003821"
     mRNA            <475646..>477097
                     /locus_tag="OSTLU_16849"
                     /product="predicted protein"
                     /transcript_id="XM_001419571.1"
                     /db_xref="GeneID:5003821"
     CDS             475646..477097
                     /locus_tag="OSTLU_16849"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419608.1"
                     /db_xref="GeneID:5003821"
                     /db_xref="JGIDB:Ost9901_3_16849"
                     /translation="MAKTWTPFERARVMRAGRAKHVAGSEAYGRGDYGEAIACFTRAL
                     EIDARNQFALCNRALARLRRGEDGDAARALEDARACVRNAPTWHKAWFRLGQARAASG
                     AEVEALSAYAEAIRCDECGQDRDECEAVMKKLRARVELDERKAAEAAEAEARRAVEVA
                     EEDDEIERRRARREAKLEAKRARHKVAEERLSKQLGYPEGMNAVDVNAYADESDDSDD
                     SALETYDACGRAMFIERKITDFVSIARRLRTSVGATKTMDMMCELRRYGCCQISLGAA
                     VGATAKFKVAADAADRCALPYVVIPAWREASTPWPMSLAQSHQDVQDVMWLMETVARV
                     TTGAIYEDAGKSEAELDRALDSPLSAGVLESAPSIDEVSLSALVFANDESFLRAYAEK
                     NSALVRLDWLEAYEEEDAEADGDSTLVELFVGAELTRRLDDEFITVDELDPRDRDGHG
                     PDGTSFACPRAKRPADRTRVSFFLCPKNSNSHF"
     gene            <477310..>477711
                     /locus_tag="OSTLU_33596"
                     /db_xref="GeneID:5003876"
     mRNA            <477310..>477711
                     /locus_tag="OSTLU_33596"
                     /product="predicted protein"
                     /transcript_id="XM_001419572.1"
                     /db_xref="GeneID:5003876"
     CDS             477310..477711
                     /locus_tag="OSTLU_33596"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419609.1"
                     /db_xref="GeneID:5003876"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="JGIDB:Ost9901_3_33596"
                     /translation="MLKRRKLMKKTLGERKRAQLRELFDALDADGGGEVEFSEFVTTW
                     QMIGGRDAASMRVARELFAAIDVDGSQSMDFDEFALLMSDLDSRHVLGGGANDDRGAL
                     FRQAAAALQTRRAISDFISFWGTASGGAHRC"
     gene            <477839..>478840
                     /locus_tag="OSTLU_16850"
                     /db_xref="GeneID:5003877"
     mRNA            <477839..>478840
                     /locus_tag="OSTLU_16850"
                     /product="predicted protein"
                     /transcript_id="XM_001419573.1"
                     /db_xref="GeneID:5003877"
     CDS             477839..478840
                     /locus_tag="OSTLU_16850"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419610.1"
                     /db_xref="GeneID:5003877"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Ost9901_3_16850"
                     /translation="MPTDAAPRCVAYDDTRTACVVGTAAGEIVFRERASSASALDAAA
                     VEDHSKPSASPWTRQASARAADDTSAIVDIALSDAAHGRVIAAATASGEVSFWRASAS
                     GDSNGTPRVERVGLVRVEGGAKARCVAFAPSHDALTLAAACDDGVVRFYEPREKLTAT
                     AWESTLEFEGKKPGGDATALAWRRSSERTSAVNVPILAVGTTWTSEARHGVSVLAYDE
                     KFRRWNVVTEMEDGLTTSARHLAWSATTTARGALNLVVASGSKCLVYEFTGVVMRGVE
                     DAKQIGRLDHPCEVNSAEWNASGSVIATAAADGVVRLWSANLKDGTWREQTMGQTMQ"
     gene            complement(<478855..>479613)
                     /locus_tag="OSTLU_93272"
                     /db_xref="GeneID:5003878"
     mRNA            complement(<478855..>479613)
                     /locus_tag="OSTLU_93272"
                     /product="predicted protein"
                     /transcript_id="XM_001419782.1"
                     /db_xref="GeneID:5003878"
     CDS             complement(478855..>479613)
                     /locus_tag="OSTLU_93272"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419819.1"
                     /db_xref="GeneID:5003878"
                     /db_xref="JGIDB:Ost9901_3_93272"
                     /translation="VLAALRDAHAALTLETAKTLEARGNAGRCFREEISNLARASCEA
                     TKATIRAACARAREGRAANVRRGVGAVWEASKAFAKAPKDAVRAVAARLMTCARFVKD
                     VDDEMRALGEDEEGAAASTRTDEDDLRFCDDDFSETEMANAKALRVFVKECVALLKAL
                     ILPTVKEKTARLEALEPIVDACLEFQNCVEEIGAGAYPPQDVDDLKVHVRTAREAGKK
                     MFECVRDAGIGDDETENAFARFDETGASVSLRVD"
     gene            <481149..>481943
                     /locus_tag="OSTLU_33599"
                     /db_xref="GeneID:5003822"
     mRNA            <481149..>481943
                     /locus_tag="OSTLU_33599"
                     /product="predicted protein"
                     /transcript_id="XM_001419574.1"
                     /db_xref="GeneID:5003822"
     CDS             481149..481943
                     /locus_tag="OSTLU_33599"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419611.1"
                     /db_xref="GeneID:5003822"
                     /db_xref="JGIDB:Ost9901_3_33599"
                     /translation="MTTAKARRRASDPAGAVRRIFDERRARRAAATIRTTTTTNAGRR
                     TSEPTPARARFARALDGALDDALDDAEASGGASARDGDDDASDGAYGLLLRAARDERA
                     ARDASLPEEYSLQEVRDGGAACEDLVALSVAFEREDARVGSLAGGLGGAVAHVLRTAS
                     GEAVGYTLTYENRAPEWDRARAVVLPPRLAHVFIRRDHRMRGLGTGLVNWWRRRFALR
                     CAFFAVDSPNDSMTRTLLRVECAPATTRSGHGASSVHYIAPVAASS"
     gene            complement(<481985..>483238)
                     /locus_tag="OSTLU_33600"
                     /db_xref="GeneID:5003879"
     mRNA            complement(<481985..>483238)
                     /locus_tag="OSTLU_33600"
                     /product="predicted protein"
                     /transcript_id="XM_001419783.1"
                     /db_xref="GeneID:5003879"
     CDS             complement(481985..483238)
                     /locus_tag="OSTLU_33600"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419820.1"
                     /db_xref="GeneID:5003879"
                     /db_xref="JGIDB:Ost9901_3_33600"
                     /translation="MTDVAHDVRVMFTSSADATVRAKTIAFRFDRTKRSKLVRATTTG
                     TTGHMTRLTRVEDGDGRVSRACDTCLIEIHGVRFTRSIEPRLTKIVDAREVAQRQLGT
                     LAERGAAVQLRFGNARDDDGRGTCEVLDGALTIDPLHPAMEACASAMCEVVAEGARSL
                     GTRAASVGKNPEVWTPRKLEEGDEGYEKGKTKYEFAWSGEGKFAEEFGRYRGLQSEAE
                     PLVRKIAERDRRVAALHLRIAHLEEIRRGLEVGSCGVIPEDCFTRRVVDADLIDRLHE
                     GLTLTSQVTGESYNVRECGVYFDDLEDCDAEDLKSKITETQGQLALAQAVLRAMHEEL
                     QERVRWDSHESGVETRDVLENGVRREHMERLLGRGATKADVEASLKLPDRIRAKLVGG
                     YDVDRCRKTGKYIAATADRGPARLE"
     gene            483918..485659
                     /locus_tag="OSTLU_46561"
                     /db_xref="GeneID:5003823"
     mRNA            483918..485659
                     /locus_tag="OSTLU_46561"
                     /product="predicted protein"
                     /transcript_id="XM_001419575.1"
                     /db_xref="GeneID:5003823"
     CDS             483945..485447
                     /locus_tag="OSTLU_46561"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419612.1"
                     /db_xref="GeneID:5003823"
                     /db_xref="InterPro:IPR005046"
                     /db_xref="JGIDB:Ost9901_3_46561"
                     /translation="MDMRFMFATAYAFDSPIRNWDISQVTNTSYMFYSIAASFNVFNQ
                     SVENWNTSQVMDMRGMFGNARYFNKPIGGWNTSQVTDMRNMFVTASSFNQPIGDWDTS
                     QVTDMRYMFATASSFNQPIGDWDTSQVTDMRGMLGSVSFNQPIGNWNTSQVTDMRTMF
                     ATASSFNAPIGDWNTSQVTDMGRMFYAASSFNRSIGDWNTSQVTDMQSMFYASSFDQP
                     IGNWDTSLVTYMNSMFNSAVSFNQSIGGWNTSRVVSMQSMFANAFSFNQPIGNWNTGR
                     VVSMHSMFDSAVYFNQPIGNWNTGRVVSMNSMFDSAGFFNQPIGNWDTSQVTDMNSMF
                     DSAGSFNQPIGNWNTSQVTDMNSMFDSAGSFNQPIGDWDTSQVTDMHWMFQGASSFNQ
                     PIGDWDTSQVVTSYSFSEMFKDATAWLCSHTHNTSDPMHFQRYYDGPPSFWFESAAGI
                     GAVCLSPPPPTTLPCVYVAAPPLTARSTGTARSSVALSLYTTVIIIYFHA"
     gene            complement(<486561..>486782)
                     /locus_tag="OSTLU_34854"
                     /db_xref="GeneID:5003880"
     mRNA            complement(<486561..>486782)
                     /locus_tag="OSTLU_34854"
                     /product="predicted protein"
                     /transcript_id="XM_001419784.1"
                     /db_xref="GeneID:5003880"
     CDS             complement(<486561..486782)
                     /locus_tag="OSTLU_34854"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419821.1"
                     /db_xref="GeneID:5003880"
                     /db_xref="InterPro:IPR006175"
                     /db_xref="JGIDB:Ost9901_3_34854"
                     /translation="MRALVAEKLGEDGATEAWRNVAMTHVYLDDMSQFATVNGVYSRY
                     MPPVAPSARACVATCLPGDAKVQIDCLFIL"
     gene            complement(<487068..>487712)
                     /locus_tag="OSTLU_6853"
                     /db_xref="GeneID:5003824"
     mRNA            complement(<487068..>487712)
                     /locus_tag="OSTLU_6853"
                     /product="predicted protein"
                     /transcript_id="XM_001419785.1"
                     /db_xref="GeneID:5003824"
     CDS             complement(<487068..>487712)
                     /locus_tag="OSTLU_6853"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419822.1"
                     /db_xref="GeneID:5003824"
                     /db_xref="InterPro:IPR002761"
                     /db_xref="JGIDB:Ost9901_3_6853"
                     /translation="VACLVNLCPRDAATREVDSHCFQTVAHECVGAFAACAGLDVYRR
                     RITGRSKALGLEYGDGEEGDEVEDLRAALAAAKRERPDVNSVCSGAILSDYQRLRVEA
                     VCASLGLTSLAPLWRVEQREVLRRVEAEGVDARLVKVAAMGLDPGKHLGMSIADARET
                     LIRVEDEYGSHCAGEGGEFETLVVDCPMFARASLAITETRTVKTSEDRFAPSGHL"
     gene            <488252..>490024
                     /locus_tag="OSTLU_33603"
                     /db_xref="GeneID:5003825"
     mRNA            <488252..>490024
                     /locus_tag="OSTLU_33603"
                     /product="predicted protein"
                     /transcript_id="XM_001419576.1"
                     /db_xref="GeneID:5003825"
     CDS             488252..490024
                     /locus_tag="OSTLU_33603"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419613.1"
                     /db_xref="GeneID:5003825"
                     /db_xref="JGIDB:Ost9901_3_33603"
                     /translation="MATRSGGNSNTAKAIVNKGEKKSKVKIEAKEASSGPPGALLGAI
                     PVVLGLGGFAAFKSLSGGSSADDDDDDEPIRAPPKKPSLPKFEAPKVVPPKFDAPEID
                     APKFEVPKFEMPKIPGVGGSGLPPDAPRAGFPSRADSFAEEEEEQEEEEEAVEDEDRE
                     ARKARRAAERAEREAERAARDAEREAAKAQRAAEREAVEDEDREARKARRAAERAERE
                     AERAARDAEREAAEAQRAAEREAAEAERAQAKEAKAREAERIERDRSAEERDAAERKK
                     REKQLIEQERERIKAEKRVRAEQQRAARDAEKAERQAERDAREAERQAEKEARAAERA
                     DRKAANALLKSKPKSAPEPKEAKEEKSFTQLFAKKNVEDSEPPAKTQVMKKAKPEPIA
                     RTQVMSKSGKSSGVAELPSKFPSVEDLEGLSKEEKLAIADEADAFAERLVRKAEAAEK
                     FANGPVVGVLFFLKSGAIKSAERAAEVAELAEATAAQVRSAAERGDGISGAVIGAIAA
                     TVLVGGGAALLGGSLLGGDNAPSSGPKAVAIKKAAAPKASAPMFAAPPQEAPKLRDLE
                     ALEAIEKLNNGEGDALDLYEQMRR"
     gene            complement(<490101..>491144)
                     /locus_tag="OSTLU_33604"
                     /db_xref="GeneID:5003881"
     mRNA            complement(<490101..>491144)
                     /locus_tag="OSTLU_33604"
                     /product="predicted protein"
                     /transcript_id="XM_001419786.1"
                     /db_xref="GeneID:5003881"
     CDS             complement(490101..491144)
                     /locus_tag="OSTLU_33604"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419823.1"
                     /db_xref="GeneID:5003881"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="JGIDB:Ost9901_3_33604"
                     /translation="MGAALRLPTHTANSNKRQIAQHFAPAIPGVYEPPNDYLHRKNAD
                     ATTAVLERENERRRSRRSTDDVWCGTSDDEGSARGGLHVSEDHQECGACFEPLCKERT
                     AVFVDESGARTCKHFLHERCARAVCEHIGSVCPICRTAFASARGVPFPTEDANEWFRL
                     CDVDGNGKLDKEQVLTVIRAQIPVDWRKIDKDLGSLWARWDPESSGALGKAQLVGADG
                     LLEFVSKKYPPRLREYKHVPHVTDKRAWFKFWDEDDSGTLEKDEVVRALIKTFGIKDD
                     VAHIQDVRSMVESIWCVFDLDDSGGIDLTEFLLEDGLGDSIMAAFAVDKRAELAQKED
                     AKASRSPKRPQKK"
     gene            <491391..493407
                     /locus_tag="OSTLU_46552"
                     /db_xref="GeneID:5003826"
     mRNA            join(<491391..491481,491697..491754,491868..493407)
                     /locus_tag="OSTLU_46552"
                     /product="predicted protein"
                     /transcript_id="XM_001419577.1"
                     /db_xref="GeneID:5003826"
     CDS             join(491391..491481,491697..491754,491868..493296)
                     /locus_tag="OSTLU_46552"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419614.1"
                     /db_xref="GeneID:5003826"
                     /db_xref="InterPro:IPR000225"
                     /db_xref="InterPro:IPR002652"
                     /db_xref="JGIDB:Ost9901_3_46552"
                     /translation="MSLRPGSKASERKKGFKKAIDADEARRKREDNMIQIRKDKREEA
                     MMKKRSVASDSTAMTGSPGGGSVQSKLAQLPQMLEALKNPDPNVQLEATIAFRKLLSI
                     ERSPPIDQVIETGATPFFVEFLKRTDVPKLQFEAAWALTNIASGTSEHTAIVIDHGAV
                     PIFIALLGSDNPDVREQAVWALGNIAGDSPRCRDLVLHANALHPLLAQLNAEAKIQML
                     RNATWTLSNFCRGKPQPDFSALRAALPALARLVHSNDEEVLTDACWALSYLSDGTNDK
                     IQAVIEAGVCRRLVELLASNHPSVLIPALRTVGNIVTGDDYQTQIIINCHALKALLGL
                     LAGDYKKSIKKEACWTISNITAGNKDQIQSIIDEQMVPPLVELLANAEFDIKKEAAWA
                     ISNATSGGTHQQIKYLVSQGCIKPLCDLINCSDARIVTVALEGLENILKVGEADRGDN
                     MEAPNVFAQYIDEAEGLEKIESLQNHTNDDIYQKAMRLLETYFGLEDDDAQNLMPEVQ
                     GDQFAFGAGAPTGGFNF"
     gene            <495201..>495518
                     /locus_tag="OSTLU_8924"
                     /db_xref="GeneID:5003882"
     mRNA            <495201..>495518
                     /locus_tag="OSTLU_8924"
                     /product="predicted protein"
                     /transcript_id="XM_001419578.1"
                     /db_xref="GeneID:5003882"
     CDS             <495201..>495518
                     /locus_tag="OSTLU_8924"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419615.1"
                     /db_xref="GeneID:5003882"
                     /db_xref="InterPro:IPR001762"
                     /db_xref="JGIDB:Ost9901_3_8924"
                     /translation="EQCDCPDKNCTCYDHCCNAETCQLLTNATCSAVDGCCDASTCTV
                     AASGTVCRASLGSCDTAETCDGTSKSCPVDTITAYGTACTDANGDVGACWANECRNRD
                     WKCQ"
     gene            complement(<496139..>496603)
                     /locus_tag="OSTLU_8287"
                     /db_xref="GeneID:5003883"
     mRNA            complement(<496139..>496603)
                     /locus_tag="OSTLU_8287"
                     /product="predicted protein"
                     /transcript_id="XM_001419787.1"
                     /db_xref="GeneID:5003883"
     CDS             complement(<496139..>496603)
                     /locus_tag="OSTLU_8287"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419824.1"
                     /db_xref="GeneID:5003883"
                     /db_xref="JGIDB:Ost9901_3_8287"
                     /translation="VEIGTFLGYSAIATAMRFKSARARMLCVEYEARHAEVARWALAY
                     AGLDDRVRVLTAAGSEAVGDARAFVESVKGVGTTEGADVLFLDHAKERYLPDLKLYED
                     AGVVRRGTIVVADNVVYPGAPGYLEYVDSSAGRYDTHLLEAMFEYEQVWKGEE"
     gene            <497609..>499579
                     /locus_tag="OSTLU_33608"
                     /db_xref="GeneID:5003827"
     mRNA            <497609..>499579
                     /locus_tag="OSTLU_33608"
                     /product="predicted protein"
                     /transcript_id="XM_001419579.1"
                     /db_xref="GeneID:5003827"
     CDS             497609..499579
                     /locus_tag="OSTLU_33608"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419616.1"
                     /db_xref="GeneID:5003827"
                     /db_xref="JGIDB:Ost9901_3_33608"
                     /translation="MFAEAFEEAEAAVEAEVVEVVEDVVAKRDGAAVGAVLVPAACVV
                     AVAALACVTYAQRYALMLWATKALDQWEANDPNFPSKQLRWQQLLDEEVSKREALNEE
                     WLERLQAEKAKTKANADEMQQRIEEERALALDMRANATALETEFRALIDEQRAASGAR
                     EEELHGRIVEEQAKFASLSAEAGSLREQISSLEAQLTRKSDSSNDLKEELLSARRAEE
                     VVKSELAGVCAAKDALARQLDEVRTNLTWETSKASELEEQLSALKSELASARDARAEL
                     ERELEGARANLAVESSNEHELEEQLSALKSELASARDARVELERELEGARANLAVESS
                     NEHELEEQLSALKSELASARDARVELERELDAMRDGFEAQLEAQKGAGADMKLESERL
                     EELVAKLKNEIEANSVLRERMQTEKQAEDSYVTALNEEIEALRLELHAAQAHAAQALG
                     QYAELDSALPKIIDAVDRLRSLTSMVNEDSPIVEHTFSVADVPPPQPNEFLVIVGSWN
                     DWDLATGVAMSYDPDGSWKALVELQSDIVYEYKVCVCSGSDEERVPQAWQSGANSAFA
                     IASSLINEQGLAPKATVMSHWVADPANAPIMMFGPDGEKFTLSSTQLMTDLPANLITD
                     TLEDLSHVISEVTRGIDNDILNTKQHAATASR"
     gene            complement(<499632..>501305)
                     /locus_tag="OSTLU_34972"
                     /db_xref="GeneID:5003884"
     mRNA            complement(<499632..>501305)
                     /locus_tag="OSTLU_34972"
                     /product="predicted protein"
                     /transcript_id="XM_001419788.1"
                     /db_xref="GeneID:5003884"
     CDS             complement(499632..501305)
                     /locus_tag="OSTLU_34972"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419825.1"
                     /db_xref="GeneID:5003884"
                     /db_xref="InterPro:IPR007857"
                     /db_xref="JGIDB:Ost9901_3_34972"
                     /translation="MNGNERALARELRWAGHVGAHAAIVDATSNEGEGGDVRVARVIL
                     MNIDALTHTKVWVRVLGASGDAATDEDAHARWRTTDEACGRRSNVYALLHVVAAPIGR
                     EWWERWIGERVGACALSVRAFVKNARGFPVLPKEAQAMVRDMFRRNIQIMLTDWNGAP
