GenomeNet

Database: RefSeq
Entry: NC_009365
LinkDB: NC_009365
Original site: NC_009365 
LOCUS       NC_009365             593542 bp    DNA     linear   CON 19-JUL-2017
DEFINITION  Ostreococcus lucimarinus CCE9901 chromosome 11, complete sequence.
ACCESSION   NC_009365
VERSION     NC_009365.1
DBLINK      BioProject: PRJNA19407
            BioSample: SAMN03081420
            Assembly: GCF_000092065.1
KEYWORDS    RefSeq.
SOURCE      Ostreococcus lucimarinus CCE9901
  ORGANISM  Ostreococcus lucimarinus CCE9901
            Eukaryota; Viridiplantae; Chlorophyta; prasinophytes;
            Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus.
REFERENCE   1  (bases 1 to 593542)
  AUTHORS   Palenik,B., Grimwood,J., Aerts,A., Rouze,P., Salamov,A., Putnam,N.,
            Dupont,C., Jorgensen,R., Derelle,E., Rombauts,S., Zhou,K.,
            Otillar,R., Merchant,S.S., Podell,S., Gaasterland,T., Napoli,C.,
            Gendler,K., Manuell,A., Tai,V., Vallon,O., Piganeau,G., Jancek,S.,
            Heijde,M., Jabbari,K., Bowler,C., Lohr,M., Robbens,S., Werner,G.,
            Dubchak,I., Pazour,G.J., Ren,Q., Paulsen,I., Delwiche,C.,
            Schmutz,J., Rokhsar,D., Van de Peer,Y., Moreau,H. and
            Grigoriev,I.V.
  TITLE     The tiny eukaryote Ostreococcus provides genomic insights into the
            paradox of plankton speciation
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 104 (18), 7705-7710 (2007)
   PUBMED   17460045
REFERENCE   2  (bases 1 to 593542)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (22-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 593542)
  AUTHORS   Grigoriev,I., Grimwood,J., Aerts,A., Salamov,A., Zhou,K., Lou,Y.,
            Pitluck,S., Schmutz,J., Myers,R.M., Lucas,S., Detter,J.C., Glavina
            del Rio,T., Putnam,N., Rokhsar,D. and Palenik,B.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (21-FEB-2007) US DOE Joint Genome Institute, 2800
            Mitchell Drive B100, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP000591.
            URL -- http://www.jgi.doe.gov/ostreococcus
            JGI Project ID: 3436080
            Source DNA was provided by Brian Palenik (bpalenik@ucsd.edu))
            Stock culture is available from CCMP (http://ccmp.bigelow.org/) as
            strain number CCMP2514
            Contacts: Brian Palenik (bpalenik@ucsd.edu))
                      Igor Grigoriev (ivgrigoriev@lbl.gov)
            Annotation done by JGI-PGF
            Manual curation done by the Ostreococcus User Community
            Finishing done at Stanford/JGI, Stanford Human Genome Center
            (www-shgc.stanford.edu)
            The finished chromosome has no gaps. The sequence has less than one
            error in 100,000 bp.A
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. It is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376)
            Additional Note: Transposon sequencing failed to verify the number
            of repeat copies 42140-47990.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..593542
                     /organism="Ostreococcus lucimarinus CCE9901"
                     /mol_type="genomic DNA"
                     /strain="CCE9901"
                     /db_xref="taxon:436017"
                     /chromosome="11"
     gene            complement(<853..>2406)
                     /locus_tag="OSTLU_26328"
                     /db_xref="GeneID:5004275"
     mRNA            complement(<853..>2406)
                     /locus_tag="OSTLU_26328"
                     /product="predicted protein"
                     /transcript_id="XM_001420353.1"
                     /db_xref="GeneID:5004275"
     CDS             complement(853..2406)
                     /locus_tag="OSTLU_26328"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420390.1"
                     /db_xref="GeneID:5004275"
                     /db_xref="InterPro:IPR004263"
                     /db_xref="JGIDB:Ost9901_3_26328"
                     /translation="MNRRRRAEDGDDIEAVVERRVSSKKARPPARTTFLRRITFALTT
                     ALVTFACVKNDLYANMRKPEVYKVVDAGRGTVRWAIEERVSAWNGVGAHAAKFPDEFG
                     LRRVQSMCDEIAVGSLSATYWPLNVNSSGFSDSRALCEALNDLPGTLRLYTLKTPRVT
                     RLKYAFAEKIPTFNRGYGVETYLAREIERGPFATRSFKDATAIFIPVRPYLQRLLTAE
                     AYVMAGPAKGSNNNGAIRQAIRDRLSRDIERVKAINAEAWTSKQKCARVVMTNIDIGL
                     SAFDSSDDEVRHGAVVITGNSELPIQNSEDAKDDEARARRANAVQAGFDPARHVAIWF
                     GISSHLPREVVRMGALKSTNVRTIEVSFRGSMHRGGVRRVVFPTLKQAEAGRGWDLST
                     SGQDKPRDYMTMLSKSKYCLYVYGDRAHTARLYDIITFGCVPVIVADGYDLPFSWLFD
                     WSKFSVRVLEDDVATLPSILDRADYDSLRRELVKVHSFFQYHNRGSIFGDAFWITMLG
                     VRRQLAKCT"
     gene            <3013..>3960
                     /locus_tag="OSTLU_5433"
                     /db_xref="GeneID:5004295"
     mRNA            <3013..>3960
                     /locus_tag="OSTLU_5433"
                     /product="predicted protein"
                     /transcript_id="XM_001420194.1"
                     /db_xref="GeneID:5004295"
     CDS             <3013..>3960
                     /locus_tag="OSTLU_5433"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420231.1"
                     /db_xref="GeneID:5004295"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="JGIDB:Ost9901_3_5433"
                     /translation="GAGLANLGNTCFLNSVLQCLTHTPALANFALRGEHKKYKTGGSF
                     NALYEIGEHVARALNSSGRTIAPTALVKNLRALSKTFRKGRQEDAHELARCLLDAMHK
                     KCVEVVKPKISPNSARAETSFVWKVFGGRLRSQVNCKTCGRNSETFDPFLDLSLEVGR
                     AKSVLGAFKMFTHTEVLDGDNKYRCEGKSANSKSHLTKASKQFTVNQAPNVLALQLKR
                     FAYVPFGRGKLNHFVEYPLELDITPYTSDEGLTSRGKAVYDLYGVLVHAGNSSNSGHY
                     YCFVKVATGTWCLMDDDEITSVSEKVVLKQQAYLLFYARR"
     gene            complement(<5346..>6492)
                     /locus_tag="OSTLU_17201"
                     /db_xref="GeneID:5004418"
     mRNA            complement(join(<5346..5389,5505..>6492))
                     /locus_tag="OSTLU_17201"
                     /product="predicted protein"
                     /transcript_id="XM_001420354.1"
                     /db_xref="GeneID:5004418"
     CDS             complement(join(5346..5389,5505..6492))
                     /locus_tag="OSTLU_17201"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420391.1"
                     /db_xref="GeneID:5004418"
                     /db_xref="JGIDB:Ost9901_3_17201"
                     /translation="MRGRKMHECDKLATSWIDEQRGAHERRVRARDDDAQRRFLYFLH
                     IPRTAGRSFHWCFLKPSFKDHELCGNQYTGLRIDPREPTCEFLATHDDYSLIERFTEQ
                     PRVVTMLRKPSARALSSYEFSIEVAARSFGKEPVNTTRVQTRDVWPWSVLTRFMDDEL
                     RSYDDAVNADGRNELSISNVYDNALYTPFEDWAEMKMVHDDIHNGQFFQLLGLTNNTD
                     DAVEPRAAELRECALWRGTKASKMMMDYAKERLEHEVDVLALHERLDESIELAARQLD
                     LPLSANANFADPTQIDAQNVKSRISKVGTSFKSDDASDCVDVVGFSFRFSKLKTMTTG
                     QRILKGFTS"
     gene            <7068..>7274
                     /locus_tag="OSTLU_26331"
                     /db_xref="GeneID:5004296"
     mRNA            <7068..>7274
                     /locus_tag="OSTLU_26331"
                     /product="predicted protein"
                     /transcript_id="XM_001420195.1"
                     /db_xref="GeneID:5004296"
     CDS             7068..7274
                     /locus_tag="OSTLU_26331"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420232.1"
                     /db_xref="GeneID:5004296"
                     /db_xref="JGIDB:Ost9901_3_26331"
                     /translation="MAGAHSADVVARALALAAEARGDGERKRTNALLEGALKQYVSEL
                     DEFRAVCERLKERETAGGGAATTN"
     gene            complement(<8231..>10126)
                     /locus_tag="OSTLU_44250"
                     /db_xref="GeneID:5004537"
     mRNA            complement(<8231..>10126)
                     /locus_tag="OSTLU_44250"
                     /product="predicted protein"
                     /transcript_id="XM_001420355.1"
                     /db_xref="GeneID:5004537"
     CDS             complement(<8231..10126)
                     /locus_tag="OSTLU_44250"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420392.1"
                     /db_xref="GeneID:5004537"
                     /db_xref="JGIDB:Ost9901_3_44250"
                     /translation="MTRAVPSIDARARAHATQTRRRPRRAHLYHPSTRARSSTAPRAF
                     LDRLSGNATATGDKQQRDLFAQTKRAEVRIPGFLAYVDVDEATSTRGAEVVDAVLHAG
                     ATCVALREYGVDGTGGGNSGKKLYEAATTLKTLVRGRACVLIVDRTDIAASAELDGVV
                     LTDDGVPTVVARKALPETAVVAHESESAEEAEKASKEGADLLLVRDVAMLEAIRQSVS
                     VPIFVDAADGLGALASENSSTLQDLAAKGANGVTIRNLTKDPASGDEALLQSAVRAVA
                     NALEQSYEALGDSKGANGSAPQVTPKKFSLVSADGEEMIERERQLVEEILKFLRENCT
                     DLDEIKLLAEARKGLEDLFLVVICGEFNAGKSSVINAMLGDKFVAEGILPTTNEIAVL
                     RYSSKKSREQTEDGFFNVGIPAELLQQMRIVDTPGTNVILQRQQRLTEEFVPRADLVL
                     FVLSADRPMTESEVKFLTYIRKWGKKVVFVVNKTDLLSDLGDVDEVVAFVKENATRLL
                     SVSDPAVLPVSSRNALKAKKADSSNYANSRAFVESGFGKFEDYVMSFLGGSGERAGEA
                     LRLKLSTPLNVSELLLNAAEQILEGEDEEAKSEVAMATGVTSQMESYRQEMITDAAAQ
                     RAAAREVV"
     gene            <11078..>11407
                     /locus_tag="OSTLU_9648"
                     /db_xref="GeneID:5004297"
     mRNA            <11078..>11407
                     /locus_tag="OSTLU_9648"
                     /product="predicted protein"
                     /transcript_id="XM_001420196.1"
                     /db_xref="GeneID:5004297"
     CDS             <11078..>11407
                     /locus_tag="OSTLU_9648"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420233.1"
                     /db_xref="GeneID:5004297"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="JGIDB:Ost9901_3_9648"
                     /translation="GILTERDYLNAVARGFISASTKVSEVMTSFRDASKKIAKLVSVS
                     PEDSVLAAMESMTNNRLRHIPVIASKGVNPKDQSPIEPRVLGVVSIGEVLKALLAESR
                     SEISHLES"
     gene            complement(<11576..>12115)
                     /gene="MCS"
                     /locus_tag="OSTLU_44114"
                     /db_xref="GeneID:5004538"
     mRNA            complement(<11576..>12115)
                     /gene="MCS"
                     /locus_tag="OSTLU_44114"
                     /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
                     synthase, putative chloroplast precursor (MECPS)
                     (MECDP-synthase) (ISPF)"
                     /transcript_id="XM_001420356.1"
                     /db_xref="GeneID:5004538"
     CDS             complement(11576..12115)
                     /gene="MCS"
                     /locus_tag="OSTLU_44114"
                     /codon_start=1
                     /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
                     synthase, putative chloroplast precursor (MECPS)
                     (MECDP-synthase) (ISPF)"
                     /protein_id="XP_001420393.1"
                     /db_xref="GeneID:5004538"
                     /db_xref="InterPro:IPR003526"
                     /db_xref="JGIDB:Ost9901_3_44114"
                     /translation="MRARAEATVDGAAPVLPFRVGHGFDLHRLESTAEFPELKLIIGG
                     IEIPHDRGCVAHSDGDVLMHCVVDAITGALGLPDIGQLFPDTDPKWKGQTSDVFVKEA
                     VRLMKLEGYSIGNLDCTLIAQRPKISPHKDNIRANVAKVLGVHEAVVNVKAKTHEKVD
                     SLGENRSIACHTVIMLIKD"
     gene            <12515..>13195
                     /locus_tag="OSTLU_26335"
                     /db_xref="GeneID:5004298"
     mRNA            join(<12515..12534,12751..>13195)
                     /locus_tag="OSTLU_26335"
                     /product="predicted protein"
                     /transcript_id="XM_001420197.1"
                     /db_xref="GeneID:5004298"
     CDS             join(12515..12534,12751..13195)
                     /locus_tag="OSTLU_26335"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420234.1"
                     /db_xref="GeneID:5004298"
                     /db_xref="InterPro:IPR006662"
                     /db_xref="JGIDB:Ost9901_3_26335"
                     /translation="MAMRCLSSKTTTPTTAFAARRRQTTAKRQLRVRAGEGETDGNVK
                     FANNKPEFEAVSAAAGSGLVAVQISTKTCGPCKMIYPTFVGLSQELPKVTFVKIMGDT
                     DLESRALMKEWGVRVVPLFLLFRNGERVGEWSGAKADILKENVRAACNADEK"
     gene            complement(<13291..>15063)
                     /locus_tag="OSTLU_26336"
                     /db_xref="GeneID:5004539"
     mRNA            complement(<13291..>15063)
                     /locus_tag="OSTLU_26336"
                     /product="predicted protein"
                     /transcript_id="XM_001420357.1"
                     /db_xref="GeneID:5004539"
     CDS             complement(13291..15063)
                     /locus_tag="OSTLU_26336"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420394.1"
                     /db_xref="GeneID:5004539"
                     /db_xref="InterPro:IPR000991"
                     /db_xref="InterPro:IPR006062"
                     /db_xref="JGIDB:Ost9901_3_26336"
                     /translation="MRAAPVASPARTARARGLRLAARARGDGCAVTRRAVTRSPVRRG
                     RGRANATHATNAAKEPVYLLDYGAGNVRSVRNAVTALGFEVRDVKTPKDLSEAKKLIF
                     PGVGAYGSAMDILRERGLIEPLREYVRADKPFLGVCLGLQLLFDGSEESGGVEGLGLI
                     PGSVDKFRGEGLIVPHIGWNLTNTKKSSGLMDGMESERVYFVHSYRATPTEANKDWVL
                     ATCDYGGEFIASVQKGNVMACQFHPEKSGATGLGVFQRFLEDAKPTGQFGTAPSVTNG
                     LARRVIACLDVRSNDSGDLVVTKGDSYDVREKDEGGDVRNLGKPVELAGKYFKQGADE
                     VAFLNITGYRDLPLTDAPMLEVLRRSSETVFVPLTVGGGIRDFTDSNGKSYTALEVAS
                     AYFASGADKVSIGSDAVYVAEDWYASGKVNTGKTSVEQISERYGVQAVVISIDPRRQY
                     VADPSMTKNKCVETSRPGPNGEKYVWFQCTVKGGREGRDIGAYELAIAMEALGAGEIL
                     LNCIDEDGQGNGFDHELVNLVSDAVGIPVIASSGAGCPEHFTNVFNVTKCSAALAAGI
                     FHREEVLVSEVKAHMTSNGLPTRA"
     gene            complement(<15257..>15619)
                     /locus_tag="OSTLU_9112"
                     /db_xref="GeneID:5004299"
     mRNA            complement(<15257..>15619)
                     /locus_tag="OSTLU_9112"
                     /product="predicted protein"
                     /transcript_id="XM_001420358.1"
                     /db_xref="GeneID:5004299"
     CDS             complement(<15257..>15619)
                     /locus_tag="OSTLU_9112"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420395.1"
                     /db_xref="GeneID:5004299"
                     /db_xref="InterPro:IPR011421"
                     /db_xref="JGIDB:Ost9901_3_9112"
                     /translation="EQNARFTETRNFAGKMVEVETEIVEGSKEAKARSKRVEMLAKGG
                     LDAVLAELMEPKKLNVLDKTKADWRGVKDVDVELQEDLQHHQRGGRTYREHQDFLQQA
                     DYREYELERDARLAAQSKR"
     gene            <16477..>17610
                     /locus_tag="OSTLU_4215"
                     /db_xref="GeneID:5004300"
     mRNA            join(<16477..16623,16687..>17610)
                     /locus_tag="OSTLU_4215"
                     /product="predicted protein"
                     /transcript_id="XM_001420198.1"
                     /db_xref="GeneID:5004300"
     CDS             join(<16477..16623,16687..>17610)
                     /locus_tag="OSTLU_4215"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420235.1"
                     /db_xref="GeneID:5004300"
                     /db_xref="InterPro:IPR006145"
                     /db_xref="JGIDB:Ost9901_3_4215"
                     /translation="RYCAPYDFDFVCGVKARWAGRRLCDLFASEFPMRPKEYYVKAHA
                     MGRLCAREHEDGPMLAGGNRVRHFIHRHEPPVMADEVRVLTVNDDVVSVWKPATVPVH
                     PTGQYRRNTVLALLAASRRDLGRLFPIHRLDKNVSGLLLLARSSEAANEMRVKMEARE
                     MRKEYVARVRGAFNDGDATPVSNVESLGFDSKGRVAIWRGKKGVTDLDERTLKSFKDA
                     STKFTCIKTLVDGTSLVRCEPFTGRSHQIRAHLAMLGYPIANDVAYGGALVEVERARA
                     IQHACDVTVLNEAGELVKDESLAIDYSAPRKSREQSSDLCPHCPRIVHAGDQAIDLEA
                     IWLHCVRYSGEGWEFECPMPDWA"
     gene            complement(<17634..>18644)
                     /locus_tag="OSTLU_17209"
                     /db_xref="GeneID:5004540"
     mRNA            complement(<17634..>18644)
                     /locus_tag="OSTLU_17209"
                     /product="predicted protein"
                     /transcript_id="XM_001420359.1"
                     /db_xref="GeneID:5004540"
     CDS             complement(17634..18644)
                     /locus_tag="OSTLU_17209"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420396.1"
                     /db_xref="GeneID:5004540"
                     /db_xref="InterPro:IPR001330"
                     /db_xref="JGIDB:Ost9901_3_17209"
                     /translation="MSSLADEVTTIAFESLAVDAHASFIVNASASEDTLEHAFTEHLR
                     LSGIYWGVCALATMGNLRKTMDADKREEILSYVASCRCESGAYSGGAGHDGHVLYTLS
                     AVQIYALFDAMDRIDRDSVVNYVKGLQLADGSFQGDEWGEVDTRFTYCALSTLRLLDR
                     LHEVDVEAACAYINKCKNFDGGFGATPGGESHAGQVFTCVGALAIGNRLDYVDGDLLG
                     WWLAERQVKVGGLNGRPEKLPDVCYSWWVLSALSILGKTHWIDRGALARFILRCQDET
                     SGGISDRPDDEPDVYHTFFGIAGLSLMGHPAVVEPIDPVFALPNSVLKQLGIEPWSAR
                     KC"
     gene            complement(<18756..>21620)
                     /locus_tag="OSTLU_26340"
                     /db_xref="GeneID:5004301"
     mRNA            complement(<18756..>21620)
                     /locus_tag="OSTLU_26340"
                     /product="predicted protein"
                     /transcript_id="XM_001420360.1"
                     /db_xref="GeneID:5004301"
     CDS             complement(18756..21620)
                     /locus_tag="OSTLU_26340"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420397.1"
                     /db_xref="GeneID:5004301"
                     /db_xref="JGIDB:Ost9901_3_26340"
                     /translation="MTLARDARTRGAEREGDDAETQSRGKKRARRKRDDAGRRDARTT
                     FGGFATLPTELVVKIMKELDGYSLAMATCACKDFEATGRENDELWLELLIKLEPRALM
                     REDLMQNGSGKFRAFSYKELFMWRLHTLKGCAMMNTKAYAEMAARGDATRALSADASG
                     PSSSELRSKIGHLGRLAVINQEQLFTCDPRPKGGLIYNVYDSGMNSFVPHTLLWSPRS
                     ELLACAFLVNGAESKTCHSKIILSAPKAVLTGQLKFARGDALTNTNAEVSTPRHGRHP
                     YEAPPMNNIIALPHGLQCAHMAFAPCGTMLNILHKDRMESSLYTLDCAISITSLYGPS
                     NGKSGTSPVPPPSEHVTRVASGTDSIRFAISPIDNNSLLMFGDQREIMLLRKQGIRGG
                     AIPLSDRWPGTRAFDEVSSDDDSLYASDGFEREYEMPPDAVDVPRSLNHSLTSANSNA
                     AHPACDTASEPLESAFQDDIHERATRDCQEVVSTPKMTWWQQLSRNILAGVKSATLGA
                     RGNEKPSTSAKRDEDSEHGALKRIKDSANSIDRSDWSCLKAGTWWSNIPNFRKLTDIL
                     VKEHAKQPLARLYTDETAKRIEWVPSKRGDVNGRGFWLLPSSIPERYDDDHDTAYYAF
                     LVMVPVPSEKAIKERKIKPFISGDDDELFQNISECVITEISPAPAYAEPNIVARFLYA
                     GRAGGRQVVWSTVDGLFVRCVDFNLDAEGDWMGPPTLGPMMQVIDFTSILNGANRWNK
                     SYDEVSVRNYASWNGSRQVPVLSVVNEVLRYTIEVIQWSPSGERLLILMAVHLAYEEP
                     VQAGEYYTVHQWICWDPPPVMSDDSEKALHRVPAGECHGVLSFGSRFIPSQTFRSECS
                     EKMDNLSGGINLWSPEETAIAFGIQVPRVVPTHESSDYIVIQNFPRVNFDEIERRSLT
                     GEAPPLQQDGSVASLPYHLNYVDSALEYVCEGTYCSWSPT"
     gene            complement(<21962..>25360)
                     /locus_tag="OSTLU_25190"
                     /db_xref="GeneID:5004302"
     mRNA            complement(<21962..>25360)
                     /locus_tag="OSTLU_25190"
                     /product="predicted protein"
                     /transcript_id="XM_001420361.1"
                     /db_xref="GeneID:5004302"
     CDS             complement(21962..25360)
                     /locus_tag="OSTLU_25190"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420398.1"
                     /db_xref="GeneID:5004302"
                     /db_xref="InterPro:IPR007279"
                     /db_xref="JGIDB:Ost9901_3_25190"
                     /translation="MTTLDDVDALDAVVRDAFARTNDARATAKAADASRALDALKRDA
                     RAWAVCLRAYSRTTSSETKFWCLQTLTEALAKEARGGGTTMSDEDAETLRRALGACVS
                     EATGESATGGDGGDDRRSSAATAASSTSTPAFVKNKLAQACAYAVALEYPERWPSFFA
                     DLANLLSRGTQGVDMFTRVLEAIDEELIATVDAGRAGKEDFARSMRIKEAMRADGSLR
                     LVFDAWRQCLEHYARVDPRVATRVWSVARRYVEWVDVGLVASEEYVKGAKECLMLDDL
                     SGAADESLRAAAVGYLHAVITKGMETSAKVRLIISTKIVEVCARLQVICAATQDDFDE
                     EFVTQVTNLAAAVAAELLNANKVENITALGVELSAEVSSSLHQVTPLVLSSISFKHER
                     AVLVALPFLTAYIGYMKSQPALLNAAQPALTSACQALIARGAFPTEHIDGLDWNDGSN
                     ALTQEFEADVFSLRAELNVQLKNIARLAPHLAREVVRQVLMSAVVGSGEGNQLCWQNV
                     EVAISALFTLGEGADDAAVKPMSIADRAKATNGTGEVTDTPLGALVVSLIREWGTSVG
                     RAAYHRLVAPTFLEICVRYHAVLERDDAALVAALTAFLDERGIGHVDLAVRSRACYLI
                     SRLSRPLRCKLSDKVENIMCVLPAYLTEFARSLPEPATQNAAFVSVSAAGIQSRAMAE
                     SGNDDRLYLFEAFGTMLGADEVKEEEQYRYLSQIAAGLCRQIEEVAAGGQSGEDAPIR
                     IALATRAIVAFGNISKGFSQRTCLTSRPRTGEVFRSCLEMSLRCLDVWPRDASVRNRA
                     TGFLHRMIDLLGPTVTPYLAPTVHKLRRDADAVELRETLVLFNQLASTYAAELAPFVV
                     EVLPGLAAQIFNTISSAYAQASVESVGGSIATNTEVVREADELERMWLTTTAALGANA
                     LIAPTFTGYPNTKRTAPLREQLLSHLVQAAQSHGMVSARKVALTALKSFVEEWTLDTS
                     PDEPPSLEGAPTSSAPAKGPRDERVPGFTRFVVERVCVECCILPPIRGDLDLSDAVSV
                     GALNESFAILAVVHARQSDALTTALTHIFRHSILPSHSPDRIDAIVNEYIRVLAAAAA
                     AGKPHLRSTKPARALVDAVRREIGAAPDRGRTLDLTPRLAKRGV"
     gene            <25942..>26526
                     /locus_tag="OSTLU_44260"
                     /db_xref="GeneID:5004303"
     mRNA            <25942..>26526
                     /locus_tag="OSTLU_44260"
                     /product="predicted protein"
                     /transcript_id="XM_001420199.1"
                     /db_xref="GeneID:5004303"
     CDS             25942..26526
                     /locus_tag="OSTLU_44260"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420236.1"
                     /db_xref="GeneID:5004303"
                     /db_xref="InterPro:IPR004895"
                     /db_xref="JGIDB:Ost9901_3_44260"
                     /translation="MSVDAASASAGAGVFGAVGRVKESAQHVWAQQKPMSEILDASAY
                     ARPVSFGDATSRMQKNLNYFRINYLVFASAVLSLFVLFHPSSLAIFGSVAAAWVYVFS
                     VRSEPLKIGDRELSHRETLMGMSALSAFVIFMLTSAGTVLFSGLGVALLGVGAHAAAR
                     VPDDLFVEDANDNKGFFSFLEPPSRNGQVSSGTV"
     gene            <26961..>27428
                     /locus_tag="OSTLU_8994"
                     /db_xref="GeneID:5004541"
     mRNA            join(<26961..27176,27246..>27428)
                     /locus_tag="OSTLU_8994"
                     /product="predicted protein"
                     /transcript_id="XM_001420200.1"
                     /db_xref="GeneID:5004541"
     CDS             join(<26961..27176,27246..>27428)
                     /locus_tag="OSTLU_8994"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420237.1"
                     /db_xref="GeneID:5004541"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="JGIDB:Ost9901_3_8994"
                     /translation="VRSVMTSRVLTVRPDESVFEAMKLLVDNRISAVPVVNASGEVLG
                     VVSEYDLMARVGKKETTKSVADDGMFPRRMYKASGSKVSTAMHEATTCTPDMPLVEAT
                     ELMLNGNLARMPVVDDRGALVGILSRGDIMR"
     gene            <27781..>30039
                     /locus_tag="OSTLU_44147"
                     /db_xref="GeneID:5004276"
     mRNA            join(<27781..29193,29308..>30039)
                     /locus_tag="OSTLU_44147"
                     /product="predicted protein"
                     /transcript_id="XM_001420201.1"
                     /db_xref="GeneID:5004276"
     CDS             join(27781..29193,29308..30039)
                     /locus_tag="OSTLU_44147"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420238.1"
                     /db_xref="GeneID:5004276"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="JGIDB:Ost9901_3_44147"
                     /translation="MPRAESKAGGGAKARRAAKRTNKFNPSAAAAAPALVNVGDASQY
                     DDERAIELERRKKSNVKQGKKLGKRKKGATSDKETGSSEDAAPKKKRSDAAANAEKVD
                     FSKLSRKEAKAKSDEMKALRKPNFALVQELAQIWERMRGKKVSKTDRSAMCDEIYKKC
                     VGKVPELANNHKGSRVVQAVLKYGTTEQCAKIMSEVTPQMALLSKSLYGNFLVRKLID
                     AADKKEIPALVGNLRGQIARLARHPVGSQIVEALFHAASAKEKKAMTFEFYGPEFVHF
                     GAADDVKSLREALLLKPVAQRQGMLRHINVTMIPVLEKGLVSSSVIHRVLAEYLSVGG
                     PSTKAEAAGSIAAAGLLRMMHTKDGAHAVNMILAHSGAKQRKGVIKALKGQVSRVSQD
                     DYAHVVIASLFDCVDDTQLLGKGVVSELKAESLAEVASHKNARRVLLHILNPRSTRYF
                     PSHLLECMPDPQKVREDAEETFGGEDEEEAPEGDDDDDDDDGLEEAPADGPDFGIAKK
                     PASTRRAELFHQGLGDSLVAACSVNAASMLRSNLASDVLFEVAAGGCDDIFYKTVGDK
                     KMTDLFEAISEAVATSMTSEQIDAELGEKLEPLHANFFSTRTLRRMALEVKHAQFVPI
                     FWKSALKANLKTWIDGHGAKVVAAVVRTKTDAKTRKEIHAAVGKLVDSGDAAAWSEGF
                     FRVKDGDKPRNSAGKDEQPTSKKAKKAKKASK"
     gene            complement(30074..>31096)
                     /locus_tag="OSTLU_26345"
                     /db_xref="GeneID:5004277"
     mRNA            complement(30074..>31096)
                     /locus_tag="OSTLU_26345"
                     /product="predicted protein"
                     /transcript_id="XM_001420362.1"
                     /db_xref="GeneID:5004277"
     CDS             complement(30155..31096)
                     /locus_tag="OSTLU_26345"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420399.1"
                     /db_xref="GeneID:5004277"
                     /db_xref="JGIDB:Ost9901_3_26345"
                     /translation="MATARDRPAGREGDGEGDGDGDDAAQKRTKNRDRHAVHELAGYK
                     IEGVSVGGRETSVVLPALGVAFDSGRCPQRCVYADVMCLSHTHMDHVGGCGMYIATRG
                     LLSLTPPTVLLPSARREAFGTFIESLRALDDSELNHRAIGIDPGERYAMNKLFEIAAF
                     RTRHPVPSQGYVVYGTKQKLKPAYAGLSGPEIKRLRDDGEQVTDKVEVPEVAFTGDTT
                     GDWIDDPANADALRAKLLIMECTFIDDAVSKHDAERFGHTHIDDIVARADKFQNEAIL
                     LIHFSARYKAEEVRAALKAKLPRALYEKCTPMLVGFD"
     gene            <31806..>42632
                     /locus_tag="OSTLU_88532"
                     /db_xref="GeneID:5004304"
     mRNA            <31806..>42632
                     /locus_tag="OSTLU_88532"
                     /product="predicted protein"
                     /transcript_id="XM_001420202.1"
                     /db_xref="GeneID:5004304"
     CDS             <31806..42632
                     /locus_tag="OSTLU_88532"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420239.1"
                     /db_xref="GeneID:5004304"
                     /db_xref="InterPro:IPR003900"
                     /db_xref="JGIDB:Ost9901_3_88532"
                     /translation="VYVARAVALVVVSDIAAWTVTLYGGGIPAAMRSLVIFGGMSVVY
                     YGAYVARWNRSMFDLATRLVAAAAIGSSSVIFGTALALKVIPRPMMQVLAILLASTVA
                     PLLGVYVEELRLHRTSTRRTRLMILSDCSLYGSWDAVAGTVAWACAFNQSADAFGPAL
                     AQSSFVAFIVAAACRWMRAMYVLYVIDHWIIQTVAAMSQEFTETVSRATVVVMEEVSR
                     APIVVKETVSRVSVAIAETVTQTPDVVSHNDESPQPVAEPKMHERSDNNEAAVASVKM
                     RVAREPQPVVMESAPSSDAAPVAGESVSVTQQPDERRIEYAPPYTAVIREQDPRPEPP
                     RVVYAPAFVVVEEASTSSSTESDVTQPLESKRRRRQRKRQYRRRESLAKNTIDMSEIV
                     SKEVNIALNMGVSIEAELQRMLDRRQSTLNDMKNQQANPISIAQVEADIAALRAELRR
                     ATTSREQFQRAQTSYESDLEMWMESIRAAAAVSRLDYAIDSLKNASVADDPQVKELID
                     QRAVWGLRLVSSQIFTIVELQDSLDSGEARSSARIAELRGAIESLELKLTRLQEEKTQ
                     SVDNRILLEDRLQKLNLEIDSVRERERVAQEDWQRERLRLEVELEASVKELQTATRTV
                     DDALKAKLELLAKLQTAQDQSDTDAEAIRRLEHETETLQTKLKSLTEQLSVANASVEQ
                     INSRRFDLESQLRAKATELDLANANRADTSLVEELRRQVKNLSTEICWLRDQKSREGS
                     EAEAVLQKQLAEARTQLEIQRNELEIEAKAEISELKRSMDVIREEMERLTSEMSEKTE
                     KSLEYQRIVQERQKEIESLTKNKELAARAIDESKKNLAQAQEALETKQKALDDRVSQV
                     ASLSLDLAASEEKTLTLERELSASCQRSQELEELISSLRSYSESRDALLADIDLLLGN
                     ENDEREAMLRGSKNASDLVERIQKRLRREVVLEKKLDQAQLLEQVGLTVEELKTREAA
                     SLWWKDLVQIGSKALETIQSTAVDLSKGTVTASLLERSISLRAKELQNITSEPQYQRL