                     DGCARETIAPGDVAGDEGRVGVDSAHPMRLYWEYLVYLFRGVEPASEQALAEAPYRDY
                     LQAPLQPLMDNLESVTYETFEKDASKYIQYEEAVRCALLDLVPEGDEGSVMVVGAGRG
                     PLVRASLRASERANRNIKVCAVEKNPNAVVTLQHLVAKEGWGDRVQIFPGDMRTCAAD
                     VRVDVLVSELLGSFGDNELSPECLDGAQRFLKPTGVSVPQSYESFVAPIAAAKLHDAV
                     VSYKDLKSIETPYVVKFHRVHHIAEPKSVWEFEHPNNAARIDNERYARVEWSSEELGS
                     ASSTLHGFAAYFDATLYDGPAGCVRCSIHPHNHTLGPTGELMFSWFPMFFPIQTPVYI
                     DRRGASPTKIEFYIWRRVDAHKMWYEWTIAKPVQGHIHNPNGRSYWIGL"
     gene            <501763..>502818
                     /locus_tag="OSTLU_33610"
                     /db_xref="GeneID:5003828"
     mRNA            <501763..>502818
                     /locus_tag="OSTLU_33610"
                     /product="predicted protein"
                     /transcript_id="XM_001419580.1"
                     /db_xref="GeneID:5003828"
     CDS             501763..502818
                     /locus_tag="OSTLU_33610"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419617.1"
                     /db_xref="GeneID:5003828"
                     /db_xref="InterPro:IPR010765"
                     /db_xref="JGIDB:Ost9901_3_33610"
                     /translation="MVRLTTALRRIDDAKSRDGGGAWRVCEATGARVRAPRAKTPWGC
                     VHFVGGAVLGSFPDVAYDAWLSACADDVGLVVVATPYELDLDHEKCAMAVKKTYDEAR
                     RLACAKEGMDASRAPTFRVGHSLGCKLLCLVASAEDANEREGNGEAGDGTIDMDVDAT
                     SGTAVAVSGTTRGGVGNVAGHFLVAFNNADATDSVKLVEKFARELLKKRAGAASGASE
                     EFFKTLPNLAAFAERAAKAAGLEFKPTPAQTLERCRTRFASKRVRLIKFKDDDLDQND
                     ELLEVLRERMKVYPGRVDARELDFGNHLTPVYFSTDGLKLTPALEKLVGQFALGDAEG
                     VRKLSAEFAAFIRDASS"
     gene            complement(<502904..>505369)
                     /gene="CHR3513"
                     /locus_tag="OSTLU_16860"
                     /db_xref="GeneID:5003885"
     mRNA            complement(<502904..>505369)
                     /gene="CHR3513"
                     /locus_tag="OSTLU_16860"
                     /product="predicted protein"
                     /transcript_id="XM_001419789.1"
                     /db_xref="GeneID:5003885"
     CDS             complement(502904..505369)
                     /gene="CHR3513"
                     /locus_tag="OSTLU_16860"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419826.1"
                     /db_xref="GeneID:5003885"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="JGIDB:Ost9901_3_16860"
                     /translation="MTTRGANDDAHGSVPRMANANRAFVSPYVGANGANGATRAPPYA
                     RRSVKVAGRGRATARDDAARRCFSALYAKRKAGGGGKQRSAKTFVDGVVIARGARERA
                     ELCDMRGKRVARGCAGTIVEGTTCEIGQYEVEIGEAVRAEDVDSGAAFSRGGAAVAPE
                     KVVVANEQKVKSFVAPVRGIGGAVGSATTSEAKKTFAPEAPLHSDVADGALVLSTLDT
                     DFHRRDYRTACAVVCDPFISRFLRPHQRDGVQFMYEAVMGLRTSVHTNRAHTGCLLAH
                     EMGLGKTLQVIALVWTLLKQSPFKRGQPTCRRVVVCVPASLTGNWALEFRKWLGEERC
                     DPKVVEGGDKEARKSFEEFALPSQRRYNVLITSYETLRAQADVVARANVDLLVCDEAH
                     RLKNATQSTKGAQALASLKCHRRVLLTGTPIQNNLDELWGVMDFAAPGLLGDLDSFRK
                     IYSGPIEKASERGAKEEVVRIGNARREEVGRLIGPFIHSRKADEINASLLPPKTEYVV
                     FVRLSEVQKGLYVDQLKQKSMLSMLGRIGKTQDAESISPLQAIQTLQKLCNAAALATE
                     VSDPVASSSKLAVLRAMFRALANDERIVVVSGFTTTLDLIAKLCESEHLKYDRLQGST
                     PPKERTSIVRTFNNSGKILLLSTKAGGVGLNLVGANRLVLVDSSWNPAHDLQAQARVW
                     REGQTKPCSIYRLLSTGTIEERMFQRQELKGALARTLGFKSTSGNNNSAGSSSSTFTQ
                     AELRDLFSYVKDTRCDTADRIAAMTGETPDHWRVDASTTTTDPLLINAMRSDLISFVS
                     ELPSNGTTIDAQIHDANDDADDE"
     gene            <505960..508759
                     /locus_tag="OSTLU_25071"
                     /db_xref="GeneID:5003829"
     mRNA            <505960..508759
                     /locus_tag="OSTLU_25071"
                     /product="predicted protein"
                     /transcript_id="XM_001419581.1"
                     /db_xref="GeneID:5003829"
     CDS             505960..508722
                     /locus_tag="OSTLU_25071"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419618.1"
                     /db_xref="GeneID:5003829"
                     /db_xref="JGIDB:Ost9901_3_25071"
                     /translation="MVVGGACALAACASIGVWTHRSETLQEAWRPVPGEELAMRARGA
                     RAGGASIARWGTTSTERARLGADAATGVTPTPTQMTALRGLRLQIRNAMFNPGTVTSQ
                     TLSTMTNQFFNIVPQARALFPTGAPANIDDLDATIKSLMANGAMAAPAAPAAESEFRD
                     MLASSHPTGVSMPIDVSTEPTAQQQLRPRKPLTSYESALYETRQAASQVSERSDVAST
                     GSPHHHSHRVSSETQTVIENDNLERMINSLDASGAEEVDKVEPYRAPSGDFIEYSNGD
                     STRHHRRHRHSSNGEEVEAPQDAVSTGPALPPWAAQPTAAAQVQQPIQQWTGTGSVVQ
                     SGQAMPLATPVPVTTTAPAQQEDASWTDFQNLMSAAPTPDAPTPTPVPTPTPVPTPTP
                     VPTPTPVPTPTPVPTPTPVPTPTPVPTPTPMPADEPSDIKDLLDFGAPTTSPQVEVTA
                     SATPTPTPSASDDESDIVDLFTNGGGEEKDTGGLGEDVASATDDSTAPASMLRRPVFP
                     TADAEAIASHIVDMIMHRKSSDQGEDDAADIGLDQSGSAEKKSQDAPNLSKEEIAAML
                     ASSLTAVTTEAVQANALENARVSDASNGSANAKIMADALVAHDKMMAKRIAEILTSEN
                     AEDKLANPNAAASIGSATGYDVSGRSGEAAQLIMYEEQRHQREEVEAMRRDLAALMAN
                     IQANYAMGATEDRIDKTASAAASHIIDTLRPVIKTDVAREGSSESSTLFDYPVMPSSS
                     LSSETLRLDSIDDDSYDDVGSAEAKAKAKATSKDDDGAASGDWLALLEEDAGGASAAA
                     TPSAPAPAPAKKSSDGVDASSSNSEEDVSVPGDNGATGDQPAWLAHALTDEQLTAQFL
                     ADEVEDDGEATRKRSRKHRASRLGASQRFTAPTPVVRDEPTRETKQGAYVRALNERAA
                     RALRHD"
     gene            <509155..>509754
                     /locus_tag="OSTLU_33613"
                     /db_xref="GeneID:5003886"
     mRNA            <509155..>509754
                     /locus_tag="OSTLU_33613"
                     /product="predicted protein"
                     /transcript_id="XM_001419582.1"
                     /db_xref="GeneID:5003886"
     CDS             509155..509754
                     /locus_tag="OSTLU_33613"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419619.1"
                     /db_xref="GeneID:5003886"
                     /db_xref="JGIDB:Ost9901_3_33613"
                     /translation="MESEGTVDFALADAVYASESEDSACRVAEARMTFVGDSKDLTRW
                     RSLNDGVMGGMSDGFMARRGDEGASFMGNVSLERNGGFASVRAMVEEDASDFDGVYVD
                     AKSPSGATKKFLFILKDDECLREQINFKVAFEAGEEYGRVKIPFAAFARPERMGRACL
                     REPLRLAKLREFGLMILKGDAAQVGPFELVVREIGFYRG"
     gene            complement(<509784..>510839)
                     /locus_tag="OSTLU_50387"
                     /db_xref="GeneID:5003887"
     mRNA            complement(<509784..>510839)
                     /locus_tag="OSTLU_50387"
                     /product="predicted protein"
                     /transcript_id="XM_001419790.1"
                     /db_xref="GeneID:5003887"
     CDS             complement(509784..510839)
                     /locus_tag="OSTLU_50387"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419827.1"
                     /db_xref="GeneID:5003887"
                     /db_xref="JGIDB:Ost9901_3_50387"
                     /translation="MSASRRTLDRLPAVDQTLAAKLESRGCRTAEDALYRAPLDVVEL
                     ADVSMHRARQFIISVAKAVAPTPTTALDALRRSQYVPLVIEDVDKALGGGLRVGAVTE
                     VVGAAGAGKTQLCLAACASAAAPARVGGRDGGVIYVDAERKFSGARLAEIAREKFPGA
                     FEDEESVHALARRVHVVTPTSLTDLNKRLDALEEAIIDHKVRLVIIDSIAHLARAEFG
                     REKVVQRQSALGAVASTLKRHAEKHALAVLAVNQVTTKIGTFARHASDGGDDVADESS
                     GITAALGTKWAHCVNTRIALEVLEDRRALKIVKSPLAPLTSFEYRVDASGIRVSGKSD
                     AKDVRASEANVHSTIGK"
     gene            complement(<511239..>512477)
                     /locus_tag="OSTLU_1228"
                     /db_xref="GeneID:5003830"
     mRNA            complement(<511239..>512477)
                     /locus_tag="OSTLU_1228"
                     /product="predicted protein"
                     /transcript_id="XM_001419791.1"
                     /db_xref="GeneID:5003830"
     CDS             complement(<511239..>512477)
                     /locus_tag="OSTLU_1228"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419828.1"
                     /db_xref="GeneID:5003830"
                     /db_xref="InterPro:IPR004147"
                     /db_xref="JGIDB:Ost9901_3_1228"
                     /translation="VKETLCELGPLFVKLGQNLANRPDLVNEDLMEELTKLQDRVPPF
                     NSKLAFKIIEEETGRLIEETFSEISEEPIAAASIGQVYRGKLKTDGTDVAIKVLRPNT
                     RAQCVMDLFLLRAAALKFFDKYARANLGCSASLLVDEFAEKLLEELDFVQEARNLRDF
                     AFNFRNDESVHIPPVVAELSGPRVLVMHWQPGVRCTREDAFADDAARARFLVNGVEAG
                     LKQLLEFGLFHGDPHPGNVLALRDGDIAYVDFGNVAEISRANQESLIDAVVHTMNRDY
                     EALAETLADLGFLQAGADIGPVAEGLADVWGDEALQSLASTEKFSFRGLTREFNKLLY
                     DYPIRVPERFSLVIRSLLTQENICLTLNPDFNLLDAAFPYVARRLLTDPDPALRLRLL
                     KVVVVKERFEWERLRNLMDMA"
     gene            <513786..>515119
                     /locus_tag="OSTLU_2719"
                     /db_xref="GeneID:5003831"
     mRNA            join(<513786..513907,514003..>515119)
                     /locus_tag="OSTLU_2719"
                     /product="predicted protein"
                     /transcript_id="XM_001419583.1"
                     /db_xref="GeneID:5003831"
     CDS             join(<513786..513907,514003..>515119)
                     /locus_tag="OSTLU_2719"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419620.1"
                     /db_xref="GeneID:5003831"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR011108"
                     /db_xref="JGIDB:Ost9901_3_2719"
                     /translation="IDDPPLKILPLGGLGEIGMNCMLVGSGDRYVLLDAGLMFPDHEE
                     LGIQKVLPDVSFLARWKDKIEAVLITHGHEDHIGALPWVVPALDPSTPIYAGLFTMQL
                     IKRRMQEYSLWNDQRFKVFDMNERFQAGPFEMEAVRVTHSIPDCCGLIFRSEHGTIVH
                     TGDWKIDENPVDGRIFDRTSWERVGNEGVTLMMSDSTNVLSPGRTISESAVSEGIMRR
                     VLGHRGRIITTQFASNIHRLYGVRAAAEATGRQIAFLGMSLTTYLEAAKRAGIAPIDP
                     EKLIPADEIDNCDPSKLLIVTTGSQGEERAQLALAAHGSSRLLTLQPEDLLLYSAKMI
                     PGNEKRVMRMMNEIAKRGPEIAMGREDCLHSSGHGYKDELDEVIKLLKPEHFLPVHGE
                     YAFLRAHEQLARQSGVRHTTV"
     gene            complement(<515879..>516226)
                     /locus_tag="OSTLU_8657"
                     /db_xref="GeneID:5003888"
     mRNA            complement(<515879..>516226)
                     /locus_tag="OSTLU_8657"
                     /product="predicted protein"
                     /transcript_id="XM_001419792.1"
                     /db_xref="GeneID:5003888"
     CDS             complement(<515879..>516226)
                     /locus_tag="OSTLU_8657"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419829.1"
                     /db_xref="GeneID:5003888"
                     /db_xref="JGIDB:Ost9901_3_8657"
                     /translation="GYGVSPEMKASEALKTLFTVAAVRTTLDQELSYDNEGGSTALSS
                     ALAGFLETHPLRNGDEWLEALMRDEPQLRLAALRLMETRAAYARENFDWQALRDLAVE
                     TTVRGNDALMVKYV"
     gene            <516520..>517068
                     /locus_tag="OSTLU_6983"
                     /db_xref="GeneID:5003832"
     mRNA            <516520..>517068
                     /locus_tag="OSTLU_6983"
                     /product="predicted protein"
                     /transcript_id="XM_001419584.1"
                     /db_xref="GeneID:5003832"
     CDS             <516520..>517068
                     /locus_tag="OSTLU_6983"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419621.1"
                     /db_xref="GeneID:5003832"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="JGIDB:Ost9901_3_6983"
                     /translation="RLYGDARYERLRAAHVLVVGLGGVGSWAVEALARTGVGRLTLID
                     LDAVCETNVNRQAEATVETIGAFKADAMMDRVRAINPDCDVRVVRDFVQRENVEEILG
                     GAAREVGGGVDYVLDAIDKEKDKAAIIAYCVSERIRICSTGGAGGVDSLSELRAEDLA
                     NVTFNRLLSSTRKTLRKRYAFPK"
     gene            complement(<518357..>518755)
                     /locus_tag="OSTLU_34625"
                     /db_xref="GeneID:5003889"
     mRNA            complement(<518357..>518755)
                     /locus_tag="OSTLU_34625"
                     /product="predicted protein"
                     /transcript_id="XM_001419793.1"
                     /db_xref="GeneID:5003889"
     CDS             complement(518357..518755)
                     /locus_tag="OSTLU_34625"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419830.1"
                     /db_xref="GeneID:5003889"
                     /db_xref="JGIDB:Ost9901_3_34625"
                     /translation="MEKQVVEVRDKLAASEKNVATLTKRSESEIAKLEAEKAARVKAE
                     TTAASLKKKCDRLLKEGGTKDLHAEVDAYKTLMNCNVCQGERQKAVIITRCWHMFCEE
                     CINKRVVSRQRKCPGCSLPFAESEVQRIYF"
     gene            <521202..>521521
                     /locus_tag="OSTLU_16868"
                     /db_xref="GeneID:5003833"
     mRNA            <521202..>521521
                     /locus_tag="OSTLU_16868"
                     /product="predicted protein"
                     /transcript_id="XM_001419585.1"
                     /db_xref="GeneID:5003833"
     CDS             521202..>521521
                     /locus_tag="OSTLU_16868"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419622.1"
                     /db_xref="GeneID:5003833"
                     /db_xref="JGIDB:Ost9901_3_16868"
                     /translation="MGDGGADPKAPEGFEVIREGWARALQRAGGDDVFYNKPQVVNRD
                     LSLAVIREFQKVRATEHANGQSKRNKRAKGAMCLTPRDDALLPRLLDEDDRAALFRSA
                     EEHRA"
     gene            <521625..>522908
                     /locus_tag="OSTLU_16869"
                     /db_xref="GeneID:5003890"
     mRNA            <521625..>522908
                     /locus_tag="OSTLU_16869"
                     /product="predicted protein"
                     /transcript_id="XM_001419586.1"
                     /db_xref="GeneID:5003890"
     CDS             521625..522908
                     /locus_tag="OSTLU_16869"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419623.1"
                     /db_xref="GeneID:5003890"
                     /db_xref="InterPro:IPR002905"
                     /db_xref="JGIDB:Ost9901_3_16869"
                     /translation="MSATGLRALRYAQELENVGCVVANDMDPTAAEAIERNKAYNALC
                     SPDKAEAISRVIPHNEDVRMVCMKHEKMFDVVDLDPYGTPSTLLDSAVTSVKEGGLLL
                     VTATDMAVLCGNNAEVAWAKYQSYPLRAKYCHEMAVRTLLAAVENAAIKHRRHIVPVI
                     SLSIDFYIRVFVRVYTSPLQMKQTPSKLSYVFQCVGCDAHELQAVGRQQTKGNVTKYQ
                     PGVGPVVPQRCSSCGWHYNMGGPIWSDPIHDKTWVTNVKSELERNKDAYPGYGKVHAL
                     LTMASEELLDVPLHYDLHAMGGTLKATPPSFWLFKSAVMNAGYRVSGSHSNPLAIKTD
                     APVDVLWDILRCWVKEHPVKPQSSPTPGEAILAKEPTVIANWTRRTEAQSKAQKDGVA
                     RFPQNPTADWGPKRRAGKYREEELEAKRRKEEEED"
     gene            complement(<522941..>523708)
                     /locus_tag="OSTLU_93278"
                     /db_xref="GeneID:5003891"
     mRNA            complement(<522941..>523708)
                     /locus_tag="OSTLU_93278"
                     /product="predicted protein"
                     /transcript_id="XM_001419794.1"
                     /db_xref="GeneID:5003891"
     CDS             complement(522941..523708)
                     /locus_tag="OSTLU_93278"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419831.1"
                     /db_xref="GeneID:5003891"
                     /db_xref="JGIDB:Ost9901_3_93278"
                     /translation="MADLVTCQPAKQNMDRVLVCFPPAGATASCFNGDFTRAVDARCF
                     AVDKPCRWRRCVPEVETLRWSVVDFARDVARRIVEHGCVSKGESLYLYGHSAGAWIAF
                     ECARALGERVSGVYVSAARAPCLGHWLNDTDVETPRLSELETDDAFWAAFERRYGVSD
                     ELRCVSTSLIAPFREDFRMSESYEGSTEKVHVPLTAIGIENDTRTTREMIARWSEHTT
                     GAFCSRWWDGGGAHPHRALIAKPLEFASFLSNEVFFV"
     gene            complement(<524214..>526646)
                     /locus_tag="OSTLU_16870"
                     /db_xref="GeneID:5003834"
     mRNA            complement(<524214..>526646)
                     /locus_tag="OSTLU_16870"
                     /product="predicted protein"
                     /transcript_id="XM_001419795.1"
                     /db_xref="GeneID:5003834"
     CDS             complement(524214..526646)
                     /locus_tag="OSTLU_16870"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419832.1"
                     /db_xref="GeneID:5003834"
                     /db_xref="InterPro:IPR001048"
                     /db_xref="InterPro:IPR001342"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR005106"
                     /db_xref="JGIDB:Ost9901_3_16870"
                     /translation="MGVAVKGEPKVTDCLINATDMAAKRDDTYAAELTKLEDKHVSTA
                     KALLTDKAEYDAYIAAFNEELNDLRAMFKAIYIAGCSTDAFGDFVVGHGELWTARLCA
                     ATIRCKGGKAVWIDARDILVVTESEDGGVDVDYSLSNANLDKWYDEHMQEGAVVMVTG
                     FIARTPEGVPTTLKRNGSDYSATIFGALTQARNITIWTDVDGVFSADPRRVKGAKCLN
                     SISYNEAWELAYFGANVLHPRTTLPAMKYNIPVTLRNYFNQAAPGTSIGMACPLPAGD
                     EGNVGKFETRDMSGELVKGIATIDDVCLINVEGTGMVGVPGTANTVFKAVKEAGCNVV
                     MISQASSEHSICFAVRSHEADAAVAALNKTFEKAIAAGRISRILPLKDCSILAIVGQN
                     MCQTPGVSAMLFEALAQSAVNVIAIAQGASEYNITVVVSKKDVNKALQAAHGRFYLSK
                     TAISVGLVGPGLVGKTLLRQMKEQLETLQDEFAVELRVVAITGGRKMLLSDGAIDLDS
                     WEDEYASGVQANMDDFTKHVLESEAPNQIIVDCSASDVVAGHYKEWLSKGLHVVTPNK
                     KANSGPLAYYKELRSIQRNSYTHYFYEGTVGAGLPIIATLQSLRNSGDKVERIEGIFS
                     GTLSYIFNTLEPGKKFSDIVAQAKEAGYTEPDPRDDLSGMDVARKVTILARECGLNIE
                     LSDVPIQSLVPEPLRDIESVDEFMKELPKYDGDILSKQEEAAAAGEVLCFVGVVDVKN
                     GTGSVELRRYPADHPFAQLKGSDNIVSFTTKYYTSAGPLVVRGPGAGAEVTAGGVFGD
                     ILRVCAYLGAPS"
     gene            <527428..>529158