                     QKSFNDLKRLSEAAERKLQEKERKIKSLKADSKESAAELKALTSELASVKEDLKYIRD
                     IAKEERDEQIQRIESLMLEVDSFENAKFDGEEAVRFRNEAAKLRGMKIRLEAELKLSQ
                     DLAETASSELARAREEHDVVITQLSEEIAALELDITVKSEAIEKLESKTNNIEVKLGS
                     DLESALAKLNTTLEELDKKSTDFASLESASVEQKRNFEKHVDELEKRLGASEAEVQRL
                     IQDRDLAIEAKDNEMVSKILSQSAIVSDLESERDALRSQLADLSSARDSELASVRADL
                     ESQLREREEDIERVRSELDESKAALESERDALQSELERVLSQVPEVDASQSAIVSDLE
                     SERDALRSQLADLSSARDSELASVRADLESQLREREEDIERVRSELDESKAALESERD
                     ALQSELERVLSQVPEVDASQSAAVSDLESERDALRSQLADLSSARDSELASVRADLES
                     QLREREEDIERVRSELDESKAALESERDALQSELERVLSQVPEVDASQSAIVSDLESE
                     RDALRSQLADLSSARDSELASVRADLESQLREREEDIERVRSELDESKAALESERDAL
                     QSELERVLSQVPEVDASQSAAVSDLESERDALRSQLADLSSARDSELASVRADLESQL
                     REREEDIERVRSELDESKAALESERDALQSELERVLSQVPEVDASQSAIVSDLESERD
                     ALRSQLADLSSARDSELASVRADLESQLREREEDIERVRSELDESKAALESERDALQS
                     ELERVLSQVPEVDASQSAAVSDLESERDALRSQLADLSSARDSELASVRADLESQLRE
                     REEDIERVRSELDESKAALESERDALQSELERVLSQVPEVDASQSAAVSDLESERDAL
                     RSQLADLSSARDSELASVRADLESQLREREEDIERVRSELDESKAALESERDALQSEL
                     ERVLSQVPEVDASQSAAVSDLESERDALRSQLADLSSARDSELASVRADLESQLRERE
                     EDIERVRSELDESKAALESERDALQSELERVLSQVPEVDASQSAAMSDLESERDALRS
                     QLSELRQMSSESIAGLQQQLVAFSAEADSAASLRKTVKELKATIRQRENLLSETVFDP
                     MLNDDLDRMNDELASKSAELDSARTKLQSTLNKLKEREEQAESSQAVASAVIDEIRAE
                     LLNANEKLAARESYANAVELALRSELTEREKEIALLRVKVAKILDDSTNKQTSLTTAL
                     DSAQSEIERLTRELEDVEQSKQVAMKESFERNESQIASLNAAHRELDQRLRDELDAAL
                     KAKASLEKELSDRAESTAATETAKRNAEALSESLQSQLDALSTQRAELEQRLVKREEE
                     LVAELDAAKHEATAQAARFAQLGEAASDHAHDEVDKLKSEVERLEFELGAVKNELTSA
                     TSTAKADIARLTDELASASAARDAVAETAHPEEDGSSESASAFEAMRRDMTRLESELA
                     AALAELAELESPRESESSDTEAIREFTTALDSAQSEIERLTRELEDVEQSKQVAMKES
                     FERNESQIASLNAAHRELDQRLRDELDAALKAKASLEERSDRAESTAATETAKRNAEA
                     LSESLQSQLDALSTQRAELEQRLVKREEELVAELDAAKHEATAQAARFAQLGEAASDH
                     AHDEVDKLKSEVERLEFELGAVKNELTSATSTAKADIARLTDELASASAARDAVAETA
                     HPEEDGSSESASAFEAMRRDMTRLESELAAALAELAELESPRESESSDTEAIREFTTA
                     LDSAQSEIERLTRELEDVEQSKQVAMKESFERNESQIASLNAAHRELDQRLRDELDAA
                     LKAKASLEKERSDRAESTAATETAKRNAEALSESLQSQLDALSTQRAELEQRLVKREE
                     ELVAELDAAKHEATAQAARFAQLGEAASDHAHDEVDKLKSEVERLEFELGAVKNELTS
                     ATSTAKADIARLTDELASASAARDAVAETAHPEEDGSSESASAFEAMRRDMTRLESEL
                     AAALAELAELESPRESESSDTEAIREFTTALDSAQSEIERLTRELEDVEQSKQVAMKE
                     SFERNESQIASLNAAHRELDQRLRDELDAALKAKASLEKELSDRAESTAATEIAKRNA
                     EALSESLQSQLDASRAEEAKLRDELNHFQELAREEISALHNEITEIKFTSQESQASLG
                     ESPWPSITISTLAGLNEMMSRGSEFGSEGLDWLEHAAHEVQALEKSVLDATAELELRE
                     NEYEQTIAQLQDSVRDAETDLNSQKSLASAALSDVEHLNDKLAERDEELASLRLELAN
                     LVSDDVTRELELTISNLRIQLTAKDNELNGAVASLNDLENDKRAIEEAMSELQAAADM
                     QAARVQTSIEQISSLNVELAKRSAALDASWDNLSHAESRARFAEQERDDVRRLFEERL
                     AVKERALRETQGDVEHLRQTVRNLQDKLKAHRYARSETEAGHPEEDGSSESASAFEAM
                     RRDMTRLESELAAALAELAELESPRESESSDTEAIREFTTALDSAQSEIERLTRELED
                     VEQSKQVAMKESFERNESQIASLNAAHRELDQRLRDELDAALKAKASLEKELSDRAES
                     TAATETAKRNAEALSESLQSQLDGKT"
     gene            complement(<49821..>50552)
                     /locus_tag="OSTLU_93405"
                     /db_xref="GeneID:5004278"
     mRNA            complement(<49821..>50552)
                     /locus_tag="OSTLU_93405"
                     /product="predicted protein"
                     /transcript_id="XM_001420363.1"
                     /db_xref="GeneID:5004278"
     CDS             complement(49821..50552)
                     /locus_tag="OSTLU_93405"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420400.1"
                     /db_xref="GeneID:5004278"
                     /db_xref="JGIDB:Ost9901_3_93405"
                     /translation="MRANFTRAPSRGPSTSTSGAASRAARARSAGDGECAFTDANDRA
                     VEKFWRNWTGAAHCRQIVTKSSRESLYRDPARLESKVRALLRVFPVDGDGNCGSHGLD
                     VPASAAREPRLLALREDEFVKRVLMVKRCVAGISGRQITLAPGLLLCDGRALEEAMRG
                     LEETLGAAEARDAVAKQPDRLLELVGFYGVGDDAEEEERDIGRAMRHYARAVPPVSDA
                     RAVEQRVAARELGAKKFHVGESGAI"
     gene            <50579..>51766
                     /locus_tag="OSTLU_26347"
                     /db_xref="GeneID:5004305"
     mRNA            <50579..>51766
                     /locus_tag="OSTLU_26347"
                     /product="predicted protein"
                     /transcript_id="XM_001420203.1"
                     /db_xref="GeneID:5004305"
     CDS             50579..51766
                     /locus_tag="OSTLU_26347"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420240.1"
                     /db_xref="GeneID:5004305"
                     /db_xref="JGIDB:Ost9901_3_26347"
                     /translation="MAPVAVAANVEIAAPLAVEDTATLCDLVRGALCFWRCERDYFFA
                     EGSKCARARDACAAACRLPPEWVTRALGTTREREIAKHTDPLERKEYLGTLTEEEART
                     LRRRRAEAARFVRRRAMAAAPERQSMTKRAGERRRRERAWTSSKLRKDGDDASVSASD
                     EFGKAEALEAELAEANARRYRRAYDGADESGYSSRSSSYYSDESSYSSYTGSSYSSYT
                     GSSYSSYASDADAERERRRALALDAMKPPNDATAMTVSRKDALGKPLIVGKHLAFATE
                     GLLPEGLTRWEAYIAEAERAGELRDAKMRRRAERRDRSLHRELDALKLYADRVKLSEQ
                     DVQIRRQALIDAHDARVRESVEREVKIAARARRKRNVLLNLDHDARSRLLKRWALRPS
                     AQK"
     gene            <52249..>52656
                     /locus_tag="OSTLU_44311"
                     /db_xref="GeneID:5004279"
     mRNA            <52249..>52656
                     /locus_tag="OSTLU_44311"
                     /product="predicted protein"
                     /transcript_id="XM_001420204.1"
                     /db_xref="GeneID:5004279"
     CDS             52249..52656
                     /locus_tag="OSTLU_44311"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420241.1"
                     /db_xref="GeneID:5004279"
                     /db_xref="InterPro:IPR002833"
                     /db_xref="JGIDB:Ost9901_3_44311"
                     /translation="MSDEEAGDGIGGDVGTRDEEHKMALLVREDVAMGAGKLAAQAGH
                     AAVGAAMATRDRSPMLMGRWECDGQKKVTLGVKNLRVMNELLGEAKTARLTTFVVEDA
                     GRTEVEPGTVTVAAIGPAAASDIDKITGHLRLY"
     gene            complement(52705..>59716)
                     /locus_tag="OSTLU_50795"
                     /db_xref="GeneID:5004280"
     mRNA            complement(52705..>59716)
                     /locus_tag="OSTLU_50795"
                     /product="predicted protein"
                     /transcript_id="XM_001420364.1"
                     /db_xref="GeneID:5004280"
     CDS             complement(52754..59716)
                     /locus_tag="OSTLU_50795"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420401.1"
                     /db_xref="GeneID:5004280"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="JGIDB:Ost9901_3_50795"
                     /translation="MDVGVSEEVMEKARKWRALNAKRYGARRKFGYQEPPKEEMPPEH
                     VRKIIKDHGDMSSRKFRHDKRVYLGALKFVPHAVYKLLENMPMPWEQVRHCEVIYHIT
                     GAITFVNETPRVIEPVFIAQWGTMWIMMRREKRDRKHFKRMRFPPFDDEEPPLDYADN
                     LLDVDPLEAIALELDEEEDGAVAEWFYDHNPLKWTKFVNGPSYRKWQLPLPVMANLHR
                     LSSQLLSDLTDKNYFYLFDHKSFFTAKALGMCIPGGPKFEPLFRDMDRADEDWNEFND
                     INKLIIRSALRTEYKVAFPYLYNNRPRKVSLAVYHTPMVMFIKTEDPDLPAYYYDPLI
                     HPIAFYRSNKQKTTPREEDDGEDDFQLPDGIEPFLEDTPLYTDNTAGGIALLYAPRPF
                     NLRSGKTRRAMDVPLVNNWFHEHCPSGYPVKVRVSYQKLLKGFVLNQLHKRPPKPMKR
                     RNLFVALKKTKFFQCTELDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPV
                     KTLTTKERKKSRFGNAFHLCREVLRLTKLVVDSNVQFRLGNIDAYQLADGLQYVFSHV
                     GQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGVGFWAPMWRVWLFFLRG
                     IVPLLERWLGNLLARQFEGRNNKGIAKTVTKQRIESHFDLELRAAVMHDILDSMPEGV
                     KQNKARTILAHLSEAWRCFKANIPWKVPGMPTPIENMILRYVKSKADWWTNVAHYNRE
                     RIRRGATVDKTVCRKNLGRLTRLYLKAEQERQHNYLKDGPYVTPEEAVAIYTTTVHWL
                     ESRRFSPIPFPPLSYKHDRKLLILALERLKENYSVNARLNQNQREELGLIEQAFDNPH
                     EALSRIKRHLLTQRAFKEVNIEFMDLYSHLIPVYEIEPLEKISDAYLDQYIWYEADKR
                     QLFPNWIKPSDTEPAPLLVYKWCQGINNLTDVWDTNEGECVVMLQTRFEKMFEKVDLT
                     LLNRLMRLIVDHNIADYCTAKNNVVISYKDMSHTNSYGMIRGLQFASFMTQYYGLVLD
                     LLLLGLTRASEIAGPANMPNEFISYRDVETETRHPIRLYSRYIDRVHVLFRFTADESK
                     DLIQRYLTEHPDPNNENMVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSL
                     TTLEWDNGFVSVYSRDNPNLLFAMSGFEVRILPKIRMATEYFANKDGVWNLHNEQTKE
                     RTAQAFLRVDDEALKSFENRIRQVLMSSGATTFSKIVNKWNTALIGLMTYYREATIHT
                     SELLDLLVKCENKIQTRVKIGLNSKMPSRFPPCVFAAPKEIGGLGMLSMGHILIPQSD
                     LRYSVQTDSGITHFRSGMTHEEDQLIPNLFRYIQPWEAEFNDSQRVWAEYALKRQEAQ
                     AQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRLTFKEYNLTRQNPFWW
                     THQRHDGKLWNLNNYRTDVIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEQSM
                     QYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKI
                     SLIQIFRAHLWQKIHESVVMDMCNVFDQELDALEIETVQKETIHPRKSYKMNSSCADI
                     LLFAAYKWSICKPSLMGETNDSFDQKSSNKFWVDVQLRWGDFDSHDIERYTRAKFLDY
                     TTDNMSIYPSPTGVMIGIDLAYNLHSAYGNWFPGCKPLVQQAMAKIMKANPALYVLRE
                     RIRKGLQLYSSEPTEPYLNSQNYGELFSNQTIWFVDDTNVYRVTIHKTFEGNLVTKPI
                     NGAIFIFNPRTGQLFLKIIHTSVWAGQKRLAQLAKWKTAEEVAALIRSLPIEEQPKQI
                     IVTRKGMLDPLETHMLDYPNIVIKGSELQLPFQACMKIEKFGDLILKATEPQMVLFNI
                     YDDWLKTISSYTAFSRLILILRALHVNNEKAKMMLRPDKSVVTLPHHVWPDLTDEQWI
                     KVEIALKDLILADYSAKNNVNVSALTQSEVRDIILGAEITPPSVQRQEIAEIEKRGQD
                     ANQQIAVTTKTTNVHGDELIVTTTSPYEQSTFGSKTDWRIRAISATNLHLRVNHIYVN
                     SDDLKETGYTYIMPKNVLKKFITIADLRTQIAGYMYGVSPPDNPQVKEIRCVVMPPQW
                     GNHSSVNLPSTLPEHDYLSDLEPLGWIHTQPNESSQLQPQDCTQHAKILEQNSSWDGE
                     KSIILTCSFTPGSCSLTAYKITPAGYEWGRANKDMTSTNPQGYGPGHFEKVQMLLSDR
                     FLGYYMVPDGGSWNYSFQGVKHSAGMKYALKLGNPLEFYHERHRPTHFLEFAALEAEK
                     PEETAPMDREDVFS"
     gene            complement(60659..>63236)
                     /locus_tag="OSTLU_25192"
                     /db_xref="GeneID:5004306"
     mRNA            complement(join(60659..62075,62172..>63236))
                     /locus_tag="OSTLU_25192"
                     /product="predicted protein"
                     /transcript_id="XM_001420365.1"
                     /db_xref="GeneID:5004306"
     CDS             complement(join(60771..62075,62172..63236))
                     /locus_tag="OSTLU_25192"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420402.1"
                     /db_xref="GeneID:5004306"
                     /db_xref="InterPro:IPR000811"
                     /db_xref="JGIDB:Ost9901_3_25192"
                     /translation="MYQATAQSVREGLVERWNDTYAHFHKENPKQAYYLSMEYLQGRA
                     LTNAIGNMGLTGEYSEALRSLGYTLEDVMSVERNAGLGNGGLGRLASCFLDSIATLDL
                     PAWGYGLRYKYGLFKQGVDKATGEQLEYADDWLEVGNPWEVARPQVSYPISFYGKVVN
                     GKWAPGKQVRAVAYDSPIPGYKTRNCISLRMWDAQPSAVEFDLAAFNASDYETSMGPT
                     NLASMLCAVLYPGDGTREGKALRLSQQYMLCSASVQDILARWKERGNSDWSKLHEKVA
                     IQMNDTHPTLAAPELMRILMDDEGLSWDDAWAVTKKTVAYTNHTVMPEALEKWPLDLV
                     EELLPRHMEIIKRIDEEFIASAAKAKAAKAAKKDDKKKDDKKKKESEEEKPAMVRMAN
                     LCCISGMAINGVAAIHSEIVKDFTFNDFYKLFPEKFQNKTNGVTPRRWLAFCNPQLSA
                     VITKWVGNDKWVTDTDELRKLAEHATNPELQAEWKAAKLARKKICKDYIKKVTDIDVP
                     IDSMFDIQVKRIHEYKRQFLNILGIIYRYKQMKAMTPEERAKCVPRVCIFGGKAYATY
                     TQAKRIVRLINNVGSVVNNDPEIGDLLKVVFVPDYNVSLAETLIPASELSQHISTAGT
                     EASGTSNMKFQMNGCLIIGTLDGANVEIRECVGDDNFFLFGITDPEVEPARAERAAGK
                     FVPDARFTETLEYVRSGVFGDKFEELLGSLEGNEGFGRGDYFLVGKDFASYLEAQERV
                     DVAYADSMGWTESSIISTAFSGKFNSDRTIDQYAKEIWGIKPCTVPERK"
     gene            complement(<63974..>65179)
                     /locus_tag="OSTLU_26351"
                     /db_xref="GeneID:5004307"
     mRNA            complement(<63974..>65179)
                     /locus_tag="OSTLU_26351"
                     /product="predicted protein"
                     /transcript_id="XM_001420366.1"
                     /db_xref="GeneID:5004307"
     CDS             complement(63974..65179)
                     /locus_tag="OSTLU_26351"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420403.1"
                     /db_xref="GeneID:5004307"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Ost9901_3_26351"
                     /translation="MHSLKKRRAALEGDDLTEAARDAAKRDALRALRLKTVIRENHGA
                     ARTTRVEFARGSARTSNLYATCGGSAVTVYDDAHFGDHTAIVAQYAHETTAHQTGGEI
                     TCVCFARGEDDEKENETATTRGGGHEFGDAIVTAGDEHGWISVISVAENRVVGRLNAH
                     PGSRVVDADGACARDGFVVSVGEDGFLKAWDVFGGPDGEGECVGTFDVGTNARSVACD
                     ANGAFAVTGHADGVARRWNLSGAVSQKSKALPLATFKPRFAVECVRIVDDVLFAKTRD
                     GRIETCDLKRNESIASWTLPNEKYRDHKYTGPACRFGVSSDGKFLACGDGTDSGVVYV
                     YDARTGENIVELQPLRVVGVVHAAAVVDHCRHVFAAYGPAVVWRYEVINVSSDDDAIA
                     GDAFEAVVK"
     gene            <66002..>66340
                     /locus_tag="OSTLU_9177"
                     /db_xref="GeneID:5004308"
     mRNA            <66002..>66340
                     /locus_tag="OSTLU_9177"
                     /product="predicted protein"
                     /transcript_id="XM_001420205.1"
                     /db_xref="GeneID:5004308"
     CDS             <66002..>66340
                     /locus_tag="OSTLU_9177"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420242.1"
                     /db_xref="GeneID:5004308"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="JGIDB:Ost9901_3_9177"
                     /translation="KLYVPEDEYPGYNFIGLILGPRGNTQKRMERETNTRIMLRGKGS
                     VKPGAHRDHKTDYKEDEPLHVVILGETWEGVDAAAEMVGHILRPIDEEANVHKRMQLR
                     ELASINGTFVE"
     gene            complement(<67353..>68390)
                     /locus_tag="OSTLU_3060"
                     /db_xref="GeneID:5004281"
     mRNA            complement(<67353..>68390)
                     /locus_tag="OSTLU_3060"
                     /product="predicted protein"
                     /transcript_id="XM_001420367.1"
                     /db_xref="GeneID:5004281"
     CDS             complement(<67353..>68390)
                     /locus_tag="OSTLU_3060"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420404.1"
                     /db_xref="GeneID:5004281"
                     /db_xref="InterPro:IPR011084"
                     /db_xref="JGIDB:Ost9901_3_3060"
                     /translation="PAWIRPPGTMFIVDGFEYAASSEARCEHWFLTHFHADHHRGLTR
                     TFDRGVVYGTRTTTELVRTKIGVPRERLRVVEFGVVVRVDGVDVTFLRANHCPGAAMI
                     CFEFPHRRDASPVLHTGDFRFHDGMRNDPTLLRITSDPSAPRPILILDTTYCSLEHDD
                     FPTQERVLKAVRDAVVHEDLLSTRKLFLFGTYTIGKEKVFLEAAKVLNRKVYIGKAKR
                     SVMDAIALDPEERSAMTHDDSKTNLHVVPMGSTSFMKMASILKYYKSRFDTVIAFRPT
                     GWTFSAQKKTARATSRRQRGRLIQYGLPYSEHSSLNELREFVRFMNPKFIFPHVNNDG
                     GENAKRMLTLLR"
     gene            <68905..>69399
                     /locus_tag="OSTLU_26354"
                     /db_xref="GeneID:5004309"
     mRNA            <68905..>69399
                     /locus_tag="OSTLU_26354"
                     /product="predicted protein"
                     /transcript_id="XM_001420206.1"
                     /db_xref="GeneID:5004309"
     CDS             68905..69399
                     /locus_tag="OSTLU_26354"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420243.1"
                     /db_xref="GeneID:5004309"
                     /db_xref="JGIDB:Ost9901_3_26354"
                     /translation="MTPRRDDAASPKRAKRAVEWDEANLAKNFAERSATMKIEEIETP
                     WHSPPRELFHDLRAEDEGEVARRERAHEEVMRRLEALIRADARGETSTPPTTKDADAT
                     MGDEGSEDGTSRVAFHDPDARDEDFEDDAEEVVKKRLFDAKRKAFQCKGRATARFLAD
                     EAGD"
     gene            complement(69442..>73251)
                     /locus_tag="OSTLU_25194"
                     /db_xref="GeneID:5004282"
     mRNA            complement(69442..>73251)
                     /locus_tag="OSTLU_25194"
                     /product="predicted protein"
                     /transcript_id="XM_001420368.1"
                     /db_xref="GeneID:5004282"
     CDS             complement(69451..73251)
                     /locus_tag="OSTLU_25194"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420405.1"
                     /db_xref="GeneID:5004282"
                     /db_xref="JGIDB:Ost9901_3_25194"
                     /translation="MTTTQGARKLSSSIANNHSGGKTAIARAARARALTTPARGGRGR
                     VIDPRVVRAAPARAVADVGGEGGGATIRASELSPAHSSVERWIVFSDLHVSKRTMETC
                     RRVLERVHAEALKREAGVVFLGDFWHARGAIPVEPLNEALALMSSAKWTAPTIMIPGN
                     HDQVTAGGLSHALTPLAKANPNIVVFDGPTLYGGALWLPYRRNSDELKRAIEDTRGEF
                     NAIFCHADVVGASMNETFQARDGLDPALFGGANTYTGHYHKPHVVPNTNITYVGSPYE
                     VSRSEAGQKKEFIVLDSQTWVEGANARVSLDIGPKHFAVEGVDASAPPTARPGDIIRW
                     TLPIEAMDAVSDAVPSVVQKARDQGFIVEVCYVTKDLTARIPKAEELGPAGLFDAYAV
                     ASEMAPSVSAFGRKVLQEVAASDDAPETRRQSKGVSVSFETVEVEGFGTFQSATRYPL
                     GARGVCVVVGENKSDTCSDSNGAGKTTLVMSPMWALTGQSDLRIDGAGSGKSLTKSDV
                     VNDSSKFGRVRLEGFLNGGTPFWVERKVNRTKLVSLKYAIDGEEKTMAESKLTQQGLN
                     DDLGADVIANTTFHGQHTVGALLDANDASLKAALGKLVEADTWTKAKDISRKRVTEAR
                     GNVNAIAAEVKAREEYIARTRLRRDQAHVESEKWEFEYRRRVSELETSSSAVSTTFTK
                     YLARTNHFLQRLSRASEALEVTSSHAERVLDSSRNDSDDAARRFEVKESEFEHKTSVI
                     EGEIERLNGVVREWQSKEASAGAIGRQSHAAVGMFAGAGGTHSHPDGVGTCDRCLQAI
                     DPTHHKETLIKLKDEARKTAIEHGNAIEQLKRATAALNKAMDDRRNLTEAAALARKAE
                     RMRAETTATASANATDQLRHSQRSLSLIGNAVARAEMLLNSAPEDVVHEALTMSIDDA
                     FAMSESTISISGASSNVLAGLDPDLTRGSMSSASLSNASPQIQLLRDEQMNVADADFV
                     RQLVKGAEDAIMDGERAGRDAARRLQELNEFSRSARSNPHTSALEELDAQLAGESESL
                     GARIESLNGAKELLGVAQAADTAFSTKGIQSYLFEGALGDLSARVGQYMDALTGGALT
                     LELRPAGAAFTGDDNDVVQSDVDADETATRKTKSKSAKAPASASAAERIERVIHARRP
                     DGSLIARSLRQLSGGERRRAALALALAYADLASERCGVACDALVLDEVLQHLDAEGIA
                     RVTSLLRALPKRTVLLTSQADSATAHLFDVVDKVVKSDFGSGVVVSAGDDADLVDLAA
                     RASA"
     gene            complement(74488..75663)
                     /locus_tag="OSTLU_26356"
                     /db_xref="GeneID:5004310"
     mRNA            complement(74488..75663)
                     /locus_tag="OSTLU_26356"
                     /product="predicted protein"
                     /transcript_id="XM_001420369.1"
                     /db_xref="GeneID:5004310"
     CDS             complement(74523..75368)
                     /locus_tag="OSTLU_26356"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420406.1"
                     /db_xref="GeneID:5004310"
                     /db_xref="JGIDB:Ost9901_3_26356"
                     /translation="MKSEGSNVNPDIGVSCSIDDPSSCSLADLELMYVDALWNYYNGG
                     KFTLSDEDYDRLREELNWQGSGFPTLRRYEIEFVQAAISYSRGESVVDDDKYEELKRR
                     VKAEGKRTDVTALLLYTKGKELLDEAEFELLGAEMKKLGIEVGMKGATCTLSQTSTEL
                     ISDTSGVFTMYAALATVPLLLGLSPSILLGFFGVHVPSGLSLGFAATLCAGLTYKLVN
                     YTNLQNAEILIGACPCCEMPIKQFFGGESPAETFEHKCSACGTKCTLNRPKRLIETAG
                     GFSRA"
     gene            complement(<76060..>76374)
                     /locus_tag="OSTLU_7962"
                     /db_xref="GeneID:5004311"
     mRNA            complement(<76060..>76374)
                     /locus_tag="OSTLU_7962"
                     /product="predicted protein"
                     /transcript_id="XM_001420370.1"
                     /db_xref="GeneID:5004311"
     CDS             complement(<76060..>76374)
                     /locus_tag="OSTLU_7962"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420407.1"
                     /db_xref="GeneID:5004311"
                     /db_xref="InterPro:IPR003958"
                     /db_xref="JGIDB:Ost9901_3_7962"
                     /translation="QQVALRQFWREMMIEIQQTNDFKNHLLPLARIKKIMKSDEDVRM
                     ISSEAPVLFAKACEMFVLELTTRAWAHAQENKRRTLQRSDVAAAITKTDIFDFLVDIV
                     PRE"
     gene            complement(76912..>78491)
                     /locus_tag="OSTLU_26359"
                     /db_xref="GeneID:5004312"
     mRNA            complement(76912..>78491)
                     /locus_tag="OSTLU_26359"
                     /product="predicted protein"
                     /transcript_id="XM_001420371.1"
                     /db_xref="GeneID:5004312"
     CDS             complement(77499..78491)
                     /locus_tag="OSTLU_26359"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420408.1"
                     /db_xref="GeneID:5004312"
                     /db_xref="JGIDB:Ost9901_3_26359"
                     /translation="MAERARSRGETVRETRGGAKAAPPTASARREKFDPRAPPKILPS
                     SALLAARNAPDESVSEKDARVVDTPGSDWLQSRGATAPMVLRRKPPPPVEDAESDERM
                     DETESEDKARKKRGGRRVREREERRVLRSSKNDSDKTAASRMKNAPPPAANYNDWVGS
                     QYGGGYGASVEGAVPAYGMAFADGSGLFPTFAAGYPAGYSGYYGYASAPPSATWTQEA
                     ASAASDASASAAASYPYQAPVTVPANAPFDINATGTYGAAADVSHLAERLGDLPSSLG
                     AEFGSTEDLSSVANAPVAGGGHPRVQRHASRASGSGGRKNRSRRAPKDARNGEI"
     gene            <79500..>80138
                     /locus_tag="OSTLU_26360"
                     /db_xref="GeneID:5004313"
     mRNA            <79500..>80138
                     /locus_tag="OSTLU_26360"
                     /product="predicted protein"
                     /transcript_id="XM_001420207.1"
                     /db_xref="GeneID:5004313"
     CDS             79500..80138
                     /locus_tag="OSTLU_26360"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420244.1"
                     /db_xref="GeneID:5004313"
                     /db_xref="JGIDB:Ost9901_3_26360"
                     /translation="MDDDALARPAVFVEAERRASAEAERRAREARARREEAEAEEEAE
                     AEDDDEIDSDATDDEEAFDWRAVRANGDGNDGTTAREVEADAEASARRSATLPTRNLA
                     KTQPWRARLPNFTPVRELPPQSFHDGELVFVDYEAQFGGPRSAASKAFARREARAFGG
                     VGARDRAAASTAPTAAVPRWFTDERGRKTFVDARGKSLVGKAAYAASQRLRA"
     gene            complement(<80367..>80582)
                     /locus_tag="OSTLU_88539"
                     /db_xref="GeneID:5004283"
     mRNA            complement(<80367..>80582)
                     /locus_tag="OSTLU_88539"
                     /product="predicted protein"
                     /transcript_id="XM_001420372.1"
                     /db_xref="GeneID:5004283"
     CDS             complement(80367..80582)
                     /locus_tag="OSTLU_88539"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420409.1"
                     /db_xref="GeneID:5004283"
                     /db_xref="InterPro:IPR000268"
                     /db_xref="JGIDB:Ost9901_3_88539"
                     /translation="MIIPVRCFTCGKVIGNKWDTYLDLLQADYSERDALDALGLNRYC
                     CRRMVMCHVDLIEKLLRYNTLERVDDA"
     gene            <80945..>84215
                     /locus_tag="OSTLU_17228"
                     /db_xref="GeneID:5004314"
     mRNA            join(<80945..82075,82362..>84215)
                     /locus_tag="OSTLU_17228"
                     /product="predicted protein"
                     /transcript_id="XM_001420208.1"
                     /db_xref="GeneID:5004314"
     CDS             join(80945..82075,82362..84215)
                     /locus_tag="OSTLU_17228"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420245.1"
                     /db_xref="GeneID:5004314"
                     /db_xref="JGIDB:Ost9901_3_17228"
                     /translation="MEADDAAAARRRGDDDEAARLYAARLGDARASSTTHVRYALAAK
                     ACGRAASDAAAFEATLRQGLERAMREAAEDGVEDVGRDARARAIGGQLALSLCQRGAN
                     EDASDLLEFLGYSRRLSEEVLRYAEEGARERAPEDVARVYDDALDARALRFLGDAFAR
                     RGASTFWIEHDYYAPETGFFSYVHDVPSRRENKMDAVVDMVKDVASRAFPGVKRARYA
                     EWWAHSRPHTDGHQLHFDSHDEGLGEVRHPICSAVVFVDGCCGGPTLVTNQKDTSAEL
                     ASRAWLVYPKTGRVAVFNGDYLHGVVPGRVADDGFDPEFASRRRITLMISFWEDTDVH
                     HSWTPAGSARPFPPRDAPGVSWRSRFDFAADDDFAAEAAVGVERTDAKTVAITGTDDD
                     YKLSTRHATLLDAVDAASVALESFFATAKVKNAHEAHERAAHEVLRHFRGTLGTLGTP
                     REETTDAFDDPPEKRTKTEDGEAGKKKKDEEMDAEAREDAIGRAGDVLQNMLRETHRL
                     HVNASCRVNTRAPEVKRARDNLTRIRREARELYKKIDPRGYERDRERVRMMAEETQAA
                     LDFKITRFETPPKDLAELRAKCPVMSSTGSPHHLCAHLCYYREYEPARQMYVLRCRAA
                     EANGNAAALDGWRAELAVRPAEDIPAFNRSRADTRGTASGACSLKHLPWMVEFIGPGG
                     ERFKDGMDVLNFVAVECDKLSWPRASHGGNGVREARVSEDGLNDQTELLRAALWDEDT
                     DGTAGTTPVRRSFTRIARCVDETRTPLRLAPDPLANENDENDDGEKINESVVLAAANA
                     FDDETPGQTPTKTPLKDQQGGDAAASPPGSGPEPVRHWWAPPLSPFGLLEEILWQDEW
                     KLLVSCMMLNCTTRLQVDRVLWRLFLLAPTAAAAVELGDTHEGLEALERIIAPLGLHR
                     KRTNAFVKLSRDVEAQRAKYGGRIKNVSACHGVGVYAADAHALFVDGVLAGPPRDHAL
                     RWYHAWAHERRENAAKSAPKRT"
     gene            <84761..88242
                     /locus_tag="OSTLU_25198"
                     /db_xref="GeneID:5004284"
     mRNA            join(<84761..86263,86324..86635,86690..88242)
                     /locus_tag="OSTLU_25198"
                     /product="predicted protein"
                     /transcript_id="XM_001420209.1"
                     /db_xref="GeneID:5004284"
     CDS             join(84761..86263,86324..86635,86690..88204)
                     /locus_tag="OSTLU_25198"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420246.1"
                     /db_xref="GeneID:5004284"
                     /db_xref="InterPro:IPR000299"
                     /db_xref="InterPro:IPR000857"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="JGIDB:Ost9901_3_25198"
                     /translation="MADALSVDGALTTSLLRLTSDQTNKSVKLHALLVVLVSDTDDVT
                     GETFAAGVQKIAKEVIKREELADEMYLQIIRATRSAASDRGRRKAWELVRVIAALFAP
                     SRDFIGFVSEYINEVAARGSSDIQPLARSALQTMKRTSKSAMRRHEPTAEEIIAFARG
                     EKLRVVITFLDGTFEDLPYDMSTTAKEAVVALATSINLQNYSTFSLFTVRKFFGKVAP
                     LIKEGLLSEEHHELGDVSFLSDALGDIRAMKTESTPSKATSMQTGLLFKKRMFRDADE
                     TIDETTFVLLSYVQAKHDFMMGNYPISRDDAALLAALQVQAEEGPRLGEDQAALGLVL
                     AKYLPRTMCNTRPTKEWTEHIAGQHASIRGLSGDEARQALLRMIRSLPYGNSAFFRAK
                     RVDDPIGLLPGKLMIGVNKRGVHFFRETPMEYLYTADLRDIMQFGSAPHAIFFKMRVS
                     GALHVFQFETSDGENICMALQTHINDVMMKKMADKKAAMMAVEAVTPSKKPTKRGDID
                     ASDAQKEIKTLNEKLANMRNERAELRAQLDQANEAFHEANDRLESERASKADIVDTIQ
                     MLERQLKESKEAAIASDNATTDKLDDLTAIQLQELRDELQQVVVLEQKLKRAEAAHAE
                     ELKETAEQNGADISEWQNKLHEADSRAGELEAEIRALRLEYEEQKAMVTKEMLDELEQ
                     LREMKNTFEGQQATARELMAGQTQKIKELEEKYTSEVTLRRRYFNMLEDLKGKIRVYA
                     RTRPLTEIETSQNQQAILATPDEFTCSHPWRGEKKDRSYEFDEVFPANSTQEQVFEDT
                     KYLVQSAMDGYNVCIFAYGQTGSGKTFTIYGDDANPGLTPRAIAEVMRCVHRDSNKSS
                     VKMECYMLELYRDDLIDLLLPVGTSDAPRLDIKKDKKGWVTVPNATIVPVTSEDEIIE
                     VIHTGLKVRKTAGTKMNVESSRSHLIFSLVMETTDLQTGALTKGKLSFVDLAGSERVK
                     KSGAEGDTLKEAQAINKSLSALGDVISALASEQQHIPYRNHKLTMLMSDSLGGNAKTL
                     MFVNVSPTDGNVEETQNSLTYATRVRTIKNDNGKSVESKEVQHLKQQVAHWRQKAGEV
                     EESHVDIEDERVGLDQLSLNQ"
     gene            complement(<88249..>89550)