                     /locus_tag="OSTLU_16871"
                     /db_xref="GeneID:5003835"
     mRNA            <527428..>529158
                     /locus_tag="OSTLU_16871"
                     /product="MOP(MATE) family transporter: multidrug efflux"
                     /transcript_id="XM_001419587.1"
                     /db_xref="GeneID:5003835"
     CDS             527428..529158
                     /locus_tag="OSTLU_16871"
                     /codon_start=1
                     /product="MOP(MATE) family transporter: multidrug efflux"
                     /protein_id="XP_001419624.1"
                     /db_xref="GeneID:5003835"
                     /db_xref="JGIDB:Ost9901_3_16871"
                     /translation="MLARVGVGVGARPRGGGSGTGRATRRAATATRGRANGRTRDETR
                     GFGARARARVAVAKTRAREGATRGGTRGDGTRREATRDDDDARTRDAGGADSVKGARG
                     EDARDGRLPTIPRGTYASLATALVALGFPALLNSVNEPVVSLLETVLVARVGTVFLAA
                     LAPASALFGLVEEVCFAFSVVVTTAVSSARAEFEDVDAAVPERVKQTVSMSVMASFIA
                     GLGLAIGLQALYGPICKIMVVPREVEALLRSYTVLRCAGLPMFGAANALEGVFLGSKD
                     ALTPMTGWLVAGVITVALQLFFITPQMSANAAVRWAGIALTVGQTFIFFYLWKIAHGR
                     GLFSMRSVFKGAESVGAAIARLYRRLEEEHIASEFRWLVLSATARMTTYVIITSCATN
                     LGVISAAVNKTLLDLYILLGLCAEPVFTVGNVLLPRKRRSLVEVLTYRRALFYVALFM
                     GFTLACLAYILCGSTLLSHDPHVHAVATSMRSLVAVTIGLSTAAYATDGCVIGLGGAS
                     FVGAAQMINTSIFVLVFIAFRTIYGAATSLQHLWLALLLFQALRLAEHVWKLRHDERA
                     LAFPRTAALA"
     gene            <529961..>530179
                     /locus_tag="OSTLU_9697"
                     /db_xref="GeneID:5003892"
     mRNA            <529961..>530179
                     /locus_tag="OSTLU_9697"
                     /product="predicted protein"
                     /transcript_id="XM_001419588.1"
                     /db_xref="GeneID:5003892"
     CDS             <529961..>530179
                     /locus_tag="OSTLU_9697"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419625.1"
                     /db_xref="GeneID:5003892"
                     /db_xref="JGIDB:Ost9901_3_9697"
                     /translation="RAVFVNESVCIGCRMCNHSAAKTFMMEQDYGRARAFQQWADSEE
                     DIQIAIDSCPVDCISWVNKKNLPILEYAM"
     gene            <530398..>533583
                     /locus_tag="OSTLU_16873"
                     /db_xref="GeneID:5003893"
     mRNA            join(<530398..530406,532375..>533583)
                     /locus_tag="OSTLU_16873"
                     /product="predicted protein"
                     /transcript_id="XM_001419589.1"
                     /db_xref="GeneID:5003893"
     CDS             join(530398..530406,532375..533583)
                     /locus_tag="OSTLU_16873"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419626.1"
                     /db_xref="GeneID:5003893"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="JGIDB:Ost9901_3_16873"
                     /translation="MAHRCVYLDYNATTPIWPEVSRAMAPFLHEHFGNPSSGHAFATP
                     CREAIDAARESTGAMLGCASDEVTFTSCGSESDNFAIDGAVRGFLKKNAGRGLPKIVT
                     TAIEHPAVIEHLKAKAAFGELTYELVGVDEEGLVNADDVIDAIDENTCLVTVMHANNE
                     TGAIQPVAEIARRARERGVLTHTDAAQSAGKVPVKVDALGVDMATIVGHKIGAPKGVG
                     ALYIRRGTDLGDAKPFYGGGQESGRRAGTENVLHIVGLGKACEIVEREMDTCPKHLKA
                     MRDDLQKRLVDALGGTDGSGVRVNGPRDDDKRLPNTLNIGIKGLLASITLMELSELLA
                     ASAGAACHTPDAATSGGATVSSVLEAMNVPMEYAVGTLRLSVGRHTVERDVERGAALL
                     IDAAKRQNAGAPR"
     gene            complement(<533657..>534514)
                     /locus_tag="OSTLU_33627"
                     /db_xref="GeneID:5003894"
     mRNA            complement(<533657..>534514)
                     /locus_tag="OSTLU_33627"
                     /product="predicted protein"
                     /transcript_id="XM_001419796.1"
                     /db_xref="GeneID:5003894"
     CDS             complement(533657..534514)
                     /locus_tag="OSTLU_33627"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419833.1"
                     /db_xref="GeneID:5003894"
                     /db_xref="InterPro:IPR003323"
                     /db_xref="JGIDB:Ost9901_3_33627"
                     /translation="MGKGRARRDRARRDGAITRDARDAASRDEIATLERQLRALNLER
                     RAVEADGNCFFRALADQRYGDESRHAEVRRRVVARVEARREAFAPFVEDDETFDEYVE
                     RMARDGEWAGHLEVNAATAALRVGICIHQAGSPRWVAGADARDDGAKTYHVTYEGRDH
                     YNSVRLRNSRRFDEPGGPLSVAMLRDDELCALARRTGCVDAERLRRTLRACRGDADAC
                     ADVLEEEMEEERRSREKAVEDGIDVEEFDTGDWAEVKTKKKSKGKGGAKHSRGGARDE
                     DFGVESLRI"
     gene            <534804..>535718
                     /locus_tag="OSTLU_12918"
                     /db_xref="GeneID:5003836"
     mRNA            <534804..>535718
                     /locus_tag="OSTLU_12918"
                     /product="predicted protein"
                     /transcript_id="XM_001419590.1"
                     /db_xref="GeneID:5003836"
     CDS             534804..535718
                     /locus_tag="OSTLU_12918"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419627.1"
                     /db_xref="GeneID:5003836"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Ost9901_3_12918"
                     /translation="MALTRGHEGGVNAVAFSRSGATLASAGHDGGLALWRVGDASASA
                     NFMTARGCKNAVTDACYTMDDECAVTSDADGVVRVWDAETGGQVKSYASTRGKCANAV
                     SAARGDLVMSASDDGSACVWDLRVKKRAARTYAHAVPQTACVMSAHGDRAYVGGVDDV
                     VRAWDARMENKSLMTLEGHEDTITGLDISPCGSFVLSNSMDNTLRMWDTRAFVEGERE
                     TKRFVGHSHNFEKALLRCAFNADGTRVGSGSADSCVYVWEVENAKLKYKLPGHKGVVS
                     GVAFSPAENPVIASGGADGVVFVGELDR"
     gene            complement(535772..>537620)
                     /locus_tag="OSTLU_33629"
                     /db_xref="GeneID:5003895"
     mRNA            complement(535772..>537620)
                     /locus_tag="OSTLU_33629"
                     /product="predicted protein"
                     /transcript_id="XM_001419797.1"
                     /db_xref="GeneID:5003895"
     CDS             complement(535773..537620)
                     /locus_tag="OSTLU_33629"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419834.1"
                     /db_xref="GeneID:5003895"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="JGIDB:Ost9901_3_33629"
                     /translation="MCAFKNVSRVERRGDGLVVRLIKRDGDVVELTGQTVAQAAMWER
                     GLAIVVREYAESAGANQALEAVDDDDAESNLDDTDDDDDVGGARLERGRANSASQARA
                     FVPEPSTPTRAGAVGANDGHVMISVSPEASPSSRRAARREDLGVPNFGEDESLTNKTA
                     SNARRPLLQTQGGVDELATQFRNQARLTRCDISDIGSERSSDRSDFSDDDGGSSWGGS
                     SAGGDALVIEAFSRARHGRVKELQKLFASGVDPRVRDGNGLTLLHIACQNNQRRSAKL
                     VLKSTDYKSKPPRLELIDAQTNNGHTGLHFCFAYGYQALGEYLLSLGASDTITNVHGL
                     CCYEGLEPNDARETLTTPEMKARAHESRMQRWIESQRPGANHDGYPRGVPSSSRSVAS
                     ADAFTRADSFGGHDVPRQRSEPGGYVARSRSNSEYSDDRSHASYDSSGYPRGPPSAHG
                     HPPPMQPYGVPQPYMAMPYAYAAPMMPMHPMYMAAQYPGMPPPPGYHHPGGYDDRYDD
                     RDRRRRDRSRDRSPRRRRSRDRSRDRSRRSRDRSSRGGSRRSLGDRSDSLESGEERVG
                     IHRTSSRRSSKATTPKRRPAKVDVIEATRGLDGEAFTARASAGYYSSDG"
     gene            <538695..>541733
                     /locus_tag="OSTLU_16877"
                     /db_xref="GeneID:5003837"
     mRNA            <538695..>541733
                     /locus_tag="OSTLU_16877"
                     /product="VIC family transporter: sodium/calcium ion
                     channel"
                     /transcript_id="XM_001419591.1"
                     /db_xref="GeneID:5003837"
     CDS             538695..541733
                     /locus_tag="OSTLU_16877"
                     /codon_start=1
                     /product="VIC family transporter: sodium/calcium ion
                     channel"
                     /protein_id="XP_001419628.1"
                     /db_xref="GeneID:5003837"
                     /db_xref="InterPro:IPR005821"
                     /db_xref="JGIDB:Ost9901_3_16877"
                     /translation="MSSDDDAGRRARGEANAGEHPGRERRTATDDEDDGDAGAGGGAR
                     DEGARREGGREGGRAREAREGAGDARTTRERERERERERERERERERESESESESDSA
                     STSTSDGSTTTDGETRAGAAPATEEYDVEGRLPSRTPPAGDSRGFWTRCYHEGAKFCG
                     LGVLLEEIPSESSSSESSSDSDSESDSEGSRRRHRLRALDSFKSNMSEGSELDEADLN
                     DEVKQRVLDEGKANIYPSLAIMEVLFNKMQERLSKKAVRDEMLEAKRADEAVTAAHRN
                     RRQRSRAWLLHQFVSSKFFTFLTASMIFYSSIVCGIVSQDPDKWFDTKFEDVSFLVLN
                     IGFAVEAVMRIMSSGVIIKEDGVKHLVELRPHYYFHDPVNCVDFVVTVLSFMEYVVSG
                     NSLDAVRTFRLIRLLRLIQMVEDMRVILDGVIQGVLSIVWILVLLTVVVYIYAVIGAV
                     LFGENDPRNFRSLSIAFKTVISMTTMSDWLDFLYINYHGCDQYGYDGADASYCTNPKS
                     QKVLATAYIMSLIVILGNIMMSLFIGVITNKMEDAALELKDSKDAKKRKTKAAVAAEV
                     WDDPALTPLKIGAEQYAQLLYHLNLLSGVRAEGVVRPLPDLPKWKRAQLWLKRMVTNT
                     VFEWGVVMMIIAVAITSGLGLEYNQQGKEWYKTTEAFFIAAFTAELIIKFFAYLDRSL
                     SFYTGKQKWWNLFDTFVVLVGLIPSSYQKAAVVVRLLRLLRILRLVRVIKQLQVVVLS
                     LIAGMNSIVYVAVFMSVIFFVYAVAGVQVFRLNDPFHFCDLSNAVVTLFTVSFLEDWR
                     PVFDINFYGCDKNLFGDTDGGVYYASTIDVDISNGSTVVCSHPQQHKMFAFFFFSSYI
                     LLSAMVLVSAFVGIIVTSMQSASTMVRQRLASEERLKMIEEFFQLDEHASKQTVYVYN
                     LLDSGFEGELTPEKIMEKMALFDIPTNPELLKRAHQTVNGLMDAPFDAADFLLLTVLA
                     ERARKVQEKLDEDGQVGSLEDVDFIRARLNQSGHHDIGAP"
     gene            541842..>543277
                     /gene="HAM3503"
                     /locus_tag="OSTLU_33631"
                     /db_xref="GeneID:5003896"
     mRNA            join(541842..541877,542054..>543277)
                     /gene="HAM3503"
                     /locus_tag="OSTLU_33631"
                     /product="predicted protein"
                     /transcript_id="XM_001419592.1"
                     /db_xref="GeneID:5003896"
     CDS             join(541863..541877,542054..543277)
                     /gene="HAM3503"
                     /locus_tag="OSTLU_33631"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419629.1"
                     /db_xref="GeneID:5003896"
                     /db_xref="InterPro:IPR002717"
                     /db_xref="JGIDB:Ost9901_3_33631"
                     /translation="MTKRTKDADVEDTPRRRARNHVDIPPGTELPLELGTKVHCRWRG
                     KDEFYQAKVIERRPGRGKSDEDYEYYVHYEQFNRRMDSWVSLGEMDLSTLVVVEKTED
                     GKKKKDAHEPDAEHAEFDPKALQEHEEFTKVRNILQIELGKHEMDTWYFSPFPPEYND
                     CQKLYFCEYTLQFFKRKEQLQRHLKKNEMRHPPGDEIYRKGKLSFFEIDGKKHKLFCQ
                     NLCYLAKLFLDHKTLYYDVDLFLFYVLMECDERGYHIVGYFSKEKCSEEGYNLACILT
                     LPPYQRKGYGKLLISFSYELSKIEGKVGTPERPLSDLGLVSYRGYWTRELLKILGDES
                     KQFLSIKDLSEMTMIKTEDIISTLQHLGLLAYTKGAYVICASPELIEKHFKAAGSGGV
                     PCDPEAIIWSPYDPERARDL"
     gene            543340..>544850
                     /locus_tag="OSTLU_33632"
                     /db_xref="GeneID:5003897"
     mRNA            543340..>544850
                     /locus_tag="OSTLU_33632"
                     /product="predicted protein"
                     /transcript_id="XM_001419593.1"
                     /db_xref="GeneID:5003897"
     CDS             543357..544850
                     /locus_tag="OSTLU_33632"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419630.1"
                     /db_xref="GeneID:5003897"
                     /db_xref="JGIDB:Ost9901_3_33632"
                     /translation="MRDRAREIRLVTLGLSPRDTHARCVDLARELDDAVRDVTARIDA
                     RATAHANALATLRRRIEHLRARVRDVGSSSSARTVMHAARYPMGARNGDVERMFGTSA
                     PTTAASAAEDEGDAERKMMEELLAIERQTVHREMTAEMFYASETRESASGRARVVSGR
                     DGLGTLPASLESLNECLLFNSDVNPYVEYALVDNLMDGEDDGGRGDEDGEDEGTREGG
                     EYEDDWKNLAEAPKSMQNALYDSMQATQFGFRPTMGAMPSLDLPTSLPSLRYAADISW
                     SGATKTAAPIAPSSTATPLPDVVVTPSVLAPPPPLPPTPPPPPPLPRENLHASAPPAQ
                     LPPGANVGDGGRSALMDAIRNKDNKSRLRKRGSAAPSADAAPPPPRGAPMEPDLRGAL
                     MDAIRAKPMLKSSSRPELSDGDPPAAAPPAPPRQMSMMEELANSLGRRRSAIVASGDH
                     DVREKVIETTTQRPSGIVGLGDFIKAKESATNCDEDQDDDVSDWDSD"
     gene            complement(<545113..>545394)
                     /locus_tag="OSTLU_9226"
                     /db_xref="GeneID:5003898"
     mRNA            complement(<545113..>545394)
                     /locus_tag="OSTLU_9226"
                     /product="predicted protein"
                     /transcript_id="XM_001419798.1"
                     /db_xref="GeneID:5003898"
     CDS             complement(<545113..>545394)
                     /locus_tag="OSTLU_9226"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419835.1"
                     /db_xref="GeneID:5003898"
                     /db_xref="JGIDB:Ost9901_3_9226"
                     /translation="AMEACEAPIVGAVHGDCVNAGFELALGCDALVASEDARFVDTHA
                     TIGILPSWGLSVKLSRSVGANAARACSVFGRAMDARRAEALGLTCATTKD"
     gene            <546899..>547189
                     /locus_tag="OSTLU_33634"
                     /db_xref="GeneID:5003838"
     mRNA            <546899..>547189
                     /locus_tag="OSTLU_33634"
                     /product="predicted protein"
                     /transcript_id="XM_001419594.1"
                     /db_xref="GeneID:5003838"
     CDS             546899..547189
                     /locus_tag="OSTLU_33634"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419631.1"
                     /db_xref="GeneID:5003838"
                     /db_xref="InterPro:IPR001498"
                     /db_xref="JGIDB:Ost9901_3_33634"
                     /translation="MDILNESRRVRAATHNILAYRVSRNDASKTFYQDHDDDGETAAG
                     GRLLRLLVLADARDVVVVVSRWYGGIHLGPARFHVINACAKDALVALGEIHQ"
     gene            complement(<547255..>547767)
                     /locus_tag="OSTLU_33635"
                     /db_xref="GeneID:5003899"
     mRNA            complement(<547255..>547767)
                     /locus_tag="OSTLU_33635"
                     /product="predicted protein"
                     /transcript_id="XM_001419799.1"
                     /db_xref="GeneID:5003899"
     CDS             complement(547255..547767)
                     /locus_tag="OSTLU_33635"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419836.1"
                     /db_xref="GeneID:5003899"
                     /db_xref="JGIDB:Ost9901_3_33635"
                     /translation="MNLCPFARASMAKTFAIEVVRGDGGGGGYGDVLARETRRLAACA
                     RDESATTLIVFENGWNDDWEGFMRGPVREAEDACEATTGGETVTVVPFHPLAAFDGES
                     EASNYTSRSPFPTVHLLRACDIERAEDTWYRLEEREDIRERNAEYLEALGVRELRRLW
                     ARIVANDAPT"
     gene            complement(<548020..>549960)
                     /locus_tag="OSTLU_33636"
                     /db_xref="GeneID:5003839"
     mRNA            complement(<548020..>549960)
                     /locus_tag="OSTLU_33636"
                     /product="predicted protein"
                     /transcript_id="XM_001419800.1"
                     /db_xref="GeneID:5003839"
     CDS             complement(548020..549960)
                     /locus_tag="OSTLU_33636"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419837.1"
                     /db_xref="GeneID:5003839"
                     /db_xref="JGIDB:Ost9901_3_33636"
                     /translation="MRDARARCDASAAAEREEKRRLKEKLTRAASDGEATTLALTEEV
                     KRLTRCREEDLACVRAIIGDGAVLVAGAPEEALSTMATCRRELEAARVERDAAKKASF
                     AASTSGANAESLMSAMKEKMQEKIDEAMKTMEAKKRAAESSADAARQGKAAAEQKLGA
                     LQKQYDEMASKLFDAENAMETNEARNAAEKEELVTLGEELRRREEALEAHVEAARATE
                     RATTSRDEHAESRLAEKLAVKERMVSQLAAEVESNAARAKESEEKHAAERESLNAQIV
                     ALRQEVLKARETAQPSESATLKLKAEIATLTNRVKMLQEISGLEVGDDDAAAGGDESS
                     ASGAEAMQSLRERNKKLAAELTVARRETEEATTSLEIARGAQASAERKYTETAEMVAT
                     LETDLATRLSEIIEDRAVNGSPMKVNAASSESTDLLTILTSQRDRFKRRVGELDERAA
                     RLEQDKIAAEDAKAKLEADSVQLFEKLQYVQNYYSKQLASSGGRTTILRVDAEGIPVT
                     DGAVAASTAPSQSAKNARYSCGAVTVNIESERTAAAVDGMRRRAARYGCFGGVNAESD
                     IPGGDAGGVVQRYRRRYLARLNPFAAFREREVEDSASSLPIHDRIGLTSGKMLMKSRA
                     TRTAFSVYLIVLHLFMLRRAFS"
     gene            <550839..>553526
                     /locus_tag="OSTLU_16882"
                     /db_xref="GeneID:5003840"
     mRNA            <550839..>553526
                     /locus_tag="OSTLU_16882"
                     /product="predicted protein"
                     /transcript_id="XM_001419595.1"
                     /db_xref="GeneID:5003840"
     CDS             550839..553526
                     /locus_tag="OSTLU_16882"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419632.1"
                     /db_xref="GeneID:5003840"
                     /db_xref="InterPro:IPR000121"
                     /db_xref="InterPro:IPR002192"
                     /db_xref="InterPro:IPR008279"
                     /db_xref="JGIDB:Ost9901_3_16882"
                     /translation="MKELLGSKGSGLAEMARLGLRVPAGFTVSTRCCERYEQSGMDFV
                     RRELWEEVLDGVAFIEKTTKRTVFRSGCSLVAAPPLLLSVRSGAAASMPGQMDTVLNL
                     GMNDECAQACVNAGFDARWVYDSYRRLISMFGDVVEHLPKQDFERALTKAKETNNARY
                     DTELDAEALKLLCGEFKDIYAKHGKVFEQDAMKQLEQSVVAVLESWNTPRAVEYREIN
                     RITGLRGTAVNVQQMVFGNINDNSGAGVCFTRNPADGADETYGEYLAQSQGEDVVSGV
                     RTPMGLKAMAESQPKAAEELESVCDALEDDFKDMLDIEFTIEDGELYILQCRVGKRTG
                     TAGVRIATEMFAEGIISKDEALMKVNAQSLEQVLHPVFLLDAASPDYSSKIVASGLPA
                     SPGAAVGRIVFSSKEAKEYKSQGKPCILVREETSADDIGGMYAAEGILTARGGMTSHA
                     AVVARGWGKPCVSGCGAISFKNDREIRFGTSDRTYRAGHTISINGATGEVIDAELAVA
                     PSTIDTFLPLKTLMHWADEKRRVEIRANADTPEDAAAAIRNGAKGIGLVRTEHMFFSS
                     TERVHAIREFIIAQDEQAQKVALEKLEKFQYEDFKGILKSAGGFPVTMRLIDPPLHEF
                     LPSREKLREGAANEMSKYIHGKSAHDIIEIAESMREHNPMLGFRGCRLGCVKPRITRM
                     QVHAFCRAAIDLIAEGVPVEPEIMVPLVSTVEEFHNQRDLIWDVIRDLGRENQAPPMR
                     VQVGAMIETPRSALIAGELTRAGASFFSFGTNDLTQMTYGFSRDDSDAFVKPYKDMGI
                     LQSDPFEILDTVGVRELISIAAERARAVRPDVELGICGEHGGDPKSLVTIDALDLDYA
                     SCSPSRVLVARLAAAQAAVGGAPSKQRKRAARSHASPAA"
     gene            <553918..556575
                     /locus_tag="OSTLU_50496"
                     /db_xref="GeneID:5003900"
     mRNA            <553918..556575
                     /locus_tag="OSTLU_50496"
                     /product="ClC family transporter: chloride ion channel"
                     /transcript_id="XM_001419596.1"
                     /db_xref="GeneID:5003900"
     CDS             553918..556527
                     /locus_tag="OSTLU_50496"
                     /codon_start=1
                     /product="ClC family transporter: chloride ion channel"
                     /protein_id="XP_001419633.1"
                     /db_xref="GeneID:5003900"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR001807"
                     /db_xref="JGIDB:Ost9901_3_50496"
                     /translation="MAAFESHDYDPIDNDLEEDALRGRTREDYKRERAWKWATSVMIG
                     AVMGIVAFVIDGLVDKLNLFRYGVIGDKVGTDGYARFVAWLLHAVVSCAFAAVAGGLV
                     SYVEPLAAGSGIPELKTYLNGVHLKGLLRLKTVVAKLGGISFSIGAGLIAGKEGPFVH
                     GGGLVGGGLSAFGSNTLGFKLKYPAWFRDDRHKRDFVAIGTATGVAVAFAAPIGGMLF
                     TVEEGASFYNSDMLWRGFLATCTGVLTMHWLEQLDFDAGDFARARFGTHRDFGLYTDS
                     EADYSKNYWWYFWEVPIFIAMGVCGGLLGAAFVNLNVKITQWRAKYIPVTDRRKRLLE
                     VIAIAGITSTLFFFFMSVSPCKDIPLPLRAGTADSLDDMSNSSFEYGVETRDEIRNDF
                     FKQLYCPDGQYSVYGQLFYNPLATSFKFLLHLGEVGEFGGDSAHPFPIGALIWYFLLT
                     FCLMTVTYGIGAPTGLFVPSLAVGASFGQLCGRVVAHIAASRGSDVKINLHAYAIIGA
                     AANLGGATRMTISITVLVMETTGSMQLIIPLMLTIFTAKAVGDRYGHGIYDTHIKIRG
                     APFLEEPELAGPTGDKLRVNEVMSDELVTLQPVMRVKDLLQILTQTPHGAYPVTEHPP
                     AYAGEDFELHGSITRNLLLKMLLHRISFVDASGGGRVGGDNLFTNPRERDDLLEQLKQ
                     IPFKVPSAREVAHRVSEEDIRTMSVDLRSFMQRHPFLVHADARVSRAYRQFRTMGLRH
                     MYVMPSRPRVVGLLTRKDIIQERTSLTLGLYARGLARPPARPVSRTSEPPHDARDAAV
                     ASTATALTPSAAIDDDDDAKLPYIPYYANNSATTDDGDDAAASARASHASDLDAARAS
                     NPFIDAASTLRRR"
     gene            556668..558188
                     /locus_tag="OSTLU_33639"
                     /db_xref="GeneID:5003504"
     mRNA            join(556668..556816,557083..558188)
                     /locus_tag="OSTLU_33639"
                     /product="predicted protein"
                     /transcript_id="XM_001419597.1"
                     /db_xref="GeneID:5003504"
     CDS             join(556706..556816,557083..558150)
                     /locus_tag="OSTLU_33639"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419634.1"
                     /db_xref="GeneID:5003504"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="JGIDB:Ost9901_3_33639"
                     /translation="MGAYLSQPVTRKDSTDGADARFAYGTTAMQGWRTNMEDAHATIL
                     DLDADTAFFAVFDGHGGKEVAMYAAKRLHETLKETESYVAGDVARGLEESFLALDRKM
                     LAKEAAGELKAFRAGGEKDDSSGFGGLLGDGASAEEQKNRRAEINAKLRAALIEQVKE
                     SNPDIDENDIKFDFELEDGDFNEIASSSGGDGADDASHENWTGPQAGATSVVVCVRGD
                     KVYCANAGDSRAVFSRKGGEAVEMSEDHKPMNDGERKRIINAGGFVSEGRVNGSLALS
                     RALGDFEYKMNKELDEKQQAVTAFPEIREFQLQEGDEFMILACDGIWDVMSSQECVNF
                     VRERLVAKLKSGESDLKLSQICEELCDRCLAPDTRGSGLGCDNMSVVVVLLKKFCSIA
                     "
     gene            complement(<558225..>558686)
                     /locus_tag="OSTLU_33640"
                     /db_xref="GeneID:5003505"
     mRNA            complement(<558225..>558686)
                     /locus_tag="OSTLU_33640"
                     /product="predicted protein"
                     /transcript_id="XM_001419801.1"
                     /db_xref="GeneID:5003505"
     CDS             complement(558225..558686)
                     /locus_tag="OSTLU_33640"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419838.1"
                     /db_xref="GeneID:5003505"
                     /db_xref="JGIDB:Ost9901_3_33640"
                     /translation="MRDDALAAYERRLDDVERRFETLRAKMELTLPSGITKCARSGIR
                     AAFASARLRAEKARAVASRDAEPRRRRLGSKEGQRVLRSWILAHFDHPFPTREEKRRL
                     AREIGSSEFAIGNFFINARARFHKPLVMALADELEREGVDVLNARDEERVR"
     gene            <559157..561586
                     /locus_tag="OSTLU_25081"
                     /db_xref="GeneID:5003841"
     mRNA            <559157..561586
                     /locus_tag="OSTLU_25081"
                     /product="predicted protein"
                     /transcript_id="XM_001419598.1"
                     /db_xref="GeneID:5003841"
     CDS             559157..561565
                     /locus_tag="OSTLU_25081"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419635.1"
                     /db_xref="GeneID:5003841"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="JGIDB:Ost9901_3_25081"
                     /translation="MSPVRASTKLATRARYAAIDEDAGEEDAASFVDADDRMPFGRAS
                     DFPPSYGEAKALKRVEGEASVSGEPSSEEEDLEAATPRDELGFEVPESLRETHEARRA
                     VRADHRIRQMEYLEVYRNVPEKQRGVGGDACLALAVNGIHPDHRAEIWAEKLKAHVKQ
                     YSSSHSFYQYLELGQASLSDAERELIEGDVRAACPTHPLLRSDVAESTSRSTSSSFTH
                     AFANTASEGFVLGGKGVAFQDFPRTLINILIAAAERSPHGYCSGFVVPAAVMLLLTED
                     EEASFWMLAGFTEDVLSSVISRSCINLYAEAKYIDLDVMLHEPELAAHLNEGDCRPSV
                     VVAGLLTRVGLGVLPTESVLRLWDALILEGGQVLAPFSILVMKAAKEQLLAAAVGDLC
                     ETFDAEAARMHDVGDTLMDAIVASREMSSKFDSLSIRLGEREVTADVLNNLFNFRDVV
                     RSLSESAGPEGIGRQEIITREELEEVVCATYCLEQFTDVDTAVDKKYQSRELLMAYDL
                     AVRHKEELKTKGLRFDEFMKVLRVKSSTSSKLKMLAVKGDTVEARVKNFIIGETNDGM
                     PTEKSVKLALFVANGVIPTQRLSSAPVESKILNGLASSENWYCEMRMNARAALILANF
                     AIPLFITEDAVPSMERDDASDSKDAFDVSIIASKAKALDDSPRAFGGLVPLAHTEYHI
                     LVQTREGPPRVVKKRFSDFKSLHEELRKSGCYNVTRVAENAIGTDAALSVDPHVVASR
                     SVSLQRYLDQLNACGLPKVHRFLRAFLGLDEPKSRVSRLRSLCAACSPARIVCGFTAR
                     ARRR"
     gene            <562075..>562314
                     /locus_tag="OSTLU_34727"
                     /db_xref="GeneID:5003506"
     mRNA            <562075..>562314
                     /locus_tag="OSTLU_34727"
                     /product="predicted protein"
                     /transcript_id="XM_001419599.1"
                     /db_xref="GeneID:5003506"
     CDS             562075..562314
                     /locus_tag="OSTLU_34727"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419636.1"
                     /db_xref="GeneID:5003506"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="JGIDB:Ost9901_3_34727"
                     /translation="MSAPINPKPFLASLTGKKVAVKLKWGMEYRGFLVSTDAYMNLQL
                     ASTEEYVDGERQGALGEVLIRCNNVMYLKAADEEA"
     gene            complement(<562476..>563033)
                     /locus_tag="OSTLU_34638"
                     /db_xref="GeneID:5003507"
     mRNA            complement(<562476..>563033)
                     /locus_tag="OSTLU_34638"
                     /product="predicted protein"
                     /transcript_id="XM_001419802.1"
                     /db_xref="GeneID:5003507"
     CDS             complement(562476..563033)
                     /locus_tag="OSTLU_34638"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419839.1"
                     /db_xref="GeneID:5003507"
                     /db_xref="InterPro:IPR005307"
                     /db_xref="JGIDB:Ost9901_3_34638"
                     /translation="MPNKGNGGEAEKYVWTQTLDDLEVRVAVPPGTKSKEIECAFAKN
                     RFSFKLKTASGEPRIEGEFYAAITPDECYWTLEDNAYVSCFLQKAKTGAEWWPHVLVD
                     DPKIDTKKVEPENSRLDDLDGETRSTVEKMMYDQRQKAMGLPTADEQTKQDALKKFMA
                     AHPEMDFSNCKFDGVSGASPFDASA"
     gene            <563815..>566811
                     /locus_tag="OSTLU_16888"
                     /db_xref="GeneID:5003842"
     mRNA            <563815..>566811
                     /locus_tag="OSTLU_16888"
                     /product="predicted protein"
                     /transcript_id="XM_001419600.1"
                     /db_xref="GeneID:5003842"
     CDS             563815..566811
                     /locus_tag="OSTLU_16888"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419637.1"
                     /db_xref="GeneID:5003842"
                     /db_xref="JGIDB:Ost9901_3_16888"
                     /translation="MTTTTMASDALKALEPATRDANAFKARAALIAMREIIDGTTEAT
                     EAGVGARACWSGCREWLGSGKKDARKDAVKTTLALMRCGITREEMEDKLSFAWKHANW
                     RFRVSAIEILSATMATTEDDAFARRCFDAFARTLGDREGEVREQAMDGIAVVFEKFPR
                     VGREALEATKDAMRPQHVKEIERRLDGAKAETNEMETSKSASESMSASAVVKPLGDGL
                     VPPPPERISNEREFTRAMDRVTRDLRPDVDWLKRIAAMVRLEAITLGGGGEVFEDAFT
                     SSLGRAVEVLLAQISDRRSAVVKQVSHLLVTLARGATKSFAQYVDHFVMALLKTTVVT
                     VGVIADSGNACIRGIIEHCHAPKLVQRLTDAVVAERAPKMRGCIVEYLSIILKSWELS
                     NRHIDAIGDALRVTLSDADATVRANSKACFEILSVTSPTASGDLLTRVDSKLARSLSN
                     LTNDSESEETSSVARRGRSGSLSSAPSRIAPEAPAAKKLPTPAPTEARDIASAVMFAE
                     RVERAAERASRAEASSRLRGALDDADARTHGARAAQFEAQVTLHAARIAELLLGYISD
                     SNALVLDPALESIATLVYIASEDLKQVMPDLCLGVFECLTDHRESTRSLSSEALTAIG
                     DVHKPNALLPALLRSLHLASTAKTKTGVLEFALYVLSGRGGGADEVVHTPASVSANLE
                     SWIDLVVELACDVNEPLAKAAGSNLGAIHVHVDGAVVPRRLLASSEYKRVRFMEAIER
                     RVPKLAEMLRPFLEAPPTPPPAPPPAPAPSPPVVTATMHDVGYDSLDEEHGYEDQNMG
                     SLNRSYETMRIEASAGKSRHAGVGERIVEAMEGLRDENIDTVVRSLRTIASSAEDCFA
                     HFKPYMPLLVPTVCSAMDDENELVAAHAYGALRAIFQHREIDTEDAFTALAPLINAYS
                     ASTAPLICAHMIIETADAASVESSLPLVLPSVADVCASKTVAIRHRALNALGACQRTF
                     GAASLSPYVEALSVTHRAVLAHYARN"
     gene            complement(<567065..>567970)
                     /locus_tag="OSTLU_35116"
                     /db_xref="GeneID:5003508"
     mRNA            complement(<567065..>567970)
                     /locus_tag="OSTLU_35116"
                     /product="predicted protein"
                     /transcript_id="XM_001419803.1"
                     /db_xref="GeneID:5003508"
     CDS             complement(567065..>567970)
                     /locus_tag="OSTLU_35116"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419840.1"
                     /db_xref="GeneID:5003508"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="JGIDB:Ost9901_3_35116"
                     /translation="SQSNVRGLRDVNERNDDASDSNGPDPQEWYTGGASSGQAVIDPR
                     ERPDARLASMFDSARAHGAMDGTAEDLNPNESRGARGGAATAFRGRGRTLNSSAEEEA
                     ADEEEASAATAANADDGIVSRVVTFWQNGFTVDDGPLRTFDDPANVAFMESIGRGEAP
                     AELAPRSRTERVNINLVQRHEPYVPPKEPKYRAFGGSGRTLASDSEPAPASTAPASTV
                     EWNVDESQPTTSIQIRLRDGSRLVAKFNTTHTVAHIHSFIARSRPDESFAYTLQLSGF
                     PPKTLSDDDAVIADAGLAGAVVIQR"
     gene            complement(<568232..>570991)
                     /locus_tag="OSTLU_93284"
                     /db_xref="GeneID:5003843"
     mRNA            complement(<568232..>570991)
                     /locus_tag="OSTLU_93284"
                     /product="predicted protein"
                     /transcript_id="XM_001419804.1"
                     /db_xref="GeneID:5003843"
     CDS             complement(568232..570991)
                     /locus_tag="OSTLU_93284"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419841.1"
                     /db_xref="GeneID:5003843"
                     /db_xref="InterPro:IPR003169"
                     /db_xref="JGIDB:Ost9901_3_93284"
                     /translation="MSDAKGDDGSRATSARGQDDGGGWHTAHGHGHRDRDGDARKSHD
                     GGARRESDTREEAKVKWRGDGDGQGAASGGSRRERASRGERREKYGKDGGPPGWGKRD
                     ARDSWGSKAWIDGDGKRAEGGDAKAEGGEGRGRHGSGRAQAREGIPTRPAGRGFTMGR
                     GKSGGQALELSLGALQVSSVSDAFFDAVMARKAASGQFADDGEKTGDDAAPAETPPEK
                     KENGAKYRYDAAQLVTILREMEALQTCKLPEDVCGTNVPLKAIKPGDPMWELTMIGRH
                     GDWQKKKEPVPEPKTAASAATTTRKAKDDVPEWAQEGNSLADASLTDDSFLGTALPQL
                     TAEERLGLAGLGKPAVPAQEQSRTSRFVALEEDETLMPHLSHIGGMMQAPPQQTVQMP
                     PMQMPPMQMPPPQQQIPPQQRQQMPPTQQQLPPPVPANVDWLYLDPSGQQQGPFTRQE
                     LIEWHQGGFFPNDLPCKPIDAPAGAPFMPLIELLQNGWRYRIPMQQAPPPQQQAPPPR
                     QQGGLPPWLSQQAQPSGAPPPRGLTLEEIEQSHGIAPKAMSQQAARSNALANFAAGLG
                     ISSQAGGAPPRARGMTLADIENRHMHDRSGRQEVASADASSKWDAPPAARDVPRQPPP
                     QPAMPPPVTMPPRVEPAPEPAKAAPTGPAWGGAAPALPAAVAGKTLLDIQREEEARAA
                     QAAKNAPPPSTHTAFGGAWGGNAGGGGKSLKQIQEEEALRAAAKHEAEAAMAQQNQAM
                     QTSGGWAAAAAPSQVAPRPSAPMVVPRSVPQSQAPKARPVIGNAVAPLTQSAMSSSAP
                     LPSGLPPLNNKNALRAWCKAQMSQLNNSDDMTLVDFLLGLPSAGEVQEYVALYLGKTP
                     QASAFAVELIRQKRADPSLAEGLGNGELAKVAAQGAGPGFSGADGEDNEAGWASAEKK
                     RRGKK"
     gene            <571613..>571972
                     /locus_tag="OSTLU_33647"
                     /db_xref="GeneID:5003844"
     mRNA            <571613..>571972
                     /locus_tag="OSTLU_33647"
                     /product="predicted protein"
                     /transcript_id="XM_001419601.1"
                     /db_xref="GeneID:5003844"
     CDS             571613..571972
                     /locus_tag="OSTLU_33647"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419638.1"
                     /db_xref="GeneID:5003844"
                     /db_xref="JGIDB:Ost9901_3_33647"
                     /translation="MRVHHYDLYRLRDASEIEAMVDLEESAESAVSVLEWSERLGRLT
                     PETRLEVRVRAIGAGERACGEVVDDSGETASEEGDEEGEEEEEETDAAYVDVAARSFR
                     FVGFGGDWADRIARISP"
     gene            complement(<572655..>573368)
                     /locus_tag="OSTLU_7001"
                     /db_xref="GeneID:5003509"
     mRNA            complement(<572655..>573368)
                     /locus_tag="OSTLU_7001"
                     /product="predicted protein"
                     /transcript_id="XM_001419805.1"
                     /db_xref="GeneID:5003509"
     CDS             complement(<572655..>573368)
                     /locus_tag="OSTLU_7001"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419842.1"
                     /db_xref="GeneID:5003509"
                     /db_xref="InterPro:IPR001023"
                     /db_xref="JGIDB:Ost9901_3_7001"
                     /translation="ICGIDLGTTNSAVAIVRDGRAEIVPCQGLRTIPSVVALGPDGAV
                     TVGVEAKKRMQKDSRNALHSVKRFIGRKYKKCKAQAKDVPYRVVPHPETKFAAIAAVD
                     ESGEEYLVLPEEASAHVLRTLLDAAEAELGTTIDKAVITVPAYFDDLQMEATTRAGHL
                     AGLNVVRLLKEPVAAALAYGVDVDEDETVFVFDLGGGTFDVSVLEVGGGTVEVLATGG
                     DPNLGGDDFDRIIAVWLASE"
     gene            complement(573609..>575050)
                     /locus_tag="OSTLU_50562"
                     /db_xref="GeneID:5003845"
     mRNA            complement(573609..>575050)
                     /locus_tag="OSTLU_50562"
                     /product="predicted protein"
                     /transcript_id="XM_001419806.1"
                     /db_xref="GeneID:5003845"
     CDS             complement(573668..575050)
                     /locus_tag="OSTLU_50562"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419843.1"
                     /db_xref="GeneID:5003845"
                     /db_xref="InterPro:IPR001098"
                     /db_xref="JGIDB:Ost9901_3_50562"
                     /translation="MEIEMPFVAPIVAMQTVRIPFDARKMREEMATMDDRLKKLEEYA
                     LTQKWIVLDSSVSIARRALTNNTYLQDRLYKHLKLTPPPGAKTSIDANNLRKLYEQSN
                     HPFPLLIIEHRSVFKRRGFADTILGMYADDSRIRYSIFQTNHDCGRLAHSEPNFHSLA
                     HDMTCGDQFYGLDAPKISIRSAFVPPAAKVFVRADYSQLELRIMAHFSGDRTLIHMLQ
                     NPEPNNLKDDPFTMLASKWYRKAPDTVLAEERTNCKNLVYGLLYGSGAKKLASDLRMC
                     EEAAKSEVARFKSMLPRLMEWLDGIVIRAREEKPIARVTTISARHRYFPDLHSKNNDD
                     RAAAERQAVNTVCQGSAADIFKTAVVRVIDTLRTKYLIERCQLVLTVHDECVFECDAR
                     SAKAIAQIVRHAMESVANEFNLAVPLPVKVQIGSSLGDDAFAVVPRPSSRLPSAANTP
                     AQSPIKSRGP"
     gene            complement(<575951..>578653)
                     /locus_tag="OSTLU_34768"
                     /db_xref="GeneID:5003846"
     mRNA            complement(join(<575951..577635,577717..>578653))
                     /locus_tag="OSTLU_34768"
                     /product="predicted protein"
                     /transcript_id="XM_001419807.1"
                     /db_xref="GeneID:5003846"
     CDS             complement(join(<575951..577635,577717..578653))
                     /locus_tag="OSTLU_34768"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419844.1"
                     /db_xref="GeneID:5003846"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="JGIDB:Ost9901_3_34768"
                     /translation="MRDTVGENDENARRRAANEAFSSESRDERLKRPRVDVAASRDDG
                     SAERSDDRARSDRVRGLTQDSARFSRHSGAKTPERLETLLDDVDDEALAEVAARLSAE
                     RSARSRSRTTDDARASRGNEASTSIERPVTATGRRDLEFWGVPESAREALAAKGVREL
                     YPWQMECLSLPGVMEGRVNLLYSAPTSGGKSLVADLLLMRRFRERPGSVAMFVLPFVA
                     LCEERADSLENLFAGTEFRLRRMYGGRGGAFPSDSKMNTLLVLTPERANQVTSRLLEE
                     NRLHELSAVIVDELHLIQDDDRGATMELFLTKLVYAIGNTRGGTRDQRSMQIIGMSAS
                     IPNLKALADWLFARLYVTNFRPIRLEVCVKVGCEIFHPATKHVIRTMLNKSPNSDNAH
                     IAELAQETIDEDGSVLVFCSTRAACKTLADQLRNMMQCTVPRQIHNATLSRDEIVVGY
                     ETALGAKSDVLPYIKDGVAFHHAGLSREENEAVADAYKRGVIRVLCCTSTLATGVNLP
                     ARRVILRDTNMGWKKLNARDIQQMTGRAGRAGLDTSGSAIIFCPKLAELDNVCALVDG