                     /locus_tag="OSTLU_44133"
                     /db_xref="GeneID:5004285"
     mRNA            complement(join(<88249..89343,89428..>89550))
                     /locus_tag="OSTLU_44133"
                     /product="predicted protein"
                     /transcript_id="XM_001420373.1"
                     /db_xref="GeneID:5004285"
     CDS             complement(join(88249..89343,89428..89550))
                     /locus_tag="OSTLU_44133"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420410.1"
                     /db_xref="GeneID:5004285"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR008913"
                     /db_xref="JGIDB:Ost9901_3_44133"
                     /translation="MLIWVRNALNEDEREGMISSMRHATQNTRFAQWMNTWYSGKTNA
                     ADTAAVSSQDGMRQVHAYLSRRSGDVDKETFKPGWEDIFRMNQIQLEDAVRTVNRDDT
                     LAPTKKAYLIQNLLASRWIVGNQLQAQKDKTTELSSVGSAQKSGAPAILCQPVDEDEE
                     NGKDGCKHYKRRCKIVAPCCDQAFTCRFCHDDASDHTVNRYAVKEMVCNECKKRQPVN
                     EVCVGCSTSMAKYHCNVCNLFDDSSEAIYHCPFCNVCRRGKGLGVDFFHCMKCNACVS
                     LQHGKHECSERGMDSECPVCKEFLAESETPVKELPCGHIMHATCFTTYTRHYYTCPLC
                     RKSLGDFSMYFRMLDAILADESDDSVPEALRGKTQKVSCNDCAKDSDAKFHFVYHACA
                     HCRSYNTRVLTFD"
     gene            <92847..>94238
                     /locus_tag="OSTLU_2292"
                     /db_xref="GeneID:5004315"
     mRNA            <92847..>94238
                     /locus_tag="OSTLU_2292"
                     /product="predicted protein"
                     /transcript_id="XM_001420210.1"
                     /db_xref="GeneID:5004315"
     CDS             <92847..>94238
                     /locus_tag="OSTLU_2292"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420247.1"
                     /db_xref="GeneID:5004315"
                     /db_xref="JGIDB:Ost9901_3_2292"
                     /translation="VVCIQGPPGTGKTSVVVEIIAQAAARGERVLACAPSNLAVDNLV
                     ERLDGVTDVRAVRFGAPERISAAALSCSLDAKVSEATELFFQTQRVESSETSTKLRAL
                     MDRYQKATNVPKKQREKLQSEIEALKKKLKTTVSAGTKHRKASQAKILREANVVLATN
                     AGAGMDTVQQLPPFDLVVVDEAAQASEPLSWIPLVRGRRAVLIGDPCQLAPVVRSLEA
                     VEAGLARSLMSRLMPAPENLDDEDDGWNARAYASSGVLTLTLSTQYRSHETISSWSSR
                     EAYGGRLRAAESVRGALLRDLPGVQDTQITRIPMLMITARSPYGRIPAECNERRVGGS
                     YINEGEATTAAAHVLMMLKAGVRASDIAVISPYAAQVRLLRSVLAVALEDVEGADAVE
                     ISSIDSFQGREAECVIISTVRSNARRGVGFLSDNRRMNVAVTRGKRHVTIIGDDKTIM
                     GDAFLRRLVEHIEA"
     gene            complement(<94399..>95805)
                     /locus_tag="OSTLU_93408"
                     /db_xref="GeneID:5004286"
     mRNA            complement(<94399..>95805)
                     /locus_tag="OSTLU_93408"
                     /product="predicted protein"
                     /transcript_id="XM_001420374.1"
                     /db_xref="GeneID:5004286"
     CDS             complement(94399..>95805)
                     /locus_tag="OSTLU_93408"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420411.1"
                     /db_xref="GeneID:5004286"
                     /db_xref="JGIDB:Ost9901_3_93408"
                     /translation="VTQKGDDAPRRRSSGRASGDAADLSFSSIPDVSKNASFSGASNS
                     PPGLEPTPASMVGRKLSAGSSSSGRTPPGNRADASFNDSTSSHMTNSSEEGVDGGNNN
                     KRRSSRRTHKGVTRFGEFQSWESVAADEVPPSPAFVGNPRQRQAYLEAYAKARYEEEL
                     AERKANGHAVEDTVSDVHSRVAELMKAADEMLPDYAPSPAKSLHAKSLREQLQESWQG
                     KGYYARLMAQMASPSPARPNQRPPHMQRLHQGANDAAAAANKAKLDEAAKQQASLATM
                     SGAALNGFGGGGGGYLFANLPGMAAAAPAPAPPAVVAAKSKAKRKSGDVMPPPGTKRA
                     PEKSPEPTKSEDTAESVTNSILKVQQAIRRLSMSPAPSKMANLAAIDSNSPRMGGTQL
                     KFDSPLSASSVDVDAAIHGSDMEAMRKALRELRRENEDLREKLVTTQREARVAISRVT
                     GDVIARAKIAEQEFSRKF"
     gene            complement(<96304..>97185)
                     /locus_tag="OSTLU_26368"
                     /db_xref="GeneID:5004316"
     mRNA            complement(<96304..>97185)
                     /locus_tag="OSTLU_26368"
                     /product="predicted protein"
                     /transcript_id="XM_001420375.1"
                     /db_xref="GeneID:5004316"
     CDS             complement(96304..97185)
                     /locus_tag="OSTLU_26368"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420412.1"
                     /db_xref="GeneID:5004316"
                     /db_xref="JGIDB:Ost9901_3_26368"
                     /translation="MPRVIAAGVRARVRTPAPASIHSARRARASSGALLNAQPRHSAR
                     SVRRPSACRASARRRDEAKAQNALDAAVDVDNLGYTEPWAVELVTFWREYAGARDRVV
                     RALVDVGETHREMRDPAQIAIAGDRLRRLLPDIDVCAVFERDPGVLKIEFVAASKRVL
                     ELQDVLCSSDMCRDVTGLIERHPQLLLVDDIHAHIERAVAKLASLEPNCDARAVVDEF
                     PELIYRIHSYDYVESLPISIQNMLLDSASEDDTRLEDYERMWDEREAADRERDDFFAD
                     DASEWMVDGFWEGPTAD"
     gene            complement(<97367..>102983)
                     /gene="CHR3510"
                     /locus_tag="OSTLU_17234"
                     /db_xref="GeneID:5004317"
     mRNA            complement(join(<97367..100243,100551..>102983))
                     /gene="CHR3510"
                     /locus_tag="OSTLU_17234"
                     /product="predicted protein"
                     /transcript_id="XM_001420376.1"
                     /db_xref="GeneID:5004317"
     CDS             complement(join(97367..100243,100551..102983))
                     /gene="CHR3510"
                     /locus_tag="OSTLU_17234"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420413.1"
                     /db_xref="GeneID:5004317"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="JGIDB:Ost9901_3_17234"
                     /translation="MAESGGSRLDRLIKLLDTGSTAAARREAARQIGELAASHSTQLP
                     NLLRRVRAHLRSKKWETRVAASATMSEIASRLRHPSVDALIAMESDGAERDAGRDASE
                     AKTGRDANAGSDALDLTFAKFDVERVLEKAGILLSSSGIGWRLENGPGTKAERLAQAK
                     ASLKRRLGMELGPEAGAMMDENMKMSDLVKDEDLLDDGKVTVQEKVAVGDSAAEAVDG
                     LTGDVDYSHLSARELNKLKRKAKRMLREGANPLDAKRSKQDEEAARLEQEKAEAEEDD
                     EEQAEVAAGGWPLARTCETLAYMMFSEGWEERHGAAAALREVLRHQAASAAIWAPPPG
                     VKPEPGTVEIARESNAAWLEDMCVRLLCILALDRFGDFAGDGAVAPVRETSAQALGAA
                     LLPLSPQAVDAVVSCTLTLLSRPEWEVRHSALLGLKYILAAKSELAVELLPAALPAAT
                     KALVDADDDVRGAAAESLLPAVEHLPSHPQFNELLSSLWGLLNELDDLSPSAVPVMKL
                     IAELYALESTRAKSTAALAEVVPRLWPFAAHPIPAVRLAVWQTLARLLAVEPNASTQL
                     WVQEACAPAMRHAFQGALLDVDAASADAASEAWVALLRTVPIAIIEATFTVHGAKWCE
                     LATTVANARGEGKLIFVSTPPSVKGEIRAVAKDWPATTAGRMRGLECLARLAAAFGAH
                     ERSSSVARMEQHIVGMLTGELATARLAGAHLLTSWLRVVPPGPQRPTLQAPGAQLGAI
                     LANTNPAYPSAPSPTPYGEVAQMVKYVKSESMAFLRVAATNGVVVTGEVPSPEADGFG
                     ADSAATLSAAVPQSEIAAVETARGSLHASAQRLRDTEAKLHGAVLAAAAGAAVGFGAL
                     PPKLNPFIQPLMSSVRRERDADLQAHAAASVAAMMKLCTSRSPSPNDKLLKNITSMIC
                     GDEAETPKAGLTEEVEEEEDDGKKKKSVAGIVDEEVISDATIARRGGEAVIRSAASLF
                     GADVFNQLGALDALMMKPITQAPPENAPTATLQSLVDALQLFKILGPVVHEALEEKVI
                     ETTKTAFAAALYTDVAVRKTAAKTIASIASKHPERIISSLLDFIVPKLEEGEAASQTA
                     KRAGAVGLASELVDTLGAVLAPYCVLLLVPLMGRMSDPDLKIRGNATRAFAKLVPLLP
                     LAVGKEPPNDLTTKQKERSKKDGEFLEALLDNSKIEDFKLPFKCARTLRPYQQDGVNW
                     LAFLRRFKLHGALADDMGLGKTLQSTCILAATTVERKEAGLKTLPHLVICPSTLVSHW
                     AYEIGLYVEPDVLRPLEYHGSPPDRRALQKDFGKYDVVIMSYESVRADFDSLDKFDWC
                     YCVLDEGHAIRNPKSRVTQAVKSVRAEHRLLLSGTPIQNDVVELWSLFDFLMPGFLGT
                     EREFKKTYGIAAARSAAAKKGGGLSEQGALATGALHKQVMPFVMRRTKDEVLKDLPPK
                     IIQDVYVELTDAQRKMYDAFESSEAKDQAVSAIEGGGGAEGAAQHVFTTLQYLRKLCS
                     HPKLVVSDGASKKFNPEMRSPKFDALKQILIDCGIGVDLEEEKSNGDEGKPNPASGAG
                     HRVLVFSQLKSLLDLVENELFTTQMRDVSWLRLDGSIPPSQRFDVVRKFNADPSIDVL
                     LLTTHVGGLGLNLTSADTVVFLEHDWNPQKDLQAMDRAHRLGQRKTVNVYRILTRGTL
                     EEKIMSLQRFKLDVANAVVNADNASMSAMDTGQMLELFTAEKGVKLGKDGAPVAKGAA
                     AAAAGAASGGLSNIVNGLEEMWDEAQYAEEFSVDDFVSKLKHK"
     gene            complement(<103122..104238)
                     /locus_tag="OSTLU_19724"
                     /db_xref="GeneID:5004318"
     mRNA            complement(<103122..104238)
                     /locus_tag="OSTLU_19724"
                     /product="predicted protein"
                     /transcript_id="XM_001420377.1"
                     /db_xref="GeneID:5004318"
     CDS             complement(103122..104237)
                     /locus_tag="OSTLU_19724"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420414.1"
                     /db_xref="GeneID:5004318"
                     /db_xref="JGIDB:Ost9901_3_19724"
                     /translation="MTRERAPTTATLEALRHLVRAAKEDSAILDAPALEFFRRWLEED
                     LGATIPAPRTTTTTGTGTDAIEIEDDEAMAAESDDLSAIAMGAETAPETLGEAEEAKA
                     SEAKRLASEAFAREAWEEAIERYTEALMIAPSALTYAKRAECFIKLRKPLSAIRDGTA
                     ALKLNPDSAKALKVRGAAHRYLGHWNEANADLSAGLSQDFDETYGEMHKKVLSVVHEL
                     HVREGKARAAKEAKEREELEKRRAAAEAARKEAAAKDAGGPGFGQPGAGFPGGAGDLP
                     PGVSPEMAQKLMSDPDLIAAMQNPKVMQALQTMMKNPMAAMQYMSDPEVGPVLQKLMA
                     SMGGAMPGGAPGGFPGGFPGGFPGAGAAPGGAANDVD"
     gene            <104616..>105890
                     /locus_tag="OSTLU_17236"
                     /db_xref="GeneID:5004445"
     mRNA            <104616..>105890
                     /locus_tag="OSTLU_17236"
                     /product="predicted protein"
                     /transcript_id="XM_001420211.1"
                     /db_xref="GeneID:5004445"
     CDS             104616..105890
                     /locus_tag="OSTLU_17236"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420248.1"
                     /db_xref="GeneID:5004445"
                     /db_xref="JGIDB:Ost9901_3_17236"
                     /translation="METALEDAKSMIEYARARWRVGARGDARGVLEHASVALRRRGEE
                     PATSSAIARARTAWAHLARERGERGTARDAARDARDAARESGAPEDGASADAMWTLLE
                     AREEAKEATWADVVEGARRGAGGGAGGRCAAAGAETLAALTRRRARDALEAAETCEIA
                     LRGMSSEELREAKDAPHGWAIASAMKALGHVERLTPSGSSERALELYERAAEYAKDVA
                     LSEHPGAMASRMIAEDLQADCALARAQAYAALGDVENAETFAARAVSAAEALGDEKHP
                     RVGAAIAVSGDVYVAKALRSMSNDEKTSLGDGAGVMFAEGLYKSAIKLMHYPHVVEDG
                     KIVLDYEARHLCALLHARYSSILRASGGQREREANAWLESAKILWPDERGDDEGVDGV
                     DIVTKAATKLGVKHGPSVLIDLQQMAPLTMGA"
     gene            complement(105875..107107)
                     /locus_tag="OSTLU_26372"
                     /db_xref="GeneID:5004287"
     mRNA            complement(105875..107107)
                     /locus_tag="OSTLU_26372"
                     /product="predicted protein"
                     /transcript_id="XM_001420378.1"
                     /db_xref="GeneID:5004287"
     CDS             complement(105983..107092)
                     /locus_tag="OSTLU_26372"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420415.1"
                     /db_xref="GeneID:5004287"
                     /db_xref="JGIDB:Ost9901_3_26372"
                     /translation="MARERTTDASTPARAADASRLLALFDLSNVSPICVSRASWLRAA
                     SSATGKVVPPVEDETFPFDASPTAAVFAPTRGRRAKDDDARVARAPVKAAAVVKSQDA
                     GRARTTVPTVTATRANDDDDDDGGAIDGVIYEEDRNALFEAQLRRAMAAEAAGVDVGR
                     MLAAKGGLANSPPKASGGDDDAEANSEGDGEAKVEDDLSARDDVAMDVDAPVEFVNSP
                     VNSPAVEASPPASAAEDDAFERMLSAALKETRGASTPIEKQPLDRAVPKREFKPKLEV
                     KSPEKYEPAAKPTPSTSALDFEAKLEAAMRAAEAGGDLTAILSGPSSKTANSPVGTTS
                     AEARVNYRELGFTKAERRHHSLHVETEEAASERKT"
     gene            complement(<107273..>107599)
                     /locus_tag="OSTLU_9345"
                     /db_xref="GeneID:5004446"
     mRNA            complement(<107273..>107599)
                     /locus_tag="OSTLU_9345"
                     /product="predicted protein"
                     /transcript_id="XM_001420379.1"
                     /db_xref="GeneID:5004446"
     CDS             complement(<107273..>107599)
                     /locus_tag="OSTLU_9345"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420416.1"
                     /db_xref="GeneID:5004446"
                     /db_xref="JGIDB:Ost9901_3_9345"
                     /translation="ERDANDDVKSQGARESSPKLVPYNVRVATPPPVDLGLHKLPKNI
                     ACGETIEVPTNADGDESANGWFIVNRVTTMYNLVRGRYRKDGSRLDVQKAERYFINAS
                     LERLYSK"
     gene            complement(107892..>109954)
                     /locus_tag="OSTLU_25201"
                     /db_xref="GeneID:5004447"
     mRNA            complement(107892..>109954)
                     /locus_tag="OSTLU_25201"
                     /product="predicted protein"
                     /transcript_id="XM_001420380.1"
                     /db_xref="GeneID:5004447"
     CDS             complement(107906..109954)
                     /locus_tag="OSTLU_25201"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420417.1"
                     /db_xref="GeneID:5004447"
                     /db_xref="JGIDB:Ost9901_3_25201"
                     /translation="MGDRTRQIAREWVMKCADVVLDARARAATPRDARDGGMKANRWF
                     NCACARRRETTRAMERDEAARDGGTRAVKELEGDSVDAFVEGAVTVDVYFERGGDAST
                     SGERALVERWAFHAGADGERVGGNNHFNKDLDTAVVYKRAVIMVRTVVAMLRTLPAHG
                     ARLRAMRRRGARDGGGGGGFSFEIKNVDRGGTIASAHPGKAEGYRTYAFTDVPTSIGK
                     LSACVYFLDQVAMSALEDECVAVVETAPTPCERLDASVGPDVVALAGGEMSLSPSPTG
                     KSDAPESLQRARREEDSSPMSRGILFDEASPSPSPNARPPIRGGMTASLSSGSLQQQA
                     KPPVSPSVVPLADYTSPNYQRFDNAPSSAPNNGPAPIYGFNAAPVGAKHALQSAIESP
                     LVEPPRPPPRRSTMASCLKIDVGTSIDKDDFVAKPPGANDIGAPSPSIAVAQPPPPPA
                     PASPMTTIGFSPTTAAPIACSPRVRAPKDGRSGPAPHGSPSPWGGFVCPESPIPSPGG
                     AAFAHPRSVPRSSWSPSSSLGTSIRDVIGVYPHSPGGVSNFARRMSGASDDAAPGSPL
                     TPHAADESIDNQDEFPFAIDDADATATATYVEHTPADLLSLLENPCTLRRRSLDGPLP
                     LDAALEDSTDSIVNQSAELDKSVGGDDKSRAASNGMTLGSALRALAELDVAAKTQFTD
                     "
     gene            <110690..>111544
                     /locus_tag="OSTLU_43950"
                     /db_xref="GeneID:5004448"
     mRNA            <110690..>111544
                     /locus_tag="OSTLU_43950"
                     /product="Tat family transporter: protein export TatC"
                     /transcript_id="XM_001420212.1"
                     /db_xref="GeneID:5004448"
     CDS             110690..111544
                     /locus_tag="OSTLU_43950"
                     /codon_start=1
                     /product="Tat family transporter: protein export TatC"
                     /protein_id="XP_001420249.1"
                     /db_xref="GeneID:5004448"
                     /db_xref="InterPro:IPR002033"
                     /db_xref="JGIDB:Ost9901_3_43950"
                     /translation="MVPLASAAVTTVKEKRTFVEAPPEDVQREQVRSFLYPGEDELPD
                     DVSMTIWEHLEELRERALISAAAVGALILVCFCFAKDLTIFLEEPVKSQGVRFLQLGP
                     GEYFFTTVKVAGYTGLLAGAPVVLYEAIAYVLPGLTLNERKTLGPIVIGSSVLFYGGI
                     AFAYYVLVPAALKFFVGYADGAVESLWSIDQYFEFVLVLLFSTGLSFQVPVIQLLLGQ
                     SGIVSSKQMLSVWKYVVVGSVVAAAVLTPSTDPFTQMLLAVPLMSLYLGGAALVGVFE
                     KDREGETA"
     gene            complement(111600..>112178)
                     /locus_tag="OSTLU_26376"
                     /db_xref="GeneID:5004288"
     mRNA            complement(111600..>112178)
                     /locus_tag="OSTLU_26376"
                     /product="predicted protein"
                     /transcript_id="XM_001420381.1"
                     /db_xref="GeneID:5004288"
     CDS             complement(111681..112178)
                     /locus_tag="OSTLU_26376"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420418.1"
                     /db_xref="GeneID:5004288"
                     /db_xref="InterPro:IPR002738"
                     /db_xref="JGIDB:Ost9901_3_26376"
                     /translation="MLALGEDLEKFDVLALEPTSERAFASACANKHADVVSVGAGRRL
                     RYKFTASAVRAATGNRISFELCYGEALRDSNSRMWFFANASALARATRGGRELFILSS
                     GAERAIELRSMYDVVNLATFFGMTEKAARAAMTTNVHAMLAMCKRRRDAAATDSVVER
                     MDASA"
     gene            <112783..>114261
                     /locus_tag="OSTLU_44053"
                     /db_xref="GeneID:5004449"
     mRNA            join(<112783..113478,113506..113646,113707..>114261)
                     /locus_tag="OSTLU_44053"
                     /product="predicted protein"
                     /transcript_id="XM_001420213.1"
                     /db_xref="GeneID:5004449"
     CDS             join(112783..113478,113506..113646,113707..114261)
                     /locus_tag="OSTLU_44053"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420250.1"
                     /db_xref="GeneID:5004449"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="JGIDB:Ost9901_3_44053"
                     /translation="MTRSSATRGSGDDYDLDAGIAGATPGDGWTPTSYDGRGSTGDVY
                     QGPARLAEGLRRHTVLVYVADETGMINRVAGVFARRGYNIESLAVGLNIDKAIFTISV
                     ICSDGDVGKLIKQVNKLAKVRKVENVTDKECVERGLMLLKVKCEPEQRSQVLEINRIF
                     RASVVDVAERSLTMSVVGDPGKNRAFQSALMKFGVIQVARTGKLALKREPVYSEARSR
                     RVKLMEAMRKAKDASAKYESILASRIVRAVAGMEHDDDGDLHVGDVYTSLENDEIGVW
                     DVPMDENAKYTPHTISILVDNRPGVLDSITGVFARRGYNIQSLGVGPERTFDISRIST
                     VVPGSTEDIAMLLKQILKVPYVISAEDITMTPFTERELMLIKVVSSRAQRAEIIDLCG
                     MFRAKVCDISEDTVTIEVSGRQRKINAIQALLEPYGILEVARSGRVALPRDSGVDSKL
                     MMAIESESDLDKW"
     gene            complement(<114298..>115152)
                     /locus_tag="OSTLU_43937"
                     /db_xref="GeneID:5004319"
     mRNA            complement(<114298..>115152)
                     /locus_tag="OSTLU_43937"
                     /product="predicted protein"
                     /transcript_id="XM_001420382.1"
                     /db_xref="GeneID:5004319"
     CDS             complement(114298..115152)
                     /locus_tag="OSTLU_43937"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420419.1"
                     /db_xref="GeneID:5004319"
                     /db_xref="InterPro:IPR006992"
                     /db_xref="JGIDB:Ost9901_3_43937"
                     /translation="MRASIIDAHVHVWPSAEDFAYEDGKAPPVPGAANELIAAMDANG
                     VRAAMIVQPINLGFDHTYVERALETHANRFVGMCLANPSAGDAGVEALEKLLAGRFRG
                     VRFNPGLWPNGKGMDGEIGRKMMRACAARTPPAVVGFMCFNGLDLHVDEIRALLKAEP
                     TVPVLIDHFGFTKGVDDPNFELLQALGRDFPQVSVKVSAHFRVRIETSDGGDSTATQL
                     RELVKVFGPHRLIWGSDYPFVTAEEGGYADAVRVLERQIGDDDPALLANIRGDNFLRL
                     FPGALGEA"
     gene            complement(<115309..>116238)
                     /locus_tag="OSTLU_5336"
                     /db_xref="GeneID:5004450"
     mRNA            complement(<115309..>116238)
                     /locus_tag="OSTLU_5336"
                     /product="predicted protein"
                     /transcript_id="XM_001420383.1"
                     /db_xref="GeneID:5004450"
     CDS             complement(<115309..>116238)
                     /locus_tag="OSTLU_5336"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420420.1"
                     /db_xref="GeneID:5004450"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="JGIDB:Ost9901_3_5336"
                     /translation="VVVGGGVIGLTVALTLAERGMDVRVVAASFERTTSSVAAAFWFP
                     FIVRTEPAALSDAWAIKSYEWYRELAREDGACGVEMRRCREFLKAPAPAAGWANAVEH
                     YRALERGEHDEKYAGGYEFDVPVIAMPKFLPWLRTRCEALGVKFETRTLADVREARAF
                     ASNSERAFVVNCTGLGARRLVNDDLVKPVRGQVVYLKQDCGYGLFDDDPNALAYLIPR
                     ADCTVLGGTAQVDNDSLEPDDADERDIIAKCKRLWPELDETKVIGTNVGLRPSRTVVR
                     CERDPADATLIHAYGHGGAGVTLCRGTALEVLAL"
     gene            <116921..>118330
                     /locus_tag="OSTLU_17244"
                     /db_xref="GeneID:5004451"
     mRNA            <116921..>118330
                     /locus_tag="OSTLU_17244"
                     /product="predicted protein"
                     /transcript_id="XM_001420214.1"
                     /db_xref="GeneID:5004451"
     CDS             116921..118330
                     /locus_tag="OSTLU_17244"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420251.1"
                     /db_xref="GeneID:5004451"
                     /db_xref="JGIDB:Ost9901_3_17244"
                     /translation="MCEPKRGRELTKLLQMLVEYLLHVQEALSEGKAKAERDAEGWKD
                     RARTERDEARKSARELRLAMEAHEAELIAVAAEYAKKRNNPDNAELEDARRRGESMAA
                     ERAAKDLEKRLREQRELFDSAVDRMRAAHAEAQAEAARELSARKAELASARAQYVASS
                     TESTKEANRMVADAQALIREAREKAELEKSNVARVRSELNAAVEATQRHKRSLVDVKS
                     ELTRLKEDFKFEHESNAELRKALERRDEERKLMREQIERLHGKQKSSMTEEMAELTNM
                     RELAKNNYAEIERLKRENEVLREDKNAQSTWVAEEKKRWVSANEQILQAELTEKDNAI
                     AQLREEISQLRNDIATERSRKMITIKPIIAEYEARAQAAPPVAPKPAVKAAKARKTLE
                     PPPSDVQDMDGALHAAMLDLDVDLDAVAEAGLDDATFQEAMAKFEAVQMQDVPKELRA
                     KYALSRAKIQKELDGVAVR"
     gene            complement(118375..>120080)
                     /gene="SDG3510"
                     /locus_tag="OSTLU_25206"
                     /db_xref="GeneID:5004320"
     mRNA            complement(join(118375..118642,118678..>120080))
                     /gene="SDG3510"
                     /locus_tag="OSTLU_25206"
                     /product="predicted protein"
                     /transcript_id="XM_001420384.1"
                     /db_xref="GeneID:5004320"
     CDS             complement(join(118612..118642,118678..120080))
                     /gene="SDG3510"
                     /locus_tag="OSTLU_25206"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420421.1"
                     /db_xref="GeneID:5004320"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="JGIDB:Ost9901_3_25206"
                     /translation="MPFGLGGMGAALPKSKKAQKVDEADAIRVEGNEKFAKGDYLGAI
                     AAYDAALKLNGSDASAYANKAECYLRARVFEKALECATKALECSKGDKAMELKAIYKK
                     SMALNGMARYVDAAKTADEGSRLADAPEDAAVRATLEKVKLECDMLTAQAFTGAYDLG
                     ALYLNRMGASFRRCADYIGVVRVSKLSDGRRGLVTTSAVAAGDLLMVQSPLSSASFGK
                     TVEQNLVRGLYEAARAHPADWAILKALPASSEDEQKDAPEMSVFRKHISAANKENAPA
                     PESPEELAFIPKVVANCAISGRRLCGVWPLPSFINHSCAPNCHRINVGQIMLVFASQN
                     LPAGAEITMKYYDTLMPKKDRDAFASRRGYMCNCARCAFESTGDVSEEKKADEAEEND
                     EGAGPITCAVNELKRKLKPVLKDFKEELAEMKKTKGKTVPNVNPLIELRGWYESRLAA
                     LNLSRAQLAMARMSCYSMSGRDEARAR"
     gene            <120487..>121224
                     /locus_tag="OSTLU_93415"
                     /db_xref="GeneID:5004452"
     mRNA            <120487..>121224
                     /locus_tag="OSTLU_93415"
                     /product="predicted protein"
                     /transcript_id="XM_001420215.1"
                     /db_xref="GeneID:5004452"
     CDS             120487..121224
                     /locus_tag="OSTLU_93415"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420252.1"
                     /db_xref="GeneID:5004452"
                     /db_xref="JGIDB:Ost9901_3_93415"
                     /translation="MSAPVDVARAAAARVRADASSTSRAGSGVVVRHRGVACVLTAAH
                     VASFAGAKNALRVELASGAARRGRVVGVHDALDLAVVYLDGDLDGAATMEPGEARVGD
                     EARALGTAQRYAAATAACADAIRGRRETGRVLKIHRDDRGDDTHAMHDARVLAGQSGG
                     ALVRETDGKLLGVHSFGDAFWGGSRDVCVLVNAATLDAIEIARDGVDPEVYATARVNA
                     MIFRSSDEALKRMAPELSAKQRASWIF"
     gene            complement(<121311..>122288)
                     /locus_tag="OSTLU_44228"
                     /db_xref="GeneID:5004321"
     mRNA            complement(join(<121311..121745,121797..>122288))
                     /locus_tag="OSTLU_44228"
                     /product="predicted protein"
                     /transcript_id="XM_001420385.1"
                     /db_xref="GeneID:5004321"
     CDS             complement(join(121311..121745,121797..122288))
                     /locus_tag="OSTLU_44228"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420422.1"
                     /db_xref="GeneID:5004321"
                     /db_xref="InterPro:IPR001406"
                     /db_xref="JGIDB:Ost9901_3_44228"
                     /translation="MVASKRIAAAVPRYLAFLEYDGARFRGFQRQCGVAATVQGALDE
                     ALTAFTGARGAIECVGSSRTDVGVHALRNSAHFDFARTTKDGTTVEPHDGASVRRGVN
                     YHLRKLGAAVRVTECVRVDEMNPKFHARHDAVARRYRYDILVGERDDGGSLFDAERAW
                     YVRATCDGRLNVDAMRDAAAALTGTHDFSSFRANGCQASSPVRTLTSIDVKEELTEWP
                     AAEARGTKQKISIAVAAPSFLYHQVRLLAGALKAVGANDLTVKDVQELLEAKDVARAP
                     QMAPAHGLYLADVAYLENYAVRPAYGARDEDA"
     gene            complement(<122500..>123963)
                     /locus_tag="OSTLU_93416"
                     /db_xref="GeneID:5004453"
     mRNA            complement(<122500..>123963)
                     /locus_tag="OSTLU_93416"
                     /product="predicted protein"
                     /transcript_id="XM_001420386.1"
                     /db_xref="GeneID:5004453"
     CDS             complement(122500..123963)
                     /locus_tag="OSTLU_93416"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420423.1"
                     /db_xref="GeneID:5004453"
                     /db_xref="JGIDB:Ost9901_3_93416"
                     /translation="MSLRATNPRFGARVASARATLARRRARPGRVDVVPRAGPKNRLR
                     EKEAKKRSSSARDYEREMDDYVEKHVAPATRALDAARARPERRSDAQRFIRKVQRKVK
                     KASQKAVDALLPRDAGAFRPRADVPARVGAPGTYATVYRPQRPNPASAYGRAAAAWGT
                     LFACAWIALKVINRENPLRAIGSAFKGVGRRAPPPGATGPGRWVGDRSLGGRQVWVPA
                     TADRFRDERKRLEGALDDVPEDANVKPGSATKARGNEKKTSGAAKALPAWWTPPSPQY
                     VPPGRKEALIQVAKAQGATLAAKRVSGAGFSADDIADFRAACAAAGERGCAVKSVGPE
                     SARVAIFRAAADFAVTDAMRGQAGATSAFNTPVGPFLVGLSDDLSLDAHKCVSIVMAD
                     VAVRVRGAVVQAGAGLRSNDSVATMLELNKLVDLFNTFPFTPDAPELDMLSVGLRSRL
                     SEDERRRICDEFDAISNGEHSAVVRVAVCGASDSAYE"
     gene            complement(124055..>126241)
                     /locus_tag="OSTLU_25207"
                     /db_xref="GeneID:5004454"
     mRNA            complement(124055..>126241)
                     /locus_tag="OSTLU_25207"
                     /product="predicted protein"
                     /transcript_id="XM_001420387.1"
                     /db_xref="GeneID:5004454"
     CDS             complement(124793..126241)
                     /locus_tag="OSTLU_25207"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420424.1"
                     /db_xref="GeneID:5004454"
                     /db_xref="InterPro:IPR002466"
                     /db_xref="JGIDB:Ost9901_3_25207"
                     /translation="MRAHAVDDVDDVERVAAVVRACALATYDARGREKTSKDAYTTLC
                     AFCIVERNDAASARGTCYVAAFATGTKCVPMANRARDGGAIGDCHAEVLARRALTRWL
                     QREYAEARDGRASVFEVTRERGAGCDEETAWDEILGAGNRVRMRAGVEVHAYCSQSPC
                     GDASVFELPSEARRSDGGAEASTATVKRAKTTGGAGGGAGVTGAKILTDMNGGGGGGG
                     GADPERDRPTQEVGAVRWKPGRGAPSFCLSCSDKMCRWQMHGLQGTLMRLVAREAIKP
                     RSICVSIPNVREERAEETKRVVALALKRAIVKRARLDDSQSDDRVEPRCVAVDAPSDD
                     LSSYRAVVDGDRVASPTCVTYVAPSRSTFEFNDAVGAVDIASGRVERLLGAIGFLHGY
                     GKKCRASGAASSALCARELCASFDADVLSRLPPRARRAMENKPYAAIKREFRAFRSRD
                     FGIPSSPPLPGKDKSDHESFVPFPRRVRSAAS"
     gene            <127000..136289
                     /locus_tag="OSTLU_26387"
                     /db_xref="GeneID:5004455"
     mRNA            <127000..136289
                     /locus_tag="OSTLU_26387"
                     /product="predicted protein"
                     /transcript_id="XM_001420216.1"
                     /db_xref="GeneID:5004455"
     CDS             127000..136278