                     PSDELTSAVAEVGMRRIMLEAVAAGLVKIPTDVQDYVKCTLLSALNDFDESVRQTAID
                     ALRWCQKNALLVWNVTAYLWSASALGNAVAGGMMPLDQVQPIIRDVKTAREDLVLSTP
                     LHLLYLLTAPPVLDDEGAPVNLNKFRTLDALAVLWSNLNAEQLRIAEKVGIDERYVQR
                     LRSNKRDITIAHQLQRFACQRFHVALFLTDLIQEVPIESITSKYGVRAFDVLEEQKSC
                     ARFASYVAAICGTLGWGDMEGLITRISDRITAGAQEEILELTKIPYIGIHRARALYTG
                     GITTPKAIVTLGSVDKIA"
     gene            complement(<578937..>582902)
                     /locus_tag="OSTLU_16890"
                     /db_xref="GeneID:5003847"
     mRNA            complement(<578937..>582902)
                     /locus_tag="OSTLU_16890"
                     /product="predicted protein"
                     /transcript_id="XM_001419808.1"
                     /db_xref="GeneID:5003847"
     CDS             complement(578937..582902)
                     /locus_tag="OSTLU_16890"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419845.1"
                     /db_xref="GeneID:5003847"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="JGIDB:Ost9901_3_16890"
                     /translation="MLRRRAARAAVGLGRETAGGVDARARSGLDASTSARDRTPRGVY
                     STSASSSFESQRARELGLETPRPGSKLLKGWLAQDYDWTRENVASSELTGNEMTEHRL
                     AVQKTYEPELSAPKVLARWYGGREPVAKEALTPSFAPALWNWLSASAMEGMRGNIAVL
                     GAIVGQSRSASKFLTFTQGSARKSTFLYNVRSNKTMDIELTQRGEALFDNMISNMLLM
                     QATKRARYSPLLSMFRPNAYMTLAGLPRDWEGLRLHQILVRRMEESGRVVDARPDTPI
                     TVIPMHELAFSEFSDSLSPQLFVWVLPPVNNSPENREMIKQDIETALRLAKTTDVRVV
                     VCGLEFAGHRGSNVPVGKQWEEYMSDLTDLTRAAAIEEHSARFIGQLDNIQKQWLNEW
                     SHNGLTLPEVTKMMSAGELDKFGEMTSVRARKWFDEYTAPYLGKQHDSRWFLMNAIFG
                     GLRFINRLRSRTRSFGDSIVETTQHTHRFLRGEMTDEEILEEERKLIAFHGTPEGKAK
                     VFPPVTKIFDALREFRAAVRKADLRAELKALTARAREITDTRDDADVVKAEVLLREMW
                     NAKGRMSEVHLPQIEPSVAAFSMQLGKLEQIAALGEMHRQAFLDTVNRINEFAGAPMP
                     IEGGPQALEAQGVEMEELMNELSSRIQARLAGSALQVSHENMEELQEEDISTELMDAL
                     QMDAEDVDAAAKASKLGRARVLALGAARDLLHAAEDVDPVKLRERIAQAKDMGVDEDI
                     VRSAETKLENLERQIQAFIRAHRITDSLLPAPTSGNDSDSDRWVNAGRNIWYNEAEIL
                     GRGSLGTVVFKGYYDEGAGNRVVRRDAAIKRIPLPPGERGDNMKSLIEREIAIHKHLN
                     ERSTRATHILGSKLDVDRGDGAIYTAMELCGESLATWLKNAGTAGGAPAISHVERMDA
                     VRQLAQAVEDVHAAGVTHNDIKADNCLRSADGEFKLADLGLGVRLKDANKATDGNTYS
                     LTTFEGYGVNIGLQGRPPEVLLNAPLTPKVDVWSFGCLMYTIMTGLQSPYKQERKMDS
                     RNKSPTQELDLSASTALDVGFENQRIVKGKFSLQAIETAMLPSHTAVAARELLHRMLD
                     PDPRERPTATEVCEHPALWDVEECMEAVREIFDRRIVNSLSEKDEADLAQTVWKGRPG
                     QAERAAQSIRNWKSLVVPSLLVRADRYAQRTANMQQTWEDARAARAAEAASKTNSKRN
                     RRRGGKRAADVVPPPRQNEPKDYSYGNRLFDLVRFARNMHEHPPLEAERAEMLRALGS
                     NVAVLLRPEDTAADPWTSSRKIVEAYIAHTFPDLPLFAHYLLKRDVTGVDAANAGASA
                     P"
     gene            <583512..585794
                     /locus_tag="OSTLU_25083"
                     /db_xref="GeneID:5003848"
     mRNA            <583512..585794
                     /locus_tag="OSTLU_25083"
                     /product="predicted protein"
                     /transcript_id="XM_001419602.1"
                     /db_xref="GeneID:5003848"
     CDS             583512..585734
                     /locus_tag="OSTLU_25083"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419639.1"
                     /db_xref="GeneID:5003848"
                     /db_xref="InterPro:IPR000313"
                     /db_xref="JGIDB:Ost9901_3_25083"
                     /translation="MPACAMGNDAAEPYASAAGRATQEVRKASDATRGGRGEIRGETP
                     DLPLSYARNGGTCSTSDDSRPSSRMAMGKDGNSRASGDGTTSGMEEERRRAREATRAW
                     FSERAANGDLELMRAELHSMGQKELQRMFVEMFDRATTSNNNQWLRRRIANGLGLEDV
                     AEHVVSSQAKLASATNERVPSKRQSARRNAVETAAVTPAAQATPNTRGAESPDEAAEF
                     TPDGVRKSRRAVKPKAIFDSDAFPSAAKVSEERRRERKRQEALEQAATCASGVTTDHH
                     GGKAAVGRRVRVYWPLEGKFFAGVVTAYNARTGLHHIDYDDGDKEEIKLATPEQPRKF
                     EAIEHPALASTPSPASDWPALTNTVDSSISLSMPQPGRPADILSTLPSSWPAVGSLVW
                     GRVRGHGWWPGAVHDKDASHDMQEISFFDNSRARLHRHDLLPFQQYYMVLRDAKKTHA
                     YAEAVSRAAETYESRRQRTVKRRSKKEEQSNVEESSEPPRIWHFEREGAKKSHKRSKD
                     VDVDDAGAAKRGKVNEHSTTVFGSIEAPKTLNDLNKSLEEMKAKMLPLAKESRKTLNK
                     HLVDTARKVKTEAADDDEETLIAADERVVVLDELASIESLIAWSENKAAKSPAKTPDL
                     SFMTKRGDDISPSDPKGLLRQPSENLLCLGEISEFFDGTARADPLGIDDPIVADLGAD
                     EVAKMTAPSTPEQHGIEGEGSPFAKSNMSDSCTTLHASYGDKKINVSETPVTKGALSA
                     "
     gene            <585940..>586617
                     /locus_tag="OSTLU_34998"
                     /db_xref="GeneID:5003510"
     mRNA            <585940..>586617
                     /locus_tag="OSTLU_34998"
                     /product="predicted protein"
                     /transcript_id="XM_001419603.1"
                     /db_xref="GeneID:5003510"
     CDS             585940..586617
                     /locus_tag="OSTLU_34998"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419640.1"
                     /db_xref="GeneID:5003510"
                     /db_xref="InterPro:IPR001578"
                     /db_xref="JGIDB:Ost9901_3_34998"
                     /translation="MPKRWLPLEANPEVMNAFARHLGLSDDFAFHDIYGFDDELLDFV
                     PQPCVAVLLLFPITPATEAIEGEPKPETSSSGEPWFARQTVGNACGTMGVLHAALNGA
                     GATKPGSYFEQLRARCEGLDADARAKIIESDDALETAHVGASVEGQSEVPREDAEVDL
                     HFVALVEANGGIWELDGRKPTGPAYHGPSSDKGLLRDCVPVIKKFMNAANGSIHFNAI
                     ALAANLG"
     gene            complement(<586807..>587250)
                     /locus_tag="OSTLU_34833"
                     /db_xref="GeneID:5003511"
     mRNA            complement(<586807..>587250)
                     /locus_tag="OSTLU_34833"
                     /product="predicted protein"
                     /transcript_id="XM_001419809.1"
                     /db_xref="GeneID:5003511"
     CDS             complement(586807..587250)
                     /locus_tag="OSTLU_34833"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419846.1"
                     /db_xref="GeneID:5003511"
                     /db_xref="JGIDB:Ost9901_3_34833"
                     /translation="MFGSSSEDVVVPRAFKLLKELEKGEKGGAGLPPYLSYGLADADE
                     DEDMRAWTGTILGPAGTTLDMRVLELAIECGSAYPERPPEMRFKTKVNLPFVKGDGTV
                     DLKTLGVAQAWKRNNSIEDALNAVYHAMMRPECRRAPQPAEGTRY"
     gene            complement(<587533..>587754)
                     /locus_tag="OSTLU_94754"
                     /db_xref="GeneID:5003852"
     mRNA            complement(<587533..>587754)
                     /locus_tag="OSTLU_94754"
                     /product="predicted protein"
                     /transcript_id="XM_001419810.1"
                     /db_xref="GeneID:5003852"
     CDS             complement(587533..587754)
                     /locus_tag="OSTLU_94754"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419847.1"
                     /db_xref="GeneID:5003852"
                     /db_xref="JGIDB:Ost9901_3_94754"
                     /translation="MAHDDARVPYDVAVERAVDVGLRRACYGALAGGASAFIFLRGPR
                     ARVAALAFGVGVGVGSAYEDAQRAFANVE"
     gene            <587907..>588458
                     /locus_tag="OSTLU_88308"
                     /db_xref="GeneID:5003853"
     mRNA            <587907..>588458
                     /locus_tag="OSTLU_88308"
                     /product="predicted protein"
                     /transcript_id="XM_001419604.1"
                     /db_xref="GeneID:5003853"
     CDS             <587907..588458
                     /locus_tag="OSTLU_88308"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419641.1"
                     /db_xref="GeneID:5003853"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="JGIDB:Ost9901_3_88308"
                     /translation="VKLVLLGASGAGKTALSTRFVRGTFDGENASATVGAAFASTTRA
                     LDDARARIKFEIWDTAGQERYASLAPLYYRGATAAMIAFDARDGASFERARYWAEELR
                     KHGDARCRVLLVGNKIDAVRDDERATAREACEALAREYGMAAYRETSAKTGEGVQEAF
                     EDVARAVMTREMSAREDATVVDA"
     gene            <588709..>589743
                     /locus_tag="OSTLU_93288"
                     /db_xref="GeneID:5003512"
     mRNA            <588709..>589743
                     /locus_tag="OSTLU_93288"
                     /product="predicted protein"
                     /transcript_id="XM_001419605.1"
                     /db_xref="GeneID:5003512"
     CDS             <588709..589743
                     /locus_tag="OSTLU_93288"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419642.1"
                     /db_xref="GeneID:5003512"
                     /db_xref="InterPro:IPR001537"
                     /db_xref="JGIDB:Ost9901_3_93288"
                     /translation="VSFVLCAPEGPLNVGAAARVIQNFSLPSSLRVVRPSASVLRDDD
                     DGASAPRLHEDAYKFAVHAKWMLDDCCARGESVLEAVAEASLVVATTARPRENLPLLT
                     LGAACEKMRDEIARGGKCAILFGNERTGLTNEELELAEFGVSIPTSATVGTSAMARRN
                     KYSGGAGVDGSQTATSLNLGMAVGVVAYELFSQVHAVREDDETKSIGGFNQPHRLTVG
                     ERAALIDDVVAARRAVDVFADVDAEEDVIFAEKERRAITAVLSSGPIATRDATPIFML
                     ARRARALARLADPNALVADAARAYARANGGAVPSTKSLNAYIRETLGISLTKRELERA
                     AALVRDDLPP"
     gene            <589772..>590683
                     /locus_tag="OSTLU_93289"
                     /db_xref="GeneID:5003513"
     mRNA            <589772..>590683
                     /locus_tag="OSTLU_93289"
                     /product="predicted protein"
                     /transcript_id="XM_001419606.1"
                     /db_xref="GeneID:5003513"
     CDS             589772..590683
                     /locus_tag="OSTLU_93289"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419643.1"
                     /db_xref="GeneID:5003513"
                     /db_xref="JGIDB:Ost9901_3_93289"
                     /translation="MRVGPSCARAASSASSASSASRSSASKQVLRLKHRGRDVFLIGT
                     MHYNTASIRLCEETVSTLRPRLGAVVLETCPKRWEKTLTYQPAGSVMRSVLDNEFQSA
                     AEAAGDDAEIVLGDQEIAALGENLGRLVKETAFDLLYPPRAFTGGWKSYADDVREAVA
                     TEIDGGDEGVDAMDLFGDGKLLLNAPVSLIRYPLAWLLKSPKLIVPLASFWLTIAALP
                     GAVEALPEGAAQSSAETLVTDLFLMLDFLQVTLLSRCFLVALLRDRNEILARSIADAC
                     ERVPEGNAVVAVLGAAHLNGVRRRLVE"
     gene            <590783..>591640
                     /locus_tag="OSTLU_34850"
                     /db_xref="GeneID:5003514"
     mRNA            <590783..>591640
                     /locus_tag="OSTLU_34850"
                     /product="predicted protein"
                     /transcript_id="XM_001419607.1"
                     /db_xref="GeneID:5003514"
     CDS             590783..591640
                     /locus_tag="OSTLU_34850"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419644.1"
                     /db_xref="GeneID:5003514"
                     /db_xref="InterPro:IPR008183"
                     /db_xref="JGIDB:Ost9901_3_34850"
                     /translation="MTTHDALVGTLPGVRLENDTHVCEITRFGAHVASWRVKRTSDEL
                     LFRSKLAKLDGTKAIRGGVPVCFPQFSDMGPCAQSHGFARTSVWAVEALSATEVTMVL
                     RRGDEAGDGDAFGGDYEARFTATLDGDALRTALRVTNAGKSCFEFTSALHTYFRVSDC
                     AKTKVRGLRGTTYLDNLRARASAKDDEDAVEFSGEVDRIYTDAPSVLTIDDEALGRRF
                     RVAKTSTFPDAVVWNPALTDKTRGMSDFGDEEYREMVCVEVAGVKDKITVEPGETWEA
                     SQTISYSAI"
     gene            complement(<591667..>594522)
                     /locus_tag="OSTLU_34669"
                     /db_xref="GeneID:5003515"
     mRNA            complement(join(<591667..593125,593174..593983,
                     594023..>594522))
                     /locus_tag="OSTLU_34669"
                     /product="predicted protein"
                     /transcript_id="XM_001419811.1"
                     /db_xref="GeneID:5003515"
     CDS             complement(join(591667..593125,593174..593983,
                     594023..594522))
                     /locus_tag="OSTLU_34669"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419848.1"
                     /db_xref="GeneID:5003515"
                     /db_xref="InterPro:IPR002092"
                     /db_xref="JGIDB:Ost9901_3_34669"
                     /translation="MAATAFGDVKDRIFETTDERRAKIKLALQSLHARRRQLRRAGGH
                     EARERAEDADEGERRAQTRKQREAENLAVEREVMRYKELARKTFAAGIGAQLPVVQKL
                     LASFYVPLVEALTEEQEKIRGNVPGVDRRVYGHYLGLLEPDKLAVLTLHATLSTLMKG
                     DGRNNGAAKFISVADQVGSAVQAEVNLERMRSAEKAAKEAFRRSRLVNTEGNVKEIDD
                     AAEHRINLALDTSKMNTIKSVSKHARQALENAEWGREIRLKIGTVLLTALMNTAKIGV
                     PDEKGELLTLPAFYHDYKEAGYGMLHWHDSIYRFINTETMTRAALVPVRHFPMVIPPR
                     YWERYNKGGYLRADNLCMRGKYSNEGPSRAQIAALEEKAREADASGEPVQYQPVLDAL
                     NALGQTAWQINTDVLPIVEEVWARGGGVAEVPLRAELQLPRWPGGGLPGKGEVIDFLQ
                     SVRKTKKSNMELHSQRCDFLIKLQVAREMKNEPNIYFPHNLDFRGRAYTMHVHLNHIG
                     SDLCRGLLRFNEKKPLGERGLRWMHIQCATLFGNGADKLPMDERVQFIKDRIEDVRAS
                     AQDPLAKDAWWQEAEEPWQCLATCIELDKALELSDPTQFMSNLPVHQDGSCNGLQHYA
                     ALGRDLHGGEAVNLVPADRGADVYTGIANVLKRIVAEDIKLIDSEDEEDVNNAKLAMS
                     LAQHIDRKLVKQTVMTSVYGVTFIGARAQIYSRLREREAMEDNELLRYRVSNYAAKRT
                     LDALNNMFSNARDVMGWLTTCATIATSAGEPVRWTTPLGLPVVQPYHSQRTKRVRTIL
                     QSFSLKVHDEQQPVMKVKQRSAFPPNYIHSIDSSHMMRTAIACVDAGLTFAGVHDSFW
                     THATDVDTMNVILREKFIEVHKEPLLENLYHEFRANYPDVADEFPQPPAPGDLDLDVV
                     QDSVYFFS"
     gene            <595081..>596045
                     /gene="RPL6"
                     /locus_tag="OSTLU_94758"
                     /db_xref="GeneID:5003854"
     mRNA            join(<595081..595085,595490..595778,595830..>596045)
                     /gene="RPL6"
                     /locus_tag="OSTLU_94758"
                     /product="Ribosomal protein L6, component of cytosolic 80S
                     ribosome and 60S large subunit"
                     /note="Has EST support. CTZ79_B03.y1d_s and
                     CTZ79_B03.x1d_t"
                     /transcript_id="XM_001419608.1"
                     /db_xref="GeneID:5003854"
     CDS             join(595081..595085,595490..595778,595830..596045)
                     /gene="RPL6"
                     /locus_tag="OSTLU_94758"
                     /note="Cytosolic 80S ribosomal protein L6; Cytosolic 60S
                     large ribosomal subunit protein L6"
                     /codon_start=1
                     /product="Ribosomal protein L6, component of cytosolic 80S
                     ribosome and 60S large subunit"
                     /protein_id="XP_001419645.1"
                     /db_xref="GeneID:5003854"
                     /db_xref="InterPro:IPR000915"
                     /db_xref="JGIDB:Ost9901_3_94758"
                     /translation="MAKTKKQVKNGQPSFYPADDIKKPLKRTIEHKQTKLRASIAPGQ
                     VLILLAGHLKGKRVVFLKQLESGLLLVAGPYGVNGVPAKRVNQRYVIATSEKVDKPAK
                     DRSNKKSEEEFFKVDLAKKELPADYLENNKALDKALGDAIAKTPYLKEYMSTLFTLKS
                     GDKPHEMKF"
     gene            complement(<596195..>597394)
                     /locus_tag="OSTLU_16898"
                     /db_xref="GeneID:5003516"
     mRNA            complement(<596195..>597394)
                     /locus_tag="OSTLU_16898"
                     /product="predicted protein"
                     /transcript_id="XM_001419812.1"
                     /db_xref="GeneID:5003516"
     CDS             complement(596195..597394)
                     /locus_tag="OSTLU_16898"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419849.1"
                     /db_xref="GeneID:5003516"
                     /db_xref="JGIDB:Ost9901_3_16898"
                     /translation="MATKEIEARAVRYMGIGDDGSGWTAVEEDGSGAGGRRRRHDSDS
                     EEATAAAAAAPSRRARHDSDSEDDAGDASVPPEDAPTTSAGDGLQYDSDGDLIIPQEP
                     AAAAAAAAAAGEPQYDSDGDFILPEEPSGQQELQYDSDGDLILPPDPLPEAPAEDNKK
                     KSKEKKTKEHKMTDGTSTGLVSAAQVIMEAELKRKAEQARVAKMTDEQSGRGAATNYR
                     DKATGKLMDSEEMKRRSENVKPKERERPVWATGVEQARQAKQYEVDLVKAKDTPFAHA
                     DIDADYEDKQRSAMRFGDPMAHLSRKKRHAESLNLPSVVDGLGLSMDDLKKSGFRIPQ
                     EVPPHSWLRRGVVAPHNRYGIKPGRHWDGVDRGTGFEAKMFRKKSELKERAQLEDADA
                     EEHNEWF"
     gene            complement(<597845..>598417)
                     /locus_tag="OSTLU_16899"
                     /db_xref="GeneID:5003855"
     mRNA            complement(<597845..>598417)
                     /locus_tag="OSTLU_16899"
                     /product="predicted protein"
                     /transcript_id="XM_001419813.1"
                     /db_xref="GeneID:5003855"
     CDS             complement(597845..598417)
                     /locus_tag="OSTLU_16899"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419850.1"
                     /db_xref="GeneID:5003855"
                     /db_xref="JGIDB:Ost9901_3_16899"
                     /translation="MDLVEALERAGRAPDDAAALGASVSGAWSLLASVAADDAAEEAR
                     RRREGALGAALTEASGSSGRSVASEKSEKSEKSEKSFARSIGNYQDIDVAAATVSNRA
                     EFEGPFGVNLGVNLAGECAFDDPVAHPTRLNVRFRSVELRIGSLPPLRASLDFVDPRG
                     WIETTYVDDDLRTGRGDKGSIFVAARRVDA"
     gene            <598710..>599762
                     /locus_tag="OSTLU_34640"
                     /db_xref="GeneID:5003856"
     mRNA            <598710..>599762
                     /locus_tag="OSTLU_34640"
                     /product="DMT family transporter:
                     phosphate/phosphoenolpyruvate"
                     /transcript_id="XM_001419609.1"
                     /db_xref="GeneID:5003856"
     CDS             598710..599762
                     /locus_tag="OSTLU_34640"
                     /codon_start=1