                     /locus_tag="OSTLU_26387"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420253.1"
                     /db_xref="GeneID:5004455"
                     /db_xref="JGIDB:Ost9901_3_26387"
                     /translation="MSFSTGKVRKRKYPDSFYYVVAPEADEEVGYLGAPSDWPTGDRV
                     TVDLHTGCSPIDALPFQRPGFDFDTVQARFVSKKLSMEFMFEDSQPMTKVGCGHFRAT
                     VELSKGWEFGFYLHANGDDSDENTMLDIGCETAVPGANNTKCPDFASPAMLATSECTD
                     KFVCNHGLYTFWNRRYDGEQTSFLWGACGSECPHQDCGHMYCAANERVQNQACASCPP
                     GTTNDAGDKNVGADTQCDPVICGAHMRVQDHNCVQCVAGKENEAGDDASQSNTECDAV
                     ICEPNHHVAGNVCTACPAGHAHAGGDVQHGPDTSCDEVLCHTNERVLGHQCVACPPGS
                     TNAAGDGAASGDTQCDHTICPANMHVVGHVCTPCPPGMNHPGGDDAFFGDTSCSAILC
                     QSNQRVLGHACVSCPPGTTNDADDDASGGDTQCDPVICGAHMRVQDHNCVQCVAGKEN
                     EAGDDASQSNTECDAVICEPNHHVAGNVCTACPAGHAHAGGDVQHGPDTSCDEVLCHT
                     NERVLGHQCVACPPGSTNAAGDGAASGDTQCDHTICPANTHVVGHVCTPCPPGMNHPG
                     GDDAFFGDTSCSAILCQSNQRVLGHACVSCPPGTTNDADDDASGGDTQCDPVICGAHM
                     RVQDHNCVQCVAGKENEAGDDASQSNTECDAVICEPNHHVAGNVCTACPAGHAHAGGD
                     VQHGPDTSCDEVLCHTNERVLGHQCVACPPGSTNAAGDGAASGDTQCDHTICPANTHV
                     VGHVCTPCAPGRDHPGGDDATLGDTSCSAIMCGPNQHVVSHACTVCPAGMVNDANDDA
                     SGGDTHCDPILCPSNQRVQGHTCVQCAPGKTNAPNDDASRGDTECDITYCAANQRVQG
                     HQCVACAPGTTNDAGDDASQVDTQCAPIICGAHMRVQSHACVQCVPGRENLAGDDASG
                     QDTPCDEIVCEENHKVVSHQCVACPAGKIHTAGDVASGPDTSCDAVTCSTNERVQGHQ
                     CVACPAGTTNDGGDDASGGDTQCDPVICPAQTHVQNHVCEVCPPGHAHPGGDDASQGD
                     TQCDAVMCGANYHVQDHHCVPCPTGKDNQANDNAAGADTECDIIYCAANQRVQNNVCT
                     ACPPGTINAGGDNAFDHDTTCDTVYCGVNQHVFENECVPCPAGMVNPSGDDATGPRTF
                     CEPIICGAHMHVQNHQCVQCAPGDENLAGDSAAQHDTTCDEVTCSANEHVVSHQCTAC
                     PAGHAHAGGDVQHGPDTSCDEVLCHTNERVQGHQCVACPPGSTNAAGDGAASGDTQCD
                     HTICPANTHVVGHVCTPCAPGYERLAGDDATGGDTQCSAVLCGANMHVQNNLCAACPA
                     GTTNAAGDDASRGNSECDHTICEAHMRVQSHQCVACMDGKENLAGDDAAGGDTQCDEV
                     ICAADHHVLNHQCVSCPYGHAHAGGDVQHGPDTSCDEVLCHTNERVLGHQCVACPPGS
                     TNAAGDGAASGDTQCDHTICPANTHVVGHVCTPCAPGREHPAGDDATGGDTQCSAVMC
                     GSNMHVQNHVCTACPAGTTNAAGDDASGANTQCDPILCGANQHVLNHQCMQCPPGTLN
                     DASDSAAGGNTQCDAVQCGCNQRVQGHQCVTCAPGTTNDAGDDASQGDTQCDPTICGA
                     HMRVQDHACVACVDGRENLAGDDASQGNTQCDEIVCEENHKVVSHQCVACPAGKIHTA
                     GDIASGPDTSCDAVTCSTNERVQGHQCVACPAGTTNDGGDDASGGDTQCDITRCTAHM
                     HVQNHVCVQCPAGKENVAGDDASGGNTECDVVRCGANQHVVDHVCTACPAGTTNDEGD
                     DASGANTQCDPVICELHMRVQNHQCVACAPGKENLAGDDASQGNTECDAVICSANEHV
                     VSHQCTACPAGHAHAGGDVQHGPDTSCDEVLCHTNERVLGHQCVACPPGSTNAAGDGA
                     ASGDTQCDHTICPANTHVVGHACTPCPPGHEHPAGDDATGGDTQCSAVSCGPNMHVQN
                     HACTACPAGTTNAAGDDASGANTQCDATICAHNKHVVNHECVPCPDGHEHPGVADASG
                     SDTSCDVTLCGANQHVVNHQCMQCPPGTLNDASDSAAGGNTQCDTVQCGVNQRVQGHQ
                     CVTCAPGTTNDAGDDASQGDTQCDPTICGAHMRVQDHACVACVDGRENLAGDDASQGN
                     TQCDEIVCEENHKVVSHQCVACPAGKIHTAGDIASGPDTSCDAVTCSTNERVQGHQCV
                     ACPAGTTNDGGDDASGGDTQCDITRCTAHMHVQNHVCVQCPAGKENVAGDDASGGNTE
                     CDVVRCGANQHVVDHVCTACPAGTTNDEGDDASGANTQCDPVICELHMRVQNHQCVAC
                     APGKENEAGDDASQGNTECDAVICSANEHVVSHQCTACPAGHAHAGGDVQHGPDTSCD
                     EVLCHTNERVLGHQCVACPPGSTNAAGDGAASGDTQCDHTICPANTHVVGHACTPCPP
                     GHEHPAGDDATGGDTQCSAVMCGSNMHVQNHVCTACPAGTTNAAGDDASGANTQCDVT
                     LCGANQHVVNHQCMQCPPGTLNDASDSAAGGNTQCDAVQCGCNQRVQGHQCVTCAPGT
                     TNDAGDDASQGDTQCDPTICGAHMRVQDHACVACVDGRENLAGDDASQGNTQCDEIVC
                     EENHKVVSHQCVACPAGKIHTAGDIASGPDTSCDAVTCSTNERVQGHQCVACPAGTTN
                     DGGDDASGGDTQCDITRCTAHMHVQNHVCVQCPAGKENVAGDDASGGNTECDVVRCGA
                     NQHVVDHVCTACPAGTTNDEGDDASGANTQCDPVICELHMRVQNHQCVACAPGKENEA
                     GDDASQGNTECDAVICSANEHVVSHQCTACPAGHAHAGGDVQHGPDTSCDEVLCHTNE
                     RVLGHQCVACPPGSTNAAGDGAASGDTQCDHTICPANTHVVGHACTPCPPGHEHPAGD
                     DATGGDTQCSAVSCGPNMHVQNHVCTACPAGTWNDEGDDASGANTQCDPVICEVHMRV
                     HDHACVACAPGKENEAGDDASQGNTECDAVICEPNHHVAGNVCTACPAGHAHAGGDVQ
                     HGPDTSCDEVLCHTNERVQDHQCVACPPGSTNAAGDGVASGNTQCDSTICGANRYVSN
                     HVCVLCPYQHYRAAGDDATGPDTACIRYYGLG"
     gene            <136408..>136911
                     /locus_tag="OSTLU_17249"
                     /db_xref="GeneID:5004322"
     mRNA            <136408..>136911
                     /locus_tag="OSTLU_17249"
                     /product="predicted protein"
                     /transcript_id="XM_001420217.1"
                     /db_xref="GeneID:5004322"
     CDS             136408..136911
                     /locus_tag="OSTLU_17249"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420254.1"
                     /db_xref="GeneID:5004322"
                     /db_xref="JGIDB:Ost9901_3_17249"
                     /translation="MRASARVASARAVVKRERDARSTRARAFVPPIVPNPRQGDDDAN
                     ADAAPTLPNIERALAPHGWAIGAERGYDDTPHAFKIFKVRDGHHTLEQLQEALYVSDE
                     RGCRIRRETQSLFYMCCDGVRCRLNEGKKEIVVEMPCDLDSVGAYVAKAKVIEDIIKS
                     SQKKRAS"
     gene            complement(<137037..>140204)
                     /locus_tag="OSTLU_26389"
                     /db_xref="GeneID:5004323"
     mRNA            complement(<137037..>140204)
                     /locus_tag="OSTLU_26389"
                     /product="predicted protein"
                     /transcript_id="XM_001420388.1"
                     /db_xref="GeneID:5004323"
     CDS             complement(137037..140204)
                     /locus_tag="OSTLU_26389"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420425.1"
                     /db_xref="GeneID:5004323"
                     /db_xref="InterPro:IPR002093"
                     /db_xref="JGIDB:Ost9901_3_26389"
                     /translation="MPAPSPGVSVGALARCGNPFAHTPAWPKTQRTTPETAAAARRAR
                     GKGFMYLRDEDDDADAVTPVSRRRAPASAPGPSARATAMAQSPFVIMQRHMAGSATPY
                     ANLDAPAPDSVTLTTASGKSVIARANGAIRTDEQPRFDDDDEAYEDAFTFRAAIETPA
                     TTRAESGGVFTSAAPKGLVFQTGGGASIAVSEDVKRRARAMFADVDENDPSSSGRERP
                     SAAAATPPAASGGGGLVFQTAAGATLELSEAALKKSRAFLAEVGNENTPVRAAFPQPS
                     FKTPKSLPAVRKAPSKAPGFTPPMKSTTAFTPPMSILGARTAASAPRQAKRSRHDGTG
                     ASVGVAVHDLFAARVRMGMRAPLCTFFNNLLPFQVRPAFVDTCVATLNADTAKSLRLP
                     SVERGLVGWREMRELMIKAGASDASLTNEWVANAYKWIVWTQACMARAFPEKYAFGVL
                     SESAVLQRMLYKYEREINRAERPHVRRILEKDENPGAPAVYVVSAIRSMTTASGIGNV
                     PTMSEIEISDGWYSVRARLDAKLTRAVREGRLRVGYKIFVVGAELRGVTDAVSPLSDD
                     AEMAYVCLHVNGARLAPWDAALGRVTYNLTIPLRSVVPDGGVVPRMLIHVRHAYPMMH
                     QERRDADKNVLRCEIAERRAHAEWQRARDSVLHELQDAMHNRIGGWGSEVDQERAIRE
                     ALQEKNLYDRRTSAVLRLNVVGFMPSSKHESYRGPITRGSTSAILTIWDADEALVDAA
                     QPGQSFAVTAIKPRANAFIEGELSLSTTRYTRWTPIPQEDIAAQKLEHSEHEWRCLSV
                     RAAVDLADLSRSGLVRKEFDAVACTLHCGPPRSTQRGRLSQWIFCFDSSVLDSTTPNA
                     ARPHLLAVEITGYDDDSFVKADDWMPSTKLFTEARHECGPPLVLRNLEFQHYDADNGV
                     YVARVPIENVSVTLAAQTPGIHRISVASRDLERFCGSRDDRSRSIIASLKSRARALTG
                     VPENAESLVDEMPWDEVHASQEPASQYDPPRLSMDDDWNDENAQSLADEAVRLTRSAS
                     KAPVVVPTPTPRRTPRRSSRGSASR"
     gene            <140854..>141684
                     /locus_tag="OSTLU_13022"
                     /db_xref="GeneID:5004456"
     mRNA            <140854..>141684
                     /locus_tag="OSTLU_13022"
                     /product="predicted protein"
                     /transcript_id="XM_001420218.1"
                     /db_xref="GeneID:5004456"
     CDS             140854..141684
                     /locus_tag="OSTLU_13022"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420255.1"
                     /db_xref="GeneID:5004456"
                     /db_xref="InterPro:IPR011576"
                     /db_xref="JGIDB:Ost9901_3_13022"
                     /translation="MSRARSASDAGAEALAEALARHESRAARLSFAEEARVILDTNGC
                     GALSTLGNQRAGVLAGFPCGSVAAYASDEDGLPIFALSALSQHARDARENGKATLTVT
                     RAEFEDVSDGRVSMSGILTEVDAGEATARARARYLARHPGAFWVDFGDFAWYKMTEVV
                     AIRIVGGFARAGSVTVEEYANARPDPVAAFSAPVCGHMNADHGDSLRDVVKHYVGVDV
                     DSVEMRSIDALGMNCRVVKDGEKYACRLPFESAATGRKEVKDQIVLMTRNAAAAANAQ
                     "
     gene            <142606..>142887
                     /locus_tag="OSTLU_43989"
                     /db_xref="GeneID:5004324"
     mRNA            <142606..>142887
                     /locus_tag="OSTLU_43989"
                     /product="predicted protein"
                     /transcript_id="XM_001420219.1"
                     /db_xref="GeneID:5004324"
     CDS             142606..142887
                     /locus_tag="OSTLU_43989"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420256.1"
                     /db_xref="GeneID:5004324"
                     /db_xref="JGIDB:Ost9901_3_43989"
                     /translation="MLGICAASAEEGLAALKTWTAELGLPKGKLHGMDKDGIPVDPPK
                     GAVFIKYNSLSGDAYISGYGGTFRGVLFTPELDDGAFRQYGYLPLDVLL"
     gene            complement(<142951..>144252)
                     /locus_tag="OSTLU_44390"
                     /db_xref="GeneID:5004325"
     mRNA            complement(<142951..>144252)
                     /locus_tag="OSTLU_44390"
                     /product="predicted protein"
                     /transcript_id="XM_001420389.1"
                     /db_xref="GeneID:5004325"
     CDS             complement(142951..144252)
                     /locus_tag="OSTLU_44390"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420426.1"
                     /db_xref="GeneID:5004325"
                     /db_xref="JGIDB:Ost9901_3_44390"
                     /translation="MIPDGVASASATSIAASENGEAEEFNLLRSCYVCKSRFRKMHHF
                     YAALCPECAELNWEKRSQTADMRGKFCVVTGARVKIGYRIALKLLRAGANVIATTRFP
                     VDALKRFEGEDDAGQWIGRLQILAMDLRDLPALEKLCAHLLATLPRLDVLVNNACQTV
                     RRPPAYYKHLLQAEARSGFTRSLAGANARCDFLPSADAEAPSPTALSDWRQGDKFKEA
                     GWMAPSAAMSQLQLIASDADESNEHFPEGALDVNGQQVDLRTKNSWTMKLGEIETPEL
                     LEVLAVNAAAPFVLNGKLRPLMAKTVAVDKEAGVEYAAAFIINVSAMEGQFARAKLST
                     HSHTNMAKAALNMMSATSGKDFAEDGIYMNSIDTGWINDENPLEKAARLAKEKGFQTP
                     IDEEDAAARVLAPVFEGFSEPPQAWPPVFGKFLKDYRETFW"
     gene            <144787..>145818
                     /locus_tag="OSTLU_88555"
                     /db_xref="GeneID:5004457"
     mRNA            <144787..>145818
                     /locus_tag="OSTLU_88555"
                     /product="predicted protein"
                     /transcript_id="XM_001420220.1"
                     /db_xref="GeneID:5004457"
     CDS             144787..145818
                     /locus_tag="OSTLU_88555"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420257.1"
                     /db_xref="GeneID:5004457"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="JGIDB:Ost9901_3_88555"
                     /translation="MSYAKSTRPTRFLRVCPLRARDEARALAEGAAREAVEVDARDID
                     AKRAVTFEFARVEDATAALERLRGGRTRASVFGAGVADGETALACGYSARASDSRAPE
                     RERTKASRRSSVEGLTLIENFVTVDEERALATLAATSGDETRLARRRVKHFGYAFDYG
                     TRDANLKVVDEIPELAMEVLRRLPRETPGYEGAMRCDQVTVNEYPRGVGLAPHVDTHS
                     AFGDTILSLSLLGGTVMEFRTSGEAHRAIYLPPRSLLVMHGESRYRWQHYIPHRKFDT
                     LEGEAAPTPRDDVRLSYTFRERRSGPCECAFPLQCDSRDGAQSKCSKRKTGKTQAFAE
                     LVGESGDSF"
     gene            complement(145809..>147583)
                     /locus_tag="OSTLU_50834"
                     /db_xref="GeneID:5004326"
     mRNA            complement(145809..>147583)
                     /locus_tag="OSTLU_50834"
                     /product="predicted protein"
                     /transcript_id="XM_001420390.1"
                     /db_xref="GeneID:5004326"
     CDS             complement(145841..147583)
                     /locus_tag="OSTLU_50834"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420427.1"
                     /db_xref="GeneID:5004326"
                     /db_xref="InterPro:IPR000184"
                     /db_xref="JGIDB:Ost9901_3_50834"
                     /translation="MTLKPNYSYRAREVAGESHVIKSELGIFKSVRALAKDTRDGMRV
                     TFEVVPFEILRGVELQGLEAVPAKVVEETFRPMMGKPINSNHVSGAVEYFKAYAESKR
                     GIDSIEGISLLEEPSDGVLRLGFVDVDINDVKVEIDPSIDAKTGKENKVLSKVDSVMP
                     YFENIKTTKVLNGMRVRETIDRFRAQNPRFGEPQINMLPKPGPLGKRTLLVSLKEKSM
                     KGVTCGGGMSARGLSEGIFSGIAGHFSAFHTNLFGQGKMLNLGVEATPRKGGRGLTVV
                     RPQVNLQYQDPWVGFGPTRTSRAMSVRSESSSMRSTHGVNSTNVDGDQPDITSPGLSE
                     MSLQRLQTSVEHSRPLLNGWNGMFSVDFKRTGVLDNDGNHSLFDAYGAPVTFSGTKCD
                     TALAAQMRFTYGGPNAAQLMLSAEQALPVQPQWLNYTRMVAKAKRSFNLLSVGSLPGP
                     VQLVLSSKGGSVVGDLPPYEAFAIGGTSSVRGYNDGAIGTGRKYVVGSAEMRVPVTPT
                     ITGAAFFDYGSDLHSGGSVLGDPAGTRGKPGSGYSYGVAGMFETGGLPIRFDYAKNDQ
                     GNARFHFSLARDFN"
     gene            complement(148080..150353)
                     /locus_tag="OSTLU_26395"
                     /db_xref="GeneID:5004458"
     mRNA            complement(join(148080..149680,149936..150353))
                     /locus_tag="OSTLU_26395"
                     /product="predicted protein"
                     /transcript_id="XM_001420391.1"
                     /db_xref="GeneID:5004458"
     CDS             complement(join(148347..149680,149936..150185))
                     /locus_tag="OSTLU_26395"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420428.1"
                     /db_xref="GeneID:5004458"
                     /db_xref="InterPro:IPR000343"
                     /db_xref="JGIDB:Ost9901_3_26395"
                     /translation="MSAALAPRAIAVGARATRKPTKKNFRHALRAVVDSETPQGDQTK
                     PMQVQRPTRDAVTLRPAGVSDAVVDSSKALEALAALGGNPYESERKSSIVTVGLSIHN
                     CPVEIREKMAVPPEAWNDAVAELCAYPHIEEAGILSTCNRMEIYVVALSYERGLKEVE
                     EWMVKHSGVDVESLREHLFVLKDRESTGHLLKVSGGLDSVVMGEGQILAQVKSVFAMG
                     ESEKAFGRHLTGLFKAAITAGKRVRSETSIASGAVSVSSAAAELVQMKLPSQSFEGVR
                     VLIVGAGTMSKLLVKHLASKRCTEMTIVNRTKPRAEALAEEFPEVNMRIELMDQFLTL
                     AGEHDVIFTASSAVDPIICKDDLAKMSVCGDAVGGKRRLVDIAVPRNVDANCCEDPNT
                     LVYNVDDLKELAEINKAKREAAGLEAEALLLEEQRNFEAWRDSLETVPTIKRLRQKAE
                     NIRSAELDKAMTKLGDGLTNKQKKAVEELSRGIINKILHGPMAALRSDGSDPTAVALT
                     LVNMHALERMFDLRNVDED"
     gene            complement(<150716..>151975)
                     /locus_tag="OSTLU_2307"
                     /db_xref="GeneID:5004459"
     mRNA            complement(<150716..>151975)
                     /locus_tag="OSTLU_2307"
                     /product="predicted protein"
                     /transcript_id="XM_001420392.1"
                     /db_xref="GeneID:5004459"
     CDS             complement(<150716..>151975)
                     /locus_tag="OSTLU_2307"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420429.1"
                     /db_xref="GeneID:5004459"
                     /db_xref="InterPro:IPR008915"
                     /db_xref="JGIDB:Ost9901_3_2307"
                     /translation="KLVNILESPEEAAIAPKDVERIKKEIFGMQTFYVTAVENLGAEM
                     NGAGVLFKGNLRTERAKVWETVQADLERMFNGEYTAFMLEEPPGEDGPSGDVAIDSKY
                     GPRVSFLIVPSDRAGPSPGTAGWQYLLALALMGLTVGSAVQLGLVAEVSKLPPETMSW
                     LQQAGDVELPEGALPPGLENFDSVAYVESALPVTIGVMAASVGHEVGHQIAAFMRKIK
                     IGIPFLIPNSQLGTFGTLTQIKSTPETRADLFDVAAAGPVAGGMVALNLFVYGLTLSM
                     GGDSPDLIPIPNALFNSSLLLGGISQLFLHAGAKGVMVHPYFIAGWCALTTQALNLLP
                     VGSIDGGRMTQTAFGRRVLGATSLGTYIGLSFGIIASSLALPWAIYIVLTQRTPEFAP
                     KDDVTEVDDGRATLAFALIAVAFLVLLP"
     gene            <152763..>153614
                     /locus_tag="OSTLU_93419"
                     /db_xref="GeneID:5004460"
     mRNA            <152763..>153614
                     /locus_tag="OSTLU_93419"
                     /product="predicted protein"
                     /transcript_id="XM_001420221.1"
                     /db_xref="GeneID:5004460"
     CDS             152763..153614
                     /locus_tag="OSTLU_93419"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420258.1"
                     /db_xref="GeneID:5004460"
                     /db_xref="JGIDB:Ost9901_3_93419"
                     /translation="MLRCARAPTPPTPTPTPTPTRGARARVRRASTRARALDDDDARR
                     DSRFASEDERRRAVERLAPPKRDGDRAKPRLRELGKKRAMGFTSGAASSGEAREAARR
                     ARLERRDARATRESREIMSAMRDALDAWESEIDGMTDFARASVLEQASTATEMFERLR
                     DEGFGAVESAFAVMSWMDDAIEDAAARADEDAATSTSTSKERVEDASKASKSKTAPDG
                     VVGALSDALRQWFAIDITELEDGRKSIVVNASAEFLAVFILLLVASAHFGGELVSDFL
                     APDPLLR"
     gene            <153796..>155079
                     /locus_tag="OSTLU_43912"
                     /db_xref="GeneID:5004327"
     mRNA            join(<153796..154053,154165..>155079)
                     /locus_tag="OSTLU_43912"
                     /product="DMT family transporter:
                     UDP-galactose/UDP-glucose"
                     /transcript_id="XM_001420222.1"
                     /db_xref="GeneID:5004327"
     CDS             join(153796..154053,154165..155079)
                     /locus_tag="OSTLU_43912"
                     /codon_start=1
                     /product="DMT family transporter:
                     UDP-galactose/UDP-glucose"
                     /protein_id="XP_001420259.1"
                     /db_xref="GeneID:5004327"
                     /db_xref="JGIDB:Ost9901_3_43912"
                     /translation="MSRRAVDAARDDRVVSCDDDVDSRSLASDPSRASTSHAATTDFA
                     VLLHPTAHFILVAAATIGSLALYGVLQERVMTIPYARERGESEDVFTCSMFLVFMNRW
                     VALASSGALAMVTGWGGGATRGGAKDYAAVSFSNLVATVCQYEVLKYLTYSVSTLAKT
                     MKVVPVMIWGQFLGEKKFTSREYFDAAVMTFGCFVFVANRGWRSAVQKRYEGEYDESS
                     LEWAANAGFLILAVYFVFDGFTSTFQQKMYRRDGVTVTAQVFFTSFFTTVFGFAWLVI
                     TDQLSPSIRFVHDHPAIVGDILLLSCASTVAQFSIAYTIKSYSAVILASIMTFRQFLS
                     VLISCYVFSSPLNVVQWLGILLILAPLTFKHVAFANWAESAHPSSSKSDDDRLNAL"
     gene            <155281..>157881
                     /locus_tag="OSTLU_44236"
                     /db_xref="GeneID:5004328"
     mRNA            <155281..>157881
                     /locus_tag="OSTLU_44236"
                     /product="predicted protein"
                     /transcript_id="XM_001420223.1"
                     /db_xref="GeneID:5004328"
     CDS             155281..157881
                     /locus_tag="OSTLU_44236"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420260.1"
                     /db_xref="GeneID:5004328"
                     /db_xref="JGIDB:Ost9901_3_44236"
                     /translation="MSIAAWSTARDAATAFAARDALVPIDDAARAAFAELRSQRCEDL
                     LERAFLRAFERALRDDALPRWREACAMPSSIDAGALERTNAEERDEEEEETRARAEGW
                     TRAEAAPATTAFAEWIERGRERARAFSAGVRGVSEDDDAVRTFERAFDAMVGGTCAAR
                     GPPRLSAILSAWYRARAREFDHAVRKRWGETSDDDENDRMETSVLERQSSIGADIASC
                     GEVMGRAWAAETSAMGETLARCHASLGRVAENAAARALGECVKRHVIRRCRGAFDAPK
                     LWPTLRWVRAVPLEFFKTALRLKRVDGAAIESWRGRLEYTVHEHLGALRIHELFDIIV
                     DYPDSLPAITDLRTCLQNTTLHAALVDSFVDAMRSRLLHAGASTVDIVQQYIGTIKTL
                     LELDPSGVVLELVSGPVKEYLRERKDTIRCVVTMLTDDGGEDGGEGGEGALYVELGRL
                     ARGESIEIAESSVPAPNPNATVSGTDNLDRMDSITAEMVAIAAGANDDDLADGVQSTQ
                     QVLSGWDAWEPEPVETEAAASRGRRRKAGDIIGLLVGIYGSKELFINEYRTMLAEKLL
                     SKSNYDTEREMHALELLKLRFGETSLHNCEVMLKDFADSKRANANIKTRPTTGTPSAK
                     DRRTSDILIQTPVEATIVSSLFWPAFSTDLTDFKLPTEIQEHMDAYARRYHQIKAPRK
                     MEWKASLGTVVMDVTHNDRTFEASVNPLQAAILHYFQREKVWRANDLANALGVSVDAL
                     RKRIVIWMNNGVLVERKEGHVISYALAEPSDEVDAMDGVHDDDEHVSGVATAEETAAA
                     GMMVYEQYIMGMLTNFPSLPLDRIHNMLKMFVVEPVYDKTVAELEGFLLELVAQDKLA
                     MDGSAFAKKK"
     gene            complement(<158028..>158831)
                     /locus_tag="OSTLU_26400"
                     /db_xref="GeneID:5004329"
     mRNA            complement(<158028..>158831)
                     /locus_tag="OSTLU_26400"
                     /product="predicted protein"
                     /transcript_id="XM_001420393.1"
                     /db_xref="GeneID:5004329"
     CDS             complement(158028..158831)
                     /locus_tag="OSTLU_26400"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420430.1"
                     /db_xref="GeneID:5004329"
                     /db_xref="JGIDB:Ost9901_3_26400"
                     /translation="MRCASALARASAPLNACARRTGRGARARDALALKRATVGVRRTI
                     EIESIRPRTAARARASVATRASSLDDDVVVVPGDYRVGGVLLGVALLTGPALHLWTQF
                     LVHGVLGGFLAFQASRVRFRFTRTDLEVVFIEPGADDSAALATDVASSGDNKLQGGGE
                     NRWAYDTITNWEFWWPGFPCLVYFKETQTKSDGQPHFFPIIMDGKMLYEVMLSRLPPS
                     QNEKPSPSEWSLDLALEQTQIGRQIKENLNEDQLRQIKEMKGFPVLDDK"
     gene            <159327..>160241
                     /locus_tag="OSTLU_17260"
                     /db_xref="GeneID:5004461"
     mRNA            <159327..>160241
                     /locus_tag="OSTLU_17260"
                     /product="predicted protein"
                     /transcript_id="XM_001420224.1"
                     /db_xref="GeneID:5004461"
     CDS             159327..160241
                     /locus_tag="OSTLU_17260"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420261.1"
                     /db_xref="GeneID:5004461"
                     /db_xref="JGIDB:Ost9901_3_17260"
                     /translation="MCANIERSTGRRCSLETLRMVAACAPAGTITFRAKTSRADDLKN
                     IHVDVDLGIEEGSSGNDKAGMVAMRAKMAAIRAKMVMIVANTHEGDAYDASAAPPESW
                     REDFDLESVPLPEPVKIAFMEDSSRDGPRLLSSTSAPLLGEASTSALGRGGVSEGELT
                     RAMSDLGPDGKGISARAVQAVLERQAIVEAFNDPSAVADRERRRLHGRLPHVFDAVRT
                     AFAARKRSVMELDPLLDELMHTNARAEISAHELADGVRILARMCPEWCTIVHARHGDE
                     ELFRIVSRDPATARVARAKLAKLCRDAA"
     gene            <160506..>161953
                     /gene="PAFE3501"
                     /locus_tag="OSTLU_17261"
                     /db_xref="GeneID:5004330"
     mRNA            join(<160506..160558,160663..>161953)
                     /gene="PAFE3501"
                     /locus_tag="OSTLU_17261"
                     /product="predicted protein"
                     /transcript_id="XM_001420225.1"
                     /db_xref="GeneID:5004330"
     CDS             join(160506..160558,160663..161953)
                     /gene="PAFE3501"
                     /locus_tag="OSTLU_17261"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420262.1"
                     /db_xref="GeneID:5004330"
                     /db_xref="InterPro:IPR007852"
                     /db_xref="JGIDB:Ost9901_3_17261"
                     /translation="MDPLRLIRDHTIAGIIAESTHDDERIHLKDVDVELRRTTETNYR
                     SKAGNKLLKVEAIWYFIKYHVANPDAAHTAYMKAAIAAGFSTLSMLDRKDLIAYLTGE
                     RATSDRIDITVPVIVDEEGVSTVDAKRAREEDEAEGVPRERVLRDRNSVLRAPKDMTS
                     VLDFFAAPEEEKERLEEEKQQAADLAKGIKNQRYRDVKEQVFWREHVGSDFDMMNLDT
                     NASFLSGPKPPVDDGTDMLMTDARAMEKQPTAPSGPSTASRGGPAAAAKAPRKTSGKP
                     GGVPIIIVPAGFNQKVVLNMFNAKEFLQDGKFTQWDVVQKGGAKKSSSVYISRTYKRD
                     GAKVKYEVTEKAPHKRSEDWARVAAVFVLGAKWQFKDWPFRGVEDGDLVETFTKIRGF
                     HARFDGDPEVDVVKTWNVKPITISRTKRHGDRAAFEFFWDELDRHLALRSSALKY"
     gene            <162436..164391
                     /locus_tag="OSTLU_26403"
                     /db_xref="GeneID:5004331"
     mRNA            <162436..164391
                     /locus_tag="OSTLU_26403"
                     /product="predicted protein"
                     /transcript_id="XM_001420226.1"
                     /db_xref="GeneID:5004331"
     CDS             162436..164301
                     /locus_tag="OSTLU_26403"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420263.1"
                     /db_xref="GeneID:5004331"
                     /db_xref="InterPro:IPR006088"
                     /db_xref="JGIDB:Ost9901_3_26403"
                     /translation="MATKPGALYDFPWAEWGSMKYAVFLPFVATVALGKDDGDSFCWH
                     LLAIAALRYASAQLWISLSRVHAWTRKTRIQARGIDFKQVDREDNWDDYILLQTLVIA
                     LVHWMPGLGFNNFPATNEKTAVQLLLLHAGPTEFIYYWLHRALHHHKLYSAYHSHHHA
                     SFVTEPITGSVHPFMEHLMYTANFAIPLIGTWALGGGSIAMFYMYLLGFDMLNAIGHC
                     NFEFIPRWFMRLPLMKYLIYTPSYHSLHHSRVHTNFCLFMPLYDHVYGTADVTSDELY
                     EKAINGRAVPVTAPDVVFMAHGTELLSVFHLPFMLRSFSSRPFVSQWWLKPFWPLCVP
                     FVLVLRMFGKSFVADRHRLKTLNCETWVTPAWGFQFFIKSEFNHINRKIEEAILDADR
                     AGVKVVGLGALNKNEALNGGGALFVNKHGKSLKTRVVHGNTLTAAAILQKIPSECKEI
                     FLTGATSKLGRAIALYCVERGMRVVMYTTSEERFEKIRNEAAKKDQHLLVQSTSLSDG
                     AKIKDWVIGKHCPEKDQNMAPRGAIFHQFVVPPIPETRKDCVYTDLPAFKLPKEAKDF
                     RSCEMTMKRGHIHACHAGALVHSLEGWDHHEVGAIDHTRIDTTWEAALKHGFALA"
     gene            complement(<164644..>165027)
                     /gene="PRPL24"
                     /locus_tag="OSTLU_17263"
                     /db_xref="GeneID:5004332"
     mRNA            complement(<164644..>165027)
                     /gene="PRPL24"
                     /locus_tag="OSTLU_17263"
                     /product="Plastid ribosomal protein L24 large ribosomal
                     subunit"
                     /note="imported to chloroplast"
                     /transcript_id="XM_001420394.1"
                     /db_xref="GeneID:5004332"
     CDS             complement(164644..165027)
                     /gene="PRPL24"
                     /locus_tag="OSTLU_17263"
                     /GO_component="plastid large ribosomal subunit"
                     /note="Chloroplast ribosomal protein L24; Chloroplast
                     large ribosomal subunit protein L24; imported to
                     chloroplast"
                     /codon_start=1
                     /product="Plastid ribosomal protein L24 large ribosomal
                     subunit"
                     /protein_id="XP_001420431.1"
                     /db_xref="GeneID:5004332"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="JGIDB:Ost9901_3_17263"
                     /translation="MEIVAKKKWEKQALTPRGLPVRIPMHVKTNDKVVVIAGADKGKV
                     TNVVEVFTKTGEVLCKDVNVKTKHVKPRGEGETGQIIQREFPIHHSNVMHYSEAKSVR
                     SRIGTKEEGGKKVRVLKKTGEVLAN"
     gene            complement(<165613..>166530)
                     /locus_tag="OSTLU_26405"
                     /db_xref="GeneID:5004462"
     mRNA            complement(<165613..>166530)
                     /locus_tag="OSTLU_26405"
                     /product="predicted protein"
                     /transcript_id="XM_001420395.1"
                     /db_xref="GeneID:5004462"
     CDS             complement(165613..166530)
                     /locus_tag="OSTLU_26405"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420432.1"
                     /db_xref="GeneID:5004462"
                     /db_xref="JGIDB:Ost9901_3_26405"
                     /translation="MDVAALTARAVDAYNTSHTFARDVLSHRLAVDDANAAHALVAIV
                     TLLAIVVAFRVVFGVGGAFAALASGPGSRSKTYKPAVLLLGGKGCGKTALWQGLKYGE
                     QRFRTTTSVEANECGDAVVVGKNSRGREVTKSHVRVVDVPGHAKLRKEALRELARARA
                     VVFVVDSVSFASERKEVAKFLFDILSDESFQTRKIPLMIACNKCEKLTAHPPDFIRKR
                     LEREIDAARAADAGSLPEMAITAAQRRANAVAKKKRDKYRTLCQRPGETFTFDAFTKA
                     SRRPGVVCDRVSAMKNQLAPLCDFIVRVT"
     gene            complement(<166618..>167232)
                     /locus_tag="OSTLU_17265"
                     /db_xref="GeneID:5004463"
     mRNA            complement(<166618..>167232)
                     /locus_tag="OSTLU_17265"
                     /product="predicted protein"
                     /transcript_id="XM_001420396.1"
                     /db_xref="GeneID:5004463"
     CDS             complement(166618..167232)
                     /locus_tag="OSTLU_17265"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420433.1"
                     /db_xref="GeneID:5004463"
                     /db_xref="InterPro:IPR000056"
                     /db_xref="JGIDB:Ost9901_3_17265"
                     /translation="MLDEGADWLHVDIMDGHFVPNLTIGPPVVADLAKRVGPRDAFFD
                     CHLSVSNPATLVPALAAAGASSVTFHIEVVSGTAAEELCKTIRSLGMRAAVACKPSTP
                     CDEDGGVYELVDAGLVDMVLCLSVEPGFGGQKFNPAVCDKVSALRARYPDLDIQMDGG
                     VNPSTAELCARAGANVLVAGSAVFGAANPAQVISQLRQSILNAS"
     gene            complement(<167368..>168813)
                     /locus_tag="OSTLU_2596"
                     /db_xref="GeneID:5004464"
     mRNA            complement(<167368..>168813)
                     /locus_tag="OSTLU_2596"
                     /product="predicted protein"
                     /transcript_id="XM_001420397.1"
                     /db_xref="GeneID:5004464"
     CDS             complement(<167368..>168813)
                     /locus_tag="OSTLU_2596"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420434.1"
                     /db_xref="GeneID:5004464"
                     /db_xref="InterPro:IPR000577"
                     /db_xref="JGIDB:Ost9901_3_2596"
                     /translation="VVGVDGGTTGIRAGVFTLTGVPLAFADVPYATSHPAPGRAEQVP
                     ASWLDGLATAIAEARRLCGVDARDVAAVCVDTTCCSVVALDARGDAIGNSVLWMDVRA
                     SDEATACVETEDDALRVNCAGAGPVSAEWMVPKALWLKRNDRERYDRATMICEYQDYV
                     NLWLTGRYCGSMNNVGVRWHFDGDGRPPMTMLEKLGCAELVEKWPKEILPMGAAVGGM
                     TARAAAACGLLEGTKVIQGGADAFVGMVGLGVIEPGQLALITGSSHLHLGVAEEEFHA
                     KGIFGTYRNALVESAPFVVEGGQTSTGSVVNWFKNLCGGGDSFYDDMNREASAIPPGC
                     EGVVALDHFQGNRTPHVDALSRGVISGLTLKHSKAHVFRAILEGVCCGTRLIFETMTR
                     GGYEPKEVVIAGGATRSELWLQIHADVTGVPHVVTECSDAPALGCAILAAFGAGLFGS
                     VREAVAAMVRKSRVISPNPEAHAAYADVYAAY"
     gene            complement(<168890..>171292)
                     /locus_tag="OSTLU_93421"
                     /db_xref="GeneID:5004465"
     mRNA            complement(<168890..>171292)
                     /locus_tag="OSTLU_93421"
                     /product="predicted protein"
                     /transcript_id="XM_001420398.1"
                     /db_xref="GeneID:5004465"
     CDS             complement(168890..171292)
                     /locus_tag="OSTLU_93421"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420435.1"
                     /db_xref="GeneID:5004465"
                     /db_xref="InterPro:IPR001293"
                     /db_xref="JGIDB:Ost9901_3_93421"
                     /translation="MGGLVRLRDARGNGTDFWMSTNRATPWTARGALGRARRDAGATL
                     DGVDARGGAAMTSGRMETAGEDSTAATRGDDAEEAAEDDALEHAPTVFVGFPHASLVC
                     PQCRDVMLSPVVAENGTTYCAKCAPREDAEDALAEDAEVEDAIQSLPVLCRRAMVLKR
                     NAQGASEWCWKADGCGESGIRLRLRDVHDRECAFVPRRCWYPYDSRVECEANEARKGR
                     DYCGAIVTKIAYVSHVSECAWRSVKCDVKGCEDVVPFCKMTQHALTCPSALVKCPNEC
                     EWDGKRRELAEHREICPREYIKCGFINLQHEDGNGCLYGCERDAIDSHRTDCDFRPWH
                     CPSCDAVVNAMHASIHAVKCEESRRPCPRCRAMVRTRAFDAHQEFFCVGASKPCAFAA
                     FGCLEVGAETELRAHERDAAPRHLRLVVKALEAERSSGRKKSKVIERMEQALNKFGEE
                     YASLATKASERVRFVESKAIEEMDRLNEHMESSKRAYDAHVVALEKEIEQLKADRAAA
                     VDADAHLAKLDTAITCEEAQQLLDAAKGEMASVNAQFAKLQFAIDVREQKWEEDIEHA
                     ATKEAATREAVRREIASIIATTSGADDDLLKRMDTLSTEIREISRTLNLDLMDLADKQ
                     KELEDAWRRANENPRLRASAPRAKNPPSPTRGDSDSEASEAVSVKPRRKFKTTSDTTS
                     ETASERSHRRLGSATLRARRLAAAAAASSEDLTNAPIPPSIIAMTDSERSFDPTSRAD
                     LADAPEPPSAAAAAAVADDDILRGALLSRYVHVTAKPNAAPEPNPLVVPRPPWIDSDD
                     DL"
     gene            171605..173511
                     /locus_tag="OSTLU_26408"
                     /db_xref="GeneID:5004466"
     mRNA            join(171605..171963,172152..173511)
                     /locus_tag="OSTLU_26408"
                     /product="predicted protein"
                     /transcript_id="XM_001420227.1"
                     /db_xref="GeneID:5004466"
     CDS             join(171754..171963,172152..173492)
                     /locus_tag="OSTLU_26408"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420264.1"
                     /db_xref="GeneID:5004466"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Ost9901_3_26408"
                     /translation="MSLTSDEMNYLVYRYLLESGFTHAAFALGNESYVDGRKLTDGQR
                     EVPPGALISFVQKGLQYCELEANLNEDGTDVDADFSVLSAKDLLSLSVDELKELVSAR
                     RNMTEEERKALREEEEKEARAKAEANGIKIESDIEREIKSEEVTVLDGHTSEVFICAW
                     NPTKQMLASGSGDSTARVWTVPAGPSGREAQTKLAKPKVLDHKASGDGVEAMDTDEKS
                     AAPDGKSMQGDVTTLDWNADGTLLATGSYDGQARIWDTNGKLKMSLKHHKGPIFSLKW
                     NKTGDCLLSGSVDKTAIVWDAKTGDMKQQFAFHSAPTLDVDWRSPTEFATSSMDHSIY
                     VCKLGDDKPIKAFNGHTDEVNAIKWDPSGTLLASCSDDFTAKVWSLKKDTCVHDFNEH
                     EKEIYTIKWSPTGPGTENPDLPLLLATASYDATIKLWDVESGKCLHTLEGHTDPVYSV
                     AFSPDGKYLASGSFDKHLHIWNVKDGSLMRTYQGEGGIFEVCWNKEGTKVAACFSNNR
                     VSVLDFEN"
     gene            complement(<173569..>174831)
                     /locus_tag="OSTLU_26409"
                     /db_xref="GeneID:5004333"
     mRNA            complement(<173569..>174831)
                     /locus_tag="OSTLU_26409"
                     /product="predicted protein"
                     /transcript_id="XM_001420399.1"
                     /db_xref="GeneID:5004333"
     CDS             complement(173569..174831)
                     /locus_tag="OSTLU_26409"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420436.1"
                     /db_xref="GeneID:5004333"
                     /db_xref="JGIDB:Ost9901_3_26409"
                     /translation="MTFAGVVGALEVALDQSVRRASGGLRQACSRESTESKPYGIAAT
                     CLRQLEAVVEALANSNGDDVVARDRAAAEVSAWALVSELFAEDKLGASRGTAAEVHRR
                     RAGVSAWLREQVARAAPCEEELFGRRAALTHVAGGRTVSAARAAAAHGDPRLATCLAQ
                     IGAGKNVAFYAKQQLTRWRAGSVGKYIDEFSEQAFKLLAGEVERDDDGMGWYQNLGLH
                     MWLAAGPTSPLRDVVKNYLDAVAQQRAANPLPPVATYEALDANQATHLRDVAFNILAL
                     AASTEDEGGSPSTAEVRVAFHPLTYSDDVLNASLAWHLFGVLNAIGVLEGEGMDALAD
                     EITVAFATQLLGMPERGRCEWAVFVSQHLRDDTRRTKMTGHILRERFEEWKCDDGKIA
                     FIKDVCAVPQESLDDAHALWDVYSTPRP"
     gene            complement(<175889..>176176)
                     /locus_tag="OSTLU_7301"
                     /db_xref="GeneID:5004467"
     mRNA            complement(<175889..>176176)
                     /locus_tag="OSTLU_7301"
                     /product="predicted protein"
                     /transcript_id="XM_001420400.1"
                     /db_xref="GeneID:5004467"
     CDS             complement(<175889..>176176)
                     /locus_tag="OSTLU_7301"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420437.1"
                     /db_xref="GeneID:5004467"
                     /db_xref="JGIDB:Ost9901_3_7301"
                     /translation="YYVAAFTLVFEYVHAMDIVFRGMDPETMTIDQHGALRLTDFRFA
                     KHLAVTDDTPGKTFTACGAAAYMAPEVVRGVGHDERADWFSLGTFIVHLLNG"
     gene            complement(<177689..>178597)
                     /locus_tag="OSTLU_4795"
                     /db_xref="GeneID:5004468"
     mRNA            complement(<177689..>178597)
                     /locus_tag="OSTLU_4795"
                     /product="predicted protein"
                     /transcript_id="XM_001420401.1"
                     /db_xref="GeneID:5004468"
     CDS             complement(<177689..>178597)
                     /locus_tag="OSTLU_4795"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420438.1"
                     /db_xref="GeneID:5004468"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="JGIDB:Ost9901_3_4795"
                     /translation="SYAMRYAACSQRGYYPEALSKANQDAHVSEARFGDRDDECVFGV
                     FDGHGEFGTECARFAAMRVPMEMAKREFGDAKGYEEAFRTTNEALRRSEVDDSLSGTT
                     GIIAHVKGRDLYVINVGDSRATMGIEKADDKGEVVVETVDLSSDQTPFRADECERVKK
                     AGARVMTLDQLEGFKDPTVQCWGTEQDDDGDPPRLWAKNGMYPGTAFTRSIGDAVAER
                     IGVVATPEIERVRLNKDTKAIVIASDGVFEFIPSTSVIKAAMATSDPQQSAIALVVES
                     YKLWLQYETRTDDITVIVILIEDFPDE"
     gene            complement(<179087..>181975)
                     /locus_tag="OSTLU_88568"
                     /db_xref="GeneID:5004469"
     mRNA            complement(<179087..>181975)
                     /locus_tag="OSTLU_88568"
                     /product="VIC family transporter: potassium ion channel
                     subfamily H"
                     /transcript_id="XM_001420402.1"
                     /db_xref="GeneID:5004469"
     CDS             complement(179087..181975)
                     /locus_tag="OSTLU_88568"
                     /codon_start=1
                     /product="VIC family transporter: potassium ion channel
                     subfamily H"
                     /protein_id="XP_001420439.1"
                     /db_xref="GeneID:5004469"
                     /db_xref="InterPro:IPR005821"
                     /db_xref="JGIDB:Ost9901_3_88568"
                     /translation="MAAAERARAKTRDRATRATRDGDSDDEFFGAGATPNASDARDAT
                     TASAHDSAGSDEGARGDGDGKLDAANGTRAMTRAEKVKDAIRRAKEAAKAGIVNVPRG
                     SAARAKHGLATSAKALREKEEGDTRRRLDENKMARAAMTAAASEKHKQKMFDTTRLEN
                     FLDHGDESEADWNAADSDEDEDEASAIAKYGDDDEARSLFVMHPTTKLRQYWDFLQIF
                     LLLYIAISVPYRIGFSEPSYGLWYVADFLVDIYFYIDMFFNFFTAYWETSADDDDFHY
                     VTNLWKIQKHYLKGWFIPDAISLIPVDYVSRSIDGTLTCSWESEAACGAAAENSQVPE
                     VLRLFKMLRLLRVMRTGRILERYQENLMRVYKMVTLGRLLALLVLLSHWMACAYAYVY
                     DFQREDASGVESHKSEMYVAALFWSVQTLTTVGYGNVVPTTVDERVIAILVMITGGFV
                     FSAIISGVNMSMDEDSPGNRFAVLMNHVRELLSEHKMPNGLKSRVRSHYKASAKPQKL
                     VNRDIIQPLPEAIRADVNFYIYGKALSIGLKANGTVQPDGIVIEILCRTMDTHMYARG
                     ARICYPYELADKFIITLNGRVSYSPDEASGFHHSHVQKIKRKRLREQQIELAEEKGLL
                     RGPGTVLNPGLLSGFYKGMLCAMPFDKHVEALVMDHAVFYDICAQHQPTLLRNFEDEF
                     LHALQALNKPKMARIALSECDMRRFLEETTRNVCSNWRELLQQERAQEDTKRRAREQA
                     GAIGTVTAGGFKDTNVPVSGAAPGATMGAIKLAMQQMHADIVNISEQIAQVMIAVKEV
                     QVVGQDTASNVSHIIISNDTIEEKQLNMELNVEAVYQSLQQIASNGLSMEAGGWHGGG
                     GGGGKQVFDFRKSGSQSGGAGGGKDAAPFSALQSDAIREKIEQAAKRGTKLSVTTHID
                     NEEEVWERERRPPTVGIQGIRRVDPDRARARQAEKDKYRADGVLRDAL"
     gene            <182211..>182594
                     /locus_tag="OSTLU_26412"
                     /db_xref="GeneID:5004470"
     mRNA            <182211..>182594
                     /locus_tag="OSTLU_26412"
                     /product="predicted protein"
                     /transcript_id="XM_001420228.1"
                     /db_xref="GeneID:5004470"
     CDS             182211..182594
                     /locus_tag="OSTLU_26412"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420265.1"
                     /db_xref="GeneID:5004470"
                     /db_xref="InterPro:IPR000361"
                     /db_xref="JGIDB:Ost9901_3_26412"
                     /translation="MCGARASVDDGLTLTDACATRLRAIADEDGSAPARLRLAVEGGG
                     CSGFKYEFTLERDAATARDKTFRAANGAEVVVDAISYEFVKGATIDYAEEMIKSSFEV
                     VKNPQAETSCGCGASFGAKDGAFGG"
     gene            complement(<182779..>183498)
                     /locus_tag="OSTLU_26413"
                     /db_xref="GeneID:5004334"
     mRNA            complement(<182779..>183498)
                     /locus_tag="OSTLU_26413"
                     /product="predicted protein"
                     /transcript_id="XM_001420403.1"
                     /db_xref="GeneID:5004334"
     CDS             complement(182779..183498)
                     /locus_tag="OSTLU_26413"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420440.1"
                     /db_xref="GeneID:5004334"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="JGIDB:Ost9901_3_26413"
                     /translation="MRARDRENHFCLDQNDAAVRAIAAALPWYGPEYSPHDVPSFYDV
                     SGITENPEVFRAVTELFVARYRAQGEAGPTHIAGFDARGFLFGPPIAMALNVPFVMIR
                     KAGKLPGVLVSSGTYVTEYSTDETVMRLGSVKAGDRVVLIDDLIATGGTALAGFNLVD
                     QLGARVHEFAAMVSLPFLDGVKKIHEYADGKFKDVPCFTMVDDSTIGPEMCRDPPAGT
                     PRVVAAGDAARVSAEIDAATA"
     gene            <184094..>184882
                     /locus_tag="OSTLU_26414"
                     /db_xref="GeneID:5004471"
     mRNA            <184094..>184882
                     /locus_tag="OSTLU_26414"
                     /product="predicted protein"
                     /transcript_id="XM_001420229.1"
                     /db_xref="GeneID:5004471"
     CDS             184094..184882
                     /locus_tag="OSTLU_26414"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420266.1"
                     /db_xref="GeneID:5004471"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="JGIDB:Ost9901_3_26414"
                     /translation="MKAMLEGLEYAPEDNAAATTAATAETVGYAFSSDHLRALERDGY
                     VVVDDLISQDVARAAAASARAMYDRGVMQNLRQEGRDDDVAVLATSSLPAGDEFAGLR
                     PCVEALLRVPDDLRRVVARVDDDALGADVVSKVRACRAPDRLMLARYGSESCRYVPHL
                     DNDPSDDANDAGSPGLRPSDRVFTLIAYLNPDWDATRGGRFRAYRPGVAADAASPSDF
                     VDIDPILGRVVVFDAAKLLHEVRPSFHDRYAVTVWTRGAELLPA"
     gene            <186274..>187074
                     /locus_tag="OSTLU_3085"
                     /db_xref="GeneID:5004335"
     mRNA            <186274..>187074
                     /locus_tag="OSTLU_3085"
                     /product="predicted protein"
                     /transcript_id="XM_001420230.1"
                     /db_xref="GeneID:5004335"
     CDS             <186274..>187074
                     /locus_tag="OSTLU_3085"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420267.1"
                     /db_xref="GeneID:5004335"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="JGIDB:Ost9901_3_3085"
                     /translation="FKIAEEELSIGAKLGVGSFGVVHRAKWNDTDVAYKTMIADKMND
                     DTINAFAEEIRMMRALRHPNIVLFLGAVIQRGRMGIVSELMKRGNLEQLLHGNGKWSE
                     SLRSNGMLRRQMAADCARGMLYLHSLAHPVVHHDLKPANLLVDANWTLKVSDFGMSEL
                     KSYTYGSNCKAPGGTPEWMAPEALRGDDVNELSDVFSFGVILWELITLNFPWADLSSP
                     VQIVAQVAFLHRRLKIPSWVEDPMEQLLHDCWTRETEARPTFASIVERL"
     gene            <187844..>189241
                     /gene="TPR5a"
                     /locus_tag="OSTLU_43955"
                     /db_xref="GeneID:5004336"
     mRNA            join(<187844..188599,188636..>189241)
                     /gene="TPR5a"
                     /locus_tag="OSTLU_43955"
                     /product="TRP-containing protein"
                     /transcript_id="XM_001420231.1"
                     /db_xref="GeneID:5004336"
     CDS             join(<187844..188599,188636..189241)
                     /gene="TPR5a"
                     /locus_tag="OSTLU_43955"
                     /note="contains a tetratrichopeptide repeat"
                     /codon_start=1
                     /product="TRP-containing protein"
                     /protein_id="XP_001420268.1"
                     /db_xref="GeneID:5004336"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="JGIDB:Ost9901_3_43955"
                     /translation="AQQMMSNMTPEQMAQMQRMAGSMGLGAPPGAAEAMKNMTAEDMR
                     RAAQEMGNMTPEQLKTQYEQAQGHAKASADYRYAGSETLKKEGNKLVGEGKHADAVEK
                     YARVKENLKDDVNAAAKTLRLSCMLNMALCFNKIGKHDGAISECTEALELEPRSLKAY
                     YRRGQAYVAKGELEQGVNDLMRANKLSPGDETVAGELEAAVKRMESQGLAVPAAAPEF
                     DHPEAAPTTSAGSSGSAMPGMPGMPTLTPDVQAQQMSSMMGNLSDDQIEQMAATNPMM
                     AGMDPDHVKKAAGMMKNMKPETMQSMMKMAQSMGTEGGKGFDPNDPEMMSKMQKELNN
                     PEMREAMVEMIQGMDSESLKEMSKSMGMTMDDAQAEQAVNALKNISPKTMERMLSMAS
                     VAGGIYSRFKRPIDWAMRNKRTALSIFVVFTAMGTTYVLRWWRRRGGAVEAADNQTST
                     STF"
     gene            complement(<189271..>191661)
                     /locus_tag="OSTLU_44312"
                     /db_xref="GeneID:5004337"
     mRNA            complement(<189271..>191661)
                     /locus_tag="OSTLU_44312"
                     /product="predicted protein"
                     /transcript_id="XM_001420404.1"
                     /db_xref="GeneID:5004337"
     CDS             complement(189271..191661)
                     /locus_tag="OSTLU_44312"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420441.1"
                     /db_xref="GeneID:5004337"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="JGIDB:Ost9901_3_44312"
                     /translation="MEQRDIYEDRGGRRAGRVRPRALEEGEDEWLRQARRRRAADRAA
                     DGDMEDDDEEFDVNIDVYDCPLREWITKDRTKVEIRKRLSRFLRKGQVDEAGRSLYHK
                     KIREMCNNNLQSLEISYMHLAKSESLIAVWVADAPKDMLDLFDEVALTEVLKLYPSYG
                     DIHPDVFVRIVDLPVEDAIRDIRQSHLNSLIRVSGVVTRRTGVFPQLKNVTYTCMVCS
                     YNVGPIFQNSSREEERPNACPECHQKGRWQINSAKTVYRNYQKLTLQESPGSVPAGRI
                     PRSKEVIVLNDLIDMAKPGDEIEVTGVYTNNFEASLNTRQQGFPVFTTYIEANYVKRK
                     GDLYSSGNLTDEDREDIRKLSRDPKIVRRIMKSIAPSIHGHEDIKMGIAFALFGGQEK
                     FVKGKTRLRGDINMLLLGDPGVAKSQFLKYTQATAGRAVYTTGKGASAVGLTAAVHKD
                     PVTREFVLEGGALVLADRGVCLIDEFDKMNEQDRVSIHEAMEQQSISISKAGIVTSLQ
                     ARCSVIAAANPIGGRYDSSKTFSDNVELTDPILSRFDILCVVRDVIDPVLDERLAKFV
                     VHSHVKCHPRFEDDPEAPLQNPFGENDDDDIEPIDQKLLRKYISYAKKECRPKLNQQD
                     LPKIQRVYAELRKESVTREGMPVAVRHIESIIRMSEARAAMRLSQQVSADDIDAAIGC
                     MLQSFIGTQKQSVQKTLQKKFARYTHFHRDYDALLLEILRGLLRETMRWENVGAKPNS
                     QADTAGQTTTVRCRDLESKARAYGIEDLAPFYGSSAFRNSHFSYDAARQCIVHTSD"
     gene            <192455..>193147
                     /locus_tag="OSTLU_93424"
                     /db_xref="GeneID:5004472"
     mRNA            <192455..>193147
                     /locus_tag="OSTLU_93424"
                     /product="predicted protein"
                     /transcript_id="XM_001420232.1"
                     /db_xref="GeneID:5004472"
     CDS             192455..193147
                     /locus_tag="OSTLU_93424"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420269.1"
                     /db_xref="GeneID:5004472"
                     /db_xref="JGIDB:Ost9901_3_93424"
                     /translation="METKRVVFVSLKPSSTASDDQHASRNARRKRALGIEERATWEEF
                     VSAACARLQIAGARAVYHASTGERVHGIEDVQDIEDLIVEEDESARMMTSGATPGVSP
                     LRTPNGRANGATARGTPGRDYDGDYDDDDGKSKPRRMSVLLSSLVPGLGSAVGDGALR
                     KLDSALDAAERGDDDGRSKNHRVPTRKPVGARKTLKRKKRLNRRAAALLLIVFVGTLV
                     YVFGRRFEDAPF"
     gene            <193558..>194166
                     /locus_tag="OSTLU_7292"
                     /db_xref="GeneID:5004338"
     mRNA            <193558..>194166
                     /locus_tag="OSTLU_7292"
                     /product="predicted protein"
                     /transcript_id="XM_001420233.1"
                     /db_xref="GeneID:5004338"
     CDS             <193558..>194166
                     /locus_tag="OSTLU_7292"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420270.1"
                     /db_xref="GeneID:5004338"
                     /db_xref="JGIDB:Ost9901_3_7292"
                     /translation="IDVLELGCGVGNSVFPLLRANLNMRVVAVDCSPTAIAAVRANPE
                     FDARRLRTHVVDASARRSMESCVDDASVDAVTAVFFLSALTANGLRNAAEEIRRVLRP
                     NGVLLFRDYARGDVKNADASSQFVPGERIDENASLSSTSNEQTYRRSDGTLAVFFDED
                     ELNDVFASVGLVGECEIVTHSITNRKLGVTMDRKFVQGRFVRL"
     gene            complement(<194223..>195764)
                     /locus_tag="OSTLU_43992"
                     /db_xref="GeneID:5004339"
     mRNA            complement(join(<194223..195167,195243..>195764))
                     /locus_tag="OSTLU_43992"
                     /product="predicted protein"
                     /transcript_id="XM_001420405.1"
                     /db_xref="GeneID:5004339"
     CDS             complement(join(194223..195167,195243..195764))
                     /locus_tag="OSTLU_43992"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420442.1"
                     /db_xref="GeneID:5004339"
                     /db_xref="InterPro:IPR007238"
                     /db_xref="JGIDB:Ost9901_3_43992"
                     /translation="MVFGALRTNREKAEARAKTALERKYGGNAARLDAYNTAPDDERS
                     IEYLERAAMDRYGVLRAIDDARSGGKKDEELKRAIASAEEEYNMRRTTGGTFDAEGAA
                     RDATSHFLLRLASCRSEEHRRWFRENELELFKYRYGELSLDAKMEFMRTNGFNDYARA
                     SEKEVRERRDDLRDYQRMCEEAASEASRWFVVGFEEVCPLVKSRRAYLIGGNAWIRKE
                     TLDQLVFGRFKTMLNKMVAEAITLFNKFEKKEAHRLTPLLKSVHNRRSGSGYDFQGED
                     GTMSIAGIEATQESFPLCMRQLYKALKKDHHLTHGGRRQLQLYLKGIGLPLDQALVFW
                     KTEFTKHPKCSAEKFEKDYAYGIRHAYGKEGKRVNYTPHACGQCIAADPGVKDAHGCP
                     FKTLTSGVKDNGARLHELLGTLKISGAKSHAIVEKATNMHYQIACGMTFAAIHDGVEI
                     EAGVHTPHQYFHESRKILAPPTASEAVLGDANAQSVAA"
     gene            <196129..>197364
                     /locus_tag="OSTLU_93426"
                     /db_xref="GeneID:5004473"
     mRNA            <196129..>197364
                     /locus_tag="OSTLU_93426"
                     /product="predicted protein"
                     /transcript_id="XM_001420234.1"
                     /db_xref="GeneID:5004473"
     CDS             196129..197364
                     /locus_tag="OSTLU_93426"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420271.1"
                     /db_xref="GeneID:5004473"
                     /db_xref="JGIDB:Ost9901_3_93426"
                     /translation="MSAALAETIARDAADGRAGEYDLAGFGEAWVDALVEAAFATPTR
                     AKGGFYASCKFIVGGGKKTRAKYDDEVVKHLTAALRARGFEDDRGASACEACQGTYKY
                     QHDTDKDLKYLHVFPRVTHEAEGGEAAAAAGGTQSPEYRACACDLEEFERLVEMYCPS
                     FSQKRALLRRMKVMEHALGALEQKVIAMESLNDREQTMYDSMVEVAAKIEFLQQALDD
                     MIKKGRLTKGEQGEIVEDLELKLEDLNLMVNEANEEGKPKRAEMLESKKEIVVKKIDS
                     VRAKPPIVYTVPHERELLDLKKELNSLKKIAAQSKGKLMSGADAAKCANIPKLEERIA
                     NLENSEEKGWYEDECRALLFPPVAEKKAPAKAKASGAKTNSGWLTKAAKGGSRGGGGS
                     AKASSTRGPSNPFAMLGDD"
     gene            complement(<197412..>200042)
                     /locus_tag="OSTLU_44172"
                     /db_xref="GeneID:5004340"
     mRNA            complement(<197412..>200042)
                     /locus_tag="OSTLU_44172"
                     /product="predicted protein"
                     /transcript_id="XM_001420406.1"
                     /db_xref="GeneID:5004340"
     CDS             complement(197412..200042)
                     /locus_tag="OSTLU_44172"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420443.1"
                     /db_xref="GeneID:5004340"
                     /db_xref="InterPro:IPR000811"
                     /db_xref="JGIDB:Ost9901_3_44172"
                     /translation="MESDRADVTESSFLESATTILDRPRQYVDDAEMGVDHLAHKELL
                     WKLSSTYLPNDVASLQRSLVRHVEYTLARRRYKLDTSSFYQATAHSVRDRLIERWTDT
                     QQYSAKKGAKKVYYLSLEFLIGRSLGNAVSNLGLRGAYAEALRQIGYDLEDIMSEEKE
                     PALGNGGLGRLASCFLDTLATQNYPAWGYGIRYKYGMFEQRIVNGKQVEFPDYWLTDG
                     NPWEVERLDVQYPVRLFGHVREFQDPDGNTLYAWEGGEVVMAQAYDTPIPGYGTYNTN
                     NMRLWSSKPSHEFNLASFNAGNYYGAVEAKERCESITSVLYPNDATEEGKRLRLKQQY
                     FFVSATLQDIYRRFKKNVGRGSTTMKNMPDKVAIQLNDTHPAIAIPELMRLLLDIERL
                     PWDEAWEITRKVFAYTNHTILPEALEKWPVPMITELLPRHMQIIYEINHRFLLEVQKM
                     WPNDTARMSSMSIIEESSPKMVRMSNLAVIGSHTVNGVAMIHTKLLKSLLFPDFLLMW
                     PEKFINVTNGVTPRRWLLQANPALASIYTGMVGPGWVNDLKRLEPIKTMAQDPQFRQR
                     WRAAKQTNKQALAEWLYRSMNIRVDPNALFDMQIKRIHEYKRQLLNVLGIVHRYAEIT
                     QATPEQRKTMVPRVHIIAGKAAPGYVMAKNLVMLVCAVSEVVNSDAACRDLLKVVFVP
                     NFNVSLAEILIPASDISQHISTAGMEASGTGNMKFVMNGGLIVGTMDGANIEIEQAIG
                     EHNMFTFGAKADQVAAIRRKMAHDPPKIDPRLHRAMGMIRAGIFGKPDDGAYNQLLDA
                     IDPRKDVYLTAHDFPSYLGAIAEADAAYQYEEKWTAKCIEAACSMWMFSSDRTIREYA
                     AKIWNVEPLPFRPPRHHSER"
     gene            complement(201526..>203421)
                     /locus_tag="OSTLU_50879"
                     /db_xref="GeneID:5004474"
     mRNA            complement(join(201526..201740,201771..>203421))
                     /locus_tag="OSTLU_50879"
                     /product="predicted protein"
                     /transcript_id="XM_001420407.1"
                     /db_xref="GeneID:5004474"
     CDS             complement(join(201568..201740,201771..203421))
                     /locus_tag="OSTLU_50879"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420444.1"
                     /db_xref="GeneID:5004474"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="JGIDB:Ost9901_3_50879"
                     /translation="MLLARAFARRTVSTPRASLAARPRASTRASERESARATATAATT
                     RRRGATTRTRARASDAGTNKKRDGGAGNRKRGEGGGRDASGVTSSPEEVKALRAQKLD
                     ALGALGQRGFDYRFDRTKYCDALQREHEGLENGVEIEGSSEAVCGRVMAKRSFGKLAF
                     LSLVDERGSVQLFCDKKRLDETSPGAFEMITELVDVGDIIGVHGSVKRSDKGELSIVP
                     AKVQMLTKALLPLPDKWHGLQDVEKRYRQRYVDLIVSPEVRNTFKARSNIISTIRRML
                     DDDGFLEMETPVLHTQAGGADAKPFNTFHNALGMQLTLRIATELHLKRLVVGGFERVY
                     ELGRVFRNEGLSTRHNPEFTSIEVYQAYADVTDMLELTEEMICRCAMKACGTLTIPYG
                     DVTIDLSQRPWRRAPMNDLVKEATGVDVMAFGDDLEGAKAAAIPALKAHSKKAGEGIK
                     GVKLAASVGHVLNEMFEAACESDLIQPTFVLDHPLEISPLAKPHRSKPGVTERFELFV
                     VGRELANSFSELTDPIDQRKRLEAQMVTHAKTSAAQREAAAANEAYDVEMDEDFVAAL
                     EYGMPPTAGMGLGVDRLVMLLTNSPSIRDVIAFPLLKKQDS"
     gene            <203552..>204076
                     /locus_tag="OSTLU_6946"
                     /db_xref="GeneID:5004475"
     mRNA            <203552..>204076
                     /locus_tag="OSTLU_6946"
                     /product="predicted protein"
                     /transcript_id="XM_001420235.1"
                     /db_xref="GeneID:5004475"
     CDS             203552..>204076
                     /locus_tag="OSTLU_6946"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420272.1"
                     /db_xref="GeneID:5004475"
                     /db_xref="InterPro:IPR008580"
                     /db_xref="JGIDB:Ost9901_3_6946"
                     /translation="MALVTLSVYDIKHAENARISSAVTSLNTLTRNALNVGGIFHGGV
                     EVFGDEWSFGYCPEGSGVYRCNPRMNPMYEYRESVPLGVTSLSPARASAAVAALRAQW
                     RGSDYEVLERNCNHFCEALCEALGCEGPPEWLNAFANNANKARGAYQSAVSGVESAYE
                     SAVSGVAGAWAWLAS"
     gene            <204379..>205476
                     /gene="lhcq-like"
                     /locus_tag="OSTLU_88576"
                     /db_xref="GeneID:5004341"
     mRNA            <204379..>205476
                     /gene="lhcq-like"
                     /locus_tag="OSTLU_88576"
                     /product="chlorophyll a/b binding, possibly photosystem II
                     light harvesting complex"
                     /transcript_id="XM_001420236.1"
                     /db_xref="GeneID:5004341"
     CDS             204379..205476
                     /gene="lhcq-like"
                     /locus_tag="OSTLU_88576"
                     /codon_start=1
                     /product="chlorophyll a/b binding, possibly photosystem II
                     light harvesting complex"
                     /protein_id="XP_001420273.1"
                     /db_xref="GeneID:5004341"
                     /db_xref="InterPro:IPR001344"
                     /db_xref="JGIDB:Ost9901_3_88576"
                     /translation="MLSRGLVSTSRASVARARAPARQQRATTSRRASIVRRTAARATN