                     /product="DMT family transporter:
                     phosphate/phosphoenolpyruvate"
                     /protein_id="XP_001419646.1"
                     /db_xref="GeneID:5003856"
                     /db_xref="JGIDB:Ost9901_3_34640"
                     /translation="MPASSDAPSTTPATRDADARSRRVVAKALADNALVALWVGTSAI
                     VILFNKYILTAYGFPFPVALTMTHMLFCSVVAFVIVRALKLVPASEGVTREVYATKIT
                     PIAALFAVSLWASNTAYVYLSVAFIQMLKALSPVVVYAIGCSIGVERYSHERLANMAV
                     VTLGVMIASYGELNFNFFGFAVQLVAVLAESCRIIAVQLVLGKANLKLNSITTLYYVS
                     PACFVFLIVPFAMLELPRLAYGLEVTHSVRYSAGIMLANAMCAFALNAVIYLLIGRTS
                     ALTLNVAGVVKDMFLIGISSVIFEAPISATQLVGSLIAFGGVCYYNYRKLNDAFAAAA
                     AAPTQGEVGPKRDSQA"
     gene            complement(<599832..>601063)
                     /locus_tag="OSTLU_94760"
                     /db_xref="GeneID:5003517"
     mRNA            complement(join(<599832..601041,601056..>601063))
                     /locus_tag="OSTLU_94760"
                     /product="predicted protein"
                     /transcript_id="XM_001419814.1"
                     /db_xref="GeneID:5003517"
     CDS             complement(join(599832..601041,601056..601063))
                     /locus_tag="OSTLU_94760"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419851.1"
                     /db_xref="GeneID:5003517"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="JGIDB:Ost9901_3_94760"
                     /translation="MTSAKRRKARREREGRSGRGTAAVTSKFAVCGTVFEVDAKYAPI
                     KPIGKGAYGVVCSARELETNRKVAIKKIVNAFENVVDAKRTLREIKLLRHLRHENVID
                     IIDCVKPRAKDAFEDVYLMYDLMDTDLYQIIRSSQSLTDEHCQYFVYQILRGLKYIHS
                     ADVLHRDLKPGNLLLNANCDLKICDFGLARTALVDAEASEFMTEYVVTRWYRAPELLL
                     SCAEYTSAIDVWSVGCIFAELLGRKTLFPGKDYVHQLNLIMRVIGTPQNPSELDFINN
                     EKAKRYIKSLPVTARCSFQKLFPNASPKAVDLVDKMLVLDPARRITVEEALAHPYLES
                     LHDEVDEPCAESPFTFDFEDGAQYLTDTDVRGLIYDELCALSAEFEAAKLAQLSLGGD
                     GQDEGNELSELLL"
     gene            <601507..>603135
                     /locus_tag="OSTLU_88314"
                     /db_xref="GeneID:5003857"
     mRNA            <601507..>603135
                     /locus_tag="OSTLU_88314"
                     /product="predicted protein"
                     /transcript_id="XM_001419610.1"
                     /db_xref="GeneID:5003857"
     CDS             601507..603135
                     /locus_tag="OSTLU_88314"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419647.1"
                     /db_xref="GeneID:5003857"
                     /db_xref="JGIDB:Ost9901_3_88314"
                     /translation="MPALVLTRAGWARASDVDDDDDDATRDVAAALWTTTTWLDMLND
                     GRRNRAFARAIERDVTRGDRCVDVGAGTGILAAMLARACGREGGVVAVEEYAPCAALA
                     RKIVGGDGIDVRCARSDEVVCETENERFDVMCAELLDSELVGEGWLKTAREARRRLTR
                     GRGATIPRRGRTHARLVRCEKAAKYYGAIGDAASAAGEGVVWCRSARQAHARAWRREM
                     ESLSDDVLAHEFDFENVPEEGRAATWEREWKVVDTAGRADAVLVWWEVDVDSEGDARY
                     STRPTPDAPWTHHWRQVLFVVPEHARGGILNGDGKVRFVATHDDYSLKIGIQTSETLG
                     ARADAAGVPDPPVEAPWLDPLRRCARGESTSYRLRAVGMRLPEFVASKARLGVVCGVD
                     LSSANALLRPEDDDLPDDAPIGCEKFDAPISWFHVFELGGGPHDADAVATSPETLFEF
                     GDESSSFAVGARAVATLRADAPFDAVVVYIDAEDDVDPFDPERDAFATPFSIARRRQG
                     VLIVPERSRAPSLQVWCAAVPGDEGFRFGILASS"
     gene            <603250..>604200
                     /locus_tag="OSTLU_93291"
                     /db_xref="GeneID:5003518"
     mRNA            <603250..>604200
                     /locus_tag="OSTLU_93291"
                     /product="predicted protein"
                     /transcript_id="XM_001419611.1"
                     /db_xref="GeneID:5003518"
     CDS             603250..604200
                     /locus_tag="OSTLU_93291"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419648.1"
                     /db_xref="GeneID:5003518"
                     /db_xref="JGIDB:Ost9901_3_93291"
                     /translation="MSLARARASGPTPARASTSTSTSSSSRARVVALTRRAALVAAVS
                     LVAPGRARADAFADADAFADAGESPAVGACADCIGEYNGYLNSCDRASSSCVSSQNDD
                     AERFVAPWAYEGDRATAMRRLVDVATGRATPRGRALSQRGSGIGARTGDGRARDGLSF
                     VARAEAYDESSGYVRLALAPKTRNDANGGFGAKVALDGNDVDVAGVGVFDAEFLFIAN
                     DEVVDVRVAQRGGNAENRGVFRLSYTDGVAFDTNLARARAEELRIAIGWEILPVIAAF
                     DPKWSDKERLWFEKLFDAAAGRPAPETNDLRDMRDTYSYE"
     gene            <604371..>604763
                     /locus_tag="OSTLU_8289"
                     /db_xref="GeneID:5003519"
     mRNA            <604371..>604763
                     /locus_tag="OSTLU_8289"
                     /product="predicted protein"
                     /transcript_id="XM_001419612.1"
                     /db_xref="GeneID:5003519"
     CDS             <604371..>604763
                     /locus_tag="OSTLU_8289"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419649.1"
                     /db_xref="GeneID:5003519"
                     /db_xref="JGIDB:Ost9901_3_8289"
                     /translation="YFVTHIPATMLIDAQVVLPPRVVPTFARNALRWHISTNNDVLMA
                     HQPAWLRSLVMCELVFQLPFFFVAISALRRRDEGAKGWLLAYGAHTATTLAPILQYIW
                     ESDAIASELERWKLIGVYSPYLVVPLWIV"
     gene            complement(<604954..>607908)
                     /locus_tag="OSTLU_16903"
                     /db_xref="GeneID:5003520"
     mRNA            complement(join(<604954..606179,606777..>607908))
                     /locus_tag="OSTLU_16903"
                     /product="predicted protein"
                     /transcript_id="XM_001419815.1"
                     /db_xref="GeneID:5003520"
     CDS             complement(join(604954..606179,606777..607908))
                     /locus_tag="OSTLU_16903"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419852.1"
                     /db_xref="GeneID:5003520"
                     /db_xref="JGIDB:Ost9901_3_16903"
                     /translation="MPALALDDRDLRGSVALSPDRTRALVRDGVHLTLRRAARVDERV
                     GKAIQFESTIASVAWHATRDVCAVVLDDGTACVVTVDDRGLTLERVARGIGACSRAFR
                     AGDGALAFAGDGDASTTMLDDRDGFDFVRIAHARKSSSRFSAHARSRDGRWMAFVTRD
                     DEARERVEVFSATAPYEGAISFRLPPGFDAQMIEFGGAGGQEILIYDDSCAVEARPAL
                     EIFSAEGLRRATIRGASAPSVRAKDGRLIVTCVSNEALLWIDELTWRITRALTHPLTC
                     DATASTRIFRESQRGDGYEKVARFEQKTLACDARGIERAGVRLALSSCKTMLATLCAS
                     HNDKVLFLWPASGNDADDGAPLAVFVHRKPIIDFRWFEDDDLDEDFYASDIASVRLLR
                     RGDDPIEEFGGASRRAGGVELTQSGWSTIYVGRARVRAGEEIGFGLVNARGETIFELG
                     HNKRFPATGELANATCLANVPAGGGAYRNRVIPKRSSMRLVDGVRRFETTWAGCLERC
                     PLTVKLIACTGPATGDADNVWGIEESVAKTDVWRNYKGHFTSVSSGEFNTWGLNTVTG
                     TLAWTRNADLNQFSRDNWNTATNNPVANGVAQGTMVDFDAGYDALIGVTDTSIHTSGG
                     YMWSRPVDGSGDWGFADDGGGKGVQVTIGRTHHFHMNKQHNMWSAELPNGGWVRQHVK
                     TVKQVEVGDSDAFVVYQDGRTLKRKASDMTGDWSTISIPSALSTATISQITVGATALW
                     LLDGNGNLWGCDLPCRDSGGFVRAANAPANIISIDAGKVIHNVPN"
     gene            complement(<608032..>609078)
                     /locus_tag="OSTLU_33669"
                     /db_xref="GeneID:5003858"
     mRNA            complement(<608032..>609078)
                     /locus_tag="OSTLU_33669"
                     /product="predicted protein"
                     /transcript_id="XM_001419816.1"
                     /db_xref="GeneID:5003858"
     CDS             complement(608032..609078)
                     /locus_tag="OSTLU_33669"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419853.1"
                     /db_xref="GeneID:5003858"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="JGIDB:Ost9901_3_33669"
                     /translation="MDDARDATGGEGARGRCQKLAKALRGQLAKKAYDALRAHARAFQ
                     RREVTTSEFAKVLVECARTGGVTRATAREVIATTPSALDRRRLRECVGRDLDDDAAVK
                     STREREKKPHGFKTERLGPGLVCLRKFLSVEAQMWLASESFALGESGSDDAARGQGFF
                     AKMGDGTFKLNQGSRGRMILEPDAFPDGILTQMCEDAVAAACAADAEMPTNMNPTTCL
                     VNFYKDGAEFKWHKDSEDPKLVKSRTGPPIVSFSVGLSGDFGYKYSFDDPEHKVVRLN
                     SGDVLLFGGPSRMIVHSVLNVYPGSMPGHLRGKMLNGRLNVTVRDIGCGVIDASQFPA
                     YRVSYDGVQADGNV"
     gene            <609184..>609882
                     /locus_tag="OSTLU_34654"
                     /db_xref="GeneID:5003859"
     mRNA            <609184..>609882
                     /locus_tag="OSTLU_34654"
                     /product="predicted protein"
                     /transcript_id="XM_001419613.1"
                     /db_xref="GeneID:5003859"
     CDS             609184..609882
                     /locus_tag="OSTLU_34654"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419650.1"
                     /db_xref="GeneID:5003859"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="JGIDB:Ost9901_3_34654"
                     /translation="MTDARRYDRANDPYYVVRDEIARHVDDLARRARSGAASATVSAA
                     LERDIESARWELDELDRAIAVAERESARYKLDAREIDERKRWSARAREAVDEAMATTR
                     ARARAGRANGDGDGDANGTTTRTAGDAGVGEAGFDDHQQLLVRRQDEDLDDISASITR
                     IGQVGLTIGEELASQSKMLEDLDEDVDGVNARLAAAERKMRDVLKKVGLRGQLCVIFF
                     LTVVLFVLFAIAFQ"
     gene            complement(<610002..>610784)
                     /locus_tag="OSTLU_34954"
                     /db_xref="GeneID:5003521"
     mRNA            complement(<610002..>610784)
                     /locus_tag="OSTLU_34954"
                     /product="predicted protein"
                     /transcript_id="XM_001419817.1"
                     /db_xref="GeneID:5003521"
     CDS             complement(610002..610784)
                     /locus_tag="OSTLU_34954"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419854.1"
                     /db_xref="GeneID:5003521"
                     /db_xref="JGIDB:Ost9901_3_34954"
                     /translation="MARGASRALYHVHARSVDIARFLRLEEGLLRHRASEDWLTTLDG
                     AARRAVVLGVSGAVERLVDAREARRRDVKLVRRFTGGGTIACDGDTLFVGMTMNAGDD
                     AMVRERETHPRRVMAATGEVYARVFDKCGTFALRENDYAFGTRKFGGNAQAITRGRFL
                     HHTSFLYDYDEDAMAATLKTPERAPAYRNGRAHGDFVTRLRDRGYERDEIFERVRGTM
                     RGMLGYEIVDVALEDAERMVDDAVTRSGVARWDTTKVLSWDD"
     gene            <611392..>611943
                     /locus_tag="OSTLU_93295"
                     /db_xref="GeneID:5003860"
     mRNA            <611392..>611943
                     /locus_tag="OSTLU_93295"
                     /product="predicted protein"
                     /transcript_id="XM_001419614.1"
                     /db_xref="GeneID:5003860"
     CDS             <611392..611943
                     /locus_tag="OSTLU_93295"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419651.1"
                     /db_xref="GeneID:5003860"
                     /db_xref="JGIDB:Ost9901_3_93295"
                     /translation="LRANIDALREELEESRWAREALETRVQEAEKIAAEARSKTIESA
                     LDPQNQLTNEQVAALRAEIEQVEYLKRLLARAEQMRNVARAETKQARDKHESDLEIVR
                     KEVAVMDAEMENLRRRVKKDKAKIEAMERTTIEAADEFATLYSRQENTRRLLGACIVA
                     ILALVVRLGLSGQTFMMKNMYQY"
     gene            complement(<612434..614099)
                     /locus_tag="OSTLU_33673"
                     /db_xref="GeneID:5003522"
     mRNA            complement(<612434..614099)
                     /locus_tag="OSTLU_33673"
                     /product="predicted protein"
                     /transcript_id="XM_001419818.1"
                     /db_xref="GeneID:5003522"
     CDS             complement(612434..614077)
                     /locus_tag="OSTLU_33673"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419855.1"
                     /db_xref="GeneID:5003522"
                     /db_xref="JGIDB:Ost9901_3_33673"
                     /translation="MALAMARASRVGAIPARARDRREVRPRGRAIARAADADEPEWKR
                     RQREQDAQISAEERAVRERVRERMAPIVSGETDVDADAHAKDGMASSSARREELSRKI
                     AAATTALERGLVERETETRLLLLAACCGEHLLLLGPPGTAKSELGRRLSALCEGGQFF
                     ERLLTRFSVPEELFGPLSMKGLENDEYVRKIDGYLPSANVAFVDEIFKANSAILNSLL
                     TILNERLFDNGSERVDVPLLCLVGASNELPESEELDALYDRFLLRSSVEQVSAGGLGK
                     LLSLGGEAAIGSKANDHGGVSTSDTRLKPEDFANIRYEAAAETEVPTNVIELITDLRT
                     FLQDKCEPPVYVSDRRLLKAVQMLRVAAYTNNRDEVSEFDTLLLVNVLWQRPNEAMMI
                     KDWILERLAQDRGTKQVQYLLAGLFGRACRADGDAEECARLLSEAKNLRGVLTAQLNS
                     LRGAQGGSLPALREHLWLSPADASRAAQTLGPMFSKVSKSLEKLLEDVLTLEVALERD
                     TEPHILALLMPDYWAAFIREGPIAEVQPLGVSNATSAAP"
     gene            complement(614902..>616276)
                     /locus_tag="OSTLU_25086"
                     /db_xref="GeneID:5003861"
     mRNA            complement(614902..>616276)
                     /locus_tag="OSTLU_25086"
                     /product="predicted protein"
                     /transcript_id="XM_001419819.1"
                     /db_xref="GeneID:5003861"
     CDS             complement(614960..616276)
                     /locus_tag="OSTLU_25086"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419856.1"
                     /db_xref="GeneID:5003861"
                     /db_xref="InterPro:IPR002173"
                     /db_xref="JGIDB:Ost9901_3_25086"
                     /translation="MISTRVAAHAHVERRRACGECAHSGRASSRARAGAREREVRRRV
                     ARRASREYDVVALGNLCVDVLLPPGPIPDATSLKTTKTLGELARTAPARESWELGGNC
                     NFLIAASRLGLRASCAGHVGNDEYGKFLIDELALEGIDHVELIPGDDQGVRVSALAET
                     LICFVLSDGAGSHAFCSRYDLGPWPLMRDVSDVSNEAREALRSCRAVFLNGFVFDELK
                     PQAVAQALKLAKGNGAGVFFDPGPRAFTFVDETNPSRMEALRVALENSDVVLATEEEL
                     AALTGVRANAPPTDYAAAVFDFPGSAAEWVVVKLGPEGAMVVTRDGQSARVGCPRVKV
                     GDTVGCGDSSAGAYVLGYLRKQADDALDLSEVLQTTATLATHVGSATAMNIGAGRNVA
                     KAETVLELLDAAVDGKTEGVDRGTASRAQAILRESMNESMKQQQAR"
     gene            complement(<617387..>617980)
                     /locus_tag="OSTLU_34819"
                     /db_xref="GeneID:5003862"
     mRNA            complement(<617387..>617980)
                     /locus_tag="OSTLU_34819"
                     /product="predicted protein"
                     /transcript_id="XM_001419820.1"
                     /db_xref="GeneID:5003862"
     CDS             complement(<617387..617980)
                     /locus_tag="OSTLU_34819"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419857.1"
                     /db_xref="GeneID:5003862"
                     /db_xref="InterPro:IPR001026"
                     /db_xref="JGIDB:Ost9901_3_34819"
                     /translation="MFKAALTTIKSAIPDEVAQAAKKRVNQWKGIGDDEALVRDATNS
                     EPWGPHGEQLRAIARLTRDGKWDVVREVLEKRLKSAPEEWRRAYKALTVVEYLVANGD
                     RAIAEDVRRRRMMDGALRFEYKDARGKDEGVNVRHRAEKIKALVEDPRSVEEAREKAE
                     RNRGKYAGMSSEEARTHARRGSTSSAGGSFSGGSALGG"
     gene            <618585..620278
                     /locus_tag="OSTLU_25087"
                     /db_xref="GeneID:5003863"
     mRNA            <618585..620278
                     /locus_tag="OSTLU_25087"
                     /product="predicted protein"
                     /transcript_id="XM_001419615.1"
                     /db_xref="GeneID:5003863"
     CDS             618585..620273
                     /locus_tag="OSTLU_25087"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419652.1"
                     /db_xref="GeneID:5003863"
                     /db_xref="JGIDB:Ost9901_3_25087"
                     /translation="MEACVRKQNALDVMPTSARTGCPIAIRRATLDDEDEKQAANGVF
                     IARVVVRYREEHELEQALLDVAIQSRTAGELAGRLCAGGTPPRRNRADEDEAEANDGS
                     IEELASVLGEDPKDVKARVLECYDRCEPFLPARVRDLLGRERVYEVRSACAGAALTAI
                     RSFILRVATAGKWTHWGIIEGTVEVELPLAYDVKFVDTPGIDASQFSLKRLRRVIGAE
                     AEERFGMFIYVCGKDAPKEWEWSALHAMGTLKKIVTEGPRLCLCWPVELVVNANGRPD
                     GFVTNLQIKKFQDRTLKMLRSDSNHWRERLDQCIVASKVDGLRGDLRRGMALAFVRAF
                     KPDASTILKYSMYQLAFSVEEELKPSPPSDNGSGVLPSTAVVADAKPSTDPCPKTKRK
                     IDEEAATKASPPKKRLKKQPRQCTIADPFVFNEDDGLFADEDAATPPMFGKHIAKTKS
                     TRSPLVDANEKSRATAAARRKTKPSNTAPKRPLVLTSTTVSPPKSKHRGAEAPQPKLS
                     PQLSATPASKPARNRPKFVVASVDDGPTPSPPPARPKRPRECTKQPWWVVQSHR"
     gene            <620735..>621389
                     /locus_tag="OSTLU_16909"
                     /db_xref="GeneID:5003523"
     mRNA            <620735..>621389
                     /locus_tag="OSTLU_16909"
                     /product="predicted protein"
                     /transcript_id="XM_001419616.1"
                     /db_xref="GeneID:5003523"
     CDS             620735..>621389
                     /locus_tag="OSTLU_16909"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419653.1"
                     /db_xref="GeneID:5003523"
                     /db_xref="JGIDB:Ost9901_3_16909"
                     /translation="MEDLHAIGDVVRELCAVDDGVLMRSTLGCMDGFKVALRAEREDD
                     DEARREICVAALFGLSKLATTAREQVIGGDVEEDVVLEMLRVQCKAPNMRFSERARAM
                     STYVKAVGVRENLTNVNVRTPPASPKDKSGRTIGGLARAFASQQEMADFNTPDVSDDE
                     GTEERRQSMSSLCASPSRIFYSPKILSGDGTVVDEAITPPGTVICRICEQPVAKRTFA
                     "
     gene            <621503..>621976
                     /locus_tag="OSTLU_34630"
                     /db_xref="GeneID:5003524"
     mRNA            <621503..>621976
                     /locus_tag="OSTLU_34630"
                     /product="predicted protein"
                     /transcript_id="XM_001419617.1"
                     /db_xref="GeneID:5003524"
     CDS             621503..>621976
                     /locus_tag="OSTLU_34630"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419654.1"
                     /db_xref="GeneID:5003524"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="JGIDB:Ost9901_3_34630"