                     DDDKASSSQDVPDDEPTPAVGDTDVNSALGDVISSPLFYVTFGVAGGVGLVRALGENA
                     SFLLSAAPVVLLTVISKTSFGESLMKNIDDQRPALVAEKARRENERARARERSSLYGA
                     RRVKFLGDAEYEYPAHLDGSLCGDAGFDPLGLGKDDLPRMRELELLHARWAMLGIVGV
                     AVPELLERYGVADLGEPVWWKVGAAKMNSDVSLDYFGLQGFHIAGGSGIAIIAACQVV
                     LMGGPEYARYVGIDSLEPVGVYLPGDKDYPGGAPFDPFKISDDADEFEKQKVMEIKHG
                     RLAMIAMLGVAAQAFVTRAGPIENLASVFSG"
     gene            complement(205468..207209)
                     /gene="FBP65"
                     /locus_tag="OSTLU_26425"
                     /db_xref="GeneID:5004342"
     mRNA            complement(205468..207209)
                     /gene="FBP65"
                     /locus_tag="OSTLU_26425"
                     /product="peptidyl-prolyl cis-trans isomerase, FKBP-type"
                     /note="Has EST support"
                     /transcript_id="XM_001420408.1"
                     /db_xref="GeneID:5004342"
     CDS             complement(205518..207146)
                     /gene="FBP65"
                     /locus_tag="OSTLU_26425"
                     /note="FKBP-type peptidyl-prolyl isomerase; contains 3
                     FKBP domains in tandem, followed by 3 TPR repeats"
                     /codon_start=1
                     /product="peptidyl-prolyl cis-trans isomerase, FKBP-type"
                     /protein_id="XP_001420445.1"
                     /db_xref="GeneID:5004342"
                     /db_xref="InterPro:IPR001179"
                     /db_xref="JGIDB:Ost9901_3_26425"
                     /translation="MTTADDAVDAVDVSPVGDGGVTKRIATPAPPDARAPEKGDAVTV
                     HYVGSLATGETFDSSRERDEAFTFTLGKHEVIDAWDVGVATMRVGERATLTCAPEYAY
                     GDRGAPPKIPGGATLIFDVELLSFKSHRDLCGDGGVMKETVREGEGYASPSAEDEATA
                     TMEAKTRTGDETLVAKTTRTFSLAANGDAPCEGVRAALLKMKRGETARVTLSEAYAEG
                     LTTAKDGAVVELMLDAIHAVVAVNGVEGATKKILEEGEGYETPNDGAKCEIEYEKRVG
                     GATTETKPAHEIVVGDEHVPDELESAIAMMKLNEKALVKLADGTEYTVKMTKLERAKE
                     QWSMNNAEKIEAAEKYKTSGNDAYKGGKFARATKKYDAALKFVEMDESFSDEEKQASK
                     KLKLSLNLNSAAVAIKTKSWMSARKSSEKALAIEGSNEKALYRFAQAAMELQEYDESR
                     RSLKKILEADESHAEATRMLTRLKALEAHQAKKDAKIFGGMFSKIDLGYEDVKVKADE
                     PDEEIPAPEAMPEVPAFDEPPAPDANEPFGVESV"
     gene            complement(<207278..>208687)
                     /locus_tag="OSTLU_17282"
                     /db_xref="GeneID:5004476"
     mRNA            complement(<207278..>208687)
                     /locus_tag="OSTLU_17282"
                     /product="predicted protein"
                     /transcript_id="XM_001420409.1"
                     /db_xref="GeneID:5004476"
     CDS             complement(207278..208687)
                     /locus_tag="OSTLU_17282"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420446.1"
                     /db_xref="GeneID:5004476"
                     /db_xref="JGIDB:Ost9901_3_17282"
                     /translation="MMREYLSLLVAVGGVKGTLAVCLAYAAGASAFGDFGAGTGGEAM
                     DFARAASIGLAFAAPTAIYDALVMGVDWTARAEATNEAREEASGEVREASALERYFEP
                     LSRYQEEETLNNPCRSMPFWMDASVALTARVADEMLERGVVLGLLAKWLADRAVEAGF
                     EPYEVDAPAKAAAAFGVYLVLEARLRRVQRQTRVQAFRVERNKVTGKQKLVPVSEDDI
                     KASAEKTKKPSLKFWEKKPDAAADDESSSPLSANEAPNVAETRAFENILRGKSVKDFL
                     DGSRSRLLFVSQSLAFVVTGGVFAPIVGGYVADAMYIIHQRNTMTRFIERALGDAAPA
                     RGAGPPDPDTVRRAQAAAFKNMLARKKRRMGRDVVDAMRRDPSISRDVNVLFQDVVRK
                     VKRVKDIDESTAVDEVLLAVNDFAADDAADDDAADDDSGVSYAERMRAALRRVSEDMD
                     AIELARAESPPSADDDDPN"
     gene            <209576..>210247
                     /locus_tag="OSTLU_4040"
                     /db_xref="GeneID:5004571"
     mRNA            <209576..>210247
                     /locus_tag="OSTLU_4040"
                     /product="predicted protein"
                     /transcript_id="XM_001420237.1"
                     /db_xref="GeneID:5004571"
     CDS             <209576..>210247
                     /locus_tag="OSTLU_4040"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420274.1"
                     /db_xref="GeneID:5004571"
                     /db_xref="JGIDB:Ost9901_3_4040"
                     /translation="EAEEVDPRVGDALDELNDSMTECNGLENALQEARKARSRTQTVA
                     RKRLDSVAARLSSSVMTAVPVFHKRALAQLYQVRSIEALRAYESAHDAHERAKKRNDE
                     LERELVASSGKVDIELMEVCAEAMREVSETTAVKLRATEVHERNTRRAVEATAEAAGL
                     ERERTSAVKKALPWFNAKALGEAECAQADERVSELKLAVRQAKARYEAALRALNEISE
                     EVHARR"
     gene            <210974..>212233
                     /locus_tag="OSTLU_1568"
                     /db_xref="GeneID:5004343"
     mRNA            <210974..>212233
                     /locus_tag="OSTLU_1568"
                     /product="predicted protein"
                     /transcript_id="XM_001420238.1"
                     /db_xref="GeneID:5004343"
     CDS             <210974..>212233
                     /locus_tag="OSTLU_1568"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420275.1"
                     /db_xref="GeneID:5004343"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR002550"
                     /db_xref="JGIDB:Ost9901_3_1568"
                     /translation="LTAGVLLVMSAFFSLAETSITTLYPWKVRELADQEGSTGGVFQI
                     MRKDVTRFLTTILIGTTFSGIMATALITEAALILYGDGATTAVTVALTIVMLVFTEIA
                     PKSVAVQHATVIARVIAKPIYLLSFVVYPLGRTCQIVVNAMFALFGLKTSAEPFVSEE
                     ELKLVLAGATKSGEVESAEKDMIQNVLDLEETVVRDVMTPLVQVHGVRSDATLAEFRT
                     EWIEHKYSRVPAWEDRVDNIVGIVRANQIMQLGIERDLRPEQSKELEDVLVQDVMLRD
                     TYFVPESMSVSKLLRELMQRKSHMCVVVNEFGGTVGIATLEDCVEEIVGEIYDEEDSQ
                     KANADEDEQDATPFIREVGQGAYLVDTRAALWKLADELSLDIPESPLYETVGGFVCDL
                     FGSIPDVGASITTTFEHVEDEDASSDDE"
     gene            complement(<212506..>213597)
                     /locus_tag="OSTLU_26429"
                     /db_xref="GeneID:5004344"
     mRNA            complement(<212506..>213597)
                     /locus_tag="OSTLU_26429"
                     /product="predicted protein"
                     /transcript_id="XM_001420410.1"
                     /db_xref="GeneID:5004344"
     CDS             complement(212506..213597)
                     /locus_tag="OSTLU_26429"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420447.1"
                     /db_xref="GeneID:5004344"
                     /db_xref="JGIDB:Ost9901_3_26429"
                     /translation="MDFILRRSLLQMFLILTLLLTLCASCRAGDADFKAQLSTTVDVR
                     ALTSSRYDGSEARPLLVFLHGYCLSDDAQQTLKLESMRNVPAVRNRLGIARRRQQTLV
                     QSGLREAALDRNWIYLAPRAPRTTRECVLCNLQESSPNSQDRLFGSWITGILARDSPE
                     FECRAWDGSDAVALPEISATDDLDVKYILEVVAAAKKEFNVDEKRIYVVGIATGGFMA
                     SRLACEKPELFRGVVSLAGGTFSDASRCRPKSGETNVLLVHGTDDHTVPIDGGVNARG
                     IPFPSADDSFSTLGKAMDCSNVVAKSMDTLPADGNSVEVRVAKAKYDRCENNVDVEQW
                     KLNGVDHFIERETSEALFYDVVTWLNDLD"
     gene            complement(<213727..>214413)
                     /locus_tag="OSTLU_26430"
                     /db_xref="GeneID:5004572"
     mRNA            complement(<213727..>214413)
                     /locus_tag="OSTLU_26430"
                     /product="predicted protein"
                     /transcript_id="XM_001420411.1"
                     /db_xref="GeneID:5004572"
     CDS             complement(213727..214413)
                     /locus_tag="OSTLU_26430"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420448.1"
                     /db_xref="GeneID:5004572"
                     /db_xref="JGIDB:Ost9901_3_26430"
                     /translation="MERELTPGRKARGDDGDDFADVRDACLRLVRESSGARETRAKGL
                     MIIRNCAPPGFAGAFGGFLRLFPKWFAARHAAAVTPMLLPWLVGEAEVNDAPEDVALD
                     VSDDVSTSVFAAMIGAPKVRAGYKQGVLLKRCRVLEETGCAAVCANVCKHPTQKFFTE
                     EIGLPVTLTPNYETFECQFTYGATPPSVEADPAFASPCFRQCGVSETLRDAECGNALE
                     SDESPCASSN"
     gene            complement(214712..>215898)
                     /locus_tag="OSTLU_26431"
                     /db_xref="GeneID:5004573"
     mRNA            complement(214712..>215898)
                     /locus_tag="OSTLU_26431"
                     /product="predicted protein"
                     /transcript_id="XM_001420412.1"
                     /db_xref="GeneID:5004573"
     CDS             complement(214762..215898)
                     /locus_tag="OSTLU_26431"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420449.1"
                     /db_xref="GeneID:5004573"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="JGIDB:Ost9901_3_26431"
                     /translation="MDWARARAKAPEGTVVEPFEMRRSMALSLAAARMRDVARAEASE
                     ELMKKHKGATSTRDICVEFTTLSRDVYAVYHPVWYVSFEHGYVVDENANKIIQQPREA
                     VVCGVTGLVVSDDLICDHKARALAFSAVAIPASIAAYVWPESAYFFLGQGALASAVAA
                     AGAAVLARQVPKMRQDKIDAVRVHDEERAFARAMRSVGNSEWMDESVQRRRDDAEWRR
                     WRETDKMRWDPDKRRAWAYSILETQIFRFRERQEMRHEMEERAHLADEAARREAEMER
                     KYGANWKRSRGDDAHGAPSGRHPGFSRDIHGFYKTLRLDAKLGHATEEEIKAAFRLVA
                     LETHPDKVAGDASAKKRAAERFQLAQKAYAVLGNKFERTAYDRK"
     gene            216644..218368
                     /locus_tag="OSTLU_25220"
                     /db_xref="GeneID:5004574"
     mRNA            216644..218368
                     /locus_tag="OSTLU_25220"
                     /product="predicted protein"
                     /transcript_id="XM_001420239.1"
                     /db_xref="GeneID:5004574"
     CDS             216672..218312
                     /locus_tag="OSTLU_25220"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420276.1"
                     /db_xref="GeneID:5004574"
                     /db_xref="JGIDB:Ost9901_3_25220"
                     /translation="MARRRGPRRRGDGDDDESTPLVARGRGSTTPATVTRVTLLVLVA
                     MGVVGASTAPRRRFSARVGVFKKGLKTVTSAASGVASAWSKTGDAAWTRAENLSKNAR
                     KKVGAELTAAMQSGHQEIFKQYDEASGWSQQAANQVAGEATELGDDVEKTAKMIAEFL
                     DGYKCDIGVKDLKKTVDDIKNAVGSNSLKSMYDKVTGSPNRYFKNMDDLACQMMWDTS
                     GFAQAASVMEAFIELAKDKCPLVVKGSSKPAFTYGFSVSGDIVGVVLSAGRSGEVGLG
                     IDLSGQKFCYAGHCVYSGFTLDVPQVGVDFNVVVSGWKSMSDVSGRSNMMAFGLSGEL
                     PDSAIPDFDVDLTLVTGGAKMSNILGVSKALGVGQDASELPVTGSFAKGTCITPWCVT
                     YEGGSCAGDPGEGRDFKCYISRHSSFRLPAPFAGQTVQDRWDYYNRKSESGKKMRKEI
                     ESNNDKYPIYEGCEFGDAEMECYYDKFYAKAHPKDYDDIEKKVNKESCNGFSSDSECS
                     KNRRERIIEKKVSRAKADFFKDKGGWKNEPTSYAKCGI"
     gene            218608..220113
                     /locus_tag="OSTLU_26433"
                     /db_xref="GeneID:5004345"
     mRNA            join(218608..218864,219062..220113)
                     /locus_tag="OSTLU_26433"
                     /product="predicted protein"
                     /transcript_id="XM_001420240.1"
                     /db_xref="GeneID:5004345"
     CDS             join(218855..218864,219062..220023)
                     /locus_tag="OSTLU_26433"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420277.1"
                     /db_xref="GeneID:5004345"
                     /db_xref="InterPro:IPR000637"
                     /db_xref="JGIDB:Ost9901_3_26433"
                     /translation="MARSVGSGAMPASAEDSIGWYLSLYWPAMNKEFKGVVQKYDHDS
                     KHHTVKWDNAPKGSDGVTEVDLTEGELTWLKAPEKPVKKAAKGKPAAAKAKPKAYKEY
                     DALETMDDLEARFTGKTTKAVAFQVLKNSGVNGMTLQEIVDESQKLGLRDWTQCKQPK
                     TTINVCVSQDSAFVKISPGRVGLRINGAQTRDASQEPKHVKASGASKKRGRPPKTGEA
                     KPKKVQRQEPQHWERKPPIDLSIEVYTSNNTHVTNAPISVAYNVTIKALKKAISNNTK
                     GMLKPHYQQLYHDNRNIGMDEDAFLVHAVRPHKFERTLDLKLVISDQ"
     gene            complement(<220167..>221027)
                     /locus_tag="OSTLU_94921"
                     /db_xref="GeneID:5004346"
     mRNA            complement(<220167..>221027)
                     /locus_tag="OSTLU_94921"
                     /product="MPT family transporter: inner membrane
                     translocase (import) Tim44"
                     /transcript_id="XM_001420413.1"
                     /db_xref="GeneID:5004346"
     CDS             complement(220167..221027)
                     /locus_tag="OSTLU_94921"
                     /codon_start=1
                     /product="MPT family transporter: inner membrane
                     translocase (import) Tim44"
                     /protein_id="XP_001420450.1"
                     /db_xref="GeneID:5004346"
                     /db_xref="InterPro:IPR007379"
                     /db_xref="JGIDB:Ost9901_3_94921"
                     /translation="MAIDAVKEEYRLAMMDPGDAAAERRKAAGYDEAMFEPYDGTTAV
                     ATTAAPKPSAFGKLWGGVKSKLGIASAFDKLEGLKKTAPYAKGAELAEDMRERWETSD
                     SPVVHRIQDFQDNLFSETEQGEAYRMIRQRDPMFNINDFIAEVRRDIPKVLGAYLKGD
                     VEALKQTNISSEMLERLSGQMNLWKHEGQHVDPRILDLSEVELMEVRLMENEPLVVLT
                     FSCQQINCVRDKSGAVVEGAEDDIQSVHYLWAMQLVDKEYTTKDGRKYTKPTWALREL
                     VLRGMMAVAA"
     gene            <221853..>223157
                     /locus_tag="OSTLU_26435"
                     /db_xref="GeneID:5004575"
     mRNA            <221853..>223157
                     /locus_tag="OSTLU_26435"
                     /product="predicted protein"
                     /transcript_id="XM_001420241.1"
                     /db_xref="GeneID:5004575"
     CDS             221853..223157
                     /locus_tag="OSTLU_26435"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420278.1"
                     /db_xref="GeneID:5004575"
                     /db_xref="JGIDB:Ost9901_3_26435"
                     /translation="MGVGGVAIEDMAQGEVIFSLRMRDDDDAPIALTTTEVENERGPL
                     RTLAKMVNATRLTSRYAGVIEDEWGFPLDSTRAATLALALAREVELGDDAYWRAYVDL
                     LPREVDSLQMWDDDELEALQGSRLIERARRRRALVRREYEATREALGATAPSYESFRW
                     AYATVLARAFVLPDLNCMALLPGLDLYNSARDAEKCTVERLGHVEDDDDEDDDEDVAF
                     ANEGEAQVTLRVGIGGAAAGTQLFHDYADHTSGGALLEFGFVYHGERERGSGVDAVET
                     SLVRAYDALDARSRAFLAERVFGAFNVRTSLTFELSNVGGVYKPALRGAACVPLEMWR
                     AARALALSPERALPASLDDVLDEDTEIRARRIILDALKAERARYAATSIEEDVRALRL
                     ALDAGAAARRTAAALDVRVGEKSLLDDVITDLETNARRARRG"
     gene            complement(<223214..>223549)
                     /locus_tag="OSTLU_93433"
                     /db_xref="GeneID:5004347"
     mRNA            complement(<223214..>223549)
                     /locus_tag="OSTLU_93433"
                     /product="predicted protein"
                     /transcript_id="XM_001420414.1"
                     /db_xref="GeneID:5004347"
     CDS             complement(223214..223549)
                     /locus_tag="OSTLU_93433"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420451.1"
                     /db_xref="GeneID:5004347"
                     /db_xref="JGIDB:Ost9901_3_93433"
                     /translation="MPPTTTKPRCRVVARAPRWIARARGTGTSTIARAWSKKDDDEIW
                     DEDERRRVEENKRWRRTDDPSEAWDIDKERDALMYKRESLEALLRVEYEPEEGRGEAK
                     DDDDDDARA"
     gene            <223823..>224461
                     /locus_tag="OSTLU_93434"
                     /db_xref="GeneID:5004576"
     mRNA            <223823..>224461
                     /locus_tag="OSTLU_93434"
                     /product="predicted protein"
                     /transcript_id="XM_001420242.1"
                     /db_xref="GeneID:5004576"
     CDS             223823..224461
                     /locus_tag="OSTLU_93434"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420279.1"
                     /db_xref="GeneID:5004576"
                     /db_xref="JGIDB:Ost9901_3_93434"
                     /translation="MTARATRERDDGARATTDEGGARATTDEDRARLTKYWLRRRCST
                     GSHASEATEVGMLTGGESSNESHQATGRRARRGGSASASTPPGAGRRAERGGIDTPGH
                     FAFATPMSARVREEGMTTPRTPTLANDSPDRARLDELLAAPVKPNFGTRAAIECTPRH
                     TPLKLRFDDNVDVVVSGTHATSKKRARGKLSDVFKATKSTTPRLTRARKAML"
     gene            complement(<224625..>225584)
                     /gene="SPD1"
                     /locus_tag="OSTLU_26437"
                     /db_xref="GeneID:5004348"
     mRNA            complement(<224625..>225584)
                     /gene="SPD1"
                     /locus_tag="OSTLU_26437"
                     /product="Spermidine synthase"
                     /transcript_id="XM_001420415.1"
                     /db_xref="GeneID:5004348"
     CDS             complement(224625..225584)
                     /gene="SPD1"
                     /locus_tag="OSTLU_26437"
                     /note="putrescine aminopropyltransferase;
                     S-adenosylmethionine-dependent methyltransferase; uses
                     decarboxylated AdoMet to synthesize spermidine from
                     putrescine, and spermine from spermidine"
                     /codon_start=1
                     /product="Spermidine synthase"
                     /protein_id="XP_001420452.1"
                     /db_xref="GeneID:5004348"
                     /db_xref="InterPro:IPR001045"
                     /db_xref="JGIDB:Ost9901_3_26437"
                     /translation="MNKYADDAPQSADKCIGACGEGWLCEVSEMWKGQAMSLKIDEEL
                     FRGRSEFQDVYVFKNSAYGNVLVLDGVIQATERDEFAYQEMITHLPLCALNEEPKRVL
                     VVGGGDGGVLREVTRHGSIERIEIAEIDGMVVEMSKKFLPSMAVGFDDARVEVNICDG
                     IKYVGDAEEGTYDAIIVDSSDPIGPASVLFEEAFFKKMHRALKPGGVVCTQAECVWLH
                     IDLIEDLAKMCKGIFVGGSMAYGYTTIPTYPSGQIGFMMCSKPAADGSTVDFTKAKRF
                     PRPADESALKPMRYYNPQVHAAAFVLPEFARAALEPHLVPGSE"
     gene            <226036..>227883
                     /locus_tag="OSTLU_43996"
                     /db_xref="GeneID:5004577"
     mRNA            <226036..>227883
                     /locus_tag="OSTLU_43996"
                     /product="ABC(ABCD) family transporter: long-chain fatty
                     acid (ALDP-like protein)"
                     /transcript_id="XM_001420243.1"
                     /db_xref="GeneID:5004577"
     CDS             226036..227883
                     /locus_tag="OSTLU_43996"
                     /GO_component="membrane"
                     /GO_function="ATP binding"
                     /GO_process="transport"
                     /codon_start=1
                     /product="ABC(ABCD) family transporter: long-chain fatty
                     acid (ALDP-like protein)"
                     /protein_id="XP_001420280.1"
                     /db_xref="GeneID:5004577"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="JGIDB:Ost9901_3_43996"
                     /translation="MLDLKSKETSGAAATAAVGRKTRDAGRGKRTREIGVGKDFWNEL
                     GYLLKVAFPTAGSRGGQLLGAQFTLLVMRTLLTVRANKVNTFYLTKAISSASWKFWVR
                     WFFNFGGWMASGVVVNSGLRYTESLITIELRAALTKKAHKMYMENNNFYKTAVLRQGG
                     LDNVDQRIVADIDAFAKETAFLYGHSFKPILEFTLSLTEAAKELGYSRPLALFASQII
                     ITGVLRSIAPRLGPMVAREAALEGGFRHTHARLIAHAEEIALLDGGKREIEILDEGLD
                     NLVVTQRWHALQRIRKSVADNVSKFQGLLVGSIFVHVPFMMKASVSEGERISSFRATE
                     ELMLRCGGAFTEVLLLGKNLDELAGYTHRLSQLFKTLDLASKEAREDKAKLASAGADH
                     AEGSPIVFDKVTVGAPEPDGSQRVLVKDLTLAVASGQHLLITGPNGCGKTSLLRVLAG
                     LWAPVSGTVTRPSGVSSIMWLPQRPYLLQGSLRDQVVYPRDARTEKIVDARVKECLMM
                     AGLAKFVDGSMNVGLNTRHLEWNDVLSGGERQRIGFARLYYHAPKFAILDEATSAINP
                     DEESKLYERLIETDTTVVSIAHRLELRKFHKLELKIAGDGEGGFRILKL"
     gene            complement(<227911..>228762)
                     /locus_tag="OSTLU_26439"
                     /db_xref="GeneID:5004349"
     mRNA            complement(<227911..>228762)
                     /locus_tag="OSTLU_26439"
                     /product="predicted protein"
                     /transcript_id="XM_001420416.1"
                     /db_xref="GeneID:5004349"
     CDS             complement(227911..228762)
                     /locus_tag="OSTLU_26439"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420453.1"
                     /db_xref="GeneID:5004349"
                     /db_xref="JGIDB:Ost9901_3_26439"
                     /translation="MEASTTDGTFASETASDGATGATRKREVTVRILTRDRDYDPFDA
                     DEKAVGYDVEDAVYKPSVSTWGVFERPPDISKTYGGGRTVKREELEDEEAIAARRARV
                     AKKLAKYREDQGMTLTNAEYAEVREVLERSGEAMKRGYMQDALDLLEPWALDRIGQKT
                     EMGGRIIFNYAICLDNLQRRDEALKQYRRCIGNQYGNVSKQADRMIWGMTTASKKMKS
                     DLFDYMDAAKLDAYDEYLIKMANEKFAGEIDEEEVKALNTQAMLTMVGLFGAPMLLFA
                     YLTTSTH"
     gene            229142..>230424
                     /locus_tag="OSTLU_26441"
                     /db_xref="GeneID:5004578"
     mRNA            229142..>230424
                     /locus_tag="OSTLU_26441"
                     /product="predicted protein"
                     /transcript_id="XM_001420244.1"
                     /db_xref="GeneID:5004578"
     CDS             229708..230424
                     /locus_tag="OSTLU_26441"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420281.1"
                     /db_xref="GeneID:5004578"
                     /db_xref="JGIDB:Ost9901_3_26441"
                     /translation="MRAIVRGDAGAGARDSGPGDGLAGELAGYFEECADAAFHAKVVA
                     EGETLRAMKSRERVKWLMRARLEMIESKLDSWPRALAAMATPRYAMTTLRRRAALADF
                     IADAADVDALDVLPDSLDTFRWHAERAAMLALYAATELRLLTDSSKDRRKTWAFLDAR
                     VDDIARSRVDVLELKSYIDVFARDADLTTLGASFASKDALAAAFAPVADVFARASRAV
                     FSTPSRDASERDPPRDSPDR"
     gene            <234130..>234354
                     /locus_tag="OSTLU_9233"
                     /db_xref="GeneID:5004350"
     mRNA            <234130..>234354
                     /locus_tag="OSTLU_9233"
                     /product="predicted protein"
                     /transcript_id="XM_001420245.1"
                     /db_xref="GeneID:5004350"
     CDS             <234130..>234354
                     /locus_tag="OSTLU_9233"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420282.1"
                     /db_xref="GeneID:5004350"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="JGIDB:Ost9901_3_9233"
                     /translation="LTASRIKADRQKGNLRSVFDEIDVNRDGKLCLAEFTQAYKKVDE
                     SLTDAQIAKLFRDADVDNSGTLDYDEFCEVM"
     gene            <235291..>236370
                     /locus_tag="OSTLU_13035"
                     /db_xref="GeneID:5004351"
     mRNA            join(<235291..235502,235665..>236370)
                     /locus_tag="OSTLU_13035"
                     /product="predicted protein"
                     /transcript_id="XM_001420246.1"
                     /db_xref="GeneID:5004351"
     CDS             join(235291..235502,235665..236370)
                     /locus_tag="OSTLU_13035"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420283.1"
                     /db_xref="GeneID:5004351"
                     /db_xref="InterPro:IPR006169"
                     /db_xref="JGIDB:Ost9901_3_13035"
                     /translation="MDGGSRRRRGADGGDGGKGGDVVLVACARTKGLGDVKNLLRGAT
                     GGAGGAQGRIGSRGADARARVPLGTIVRGEWLVVADLTRDGQTCVLARGGKGGKGNKR
                     MPVGREAGTREPGAPGEEGKFVLELKTVADVGLVGLPNAGKSTLLRALSNATPRVGSY
                     AFTTMQPQLGAVSATDGETITLADIPGLIKGAHENKGLGHNFLRHVERCEALAYVVDL
                     SSGDGVKPWDALDILKRELEEYLPGLSKRPGFIVATKTDLPHTARTLKALRARTAPTP
                     VFAVSAANREGTDEVLRVFENEIIGNRRV"
     gene            complement(<236659..>237756)
                     /locus_tag="OSTLU_3295"
                     /db_xref="GeneID:5004352"
     mRNA            complement(<236659..>237756)
                     /locus_tag="OSTLU_3295"
                     /product="predicted protein"
                     /transcript_id="XM_001420417.1"
                     /db_xref="GeneID:5004352"
     CDS             complement(<236659..>237756)
                     /locus_tag="OSTLU_3295"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420454.1"
                     /db_xref="GeneID:5004352"
                     /db_xref="InterPro:IPR004277"
                     /db_xref="JGIDB:Ost9901_3_3295"
                     /translation="ARSPHTLTMLACGAVALAVATHAFANDANDARWTTEDGIRRGAT
                     GALGAYLAYGALQGPATHMTRPHAAVWKVVHAAFTMYLLALIVLLFQTPADAQKMLKF
                     FWDDLGTPLPTRSYGGDCRVYTPGHRSGSFGIVYETLFDEFTVAHVLGWFGKAVAIRD
                     WGLLWAYSIAFELCELTFEHWQPNFNECWWDMWVWDVMICNLLGICAGMWLVKFMRGK
                     FHDWSGKKASSRSAAAKEPPRSPVRGALKTVLTSLTPASVDHYTWRPTGSPSRFLKCA
                     FLVFCGLVFDLNLFFMKFVLHVPPSHNFCLYRLGLWFAMSNIAIREYYVFIETPDVGE
                     AKLGPNAWLALAVLIVEFLVVVKNGRGKFTAP"
     gene            <238016..>240295
                     /locus_tag="OSTLU_93436"
                     /db_xref="GeneID:5004579"
     mRNA            <238016..>240295
                     /locus_tag="OSTLU_93436"
                     /product="predicted protein"
                     /transcript_id="XM_001420247.1"
                     /db_xref="GeneID:5004579"
     CDS             238016..240295
                     /locus_tag="OSTLU_93436"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420284.1"
                     /db_xref="GeneID:5004579"
                     /db_xref="JGIDB:Ost9901_3_93436"
                     /translation="MHRARDDARDDARDDGDDARDDARDGANDWMRAIENLQPTTPRG
                     CAACAVLVAIALKATTANESSFALGALVGCAGTLAAQVAAVTRAVRANAAATAAREVA
                     DAAAREEFDRGRDDDARNGDEGRNAGVGATTSVGEAPHSGWIVVARANAKSAKGAAAS
                     GEKKFARLTRDGRLQLANERGGEVVDVIDLCGCDVALTKFPGLEKPTELRWHKSTPMV
                     VRHGDRAVYRSMKTVWLFALSSPAKEAWFVALMTCVERLRAESGGAEADARALDRMRV
                     EADDFAKFTQETKKYKEESARRDAHAQGTHSAGAGTAGATINALGSRLLFDMFRDERW
                     QLEQKEKLVNKMNNAPGTPKFVGTFEITHIDFGSTVPHIISARVPSFSSSSAPWDGAS
                     MPGRGFSHALELDVEYVGRATMTVQTRVDLSKYAQDMESEANNVSNAESVDEIARSFS
                     SIKKAAAREAARVVTSLSDTLSATPLRFTLTLKKCQGVMRLWIPPPPGDRLWWGLIKE
                     PDIDLEIIPELGAAAISHEGIASRVSQFLRNLFVADMHSQLLLPNCVAEPWKELRPFV
                     SAMELSLAEAATEEFSALQPPSPSPSPINTERERPAERDRPAVSNVTTPASTPRPSFD
                     TPTSPPPEQVMESPPVSPKASVAPIAAVSASLPSSPTATITGLATTTSTEPPPKRPAS
                     EDIQAKPTSSFFAQAKSFTQKLERSFGDDFKDFTAAVKDAGVAGGLKHVSKNIEKVIA
                     PTSSKDPAQPSSSNVLKND"
     gene            <240877..>241494
                     /locus_tag="OSTLU_43977"
                     /db_xref="GeneID:5004353"
     mRNA            <240877..>241494
                     /locus_tag="OSTLU_43977"
                     /product="predicted protein"
                     /transcript_id="XM_001420248.1"
                     /db_xref="GeneID:5004353"
     CDS             240877..241494
                     /locus_tag="OSTLU_43977"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420285.1"
                     /db_xref="GeneID:5004353"
                     /db_xref="InterPro:IPR007757"
                     /db_xref="JGIDB:Ost9901_3_43977"
                     /translation="MYEHEQFDVIMMDPPWQLATANPTRGVSLGYSQLTDQHIADLPL
                     PQLQKNGLLFVWVINAKYQWCLNQFKKWGYEFVDEIVWVKVTKTRRLAKSHGFYLQHA
                     KEVCLVARRGDAPPGLKNRAIGSDIIFAPRRGQSQKPTEIYELIEELVPNGRYLEIFA
                     RKNNLRDYWVSVGNEVTGTGLPPDDVKAFEERGHIPSAKYGASNR"
     gene            complement(241565..243799)
                     /locus_tag="OSTLU_26449"
                     /db_xref="GeneID:5004354"
     mRNA            complement(241565..243799)
                     /locus_tag="OSTLU_26449"
                     /product="predicted protein"
                     /transcript_id="XM_001420418.1"
                     /db_xref="GeneID:5004354"
     CDS             complement(242397..243761)
                     /locus_tag="OSTLU_26449"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420455.1"
                     /db_xref="GeneID:5004354"
                     /db_xref="JGIDB:Ost9901_3_26449"
                     /translation="MTLNERERLISAFSPPRALADDAIVVDVDAIGVNTRRDDDVRSR