                     /translation="MSIDDFRIIKLISGGAYGRVFLAQKRATGDLFAVKALRKRDLVY
                     KNMMDQVVAERDALIAAANPFTIKLYYSFTSARHVYLVTEYANGGDLYSLLTQLGRLS
                     EEHARQYCAEIALALEYVHSKGITHRDLKPGNCLIASDGHIKLADFGLSRIDRDAG"
     gene            <622208..>622603
                     /locus_tag="OSTLU_8318"
                     /db_xref="GeneID:5003525"
     mRNA            <622208..>622603
                     /locus_tag="OSTLU_8318"
                     /product="predicted protein"
                     /transcript_id="XM_001419618.1"
                     /db_xref="GeneID:5003525"
     CDS             <622208..>622603
                     /locus_tag="OSTLU_8318"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419655.1"
                     /db_xref="GeneID:5003525"
                     /db_xref="JGIDB:Ost9901_3_8318"
                     /translation="GTPDYLAPEILLCEPCGEGVDWWALGVMAYEMLVGVPPFNASTP
                     LAIFARIINGKVEWPGSGAALSDESKDFVNALLVHDVEARLGSNDDANDIKAHPWFAD
                     VTWEHVYDKSAASVFVPKPESRQDTSYFVP"
     gene            complement(622900..623848)
                     /locus_tag="OSTLU_33679"
                     /db_xref="GeneID:5003526"
     mRNA            complement(622900..623848)
                     /locus_tag="OSTLU_33679"
                     /product="predicted protein"
                     /transcript_id="XM_001419821.1"
                     /db_xref="GeneID:5003526"
     CDS             complement(623020..623544)
                     /locus_tag="OSTLU_33679"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419858.1"
                     /db_xref="GeneID:5003526"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="JGIDB:Ost9901_3_33679"
                     /translation="MKIENETTSLTNKLCGAEVGYENVKVVLIVARAPASSAQYDIRE
                     FDPASLSVRDGAETSLIVGSLDINIGDRLPAEELAGTRSLGRRAYLSNVGVAPAARRT
                     GVASRMIERASIIARDEYAVHTLYVHVQHDNDAAIALYERSDFIREAQETAGAESSLG
                     RPARVLLRRDLRIH"
     gene            complement(<624236..>624589)
                     /locus_tag="OSTLU_9067"
                     /db_xref="GeneID:5003864"
     mRNA            complement(<624236..>624589)
                     /locus_tag="OSTLU_9067"
                     /product="predicted protein"
                     /transcript_id="XM_001419822.1"
                     /db_xref="GeneID:5003864"
     CDS             complement(<624236..>624589)
                     /locus_tag="OSTLU_9067"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419859.1"
                     /db_xref="GeneID:5003864"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="JGIDB:Ost9901_3_9067"
                     /translation="GIRFWETPEYSGWLTKQGEMLRTWRKRWFVLKQGHLVWFKTNVV
                     NERAVTRGEIPIESIDSVSVASEAAAGKPYAIHLEGALPARIGTKYLVADSERERSQW
                     LEALQKAMRERTSTST"
     gene            complement(625476..>627216)
                     /locus_tag="OSTLU_25091"
                     /db_xref="GeneID:5003865"
     mRNA            complement(625476..>627216)
                     /locus_tag="OSTLU_25091"
                     /product="predicted protein"
                     /transcript_id="XM_001419823.1"
                     /db_xref="GeneID:5003865"
     CDS             complement(625684..627216)
                     /locus_tag="OSTLU_25091"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419860.1"
                     /db_xref="GeneID:5003865"
                     /db_xref="InterPro:IPR005172"
                     /db_xref="JGIDB:Ost9901_3_25091"
                     /translation="MNRVRLTNASDDARRRSDGDGKATNGGGVSDVARLALSAEASIQ
                     RGNGGGGRARRQLDVEFGELDVQALQDDRYVLQNMYDEFDDSVIGVEEQGSYPRRGGA
                     SRGDGHEDSASKRSSTTGASVEWTKGYTKTLKNFDADSPRVGTRSARAPRGGVEASKA
                     VVAKRGVATAKNSSLASNASAMKNASACREFVASKKCNCKKSKCLKLYCECFAAGAFC
                     KDCSCQQCQNTTENEAIVTKTRQQIEQRNPYAFESKIMADAGDDARHTKGCHCKKSAC
                     LKKYCECFQAGVKCQDYCKCEGCKNNDNGPSPALPRGGAAKASKVSKSKARSRETVAA
                     TTMAAKELQDDLIIEDFKLTGVMGSPLRAFEHTDDLSSEYSNLSKSVEQSPLRTLLLS
                     EGVQLSPFFSTSSLPATALSPLRAGQMSPLRPTPSHGFMSPLTPGMRPGKYSIRSSSS
                     RGKAPVPLFNEDSGHGGEFKTPRDRKTNTVFGGMHDAAKDGPLRATFTSPIPLSTPDV
                     YE"
     gene            complement(<628318..>629388)
                     /locus_tag="OSTLU_16913"
                     /db_xref="GeneID:5003866"
     mRNA            complement(<628318..>629388)
                     /locus_tag="OSTLU_16913"
                     /product="predicted protein"
                     /transcript_id="XM_001419824.1"
                     /db_xref="GeneID:5003866"
     CDS             complement(628318..629388)
                     /locus_tag="OSTLU_16913"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419861.1"
                     /db_xref="GeneID:5003866"
                     /db_xref="JGIDB:Ost9901_3_16913"
                     /translation="MDTVRRVLGAYLSGPVGEIAGSSPASSVKSLVPRRLSFARASSD
                     GVARATNGNQASRAMSRFVRDAVGGKRARESSGTNGEGANGDVDGGGDDDGAGGKRPR
                     HDDDVDVAVVRGEISGRGDEDLAPWPSAKRKRGIEDEEDAETPAAHRRRTSERASVQA
                     PRARATPVLVAEKVLKGGRLDGFKALPKMSSRVAAPARRGPTNRRGLGGRRRIVDVRA
                     RVEFDELAEDKAERERLEATRAPALGLPSSYATTVASDRPKSNDSGGLGAALAEFKST
                     AATAAAEPAKSTTTSNPPSSTGGFTFTAAPPSSSTANPFSKPPTVGAPSATPFAFSAG
                     AAADPAPGRRVVRARRPASRNR"
     gene            <630481..>631041
                     /locus_tag="OSTLU_16914"
                     /db_xref="GeneID:5003867"
     mRNA            <630481..>631041
                     /locus_tag="OSTLU_16914"
                     /product="predicted protein"
                     /transcript_id="XM_001419619.1"
                     /db_xref="GeneID:5003867"
     CDS             630481..631041
                     /locus_tag="OSTLU_16914"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419656.1"
                     /db_xref="GeneID:5003867"
                     /db_xref="JGIDB:Ost9901_3_16914"
                     /translation="MVRASTLALHLNLVETIAGAELVALANPRSALSAIPRLTNGGGL
                     GDGLARACAQNAVVAFVVSLYGSLLVVSGACAAMKIRDRTLRVGERQFAGTHAVIAAN
                     CVAFRARVPAVFPLGALFHAVVAALFHLGDGYKLPLKFPSVLGRAKTTSAAARKAAKK
                     PSKKSSSNKAKRAPAKRASSSRKSRR"
     gene            <631687..>632195
                     /gene="PCY1"
                     /locus_tag="OSTLU_34733"
                     /db_xref="GeneID:5003527"
     mRNA            join(<631687..631752,631947..>632195)
                     /gene="PCY1"
                     /locus_tag="OSTLU_34733"
                     /product="plastocyanin, chloroplast precursor"
                     /transcript_id="XM_001419620.1"
                     /db_xref="GeneID:5003527"
     CDS             join(631687..631752,631947..632195)
                     /gene="PCY1"
                     /locus_tag="OSTLU_34733"
                     /codon_start=1
                     /product="plastocyanin, chloroplast precursor"
                     /protein_id="XP_001419657.1"
                     /db_xref="GeneID:5003527"
                     /db_xref="InterPro:IPR000923"
                     /db_xref="JGIDB:Ost9901_3_34733"
                     /translation="MSSPAFAATIKLGGDNGELGFYPPSITVKAGETIEFVNNKAFPH
                     NVVFDEDNVPAGVNVDAISHEDYLNGPGEKVTNKFDTPGTYGYYCEPHQGAGMAGKII
                     VQ"
     gene            complement(<632429..>634366)
                     /locus_tag="OSTLU_34816"
                     /db_xref="GeneID:5003528"
     mRNA            complement(<632429..>634366)
                     /locus_tag="OSTLU_34816"
                     /product="predicted protein"
                     /transcript_id="XM_001419825.1"
                     /db_xref="GeneID:5003528"
     CDS             complement(632429..634366)
                     /locus_tag="OSTLU_34816"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419862.1"
                     /db_xref="GeneID:5003528"
                     /db_xref="InterPro:IPR001900"
                     /db_xref="JGIDB:Ost9901_3_34816"
                     /translation="MERFARDAAESAKADALLRGAWELIDEFGLESGEVCDATYVSEL
                     MFEDDANAPAGAREFAAHRLLSSPMGGIYFKLKAKGTYESRAADQIDALKRKAEAESR
                     AAKVEEAFLDEIKAAAAAPAGVKPDRDALWRPSDEDNDARVRRLEALEAYALGEKFHS
                     AGEKAMADDLLGKLGFTRSSEGALKTLISTGTWSRHENLSVRKYGVQIDFPEGTAKAC
                     AEVLSNEPVDADAASRVDLTYLRAYAIDDAETVEVDDAVSAEALGDDGQIRVWVHIAD
                     PTRWIPLGSPLDAIARQRATTLYYPTEIVPMFPLEIAAGPMSLGSRSDVASEAMTVRA
                     DIDREGNIMDFEIMPSFVKLDRRWTYDEVDVELDSATCDEGLRLLYKVASARDERRAE
                     DGSVTIILPENSVNVRGATARGGDGDVAITMSKINGHTPARMLVSELMVLVGDVVARF
                     GVRENIPLPFRGQGEPRLMSDDEWDGIPEGICQDMAMRSCMTSSTSGATPRPHSGLGL
                     SAYVQFTSPIRRYADVLAHHQIKAYLRGEPLPFDEQSMENVIEDVGTTVGGAIRSQRE
                     TSKYWASAYFDAQPADARWTATVVKFIRGDDLVLVIFDDLGYETVVKLDRGAVLGETL
                     TLKFVDADPHAGSTNFARVEA"
     gene            <635609..>637426
                     /locus_tag="OSTLU_16917"
                     /db_xref="GeneID:5003868"
     mRNA            <635609..>637426
                     /locus_tag="OSTLU_16917"
                     /product="predicted protein"
                     /transcript_id="XM_001419621.1"
                     /db_xref="GeneID:5003868"
     CDS             635609..637426
                     /locus_tag="OSTLU_16917"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419658.1"
                     /db_xref="GeneID:5003868"
                     /db_xref="JGIDB:Ost9901_3_16917"
                     /translation="MPGAADARAAAQKGDKQRQNVFEPMSGTRISNRLVSGAVVRARF
                     DDRRHCAIKDLEKEIVGKHGFVGVVTEARIKVNGRGSKYALWTVSELRGGGASATVSV
                     FGDAYAAHGEDEKKAIGFIWGVFDTKFYQSRSVSVEDGGQLMKIGAAADFGVCKATRK
                     DGTPCTKAVNVSECKFCEFHVPKAIREVANAQRQMTGKRNANGDFKVGLQKYGASMQP
                     TSARASHLQRPGEGLMNGGPAPSARAQAILKQSNAHLPRNAFKPKRTGEEFAARLHAK
                     APTTMALEEEDLDFEDDKEALATLARQHAASIAQTRQDASRAKQREVAERLRATGLTL
                     TKPDPNDTSAKKPTTTVRAEPKPLPETLKAHGLQMATVQQLERKLKAEIARREALEKE
                     NEELRRQLAEARGAPASSFAPARPAMRDVSNNGTKSTSAPSTTARLFGHVAAPALKSR
                     YAAEAEEEDVDQMMKNMDALEERDQLAAQLALKREVKVKVYHCTVCEKKTRFFDVATC
                     REHRDSVKHVDSIMRYFRCKGCNRTNTSFDSLTPKHCEKSGCMSVAFERVTVADVTTA
                     AKPRKEDLVAVEGNVANRDALAPRGVEHGFRLDTIHNSA"
     gene            complement(<637497..>638780)
                     /locus_tag="OSTLU_93298"
                     /db_xref="GeneID:5003691"
     mRNA            complement(<637497..>638780)
                     /locus_tag="OSTLU_93298"
                     /product="Oxa1 family transporter: inner membrane ALBINO3
                     chloroplast"
                     /transcript_id="XM_001419826.1"
                     /db_xref="GeneID:5003691"
     CDS             complement(637497..638780)
                     /locus_tag="OSTLU_93298"
                     /codon_start=1
                     /product="Oxa1 family transporter: inner membrane ALBINO3
                     chloroplast"
                     /protein_id="XP_001419863.1"
                     /db_xref="GeneID:5003691"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR001708"
                     /db_xref="JGIDB:Ost9901_3_93298"
                     /translation="MSDSMTHLHAATGAPWFVALAASAALVRAATAPISARTIKASAT
                     VSAASALAKSRKRGNSEHVGVRDVLDAIGELRGKAPGTGAHPAWLVAGPLAQIPFFLC
                     AVMAVRRLAADGANNGLVTGGALWFQDLTVPAVDVAMMTAPMGPYGGILPVLTAAALF
                     ANVNANFASAAAQSRGMTIVKLVLEWMTLPMLVIGMQLPQAVHCYWLTSSAWALAQNR
                     ALSTTFAREALGINALAKVTREIAASQGLGGEDVAMSPEVLELVKAAAKERAGNNNAQ
                     AVNLLLRAARGGGDVAAALRGEDLGKSHPTVLFALGQTYAVLKEWKKSALTYEYSARA
                     EPDPLRRSRALMGAGVARARLGDLGMASEALYEANRLNPTDASVKVALASALKLNGDP
                     ERALEILREAAELQPDIDERYVKPLERELASRTSA"
     gene            complement(<639148..>640170)
                     /locus_tag="OSTLU_34689"
                     /db_xref="GeneID:5003869"
     mRNA            complement(<639148..>640170)
                     /locus_tag="OSTLU_34689"
                     /product="predicted protein"
                     /transcript_id="XM_001419827.1"
                     /db_xref="GeneID:5003869"
     CDS             complement(639148..640170)
                     /locus_tag="OSTLU_34689"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419864.1"
                     /db_xref="GeneID:5003869"
                     /db_xref="JGIDB:Ost9901_3_34689"
                     /translation="MPLECNSKVADLLSEMAKINQDALREVYKAKQYAAAASALRSLN
                     FEVQSIDQVDVIPMLKKRDGKIRKYVQEILTTGKLTALQSLRQRPDVKSCVELSGIHG
                     VGPVTARKLFDKGYKSLADLRAPGVPRDTLTPTQWIGLKYYEEFKQRIPREEVSHIAT
                     AVREAANTFMKDEVRCYCVGSFRRGKADSGDVDVLVECRDVSLANDLLMHILNDLRAG
                     SPSPRSGILTDDLQVGDVQYMGVAALQQPLRADDQAPPVHRRIDIKVYETDAFPTALL
                     YFTGSDKFNRSMRLWAKRKGYALQDKGLFRDRSEAAASRVRVRDEKDIFDALQLDYVA
                     PKDRNV"
     gene            complement(<640288..>641148)
                     /locus_tag="OSTLU_16920"
                     /db_xref="GeneID:5003870"
     mRNA            complement(<640288..>641148)
                     /locus_tag="OSTLU_16920"
                     /product="predicted protein"
                     /transcript_id="XM_001419828.1"
                     /db_xref="GeneID:5003870"
     CDS             complement(<640288..641148)
                     /locus_tag="OSTLU_16920"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419865.1"
                     /db_xref="GeneID:5003870"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="JGIDB:Ost9901_3_16920"
                     /translation="MGGKRRVSAVAKDGLGDDAERLVRALLSEDAATAGRRRRRRASV
                     GDEGTEATETLELPKSLRVRDLERVEATTSARGERAARRAESSEGATNESRSMNTSDC
                     ARNAAMFADAIGCGDVAVDDPYRALARCAAAANVGGDRSDDADDSEALVVDVSSLMKG
                     VHACFINIPSKRADALGRTLERMGGSVATSAADGGVTHVVASERNAPLTKALELIALE
                     DVITITPEWITESYKQNRALPVDAPEFAPRVLIRALPDRPHSQDTETSSEAERKALAA
                     RERKEHASAVA"
     gene            <642010..>642864
                     /locus_tag="OSTLU_93299"
                     /db_xref="GeneID:5003871"
     mRNA            <642010..>642864
                     /locus_tag="OSTLU_93299"
                     /product="predicted protein"
                     /transcript_id="XM_001419622.1"
                     /db_xref="GeneID:5003871"
     CDS             642010..642864
                     /locus_tag="OSTLU_93299"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419659.1"
                     /db_xref="GeneID:5003871"
                     /db_xref="JGIDB:Ost9901_3_93299"
                     /translation="MTTGANARARSGSNATTTARQTTTKQSAARTTTRDGGTSEGAKD
                     DGETTARRVKKKPGERRMTHAPSVMWFATLACGGARVWSSGAVGERALKASATARFGW
                     MDDVFSSAMGPALPLTCALARWFAASCVTEYDRGREGLVPLGTCAHIRADVEAYLYVA
                     ATRLLAYATLRRAWPSAFMSDHVFLAASVFTAVHGEVLSCAVDFLILVERREKPLRRT
                     AIMCVALYGVAVMAATCVEVFVTARFYHRGLETAVAAVLGWFVLQRPLVLAVVRPRAR
                     ELAAALAL"
     gene            <643871..>647024
                     /locus_tag="OSTLU_94768"
                     /db_xref="GeneID:5003692"
     mRNA            join(<643871..644152,644309..645127,645858..>647024)
                     /locus_tag="OSTLU_94768"
                     /product="predicted protein"
                     /transcript_id="XM_001419623.1"
                     /db_xref="GeneID:5003692"
     CDS             join(643871..644152,644309..645127,645858..647024)
                     /locus_tag="OSTLU_94768"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419660.1"
                     /db_xref="GeneID:5003692"
                     /db_xref="InterPro:IPR003612"
                     /db_xref="JGIDB:Ost9901_3_94768"
                     /translation="MRRDPRWASNAAAEYDANVGAKGREVNKLLVELKESQDKMAQKI
                     RDAEEATAWVDTIEGAKATMDKLPEYTLKAREASRRMQELRQRLEKVEARASDTFVAE
                     CAAERLEALVSACDANSEATFDRNECCVRLRELDSRDCFCNVNLGAVDFELRRRALPE
                     VLRAERLCDARLKFGNECAPLPRFPPLNVQPPPQAPSQAPQQPPRAPSTPPPPPAIVS
                     PAIISPIQATCSVDGLVTLIQAGCASIVDSTDSVLRQRVTSECCRALVKLNDERCFCS
                     EGDMIQELLREFPANFGGMFKAAPNVCGSTIVGGWQCLPFVDRTPPPSPPPPASPPPS
                     RAIQRAPLPPFIGRTFGLERDVVETITRDVQTRIRERRALIPYFNDARERPVYVGDAA
                     RAKIAARKVEDFLALPREETSDALRALRAIVEDGWATHEREGCGHARQWPEIFVAASA
                     LIREQFPQFGVASEILPGTGWGTESEAIDWVIRRPEKHIIASKIHFATRLHRDPDSWT
                     NPATTQRPRDGWPELSMPDRSRYQYRFINVHLTTSALDPTGNAWQSPLVVMLPRDGGA
                     REWAFVKRKLEMTSEGAKDENNFDDKLNIFDPKTWIIRGNRLTRGAYTKESKVKDDTD
                     TRGADGMTDAERDFEFPEVVSQDDQEFVSNGAIMFDSFDCWHGAAKWQEDKAFKKTLT
                     DVDPKGRQPFHSARCSIEMRFRVRIDMNAAGAEKLQWGPFTSAVRDGKFLDEPLRDSE
                     ARYDLARGRIVRATR"
     gene            complement(<647055..>647837)
                     /gene="FBP11-2"
                     /locus_tag="OSTLU_88325"
                     /db_xref="GeneID:5003693"
     mRNA            complement(<647055..>647837)
                     /gene="FBP11-2"
                     /locus_tag="OSTLU_88325"
                     /product="peptidyl-prolyl cis-trans isomerase, FKBP-type"
                     /transcript_id="XM_001419829.1"
                     /db_xref="GeneID:5003693"
     CDS             complement(647055..647837)
                     /gene="FBP11-2"
                     /locus_tag="OSTLU_88325"
                     /note="FKBP-type peptidyl-prolyl isomerase, probably
                     targetted to chloroplast stroma; closest relatives in
                     bacteria"