                     FAPSPSPSRSRVAAGAAAIALLGAASVAIAIAGRSGDASDAAATRARLGYTDAEKARA
                     LDVRRSIGDKRSGHGFPIFLHIPKTGGTTIETSLGVSGIAEGYCIKREDRAYELHPRY
                     RGWENWHSIPKDYVRKSWAIVRNPYERAESEFLYWTGTYDRKLFDSLKVGYDEGNCEK
                     FAAHLTLNVHDSKIRACYEAGGWELRAQKKCEDEINGGVASLSHWAPQMLMASRAENL
                     FRIEECFGAEEGECPLTPWSKRHGGASVKEENIISFIHHRYHKKIEMVVTNAWHKDVP
                     KPDLHSCWSRFDPELLNLFNTFYGGDFEHLGYDIMRSAANLGAPSQTVPKELIGLTLG
                     QLAERLPKGERVAVNNAPTCPPKESVLEEFLHGGDKSHAQVGEATTQTTTRRASRRNT
                     KPKH"
     gene            complement(<243871..>245535)
                     /locus_tag="OSTLU_26450"
                     /db_xref="GeneID:5004580"
     mRNA            complement(<243871..>245535)
                     /locus_tag="OSTLU_26450"
                     /product="predicted protein"
                     /transcript_id="XM_001420419.1"
                     /db_xref="GeneID:5004580"
     CDS             complement(243871..245535)
                     /locus_tag="OSTLU_26450"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420456.1"
                     /db_xref="GeneID:5004580"
                     /db_xref="InterPro:IPR000061"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="JGIDB:Ost9901_3_26450"
                     /translation="MHFSLNNPRKGNRLALQRARDARKAARDAAEVEAVLETFQNEFG
                     DGDDDDEDGRANAVTFVRGGLQRPDARDGVDDEGVGEVYALGARDGPAPAAKRKGADA
                     ENDVEAGPSAPRGKKKLKAIDAMLEEFAAKAPVVPEASARSEPASTSERVEPATATDA
                     SRSSNVRITNLPVDVAAVDLARAFERYGPIASVKIWRPSKESRETSNSGYVCFMSRTS
                     AERAVDEMHDALLFGNTVNVVISMAMRIPQHAMWPTTLHANEAAELLARAPAEVLGDI
                     PWSVAPTATSDTSDEADVVVQIPDDEDLKRRIDITAAYVAEDGEVFERALKAREATNE
                     EYRFLFDECSQAHAYYAWRVFAFAQSDALETWRTEPFVMIRDGARWIPPPLDETQASR
                     LENRVGRSSKRAAMKLSTADRKSLVEILQHITVARDDIRDAMEFAVERAECAADVVDV
                     IATSLCNLETPRQTMTARLYVVSDLLHNCAAPVKGVQAYRALFISALPSVFERLELYL
                     EAASSSASRRAFKRDVLATLRAWSDWCAFTDDFIIRLRGSAFAVDD"
     gene            complement(<245634..>247597)
                     /locus_tag="OSTLU_17301"
                     /db_xref="GeneID:5004581"
     mRNA            complement(join(<245634..246478,246542..247007,
                     247220..>247597))
                     /locus_tag="OSTLU_17301"
                     /product="predicted protein"
                     /transcript_id="XM_001420420.1"
                     /db_xref="GeneID:5004581"
     CDS             complement(join(245634..246478,246542..247007,
                     247220..247597))
                     /locus_tag="OSTLU_17301"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420457.1"
                     /db_xref="GeneID:5004581"
                     /db_xref="InterPro:IPR003890"
                     /db_xref="InterPro:IPR003891"
                     /db_xref="JGIDB:Ost9901_3_17301"
                     /translation="MMRETNDKTSVEYQRMSWDALKKSINGLVNKVNASNVQHVVPEL
                     FQENLIRGRGLFARSVMKSQMASPQFSGVFAALVAVVNTKFPEIGELIAKRCVLQFRR
                     AYKRNDKPVCVAATRFLAALINQQIIHELIALELLTVLLGTPTDDSVEVAIDFVKECG
                     FTLQELTPQGLHGIFERFRGILHEGEIDKRVQFMIEGLFAFRKGGFEGKKGVSPELDL
                     VDEDDQIVHEIGLDDEMQAQPGLDVFKEDPEFEENERRYADIRKEILGESSSSSSDSD
                     SDSDSGDGKVEIADLTETNLVNLRRTIYLTIMSSLDFEEAGHKLMKLNIPPGAEVELC
                     TMLVECASQERTYLRYYGLLAQRFCFIHKIYPQLFDEVFMKQYSTIHRLETNKLRNVA
                     KFFAHLLATDAMSWTCLAYIQLTEEATTSSSRIFIKILFQELAEALGLKQLNEKMQNP
                     EMREYFQGIMPKDEPRNTRFSINFFTSISLGALTEDMREWLKTAPKTVPKRSRSSSSS
                     SSSSSSSSSSSSSSSSSTSGSRSSSSSSSGSSSHSSSSSRSRSRDRRRKRSRRR"
     gene            <247984..>248811
                     /locus_tag="OSTLU_17302"
                     /db_xref="GeneID:5004582"
     mRNA            <247984..>248811
                     /locus_tag="OSTLU_17302"
                     /product="predicted protein"
                     /transcript_id="XM_001420249.1"
                     /db_xref="GeneID:5004582"
     CDS             247984..248811
                     /locus_tag="OSTLU_17302"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420286.1"
                     /db_xref="GeneID:5004582"
                     /db_xref="JGIDB:Ost9901_3_17302"
                     /translation="MRRVAVARAAFSGAARGRGRPSARARADARRDGRGRARGRDVAR
                     ASTTGTTREDDARDDARDDARAAYDATYEGLDRDAGLAIAERADRGKTREDEWFYGEL
                     EFAAARDALRRVCPNAGEGREFVDLGSGLGKMVIVAALSGLFERARGVELLTELHEAA
                     TSARAAFDDALARGDGEVIEGARACEVTLDEGDLLNYDVSSADVVYIHATCFTPQLLS
                     ALALKLASELKTGARVMIMSKQFPEGWVFKPFDGGYAALAQPQSKWKLDCFLYEISR"
     gene            complement(248826..249829)
                     /locus_tag="OSTLU_26453"
                     /db_xref="GeneID:5004355"
     mRNA            complement(248826..249829)
                     /locus_tag="OSTLU_26453"
                     /product="predicted protein"
                     /transcript_id="XM_001420421.1"
                     /db_xref="GeneID:5004355"
     CDS             complement(248870..249472)
                     /locus_tag="OSTLU_26453"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420458.1"
                     /db_xref="GeneID:5004355"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="JGIDB:Ost9901_3_26453"
                     /translation="MARAKIMERARARVRWGWAKESALRGALATKAERWEEAERCFAQ
                     ALELDPEHVRAYAARGACYANRRMYAEAIRDFDRALKIDPNDGAAKAYKAAVEEKARR
                     LERARSGANVGARATTEDLDSLRARVLNPARGLDALSRSHGATKTYEMELGDDDDGVD
                     ARSRRERKRKKERKKERKKRKKREKKRSRRDDSSSSSSSS"
     gene            <249908..>256625
                     /locus_tag="OSTLU_44002"
                     /db_xref="GeneID:5004583"
     mRNA            join(<249908..249973,250218..>256625)
                     /locus_tag="OSTLU_44002"
                     /product="predicted protein"
                     /transcript_id="XM_001420250.1"
                     /db_xref="GeneID:5004583"
     CDS             join(249908..249973,250218..256625)
                     /locus_tag="OSTLU_44002"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420287.1"
                     /db_xref="GeneID:5004583"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR004179"
                     /db_xref="InterPro:IPR006935"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="JGIDB:Ost9901_3_44002"
                     /translation="MPGARDGGAEAAARYRQYEYKANASLVLESDRRGRPRGEPTGAP
                     ESLEGKIDASRFGDRARGGTDGDFAEKRERAARRRAEKRARGDAGEAEAFGKRGRATK
                     GASVLGGSEYGLYKPKTRETRAAYEGLLSVLQGVFGDQPQDVMRGAADEVLAALKEEG
                     KTERAKQKDVEALMGTLTSERFAQITAIGKLITDFSIPGEGGEGAGEELDDDIGVAVE
                     FEEEEEEDSDVDEVLEASDVDDDDEGDEGAYDGAVGARAVEDEYTPNADHGLNPADID
                     AHWLQRAISKAFGFTDSDAAESLKLSEDVYQVLSTEDDRECENALVSMLDYDKFDLIK
                     VLLKNRLKVFWCTRLARSASEEETANIEAQMKADPAAAGILASMRATRASARDRQTAT
                     EQKIREEARKLRGEVAEMRTQGGAAAAGRQLLELDALAFVQGSHFMSNKRCELPPGSF
                     RSAKKGYEEVHIPALKQPPFNDDEALRAIEEMPEWAQPAFEGMKTLNRIQSRVYECAL
                     LSPENMLLCAPTGAGKTNCAMLTILHEVGLHRRRDGSVDTSAFKIVYVAPMKALVAEI
                     VGNLSNRLKTFGIQVRELTGDVSLSKAEIEATQIIVTTPEKWDIITRKSGDRVYTQLV
                     KLIIIDEVHLLHDDRGPVLESIIARTVRQVETTQEMVRLVGLSATLPNFEDVATFMRV
                     NPEKGLHVFDNSYRPCPLQQQYIGVTVKKPLQRMQLMNEICYEKVMESAGKSQVLVFV
                     HSRKDTAKTAKALRDLAMENETLGKLMRDDSASREILLTEAETVKSSELRDLLPYGFA
                     IHHAGMSRADRTLVEELFGDGHVQVLVSTATLAWGVNLPAHTVIIKGTQVYNPEKGGW
                     DELSFQDVMQMMGRAGRPQFDTFGEGIIITQHSELQYYLSLFNQQLPIESQFVKQLAD
                     ALNAEIILGTIQNVRDAVIWLGYTYLFVRMLRNPTLYGVSVDAVEDDPVLEQRRSDLI
                     HTAAAQLDKSGLIRYDRRSGALQGTDLGRIASTYYVSHGTLMAFNQHLKPTMGDIELC
                     RLFSLAEEFKYISVREEEKMELSKLAERVPIPVKESIEEPTAKINILLQAYISNMRLD
                     GFALMSDMVYVTQSAGRILRCIFEIVLKKGWSQLAEKSLALCKMCARRTWASQTPLRQ
                     FSAIPVDVLQKIERKDLAWDRYYDLSSQEIGELMRAPKLSKALHRFIHQVPRLELSAH
                     VQPITRSVLKVDLNIQPDFIWDESVHGYVQGFWIIVEDNDGENILHHEYFLLKGHNAE
                     EEHGVSFTVPLSDPLPPQYFIRVVSDNWLGSDTVIPVSFKHLMLPEKNPPPTELLDLQ
                     PLLVSTLKADGYDELYAGRFTHFNPIQTQVFQCLYNTDENALVGAPTGSGKTVCAEFA
                     IMRSLMTNQDGRSVYMAPTATLADERYDDWSSRFGALGVSVTKLTGDTTADLKLLEKG
                     QIVITTPQQWDVISRRWKQRKNVQTVSLFIADELQLIGGSNGPTIEVVVSRMRYMSSQ
                     LAKPVRVLGLCTSLANARDLGEWIGASSHGTFNFSPGVRPVPLEIHFQGVDIINFEAR
                     MQAMARPVYGAIANHCRRSEPSIVFVPTRKHAKLASLDLLAFAAAEGEPGRFLQVEEG
                     DLEPYLAQISDESVRHALTFGVALIHEAMSEKERKVVERVFAVGAASVLVATAPLAWG
                     LTTPCKLVVIMGTQYYDAGGAGAADYPVTDLLQMMGRASRPGIDDAGVCLLLCHAPRK
                     EYYKKFLFEPFPVESHLDHFLHDPMVAEIVTRTIETKQDAVDYITWSFYYRRLTQNPN
                     YYNLTGVSHRHLSDALSELVETTLGDLEASKCISIEDDMDCAPLNLGMISAYYYITYT
                     TIELFAASLTAKTKLKGLLEIVAGATEFESFAVRPGEADMLRRILNHAPITLSSNKTT
                     DPHVKVAALLQAYFGRTSIHGDFTQDLQKILPDATRLLQAMVDVISSNGWLGPALAAM
                     ELSQMMVQGMWDKDPAVMQLPHIDQETGERCVTAGIEGVYDLIDMEDDARRDILQLSD
                     EQLEDVAEAANRYPSIEVAFDVTDPDDVTAGDAVEIVVNLEREIEGEIGPVFAPRYPG
                     RKEEAWWLVVGDVRKGTLHAIKRITLGKRQKVKLEFAAPEQVGKADLTLYFMCDSYLG
                     CDQEYEFTLDVKEGEDESDDDAMKP"
     gene            complement(256703..258134)
                     /locus_tag="OSTLU_26455"
                     /db_xref="GeneID:5004356"
     mRNA            complement(256703..258134)
                     /locus_tag="OSTLU_26455"
                     /product="predicted protein"
                     /transcript_id="XM_001420422.1"
                     /db_xref="GeneID:5004356"
     CDS             complement(256765..258111)
                     /locus_tag="OSTLU_26455"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420459.1"
                     /db_xref="GeneID:5004356"
                     /db_xref="JGIDB:Ost9901_3_26455"
                     /translation="MSLAVAASAVAFGAALRHLGYVTERDGRSLCVIIFSSTLPAVMA
                     RTFATARMDASARCVALAGCAFGCACVLVSLTTTRAMRGANARSSGDALIEMSRRSRE
                     ALVSGAAVGLNLGNFAYPLAEILYGAKALELIVVFDATNQVFLLIVAHAIYTWRCSKI
                     DVDGAGEAAKDGSTTKILESMRRSMVKQARNPCLLACFVTLCYRAVWGDGGFPPAIDG
                     FLAFLAGANKPAALLALGILFQPNMARDEARDMVCALARRYGASMLCASAVLYTMGGT
                     LGSIGSAVALMAMLSPLPLLTVTYAMEFALNVPFAATLVNYANLVSGAMIAVLAHVSF
                     ANPVALAPNLAAFGAATLGFGALVRRADRSAGGATKRASGVIASCFDPRRSMRVGIDA
                     RRPAMRARGDRARTCGVSVVARAQSPSNRAARSRGVASATHIASVRLGALLRPVLV"
     gene            <258317..>260134
                     /locus_tag="OSTLU_93439"
                     /db_xref="GeneID:5004584"
     mRNA            <258317..>260134
                     /locus_tag="OSTLU_93439"
                     /product="predicted protein"
                     /transcript_id="XM_001420251.1"
                     /db_xref="GeneID:5004584"
     CDS             258317..260134
                     /locus_tag="OSTLU_93439"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420288.1"
                     /db_xref="GeneID:5004584"
                     /db_xref="JGIDB:Ost9901_3_93439"
                     /translation="MENAALRDARAVTHGAASASADVEIGDDGCAIAGGRARETRAGG
                     RGGWLTAGACAAACGLGVALAMAGSRNGDETGGRGVIAREDIDVRRFVAVPMLGSKRG
                     RRGTSSKRGDDDDDAPGLGIDGDDDVPPFAANTGYFAYEEWFKKFTHGKSPGESKREL
                     AGAAAATPIQESAHRGVVDSDGWKTIRDDLRHAGGKRKLLLLLRHGQATHNAWGDTVD
                     EELETLPCTWRDHGDLLDPSLTDRGVEQALTTRASLTTRDGFFKAIRGGSDKKDRIRV
                     ASSPLSRAMETAIIVTSGVDHISRPIAVTDYLRERIELNAPFEVRRPISIDEGEDSDA
                     SKLIKNSHAHGCKFHKGLRELYGDDAFMLNVETHHKHHSDCRVDKTTPLSYTHCGGLT
                     LTHEADLELGDEREENIIAMMNRVKVVLANVFDRYDEEVVMLVTHSDFIISALMELYP
                     DTLGFVPQNGEVVPIVVEDRRTNHLPEAHATDDDASETASKAKTKSKAAVGEADHNRK
                     HAKSEDEETEDRTARGKKSMRAKASTGDEIVVDSDSSGPAATIKYFDDDDQTAKESAT
                     RHKSRKREASLGNDLSRRVEESLKNFHKQFERSADLGSE"
     gene            complement(<260179..>260793)
                     /locus_tag="OSTLU_88591"
                     /db_xref="GeneID:5004357"
     mRNA            complement(<260179..>260793)
                     /locus_tag="OSTLU_88591"
                     /product="predicted protein"
                     /transcript_id="XM_001420423.1"
                     /db_xref="GeneID:5004357"
     CDS             complement(260179..260793)
                     /locus_tag="OSTLU_88591"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420460.1"
                     /db_xref="GeneID:5004357"
                     /db_xref="InterPro:IPR009269"
                     /db_xref="JGIDB:Ost9901_3_88591"
                     /translation="MPSPDPRGRADERSKRSKRDASTSSSSSRSRSRSRDAADGDQTH
                     RFKQFLKKRHERLESVRRAAERAEREALDAGEALIGPPPPPESFEVDRDAINHGKHLL
                     AGEGEAMGRFAAAGERIPRRGEIGLKTDQIERFENLGYVMSGSRHSRMNAVRMRKEAQ
                     VYSAEEKAALAALSKEERAAKERRVLDDMRALVQAQLESRERHD"
     gene            complement(260881..263905)
                     /locus_tag="OSTLU_50798"
                     /db_xref="GeneID:5004585"
     mRNA            complement(join(260881..261853,263875..263905))
                     /locus_tag="OSTLU_50798"
                     /product="predicted protein"
                     /transcript_id="XM_001420424.1"
                     /db_xref="GeneID:5004585"
     CDS             complement(260901..261851)
                     /locus_tag="OSTLU_50798"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420461.1"
                     /db_xref="GeneID:5004585"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="JGIDB:Ost9901_3_50798"
                     /translation="MELNTEWEIDYKDIEFEGGVPSSQNRIGHGGFGEVFLGRYHGSL
                     VAVKKLFNQDMMGKGLSDFRREVQILSRLRHPSIVLWLGACTQAPNLTIVLEYMDKGS
                     LHQFLHRTTTPYTTLTLTRWAMTIAQGMVYLHSAKPFPIVHCDLNTNNVLVNRDGMVK
                     ITDFGLSKVKHSSRLSRQTGMTGTVNYASPEVIRGGKFSEASDVFAYGVILWELLTRR
                     IPWEDLNEYQIVFQMTSDLDASLAATAKNLELPASAPEGYRKIIHGAWATQPERRSAF
                     KDVLGDLREVYREQVDIEKALRAARKGSTSSLSATSAPDK"
     gene            <264298..>264941
                     /locus_tag="OSTLU_17308"
                     /db_xref="GeneID:5004586"
     mRNA            <264298..>264941
                     /locus_tag="OSTLU_17308"
                     /product="predicted protein"
                     /transcript_id="XM_001420252.1"
                     /db_xref="GeneID:5004586"
     CDS             264298..>264941
                     /locus_tag="OSTLU_17308"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420289.1"
                     /db_xref="GeneID:5004586"
                     /db_xref="JGIDB:Ost9901_3_17308"
                     /translation="MFLADAVEAKDLPGLAERMRERLRTMKENYHDITSYEGLRQRKK
                     GALKAAKKMDLLRAAFNVDEAPKDACPMPTHKSDKPLKRKREYRILGTKMLCAGVCFL
                     VLLMIPFLVTQYEEHEHHTGCDSISQGMIKLDHASSGQLEVNLLVGPCTYNASDFHMS
                     YNIYQSYNHHTYQLGALGKPLTTPHWSAASSGHRRKLLGGGGAGVSKHVKASFET"
     gene            <265066..>266409
                     /locus_tag="OSTLU_13038"
                     /db_xref="GeneID:5004358"
     mRNA            <265066..>266409
                     /locus_tag="OSTLU_13038"
                     /product="ArsB family transporter: P-protein-like protein
                     (tyrosine transporter)"
                     /transcript_id="XM_001420253.1"
                     /db_xref="GeneID:5004358"
     CDS             265066..266409
                     /locus_tag="OSTLU_13038"
                     /GO_component="integral to membrane"
                     /GO_function="arsenite transporter activity"
                     /codon_start=1
                     /product="ArsB family transporter: P-protein-like protein
                     (tyrosine transporter)"
                     /protein_id="XP_001420290.1"
                     /db_xref="GeneID:5004358"
                     /db_xref="InterPro:IPR000802"
                     /db_xref="JGIDB:Ost9901_3_13038"
                     /translation="MWLGLVLLISIFGLIITEIIHRTLVAFIGAAAVLFILSLQHRLP
                     SIATILTWMDHGTLALLFGMMIIVALLSRTGVFEYISVHIVEYSKGSMWRLFFMLMIF
                     DAVLSAFLDNVTTMLLLAPVALSLCKALNIDPRPLLIPLSIFGNIGGCSTLIGDPPNI
                     IIGNALKEHIGFVDFLRVLGPGVLLTMPFIFAFVKWYYGDALFGQKINVDIDELRAKY
                     PIRDMNLLIRSGTILIFVILLFFLHPVMHMEPAYVAVFGAIAILLTGSHDEFEYALEK
                     VEWDSLLFFAGLFVFTEGIAKLGLLRAIADELSTLIASFPIGQRQIGAMLLVELVAGI
                     ASAFVDNIPFTTTMLPVIIQMSENVQGISIEALAWALCFGADFGGIGTLIGSSANIVM
                     AGIAAEAGFPITFKSFFRIGWPVMCISLCIAGAYLAALEGAGTFKVKDDDSASYS"
     gene            <266624..>267850
                     /locus_tag="OSTLU_93440"
                     /db_xref="GeneID:5004359"
     mRNA            <266624..>267850
                     /locus_tag="OSTLU_93440"
                     /product="predicted protein"
                     /transcript_id="XM_001420254.1"
                     /db_xref="GeneID:5004359"
     CDS             266624..267850
                     /locus_tag="OSTLU_93440"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420291.1"
                     /db_xref="GeneID:5004359"
                     /db_xref="JGIDB:Ost9901_3_93440"
                     /translation="MDKYRKQQRKREIEKNKERRKEARAVAAQTKDLSELQAERERLE
                     KAKNAPQIPGQRLRVDKIDEKLTWLSKQIDAKRASDARDREAGLTPRSAKPRGPTSTA
                     YAVGAEQYYKPEDSVYWHPKLNPTGRPPAGKPQKWKAGIVVDECASASRQALPAATAA
                     SDSDSDSDSDSDAMPPPPGPPPGFELVIPALPVKDDAIAAAKTDTNDEDEPLLPPSAP
                     PDHEDEPLPPPPVPAGDEDGSDSEALPPPPMPPTGTSGGNEVEVAPPRVTETTTVVRR
                     APVGSMPRVVPVQRRPPPPPKHGVGGFFAAAPRAVRKPPSDPATFTKSAAPTATPIVR
                     AEHNVKLKALVPASVRVNRQEAPNAKRQRVVTGRAINAAPKVAASSSAGGSGKAADET
                     YLSFLDEMSELGAFAE"
     gene            complement(268493..>269634)
                     /locus_tag="OSTLU_50937"
                     /db_xref="GeneID:5004360"
     mRNA            complement(268493..>269634)
                     /locus_tag="OSTLU_50937"
                     /product="predicted protein"
                     /transcript_id="XM_001420425.1"
                     /db_xref="GeneID:5004360"
     CDS             complement(268867..269634)
                     /locus_tag="OSTLU_50937"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420462.1"
                     /db_xref="GeneID:5004360"
                     /db_xref="InterPro:IPR007051"
                     /db_xref="JGIDB:Ost9901_3_50937"
                     /translation="MSTPTPRSFEDDLTALPPCTRADGTYACQRLGCDAYYAPGPGNV
                     PGSCVHHTKRPCFRDGVKSWPCCGKSSHDFGEFMSIKGCASGTHTCAKITYEDDEAAA
                     VVERLPAAPAMPLSMEARARGEGDASACVRCKSGFYCAEHANSASPATTSTTEARETT
                     PDVAQKVKPEVDLDTEQTCKNPGCGRKFRERDNADDACEHHSGAPIFHETKKGWSCCG
                     KLVYDFDDFLKLAPCARGRHDADAKPIQFQSSSAKKT"
     gene            complement(<269829..>270482)
                     /locus_tag="OSTLU_17312"
                     /db_xref="GeneID:5004587"
     mRNA            complement(<269829..>270482)
                     /locus_tag="OSTLU_17312"
                     /product="predicted protein"
                     /transcript_id="XM_001420426.1"
                     /db_xref="GeneID:5004587"
     CDS             complement(269829..270482)
                     /locus_tag="OSTLU_17312"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420463.1"
                     /db_xref="GeneID:5004587"
                     /db_xref="InterPro:IPR008278"
                     /db_xref="JGIDB:Ost9901_3_17312"
                     /translation="MRYDEDARDARDVTFAYGARGKPSVRGPATLAARCGFSVSHCDG
                     LTAVAVTTNGDACGIDVEDENRRIGTDVGKFARRWLSDDETRRLSDIVADDERARAFM
                     RLWTAKESYVKALGLGIAGRPFREFDIAWDVAEDAAKTWSMDLRDVTDDGTVPWRFAL
                     LKPRASQSHVMSLCAPAGADGRMPRVRVRWASPFEPLVDVDAADADVLALGGSRATI"
     gene            <270999..>275084
                     /gene="SDG3527"
                     /locus_tag="OSTLU_88595"
                     /db_xref="GeneID:5004588"
     mRNA            <270999..>275084
                     /gene="SDG3527"
                     /locus_tag="OSTLU_88595"
                     /product="predicted protein"
                     /transcript_id="XM_001420255.1"
                     /db_xref="GeneID:5004588"
     CDS             270999..275084
                     /gene="SDG3527"
                     /locus_tag="OSTLU_88595"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420292.1"
                     /db_xref="GeneID:5004588"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR011124"
                     /db_xref="JGIDB:Ost9901_3_88595"
                     /translation="MPAPGAEGTERACGASGRALRDRATLKHTSRQQEIILQSIRATE
                     QTIGAIKRASLSEEIERRRETALGIVRDIDAAWKAMPAVPERGAGAARECFLQCDAAG
                     CGKWRRAPRAMGDALAGDAKFYCKDGRDGRFNRCEMAQEVGDDEVDSILDESVAADAE
                     ARERCKRDISNERGRMYQKRKRLLELERRHDIGEIELQEDGTYVTLAKRGKNGKNGKR
                     HGNNGVGGLGSKAPPHPGPFDEFAWVQCEAEGCGKWRKVKHAAVEGMSVRDRWVCCMN
                     EDKEHSTCKTPQEMSDEDVDKFKVDQERRMILHQKQLQEHYAHFAPRGAKLPEGLIRV
                     TVPVQDTTPPEAEPPAAVPVAAPAPGTAETTRISIDDGPEDSPMWVPGIPRPMAPLVT
                     PNTIPVQVAVSCNGHAGVYLPRRNLFRCHCEQPEHMCASVSGDGDGRLFGGSVWEAHC
                     GKASTRKYKASVKVHMNGPNPQMFIGRWFDRVGLKVADAKGGGGGGKPKKPKVKSFIM
                     ELEEAILPGPINQLSLRNLMTIFGFILDGSAVGEVKVKTEGEEKEKPKALTANERREE
                     GAKELGRFASVCKAWKQASLTVLKTAGVAKAEKKNFDGTALRTQFTVITEYVDRKDEK
                     ECQIERSVTLAANHPFDKKSKMKTAHVDDGTPPGWWPSLGVKAERKKLVTEVIEQETY
                     GVDFVTGRDATETLKRVLPDYSEDDVWGLYKQLLAQVNESYGAMTPDTLATQNLAVAA
                     EDLAVKLERKADAKSLAFSKALWKLAAAAIETPEYYYVHRKGFGVVCNQPIKKGEFLI
                     DFLGEIYPPWAWAEKQDAIRQVQKARGLRDRGPPEFYNMQIERPGGDAEGYSVLFCDA
                     MHENNYAGRLSHTCDPNVEVNLKAINGKYEIHFITTRDIAPGEELAYNYHSCTDNMKE
                     VEMAFCLCGARMCRGSYLNFVGEDHHSQVLESKHKLIDRQVMSFKAIDKAADPLTSKQ
                     ERSLAAVGFYPGKGLLRNCPGWLLQFVGDVAVYMDTELNELPKHILAAAKKEHAKLLE
                     KNPQAEFSYTEKFAKIDALAMRENRTQCVAIMLSKLRRLLTRARDDGPQKSVYECMDV
                     FEKSAPPYVTLTEAEIAAHFWGSGPENFEKSIVCGLIRAMGPHERKNDADKFIKWTSM
                     VESVAVEVRKGKMTRKESLLWLRDELKKLKQTDGARHDLAAGLIHLYAETNRFWQPSS
                     APEHQVYKSDKVAVREDEVNAWGVGAGGGGDKIVARVEKTYRPGFSAATMLQWHKQEM
                     ADPTQYITANRRGNLSMPDIACCYSSRPGQPLARSSDREHETWLAHLQSWPEEPWPQS
                     SGPWGVANSQKLIGSPVLDAWMKGQRSIPAKCLAWLKTNTG"
     gene            complement(<275169..>276338)
                     /locus_tag="OSTLU_93442"
                     /db_xref="GeneID:5004361"
     mRNA            complement(<275169..>276338)
                     /locus_tag="OSTLU_93442"
                     /product="predicted protein"
                     /transcript_id="XM_001420427.1"
                     /db_xref="GeneID:5004361"
     CDS             complement(275169..276338)
                     /locus_tag="OSTLU_93442"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420464.1"
                     /db_xref="GeneID:5004361"
                     /db_xref="InterPro:IPR002562"
                     /db_xref="JGIDB:Ost9901_3_93442"
                     /translation="MDDLTYDGEIVVASTARELEEAMARIEAFDARAGTTATTKHCGF
                     DMEWKVSFKRGAGESKTSLVQIAVANEDLSEKLVVLARIHTAGLTRRFKRWTRDGARG
                     KTGFNVRGDARKLVRDYGLEPSRVIELSVLAKERFEGGCPSAPSWSLARLCEHVLGKT
                     LPKDKTRMSNWEREELNESQIKYAAMDAWASLLVYRALMKRDVVESFGGEPYECDPLP
                     EPVESSDEEVEDEDEDEDEDEDEANAFVDDEEDDEEPTDVVFDDAVDKGELSAQSARA
                     GEIELTDTEREVYAKHIAGASLDDIATTTDTDRIVVFSTLLSAMRKGCAFYFKLLCIP
                     EHLTLFFDDHVMLNGALPKANDFVEYAKIDDERSCKLMLIALTVKLAREREQQQC"
     gene            <276942..>278549
                     /locus_tag="OSTLU_26466"
                     /db_xref="GeneID:5004589"
     mRNA            <276942..>278549
                     /locus_tag="OSTLU_26466"
                     /product="predicted protein"
                     /transcript_id="XM_001420256.1"
                     /db_xref="GeneID:5004589"
     CDS             276942..278549
                     /locus_tag="OSTLU_26466"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420293.1"
                     /db_xref="GeneID:5004589"
                     /db_xref="JGIDB:Ost9901_3_26466"
                     /translation="MRDVDADVLPLLLRLRSAGASAEGLRRGAAGVRAWRDALARGLL
                     PDASLEWPEDETFRTALIEALGDLDMARFTRRFPPVLDTLMKNVLDILYVYERDREDE
                     DATPELPPTEPRDSETANDGEGEGDARGSGAGESDEEEGEGEARSQAGGRGGAGEETD
                     GSDNVDEFDVGMDGDDGANEAMERAKEKNKEIVSRLMEEFKEQWEPAMDKLDKAAKAF
                     EGLDLDDLADGPEGFDLTRGLWQQTGWKELDSLRKKLQDLKELRDMVRSLGRGSGRGP
                     LRRAPRQRERQGFPIGLVRSPMEPEQTSGLCRSDDLSRMMPSEMVLLASSLPQARLLH
                     FARRAERTLLSYERVGWSEEPAVTVEGFETRPAAECGPIIVCLDTSGSMMGARETVAK
                     AMVLECMRQSRSQQRACYLYSFSGPGDCQELELKLNAAGLYGLLEFLSGSFHGGTDVD
                     EPFNRALARLNEAEWSNADILLVTDGEIKPPDETLIANLNEAKEEMGLKVHGLLVGDA
                     GNAEVVESICTHVHAFKSWTAVGGKPS"
     gene            <278786..>280147
                     /locus_tag="OSTLU_3307"
                     /db_xref="GeneID:5004362"
     mRNA            join(<278786..278866,278963..279547,279695..>280147)
                     /locus_tag="OSTLU_3307"
                     /product="predicted protein"
                     /transcript_id="XM_001420257.1"
                     /db_xref="GeneID:5004362"
     CDS             join(<278786..278866,278963..279547,279695..>280147)
                     /locus_tag="OSTLU_3307"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420294.1"
                     /db_xref="GeneID:5004362"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Ost9901_3_3307"
                     /translation="VDLDACERRYLLVGGIDGSVRAYDTEAANRAGASGTASGTASGA
                     AATSEEIGHTYATSCVRWLPSDTGMFFSGSYDKTVKCWDANSLRSACDVELPTKCRTL
                     ALSDAATTHSLVAIGSDDNVVRLWDPASNAIAHTLSGHRGSVHAIEWLRSNEHALATG
                     GAEGDVRLWDIRSAGAYMILDRHNTQPSARVDAIKDAMYAGASTSGTIEAGPKPASRK
                     MADSSARGRDERDDASRSRLFPAGDGYSSIPAPAHDGQVSGLRTTPCGMFIVSTGADG
                     RIRRWDLSNGLNTYTPYDSAGAAPTASACQIAITADGERLYVPCTDTRVRVYRTHTGT
                     LDAELKGHLDDVVACAYKDGGDAKLFTCGKDANVLVWAP"
     gene            <280505..>281098
                     /locus_tag="OSTLU_26468"
                     /db_xref="GeneID:5004363"
     mRNA            <280505..>281098
                     /locus_tag="OSTLU_26468"
                     /product="predicted protein"
                     /transcript_id="XM_001420258.1"
                     /db_xref="GeneID:5004363"
     CDS             280505..281098
                     /locus_tag="OSTLU_26468"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420295.1"
                     /db_xref="GeneID:5004363"
                     /db_xref="JGIDB:Ost9901_3_26468"
                     /translation="MPSKRASANGRVDRAATDRSRASTPRGVKTLKVRLARATKFRDE
                     NRIPVRDRLGDGAKTTKSAAKDLRRTIERATTTGDARTRAKGDVGPGDLRRRLPRRDD
                     GAAANAKAKATRTSGDLRNALSGKSGRKGVANAKGRGDARVNALLRRLNLSSYEAAFA
                     REEIDLIALRAMRDGDFDKLGLPYGVKVKLALALGRR"
     gene            <281261..>282031
                     /locus_tag="OSTLU_26469"
                     /db_xref="GeneID:5004364"
     mRNA            <281261..>282031
                     /locus_tag="OSTLU_26469"
                     /product="predicted protein"
                     /transcript_id="XM_001420259.1"
                     /db_xref="GeneID:5004364"
     CDS             281261..282031
                     /locus_tag="OSTLU_26469"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420296.1"
                     /db_xref="GeneID:5004364"