                     /codon_start=1
                     /product="peptidyl-prolyl cis-trans isomerase, FKBP-type"
                     /protein_id="XP_001419866.1"
                     /db_xref="GeneID:5003693"
                     /db_xref="InterPro:IPR001179"
                     /db_xref="InterPro:IPR001478"
                     /db_xref="JGIDB:Ost9901_3_88325"
                     /translation="MATTTFTTTRVGARVRASQSASPRARLRARASRASASSASDDVP
                     RVVAIEARKPLGLTLEQGARDRGAWIADVSADGNVAVEALDARRGDVVREVNGVDARG
                     MSLDEVVARLAEGPETASLKLARWPEGREMTNARDRAWLEANSREEGVVTLASGLQYR
                     AIKNGTGPGNIKMDTPCECHYAGTLIDGTEFDSSYKRGKPITFAPKQVIKAWTEAMRL
                     MREGDEWQLFCPSELAYGARGSGRFIKPGDALVFTISIERKL"
     gene            <647923..>652602
                     /locus_tag="OSTLU_16923"
                     /db_xref="GeneID:5003872"
     mRNA            <647923..>652602
                     /locus_tag="OSTLU_16923"
                     /product="predicted protein"
                     /transcript_id="XM_001419624.1"
                     /db_xref="GeneID:5003872"
     CDS             647923..652602
                     /locus_tag="OSTLU_16923"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419661.1"
                     /db_xref="GeneID:5003872"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="JGIDB:Ost9901_3_16923"
                     /translation="MARADDDDDYDDDVDDDDRGRGATYADAGARDDDDDDDYDGASE
                     DAMDASDDGDAYEDESESESEDDDYDEDVGKTKKRGKTGRTTRASGGAVVVVPTTTGR
                     GERGVKVASVNADDALRAQLSGKQDPMAFVISSSVPETGEVLKFTSLLHNARDGRTYA
                     AAFGDARRGAGEDDASKATNRRLDMEQREDDGGGSENDEDYDEDAEDGDEDDAAWFAK
                     VDENFPLERYATLNPTLSDDEDDDEYYADNEAARPALDVGEAEARMKPRRGESGLENE
                     EWERGVVWGADSDEDEEIRLAAVGIDTVGAFKKPRRGEETDLSSQVTVPSLPPATALA
                     SATSRSWGELDGESPSGGASSFDSAVSDYMRHLSLYGVVDEKQQSGDVDMTDANAARG
                     AGEMLRMRNHDFANGRWLGDVEWEGKPRQVIDPHRKYILPKVQVNPNDPRLVLQYKGD
                     LEATVWKWANAVMAPSWDLDPVNDIDEALNISMDDKYKEENEQTVDTGERPPRQGRID
                     GIQHAEFLLTSVPQLVRDPLNDYPAPRPMLRPPTVLPKHATASMKIKIAGSELQTFKV
                     CIKSLNIHSAVINLKVRGTDTIGSVIPRIRKRWTDLDGPIHLYYPGSPKPNEKLNEEM
                     TLVDAGLQAQVGLPIIYLVAPKVTFISEEAALAPLASDAVLAPPGAYKKPSDLSARSG
                     TLMMVQYTEARPPLIAKPGMGAKKVVYYRRKTLGDQGARPYANATTTVIDLKPNAPSP
                     FLAELPPGRGITALETSMFRAPLFQQAKSDDYVDFLLIRAPNGKLTLREAPSLHLAGQ
                     QEPHVEIPAPGSDMLKDFEERLVNATVLRYFLNLQAKGLIEPGTMPTVKSTDVAATLS
                     HALSVRDVRKNIRRKICAVRRGAEANEDEYVLNPSYRFEHEKEVQRMATPEEVCAYES
                     YRHAVAVLCKDRDRDEQERILRLSSLSLQQLKNAVTILIRHSEGKRKRQLENLELWLQ
                     IQPWAQTHEFLQASLGTKGILHLETSRRIQRLTGKFYNYIRRMTVPDPPEDRRPRREP
                     GTVTGTNADLRKLTMPQAQRILENFGVEKEVILRLERWKRIGLIRELSGAATADGTNS
                     HAGMARFARRLRVSEADQLKEIREHSDLLFKRQMKQYSQRHTRHEDSSSGGETDEDDS
                     SSDSESESDSLADELEKQLEEKAAKDAPNEEDERAELEALRNALKDGSSIEPSVDPMK
                     ALAQGILVPGKKLKLKRVSTHIFPDGRSAKVEDDITEYAGEAWLQARAQGVEAADAAT
                     TAALIACGMDKPPEPPKEALERKELDDEETGLTPEARARYEMLRQRKRAKERVRRAGE
                     KIKRLQSMGVTDEGADLANAQKSPGITPSERPAPVVPGPGGLKIKLGVSKKTMDKVFS
                     SGATPQKKSTLGRKLPWDKVLIKVTESAMKHGTYGQVFTPAVTLSDYAKFVEQPMDLG
                     AIMARLREGLYNDPSDWASDVKLIAVNAQAYHGSEEPVELRLDWVPGMAADMVNYIAD
                     QAKRHEADIKASFSDFSADSLRVARQGATAGGDSAPAEVKTEVPTEPAAPPKPLPKLK
                     FSFGKKS"
     gene            complement(<652744..>653160)
                     /locus_tag="OSTLU_33695"
                     /db_xref="GeneID:5003694"
     mRNA            complement(<652744..>653160)
                     /locus_tag="OSTLU_33695"
                     /product="predicted protein"
                     /transcript_id="XM_001419830.1"
                     /db_xref="GeneID:5003694"
     CDS             complement(652744..653160)
                     /locus_tag="OSTLU_33695"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419867.1"
                     /db_xref="GeneID:5003694"
                     /db_xref="InterPro:IPR001310"
                     /db_xref="JGIDB:Ost9901_3_33695"
                     /translation="MATPHDEVLAAQEAHLRGLDDADERTIFDKIVAKEIPATILYED
                     ALAMAFRDVNPQAKTHFLVIPKIRAGLTRLSKATEEHKTLLGHLMYTASVVAKQENLD
                     AGYRCVINDGVEGCQSVYHLHVHVIGGQQLSWPPGV"
     gene            653381..>654601
                     /locus_tag="OSTLU_33696"
                     /db_xref="GeneID:5003873"
     mRNA            join(653381..653402,653835..>654601)
                     /locus_tag="OSTLU_33696"
                     /product="predicted protein"
                     /transcript_id="XM_001419625.1"
                     /db_xref="GeneID:5003873"
     CDS             653852..654601
                     /locus_tag="OSTLU_33696"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419662.1"
                     /db_xref="GeneID:5003873"
                     /db_xref="InterPro:IPR007022"
                     /db_xref="JGIDB:Ost9901_3_33696"
                     /translation="MASESSESEDDGLRRRALAVDGEPDYSTGPPMDGFEYLRRVAFE
                     ARQTPDIMRAENMDLTALEEETATSGGVTADEETEFAPPAWAKPDRAWVRRTVGDFSD
                     LRVRLSRILARFPTSVRRGSYPSNADKRDWERFCVDVREPPLGALVAMDAVTCAYLLR
                     HISRGLFRYDYDSDGVDVDDVIRRLRWFHALVARVDLPLDADTEASIRSAMKGVARGR
                     LSTSSEDDELLPHLNLAIAIGGGYFKQWRGE"
     gene            <654890..>655159
                     /locus_tag="OSTLU_8897"
                     /db_xref="GeneID:5003695"
     mRNA            <654890..>655159
                     /locus_tag="OSTLU_8897"
                     /product="predicted protein"
                     /transcript_id="XM_001419626.1"
                     /db_xref="GeneID:5003695"
     CDS             <654890..>655159
                     /locus_tag="OSTLU_8897"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419663.1"
                     /db_xref="GeneID:5003695"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="JGIDB:Ost9901_3_8897"
                     /translation="GDTALHLACLLGEVDIVKALLSYGAELERRGASANRPIHLACSG
                     GFEDVVTTLILRGCCVNATNANGALPSALSQNFKHIKAIVRGVEQD"
     gene            complement(<655514..>657955)
                     /locus_tag="OSTLU_16926"
                     /db_xref="GeneID:5003696"
     mRNA            complement(<655514..>657955)
                     /locus_tag="OSTLU_16926"
                     /product="predicted protein"
                     /transcript_id="XM_001419831.1"
                     /db_xref="GeneID:5003696"
     CDS             complement(655514..657955)
                     /locus_tag="OSTLU_16926"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419868.1"
                     /db_xref="GeneID:5003696"
                     /db_xref="JGIDB:Ost9901_3_16926"
                     /translation="MAFDDDSDDESTPRTRADFDETTAAKGRRGEGAARGSPSTTTTM
                     CCDAPTPSGSMMTETIAKRMITLAREATRRDDETAKTKTKTKTKTKRGKKDDSDEDAM
                     NQKIWTRVKDTVRSAREAVREAKRARATRCAADVTARMEIDALTLRAWGAIEEIVESL
                     IEKRVGATRSRGSKKRAEGIRLAVRDGWFGDDDEVDVAEKYNASERACERLGDGAHGG
                     IIRLLDDFELVQCETTSASCDTRARRRCIKFHEDLFENPDVAATIRISGRLREVRSDA
                     LAPLGDDDEEDGGRQIEVGNIVAYQYSFVATVPEIRGFYLVTSTATYKLLKPKATYSM
                     LYNRSFQMRYDLARRTARALPRSPRSSLESIIPELLTRQPADVAALRMVNDRDAEGET
                     WTDYKIADVWACKTTLCNLCMNELDHLNRRSAQMISALMKKTHTMYDMIRETRDEFVM
                     SHQANVVDVLDEDLERIFGEGGWKSCADARPILSDARDEDTLATWIEEVKEKYNTKSC
                     IVEEALQVWEFCAEHADVLRLPLFSFHRFMRAVMCPVSKASWTLLRDVHCALIGQVTP
                     SISVIEQIVVEGRRADPTAAPTRVARFETELHVHAWPEIARELIDDEGNVMDVKLAAS
                     RASSLLAKADYFQLTPRMRLATMSALVALTLKQREFHRFLSDRRGEDEEGKPPRDNRD
                     EKSMIDNLERKCVLFDGYAHLTEEAVKDHPTIAQTRAEILHFLQISSHRWRRLDWLAT
                     HIVGLMKQCHTSSFVELRMVLWNFEVAVYNLQLLDAKKWDGCRQLWRSKVCASKTAGQ
                     LAQFAYTLLSNLPSM"
     gene            <658246..>659280
                     /gene="lhca2"
                     /locus_tag="OSTLU_33699"
                     /db_xref="GeneID:5003874"
     mRNA            join(<658246..658280,658608..>659280)
                     /gene="lhca2"
                     /locus_tag="OSTLU_33699"
                     /product="chlorophyll a/b binding, possibly photosystem I
                     light harvesting complex"
                     /transcript_id="XM_001419627.1"
                     /db_xref="GeneID:5003874"
     CDS             join(658246..658280,658608..659280)
                     /gene="lhca2"
                     /locus_tag="OSTLU_33699"
                     /codon_start=1
                     /product="chlorophyll a/b binding, possibly photosystem I
                     light harvesting complex"
                     /protein_id="XP_001419664.1"
                     /db_xref="GeneID:5003874"
                     /db_xref="InterPro:IPR001344"
                     /db_xref="JGIDB:Ost9901_3_33699"
                     /translation="MSVSMRISSTAGLKTRVATKTRASRGPVAVSANADRPVWYPGKA
                     PAAHLDGSLPGDYGFDPLSLSADPEMRQWMVQAELQHARWAMLGVAGCVAPELLTKIG
                     VADLPNWVDAATYQYWAPGGTLFFIQMAMFNWAEIRRWQDMKNPGSVNTDPLFGYNSN
                     DTNTDVGYPKGLFDKFGWAKDEKTTAELKLKEIKNGRLAMLAFLGICAQYVQTGVGPV
                     ENLFSHMGNPGQVGVFM"
     gene            complement(<659772..>660209)
                     /locus_tag="OSTLU_7955"
                     /db_xref="GeneID:5003697"
     mRNA            complement(<659772..>660209)
                     /locus_tag="OSTLU_7955"
                     /product="predicted protein"
                     /transcript_id="XM_001419832.1"
                     /db_xref="GeneID:5003697"
     CDS             complement(<659772..>660209)
                     /locus_tag="OSTLU_7955"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419869.1"
                     /db_xref="GeneID:5003697"
                     /db_xref="JGIDB:Ost9901_3_7955"
                     /translation="RVSVVFFSKSARLVTLANVIAEGARAVEGADVRVLRVRDTIRGE
                     DDASAYDRGILDCAVATPEDILESDCIIFGSPTRHGRMAPEMSAFFDRLAAFHSNGCA
                     LKGKIGSSFTEVGGAGQGYGGHEICLMTFHSFFLQHGMIAVGVP"
     gene            <660797..>661213
                     /locus_tag="OSTLU_94776"
                     /db_xref="GeneID:5003875"
     mRNA            <660797..>661213
                     /locus_tag="OSTLU_94776"
                     /product="predicted protein"
                     /transcript_id="XM_001419628.1"
                     /db_xref="GeneID:5003875"
     CDS             660797..661213
                     /locus_tag="OSTLU_94776"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419665.1"
                     /db_xref="GeneID:5003875"
                     /db_xref="JGIDB:Ost9901_3_94776"
                     /translation="MSSSGVVAEPANAELGPNDCLECGGRGVVACDMCGGTGKWKALN
                     RKRSKDTYEFTECPQCFGRGIRVCPVCFGTGERNVKGLLRRTEATELVKAMQRGELRP
                     GDVQALIEEGRSMNTERGGFDAAPAPAKPAAQREFL"
     gene            complement(<661368..>662318)
                     /locus_tag="OSTLU_33702"
                     /db_xref="GeneID:5003698"
     mRNA            complement(<661368..>662318)
                     /locus_tag="OSTLU_33702"
                     /product="predicted protein"
                     /transcript_id="XM_001419833.1"
                     /db_xref="GeneID:5003698"
     CDS             complement(661368..662318)
                     /locus_tag="OSTLU_33702"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419870.1"
                     /db_xref="GeneID:5003698"
                     /db_xref="JGIDB:Ost9901_3_33702"
                     /translation="MDVSRELTQTKASTARPSACLIVMCGKPCSGKSSVVSKLSERLR
                     APAPDGANAEVTIVDEASVNAGARNEAYENAAKEKMTRGALRSACDRILHAQGPCVIL
                     DSLNAIKGFRYELWCAARAAAARYCVVYVDASDERVAQMNDEAGESAYDETILRDLCF
                     RFEHPIANNRWDSPLFTFRPGLDAPGHEADLYDALCAHVRGDSSNTTKQARTLVPNKA
                     TQNSPLSGTNLRYEMDRAAQDVVETIMSAQQSNGGSCCSVYGFGEGMPTLRCARVLTL
                     AELRRRKRDFLQLASKSLKTTTHEGVKRLFIDELQRGLAA"
     gene            complement(<662623..664269)
                     /locus_tag="OSTLU_25095"
                     /db_xref="GeneID:5003849"
     mRNA            complement(<662623..664269)
                     /locus_tag="OSTLU_25095"
                     /product="predicted protein"
                     /transcript_id="XM_001419834.1"
                     /db_xref="GeneID:5003849"
     CDS             complement(662623..664239)
                     /locus_tag="OSTLU_25095"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419871.1"
                     /db_xref="GeneID:5003849"
                     /db_xref="JGIDB:Ost9901_3_25095"
                     /translation="MAMASSAASTTARAMPPSSSPSRGARRRARGARGGAQAKRGRGR
                     GRRPPHAVASDDEEAQWTPTGANATAPSNALALSRSDGGSQATTLTAARESEVDLFAR
                     FAHTHAELVARMMSNDDDGDDAKCMIYLRGSGGTTSMRLTRVAAWPRRGASTASTNKK
                     STLSFTGDWDEGGFDTDISENVDDDEDGASAIDWDAPEDTLASQKTFDLPSANAVVAC
                     LAYEESLIGLIVVERMGRDAVGDASVAFTKKQRKSLEVSASAFVDAWAIHRNNVVAVA
                     AAYRADQTVGGYLYESRQPLTALRTLGGMLKTYLKPDDPAGDMAEALVQQGDALAELS
                     VKLESALYPNSSIEQRGVLYGASGGRTDVSEKFLTDGTRARVTSNSMRTDALTVVSSD
                     EMCDVTKVVITLLATSDVVATSSGLAMRATLPESENPETVVYASPKDVRSALAQIIDL
                     ALMAAPRGAVIDVAVEEPYARDVQTGVGVEVKVDASLANGSVYVDTDAPSMRIARRLI
                     QRAGGVLECDNEPGGDTMAIRVRYPSREYA"
     gene            <664411..>665228
                     /locus_tag="OSTLU_33704"
                     /db_xref="GeneID:5003850"
     mRNA            join(<664411..664437,664635..>665228)
                     /locus_tag="OSTLU_33704"
                     /product="predicted protein"
                     /transcript_id="XM_001419629.1"
                     /db_xref="GeneID:5003850"
     CDS             join(664411..664437,664635..665228)
                     /locus_tag="OSTLU_33704"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419666.1"
                     /db_xref="GeneID:5003850"
                     /db_xref="InterPro:IPR005647"
                     /db_xref="JGIDB:Ost9901_3_33704"
                     /translation="MPSRGMSAEDKRITVLAMLHESREPWLLKDVEKAASKRGVVIQA
                     VKDVVQSLVDDDLVHVDKIGTMNWYWAFPGEATNKARAALEAAESTKAQMDAEIAALA
                     KGVAEEKKKNPVTAEHEEMSAGLSQARELNQKLHVELETFSSSNPETVDAMRQGAKIS
                     KQAANVWTDNVFMMKSWAENKMGDKEQVAQFFKTEGINLNTFDYIE"
     gene            complement(<665365..>666519)
                     /locus_tag="OSTLU_34792"
                     /db_xref="GeneID:5003699"
     mRNA            complement(<665365..>666519)
                     /locus_tag="OSTLU_34792"
                     /product="predicted protein"
                     /transcript_id="XM_001419835.1"
                     /db_xref="GeneID:5003699"
     CDS             complement(665365..666519)
                     /locus_tag="OSTLU_34792"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419872.1"
                     /db_xref="GeneID:5003699"
                     /db_xref="InterPro:IPR004971"
                     /db_xref="JGIDB:Ost9901_3_34792"
                     /translation="MVVAGKRRRSGEDAGDAGDVERADAPSTRDGGAADEDTGAVASS
                     TATKDDAARLVAQHYSGRANQTHQERKQSPIYRLRCLNNWVKSNLLQSKIRENDRVMD
                     LACGKGGDLKKYARAKIASYLGVDIALESVRRDAVKRYNAEHAREFPAKFVAGDAFVV
                     DLASVLPEYVRTLDVISCQFAIHYSLSTEERARRALRNVCTMLRPGGYFIGTTVDSNV
                     LVRKLREADGLAFWNPVYEVEFDDAFKSKVFPTNQTDGFGIEYTFTLADAVTKCRECM
                     VPKDVWVSLAAEYGLELVEWRNFHDYVHSQLSGVETRERASALWSQIMGDDSMSMTDE
                     EWEAAYLYTTFVFRKSGSAEAAASAVFNRKPPAAPARIEQDDVLVLEGAA"
     gene            666657..>667149
                     /locus_tag="OSTLU_33706"
                     /db_xref="GeneID:5003851"
     mRNA            666657..>667149
                     /locus_tag="OSTLU_33706"
                     /product="predicted protein"
                     /transcript_id="XM_001419630.1"
                     /db_xref="GeneID:5003851"
     CDS             666709..667149
                     /locus_tag="OSTLU_33706"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419667.1"
                     /db_xref="GeneID:5003851"
                     /db_xref="JGIDB:Ost9901_3_33706"
                     /translation="MSRVSTLNLTSKLVNCAALKRTSRHAPTAARSIKTMASIEITKG
                     VTFDTVAREWRCKWSEDADKASLAAAQKVLDKHLPAMKAKGKVQRTVCGGCLDFKANT
                     SMSADAFGAWEAEGFAPEKQFLEELAAIPGISSIETQTFTLMSM"
     gene            <667940..>668878
                     /locus_tag="OSTLU_34809"
                     /db_xref="GeneID:5003700"
     mRNA            <667940..>668878
                     /locus_tag="OSTLU_34809"
                     /product="predicted protein"
                     /transcript_id="XM_001419631.1"
                     /db_xref="GeneID:5003700"
     CDS             667940..668878
                     /locus_tag="OSTLU_34809"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001419668.1"
                     /db_xref="GeneID:5003700"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="JGIDB:Ost9901_3_34809"
                     /translation="MFHDGDTSRGVHFVQLSHREAVAFAQRETKLLFVYLHAPAHHES
                     ELFCAQVLADPTMTAYVNQNFVAWGGNVRDGDAFSLSAGLKPTGYPCVAILDSVSGGS
                     GSASLVMSCEGFIDVDVLISACEEALAGQNASLDDARARHAEVDASRRLREEQDAAFA
                     ESLARDAARARELDAQREAEEAERRRVEEERRAVEEETKKAEEAERQRVEEIEARRAS
                     KASKLRDEPADGADGVSKLAVRLPDGSRAERRFHSTDTIADVYDFVDTLEELDEVSYS
                     LVTNFPRRTFARSERVSLVDAGVHPNGAMFVQTESS"
CONTIG      join(CP000589.1:1..670853)
//
DBGET integrated database retrieval system