                     /db_xref="JGIDB:Ost9901_3_26469"
                     /translation="MSVEHSRTVRLSEDLSYVQPTAPLPSWLKGFFVTAVSKGQDSVV
                     QAAIEASNILNDYWFKVAYDAHRIDGEKPYERAEAMWIPGCDACAFVALRPDDNDANV
                     YMCAKAIVEECRKGADWKQPTHVARIVAVEKSSSELELDALARDVLSKHFPERGGDSE
                     PVTFGIHYEEHSPMRHFSSTDVNRFVGSHVPDEGYKVDLKNPRFTICVVNAGGSMMMS
                     VVEAYDALGHFNVHRAAFEDKLSDTVPARGDDSAQPAA"
     gene            <282429..>283844
                     /locus_tag="OSTLU_43938"
                     /db_xref="GeneID:5004365"
     mRNA            <282429..>283844
                     /locus_tag="OSTLU_43938"
                     /product="predicted protein"
                     /transcript_id="XM_001420260.1"
                     /db_xref="GeneID:5004365"
     CDS             282429..283844
                     /locus_tag="OSTLU_43938"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420297.1"
                     /db_xref="GeneID:5004365"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Ost9901_3_43938"
                     /translation="MTVVIFIFLLDQLSHGPLKGRKSPPVIDVAPVWGGMLAFLAGPM
                     KLMREATPKYGEVFTVPVFHKRITFLIGPKVSEFFFKAKDTEMSQKEVYEFNVPTFGK
                     GVVFDVDHTTRAEQFRFFADSLKSNRLRMYVGMMVKEAEDFFSKWGDAGEVDLLEQLS
                     ELIVLTASRCLLGREIRETLYSEVTDLVHDLDKGMVPLSVFFPYAPIEAHRKRDAARK
                     NLAKIFDKVIQARRESGASEPDVLQTFIDARYKDGSRLTNDQVLGMLIAVLFAGQHTS
                     SITSTWTGLLAIANKERVMPALEKEQKDIMKKHGKDLDFDILAKMDELHFAVKEALRM
                     HPPLIMLLRMAQVPFEVETSTGKKYTVPKGHIVATSPAFSHRLDNVYSDPNEYKPERF
                     REPNPEDKAQFASFIGFGGGRHGCMGETFAYMQIKTIWSILLRNFEFEMVGKVPEPDY
                     TGMVVGPTAGQCKIRYKRRVL"
     gene            <284584..>284997
                     /gene="MRPS9"
                     /locus_tag="OSTLU_44376"
                     /db_xref="GeneID:5004542"
     mRNA            <284584..>284997
                     /gene="MRPS9"
                     /locus_tag="OSTLU_44376"
                     /product="Putative mitochondrial ribosomal protein S9"
                     /transcript_id="XM_001420261.1"
                     /db_xref="GeneID:5004542"
     CDS             284584..284997
                     /gene="MRPS9"
                     /locus_tag="OSTLU_44376"
                     /note="Putative mitochondrial ribosomal protein S9,
                     imported to mitochondria"
                     /codon_start=1
                     /product="Putative mitochondrial ribosomal protein S9"
                     /protein_id="XP_001420298.1"
                     /db_xref="GeneID:5004542"
                     /db_xref="InterPro:IPR000754"
                     /db_xref="JGIDB:Ost9901_3_44376"
                     /translation="MVRVPIRDVAGRSYGTGKRKTAVARVWLAPGSGEHKVNGKPYDE
                     YFSSPAARADMIAPFFVSDTLGLFTAVVDVRGGGISGQAQAVRHGVSVALQNYDPAFR
                     PALKAAGYLKRDPRIVERKKPGKAKARKSFAWVKR"
     gene            <285380..>285562
                     /locus_tag="OSTLU_26472"
                     /db_xref="GeneID:5004543"
     mRNA            <285380..>285562
                     /locus_tag="OSTLU_26472"
                     /product="predicted protein"
                     /transcript_id="XM_001420262.1"
                     /db_xref="GeneID:5004543"
     CDS             285380..285562
                     /locus_tag="OSTLU_26472"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420299.1"
                     /db_xref="GeneID:5004543"
                     /db_xref="JGIDB:Ost9901_3_26472"
                     /translation="MKQREAFRRSNAKTHKENERRNAIERQEKRLARWRAGVAMKREY
                     EMKYGGGLGETTARGE"
     gene            complement(<285706..>287118)
                     /locus_tag="OSTLU_17319"
                     /db_xref="GeneID:5004544"
     mRNA            complement(join(<285706..286440,286486..>287118))
                     /locus_tag="OSTLU_17319"
                     /product="predicted protein"
                     /transcript_id="XM_001420428.1"
                     /db_xref="GeneID:5004544"
     CDS             complement(join(285706..286440,286486..287118))
                     /locus_tag="OSTLU_17319"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420465.1"
                     /db_xref="GeneID:5004544"
                     /db_xref="JGIDB:Ost9901_3_17319"
                     /translation="MTGTAVNPLLRAAYLARRGIHDVTLVIPFLAPNEQKLVHPGMIF
                     NTPEEQGEYVNKWVEERCGFKPQMKLSFYPGRYATDKYSIIPVGDLTSYIPGDRESDI
                     AVLEEPEHLNWYHSGERWTDKFKHVVGIVHTNYLDYVRLEENGEIKEKALKFVNNVVS
                     SVHCHKVIKLSDAVQEFPKSTTMNVHGVSPIFLDVGAKKAIEATKEKDVEMKRSKKPV
                     FTKGAYFLGKVVWGKGYKELLDRVSEHNVSEDGRECPLELDVFGNGDDFAEVKSNAEK
                     MKLPLHFHGRKDHAASDIHDYKVFVNPSLSDVVATTTAEALAMGKFVVCAKHPSNEFF
                     STFPNCLVYNTPQEFTKCVKQALTSEPAPLSAQDSYRLSWEAATDRFLDAAELSPRDV
                     NPSLGDKAKETFAHAMHTTMNKIEPIRRATGAGNNTLKAPEKLDASWVPEPWDSSARD
                     SNRKS"
     gene            complement(<287210..288655)
                     /locus_tag="OSTLU_25231"
                     /db_xref="GeneID:5004590"
     mRNA            complement(<287210..288655)
                     /locus_tag="OSTLU_25231"
                     /product="predicted protein"
                     /transcript_id="XM_001420429.1"
                     /db_xref="GeneID:5004590"
     CDS             complement(<287212..288411)
                     /locus_tag="OSTLU_25231"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420466.1"
                     /db_xref="GeneID:5004590"
                     /db_xref="JGIDB:Ost9901_3_25231"
                     /translation="MRDAGRGRDGDDASRRDKARAAATTTTTTTRETDVERRSGAVKG
                     ERTDAGLGRERARATSQGAAGQDGVFNVDALRAAVDRHHRHFSSEVERAWRESNFSFG
                     FGRGSAGGEFARESGDEGDDARAHRAGRKKTLSISAFREMARRASQDSLAKLDDAKFM
                     ERFEKLRRPRRSAGGDGRRTSESKRDERKSRPTSTQDLQALIAKNIPKAPAIPKWGEE
                     WDVFKAIGTNFNQDDGALAKTPQRPNRTLNRRRAQSETVVDRSPGTSPRKSPKEAPET
                     ARSPREMSRSSSTDALTAMGDGDADHGARALSETSSPREGGANVLESLKKEITKKKDE
                     LASRLPRPPSLPKLTTDLQNAVRRFAGQPEEIVVKSPYDASLSSPGVVLKRAESKELA
                     AELEASEA"
     gene            <288850..>291702
                     /locus_tag="OSTLU_26474"
                     /db_xref="GeneID:5004591"
     mRNA            <288850..>291702
                     /locus_tag="OSTLU_26474"
                     /product="predicted protein"
                     /transcript_id="XM_001420263.1"
                     /db_xref="GeneID:5004591"
     CDS             288850..291702
                     /locus_tag="OSTLU_26474"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420300.1"
                     /db_xref="GeneID:5004591"
                     /db_xref="JGIDB:Ost9901_3_26474"
                     /translation="MRGNRCAATARATDDLGARTAAAVCDDDPFAFGARARALFEDID
                     GETLAEDDDDDDDDARRGDARRIGRGVSVFEKVRREKAGTTMTATTATTATATATAEE
                     EEEDAFDEPRAKAKANAKKPAKAKAGRERAREKTARDGGDDDVMVVDDDVGECARPAE
                     DLFDEVAATGDKRAKREVKTLARPKKRVVEAPAAVVETHAVMPAPSARAKASTTGRIR
                     ASTSAAASAPPPAKKKKVSLKEFAGEEDGDEGGFDDGEGDDDHGLVPQSGAQLADIDE
                     ANYAVSGLSTVRDVKEKMRCVGVLANLMGNQRTRRLLASYGIPMKIIKAAQDAAMAPH
                     APNALKFGAAALLYLAASDLRAPATDAMRSVKSANAIRALLRPASSSDDALYLKTANT
                     VRSALKALKFLPNEAKDAPTLALLVAHQTLKGEQDAVLASGSGPGAGDVENSFRTILA
                     NQGAVLATCELVAQATTTLSKFGGACFVASASASTNDSVDDESTIEEYEQSAARVIAR
                     LFRASRVLECVSFESPAACAVISTSALGGSKRDDTNADVRPLDLLAVSTTRLAPEDGL
                     NSSRGDGRGVESATTTAAIDIPSPSPVKSRIPGGITMTPPSTPGAVRVAGTSYDDNDG
                     LTPLSSPVPIGLMQTAATRDNAAAIQWLADNVRTPVKGGSHNARTACRALVEALPTLA
                     AATTASVVGAKKGDVVQGIEIRYNAAIAVDHRVAVGALKSALCTLTNVTNENKEGCDA
                     VVGEDSRGLLVIASLIPWLALSIEGFTLRDAKERKRTRTPTDDSGSSLLNAALVLLVN
                     IVEADATTADVLRNAMVRLPGDSSRGASFVEALTMLYLQSGGADEDEDEGEKETAEEA
                     QHLTADMIKSYSSKTNGDDLILQAYCGLLLAFLIEDDAALRAEVTSTFPEKPQGTSRL
                     KPLADTLERFHAFHESLNSISAASSERLVKVVTWLR"
     gene            complement(<292222..>292722)
                     /locus_tag="OSTLU_93445"
                     /db_xref="GeneID:5004545"
     mRNA            complement(<292222..>292722)
                     /locus_tag="OSTLU_93445"
                     /product="predicted protein"
                     /transcript_id="XM_001420430.1"
                     /db_xref="GeneID:5004545"
     CDS             complement(292222..292722)
                     /locus_tag="OSTLU_93445"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420467.1"
                     /db_xref="GeneID:5004545"
                     /db_xref="JGIDB:Ost9901_3_93445"
                     /translation="MAMDIMDTPEPMATPVPTSPVRARMDSETYTDCVPGILLLCVRS
                     LHQARRSIASVVRSLAPAFAPAFAPIFISPSNPRRVRSTRARLVDRFARVLARAFDVD
                     ENVSPNPRARDRDEDSRRVAPRRVAHPPRDATDPSRESRGVARCRPSRARARIPHLNC
                     DETMKR"
     gene            complement(<293084..>293827)
                     /locus_tag="OSTLU_5039"
                     /db_xref="GeneID:5004592"
     mRNA            complement(<293084..>293827)
                     /locus_tag="OSTLU_5039"
                     /product="predicted protein"
                     /transcript_id="XM_001420431.1"
                     /db_xref="GeneID:5004592"
     CDS             complement(<293084..>293827)
                     /locus_tag="OSTLU_5039"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420468.1"
                     /db_xref="GeneID:5004592"
                     /db_xref="JGIDB:Ost9901_3_5039"
                     /translation="VIVASGPFSCSSDLKYEPLNDMLDYVREENPDALVLCGPLVDAE
                     NAFVKRAECGGLTYDEVAKVVVDKIEDKLFKDETIRTKVIFVPSIRDVTLDPVFPQPA
                     ASLDAYVSADAARAKRAFSASNPGTFTINGIVFSACSHDVLKHLSAQEISKGFVPKDR
                     LARLAKHVLTQGCAYPLYPPDASACLDARYGEDLTFKQTPDVLIMPSDLKTFAEDIDG
                     VVCVNPGRLARGAVGGGLAKIVVHPTTDGQ"
     gene            complement(<295150..>296322)
                     /locus_tag="OSTLU_4114"
                     /db_xref="GeneID:5004593"
     mRNA            complement(<295150..>296322)
                     /locus_tag="OSTLU_4114"
                     /product="predicted protein"
                     /transcript_id="XM_001420432.1"
                     /db_xref="GeneID:5004593"
     CDS             complement(<295150..>296322)
                     /locus_tag="OSTLU_4114"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420469.1"
                     /db_xref="GeneID:5004593"
                     /db_xref="InterPro:IPR004379"
                     /db_xref="JGIDB:Ost9901_3_4114"
                     /translation="RDREFDLVVVGAGISGCVFASRASRELGMKTLLVDKRDHVGGNC
                     YDFVNAKGFRVSQYGVHLFHTKHARVWEYVNRFSEWTPYEHRVKAAIEREDGEYEHGG
                     RRYRIVGVPPNRDTINALFPEADLKTDEDARRWLDARRSVNENPKNGEESALTRAGAE
                     LYEAIFKHYTKKQWDKYPEELDASVLARIPVREDVDDRYFSDPHQALPKHGYTRIFEN
                     MIMGDPNITVRLNTDFFEHKDMLRSKARKFVVFTGPIDAWYASQGLPKLEYRSLRFFE
                     EYHEGEDKTKPFFYQPCLQLNYPGPEVEHTRVVEYKHKPNQPREAREHAGTVVFKEYS
                     CDHGEPYYPVPNPANRELYEKYRDMAAKEPGVVFVGRLASYKYFNMDQAFLNALETF"
     gene            298352..300117
                     /locus_tag="OSTLU_26478"
                     /db_xref="GeneID:5004594"
     mRNA            298352..300117
                     /locus_tag="OSTLU_26478"
                     /product="predicted protein"
                     /transcript_id="XM_001420264.1"
                     /db_xref="GeneID:5004594"
     CDS             298360..299376
                     /locus_tag="OSTLU_26478"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420301.1"
                     /db_xref="GeneID:5004594"
                     /db_xref="JGIDB:Ost9901_3_26478"
                     /translation="MTDSVAHASPTWRTYSLDPSLQPDWMNGTAEVEAVKTAEDELER
                     SYKNKPFFKNTSYEAFARKRGEYDKPTPDGLEEFKRLLRASYLRTVERIDEDTQVLEA
                     QLQDENISETRRSVIPQHIEDTRAKLKEQDNSLNALCADVDAVIADLKGLPDKIADIK
                     EHASEQLQQHKRKRTSISLERNLEELSDALRSYEAKKEQERLTITDYRGKYGSCPSQY
                     VRQTAWARRPSGREEISFIVHPVGVIGCDGSNLSVDGRVSIDGYGEFNVPKWQPEWGP
                     EKQMCACECFQEWYKVDAQDLLYSALRGVEGALKALSGSGDDTSSLRRRLGDANLDEA
                     STGS"
     gene            <300818..>302086
                     /locus_tag="OSTLU_2491"
                     /db_xref="GeneID:5004546"
     mRNA            <300818..>302086
                     /locus_tag="OSTLU_2491"
                     /product="predicted protein"
                     /transcript_id="XM_001420265.1"
                     /db_xref="GeneID:5004546"
     CDS             <300818..>302086
                     /locus_tag="OSTLU_2491"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420302.1"
                     /db_xref="GeneID:5004546"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="JGIDB:Ost9901_3_2491"
                     /translation="CPYLDTVNLANLDFDFEKRCAVSLSPVHVYACLVCGKYFAGRGK
                     KTHAYAHALECGHHVFMRLADGAAWCLPDGYEVVDEGTTLSRIRDVLAPTYAKKYVEE
                     EIEGARPMWRRALDGTEFLVGVVGLNAIWSKRDDGVSAVLQSLNRVAPLRRALLLDDA
                     REREDVYRALADITKKIWNARNFKGHSSPHEFMQAVRNRSKDAFGAETGNHDAAQFLR
                     WLLNELIRDEKKRGEKRSVIQSCFQGEVEIIDDSSASRASPFLMLSMDLPNAPLFQDV
                     MEKNIIPQVSLERALLKKFDGVTADPKTRRRFKITKLPNYLIVNYSRFTKNNFFVEKN
                     PTIVTFPTRGLNLADHIPVPRGDENSATYDLIANIVHDGAPDDGSYRAMVYHAPDKNW
                     YETQDLRVAEVLPQQVNLTETYVQIYERRDK"
     gene            complement(<302203..>302733)
                     /locus_tag="OSTLU_26480"
                     /db_xref="GeneID:5004547"
     mRNA            complement(<302203..>302733)
                     /locus_tag="OSTLU_26480"
                     /product="predicted protein"
                     /transcript_id="XM_001420433.1"
                     /db_xref="GeneID:5004547"
     CDS             complement(302203..302733)
                     /locus_tag="OSTLU_26480"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420470.1"
                     /db_xref="GeneID:5004547"
                     /db_xref="JGIDB:Ost9901_3_26480"
                     /translation="MTPTLRGGARDAPGPSSARGGSGTEYVLARRLAHPFRSAAIGDV
                     VAFAHPSDATRTLIRRVSATEGDELVDAANASVYVVPKDHAWVTADADAETDSAKSAG
                     RHEDSRSFGPVDAWALEWRVMYSMRSAVDHATVENSAAARAADAPVLEAELANAMEAL
                     GWDGEGEGEGEGGEGD"
     gene            complement(<303116..>304390)
                     /locus_tag="OSTLU_93448"
                     /db_xref="GeneID:5004595"
     mRNA            complement(<303116..>304390)
                     /locus_tag="OSTLU_93448"
                     /product="predicted protein"
                     /transcript_id="XM_001420434.1"
                     /db_xref="GeneID:5004595"
     CDS             complement(303116..304390)
                     /locus_tag="OSTLU_93448"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420471.1"
                     /db_xref="GeneID:5004595"
                     /db_xref="JGIDB:Ost9901_3_93448"
                     /translation="MPADAWDSTYVKGFGRLFTPGACVEKVVIGCDGDKRADVRVFSQ
                     SGYLWRGKNKGKDGSYAKPAKIDPGQVDVYMAHEAVATFGKDLQNPKVVREFDYVGYF
                     DQKRSAIWWPFGPSLDSMAEDFPAYTIPHSERIPAVAWIAIDCLPPRPGIVVGLAEHF
                     PTFSMGNCFNNYHLPRNLPGRGVENLEYQSKMARYMFYFAVENAPMCQGYMTEKVWMA
                     LARGSIPIYTGHDSFTELMPTKKSYIDLRDYDSFEALAAELEAIASDESRYNEYTSWR
                     YDHPSTWSPGFRKLLRVQSTDIKVGLCAVLAKGPTVFPKADKMGGCSSDADLLGVKHG
                     DFGAYIEAARFRSKHHETGVPRSPLDFLQRVSCKDEQEKEFMGDCFVRRDAPVPPEIP
                     LLLAARDRAQWNRREKRIEDRAIDATADETAN"
     gene            <305050..306451
                     /locus_tag="OSTLU_26482"
                     /db_xref="GeneID:5004596"
     mRNA            <305050..306451
                     /locus_tag="OSTLU_26482"
                     /product="predicted protein"
                     /transcript_id="XM_001420266.1"
                     /db_xref="GeneID:5004596"
     CDS             305050..306441
                     /locus_tag="OSTLU_26482"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420303.1"
                     /db_xref="GeneID:5004596"
                     /db_xref="JGIDB:Ost9901_3_26482"
                     /translation="MRARARGALERAEPSARVSRAARRRFPRPRAPSRATSRANDRFR
                     DARDDDDDDDARARQFLRLARDARDGSWALQSATVTLRPRDASARATRALRVCALVHY
                     GEARYYRGVAKDFETRENDATLVELITSRKHLEASDERGLKLWRLSEALAPTAEARAL
                     ANAHGLRAQLDALDARARGWYVADVTREELIALRREAGEMTAKTAEETTRNAKRSAVS
                     MGGNLPPALEALAVTAFGRASEGDPARLFARLSCWFVPCPEAHLLLLDWVWAGGRPSE
                     VLGAMVDCCASGDLESARRLAFAQMIVSAQAEGPAGGGSTEPVLVARRNDVAMDGVNK
                     AFKAPEIDTVNLLYGGLHVPGLVRCARERLDMEVVDVAWRDAWRVQPPENASPLRYAI
                     VPLILGIDGTDWAQTLHDAVALGASAGILSTFLYIVRHGALYYALGKWLLEWNRQLFD
                     ADVGPSPENVKYR"
     gene            complement(<307167..>308390)
                     /locus_tag="OSTLU_3043"
                     /db_xref="GeneID:5004548"
     mRNA            complement(<307167..>308390)
                     /locus_tag="OSTLU_3043"
                     /product="predicted protein"
                     /transcript_id="XM_001420435.1"
                     /db_xref="GeneID:5004548"
     CDS             complement(<307167..>308390)
                     /locus_tag="OSTLU_3043"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420472.1"
                     /db_xref="GeneID:5004548"
                     /db_xref="InterPro:IPR000407"
                     /db_xref="JGIDB:Ost9901_3_3043"
                     /translation="TRYAVVIDAGSTGTRVHVFTFSRSAFASGGEALRDETFRSIEPG
                     LKSYGGDAEAAATSIEALIDVAKGVVPESARRETPFSVRATAGLRLMPEGREAADAIV
                     EAVRRKIANAGFHPSSASFVSIMDGEDEGAHAWVSVNYLLGNLGGAPEKTVTVVDLGG
                     GSTQIAYAVGGGAAKDAPKGYVRDIEAASTTYRTYVHSFKGYGIVAVRPKIFSVGKNK
                     DGSHPCLPNAFADSCEKDCYGLEPGETYAAIGSSDGSDFTRCLLATTQALEGNCAKAP
                     CSFAGAWTTPRKTPLFVMSFIVERAIQGGAVPPPRRPTDIATMTPRDVKRAALRACST
                     PAAELEARFPVAARDAVDVNYLCLDLVYVYALLTVGHGAADDETIRALDKIRYRRRDV
                     EASWALGDGIAAAAAA"
     gene            complement(308683..>310166)
                     /locus_tag="OSTLU_50811"
                     /db_xref="GeneID:5004597"
     mRNA            complement(join(308683..309354,309442..309957,
                     309997..>310166))
                     /locus_tag="OSTLU_50811"
                     /product="POT family transporter:
                     dipeptide/tripeptide:proton"
                     /transcript_id="XM_001420436.1"
                     /db_xref="GeneID:5004597"
     CDS             complement(join(308691..309354,309442..309957,
                     309997..310166))
                     /locus_tag="OSTLU_50811"
                     /codon_start=1
                     /product="POT family transporter:
                     dipeptide/tripeptide:proton"
                     /protein_id="XP_001420473.1"
                     /db_xref="GeneID:5004597"
                     /db_xref="InterPro:IPR000109"
                     /db_xref="JGIDB:Ost9901_3_50811"
                     /translation="MRGAHPLGLVVLGATEMWERFGYYAARALLALYVTKVLRDPTFD
                     VERVLGLRTVGKTDAVGMMERTRAAEATSAKTYGAFACLAYLTPVFGGIVADAVLGAH
                     RSAVVGAVVMALGYGAMASEWAFLIGLALVCVGNGAFKPSISTQLSALYAKDDPKRDA
                     GFSIFYCCINVGAFFSPLIAGTVRVYFGYGAAFASAAVGMWCALAIYALNRRHVVDAM
                     IPASANDNDEDLNDMARLIRENSNAMFAVAIVCVAGIGFSMVYEQSGSTLMLFSDEHV
                     DLHGMPTEFVAALNPLLVLSLTPAVTALWDWQARRGAEPHQMSKIAIGCALLSSSFAV
                     LMFGALPIDSHASPTRVSVFWIVLNQIFLTAGELFTFPVALSYISKIAPDGLLSAIIG
                     LWFGSYFFGNYFSGVLGSTYPSFDSPSGFFAALALIAGAVALVLGLARAPLAARCPT"
     gene            <310735..>311469
                     /locus_tag="OSTLU_5300"
                     /db_xref="GeneID:5004598"
     mRNA            <310735..>311469
                     /locus_tag="OSTLU_5300"
                     /product="predicted protein"
                     /transcript_id="XM_001420267.1"
                     /db_xref="GeneID:5004598"
     CDS             <310735..>311469
                     /locus_tag="OSTLU_5300"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420304.1"
                     /db_xref="GeneID:5004598"
                     /db_xref="InterPro:IPR002680"
                     /db_xref="JGIDB:Ost9901_3_5300"
                     /translation="VERRVNEALIGVAVTVIDNLYGGRSYARFHALETVARVPYFSFM
                     SVLHLYETFGWWRKADYLKVHFAETMNEYHHLLIMESLGGAELWKDRFVAQHIAVAYY
                     WICVAQYLVSPRWAYNLLEQVESHAYATYDGFLNANEEVLKATPPPSVAVQYYTKGDL
                     YLFDEFQTVDRGERRPKIDNLYDVFVNVRNDEAEHMKTMEFCQRPGNGLRSPSSKEAM
                     VLLSKDACEVDEDFQVDEDCEKASIAA"
     gene            complement(<312423..>313184)
                     /locus_tag="OSTLU_44270"
                     /db_xref="GeneID:5004549"
     mRNA            complement(<312423..>313184)
                     /locus_tag="OSTLU_44270"
                     /product="predicted protein"
                     /transcript_id="XM_001420437.1"
                     /db_xref="GeneID:5004549"
     CDS             complement(312423..313184)
                     /locus_tag="OSTLU_44270"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420474.1"
                     /db_xref="GeneID:5004549"
                     /db_xref="InterPro:IPR002818"
                     /db_xref="JGIDB:Ost9901_3_44270"
                     /translation="MRARTRTRTQSRTQSRTQSQSNARQRATAPTVLVPIARGSEEME
                     TVIIVDVLRRAGADVTVASIEPGDDDETRRDDDDDAARRDDAVECSRGVRIVPDARLR
                     DLARVETRAWDLIALPGGMPGAANLAKSERLTRALTRQMETPGALVAAMCASPGVVLA
                     PRGMLDGLACTAHPAFVKDLPSDASANGRVVVDGDVVTSRGPGTALEFALALAEKLFG
                     ADKAREVAAPMVLPPIDHSSPRVANEWRLLDAEVV"
     gene            313762..315339
                     /locus_tag="OSTLU_26487"
                     /db_xref="GeneID:5004599"
     mRNA            join(313762..313835,313990..314054,314282..314944,
                     315212..315339)
                     /locus_tag="OSTLU_26487"
                     /product="predicted protein"
                     /transcript_id="XM_001420268.1"
                     /db_xref="GeneID:5004599"
     CDS             join(313796..313835,313990..314054,314282..314944,
                     315212..315253)
                     /locus_tag="OSTLU_26487"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420305.1"
                     /db_xref="GeneID:5004599"
                     /db_xref="JGIDB:Ost9901_3_26487"
                     /translation="MAKYYGDIAKSAKDLLTGGFNYDTKVSVDTKSAGTGVSASVVQK
                     GEAVSGDLKVNANVVDQVIDIELNQDAKAKVTASFPSLIPNGKLSVGGTVQDLETVKV
                     SASVLAGPLGVKADVANYAAPKADASLCYAIGGGFAVGAMATIKSSSALAYTVAAQSK
                     QGDVTYALTAADQFKTFKASVVTALDSKQTLGAEVVYKKAATATIGYSKKMDGHSFKA
                     VVANPVSAEFNPTLSVHASLGSLIPKTTATISCQVDKTMKYKYGFQFATKL"
     gene            <315914..>318169
                     /locus_tag="OSTLU_44118"
                     /db_xref="GeneID:5004550"
     mRNA            join(<315914..316543,316769..>318169)
                     /locus_tag="OSTLU_44118"
                     /product="predicted protein"
                     /transcript_id="XM_001420269.1"
                     /db_xref="GeneID:5004550"
     CDS             join(<315914..316543,316769..318169)
                     /locus_tag="OSTLU_44118"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420306.1"
                     /db_xref="GeneID:5004550"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="JGIDB:Ost9901_3_44118"
                     /translation="KLDALKRLIALMATGRDVSVFFPSVVVNIVSESFEVKVLVYMFL
                     VRTADQKPEEALLSINSFQKDLAHPNPRVRALALRVMSSIRIQVIVPVVILAARKCAV
                     DPSPYVRKSAAHAIPKIYRMDNTRKEELIEIIETMLRDSTPFVLSSAVAAFTEVCPDR
                     IDLLHRHYRKICRMLVDMDEWGQILLSELLLRYARSQFLAPDAHTRELGGSRGPGWMD
                     EDHRLLLRCTRPLLQSQNAGVVMAVAALHFYLSPAADLPKVVRALVFTAHGRPEVRHV
                     VIKNICTMVTTQPILFQSHFNAFFVTPRDPLQVRALKLEILTHIVTSENAPTLLRELQ
                     AYLRSSNHDFVALTIRAIGRCAAIMPQIASVCIRSLLELSLHPSPKVASEAVVVIRAL
                     VQQNPKEHIVVVMRLMRRLDSLIAPEARSAVIWLAGGEIFDGDAENIKASDKELREKF
                     FELAVQMMRRVVKSFPDEHEMTKQQIVNTSCKMYIQDPIRIAPMLKVVFALAAADPSV
                     DMRDRIRVFRALFPVDGKPSAVKHFGDAVVLCAKPEPKLPSPAMQTCEHALGSLSHFM
                     DHMAPGYTPLAKHPTVQPPTNVREQYFAGGSGREGSSAIAVHNGKSNGLGASGFYSSS
                     DDSDDSDSDSSSYTGSDDSDDSSDDSGDSSDDDEDEDEDDESDDSSSSNDSD"
     gene            complement(<318264..>319094)
                     /locus_tag="OSTLU_44356"
                     /db_xref="GeneID:5004551"
     mRNA            complement(<318264..>319094)
                     /locus_tag="OSTLU_44356"
                     /product="predicted protein"
                     /transcript_id="XM_001420438.1"
                     /db_xref="GeneID:5004551"
     CDS             complement(318264..319094)
                     /locus_tag="OSTLU_44356"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420475.1"
                     /db_xref="GeneID:5004551"
                     /db_xref="JGIDB:Ost9901_3_44356"
                     /translation="MVGARGIEDVIATRSAPTTGRRGRARARATVRTRARFDILKPLR
                     AGPRFAAEQSVDPRVYRGAYADWTVDAADRAEVFAYRGSLSAMSLGAALTAGLCHAGD
                     YVDAEKAYFLGGLGLGGALLMVHMYVGEIRAAMRALWSVGFLGSAAIAMSAQEPLPVY
                     VWEHPMSVLLVGPMFAALTGLAFKEGMCYGKPEAALLFFAVPAMCLSHLFGASADVCG
                     VEANVVLALLVVLALRKYSQPIKDDIGDKSIFMFQALEEGSDEQLEFLKRARENGFDV
                     "
     gene            <319343..>320146
                     /locus_tag="OSTLU_44192"
                     /db_xref="GeneID:5004600"
     mRNA            <319343..>320146
                     /locus_tag="OSTLU_44192"
                     /product="predicted protein"
                     /transcript_id="XM_001420270.1"
                     /db_xref="GeneID:5004600"
     CDS             319343..320146
                     /locus_tag="OSTLU_44192"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420307.1"
                     /db_xref="GeneID:5004600"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="JGIDB:Ost9901_3_44192"
                     /translation="MDDDAPGGPQGARSYAPYAGAQANDACRNCGQLGHYARNCAQNA
                     GLNGGRGADRCNRCGQIGHWASECSLPYSGGAGAGGFRGAVGGGGARPGDRCSRCGGL
                     GHYARACPSPAMAAFAGGAGGAPKTCHNCGRVGHIARDCRQGGGARGYDNARAPKQRK
                     GAGPDDVCNRCGEKGHWASSCSQPDTRTEAERTRQAKPDDKCHRCGELGHFAKDCSLP
                     PDNTCRICKQEGHFARECPNKDTAAAANMDADLDNYMKEGAEKKESGEA"
     gene            <320396..>322138
                     /locus_tag="OSTLU_44124"
                     /db_xref="GeneID:5004552"
     mRNA            <320396..>322138
                     /locus_tag="OSTLU_44124"
                     /product="predicted protein"
                     /transcript_id="XM_001420271.1"
                     /db_xref="GeneID:5004552"
     CDS             320396..322138
                     /locus_tag="OSTLU_44124"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420308.1"
                     /db_xref="GeneID:5004552"
                     /db_xref="InterPro:IPR004006"
                     /db_xref="InterPro:IPR004007"
                     /db_xref="JGIDB:Ost9901_3_44124"
                     /translation="MSKKFLNAPDDVVSEMLDGVCLATPSIARIADQNVLVHVREGED
                     KVVVISGGGSGHEPAMAGYLGRGMLDAAVCGNVYASPSVEAVLSAIRATTTDAGAALV
                     VMNYTGDRLNFGLAAERAKLEGFDVEMVIVNDDCALASDRVGIAGRRGLAGTLFAHKV
                     AGAAADAGKSLKEVCAEARACVEATGTMGVALQACTLPGSSGVAREIAEGTMELGLGI
                     HGEPGAHTAKTTSADEVVETLMTSIFAQNEKIGKLSEGSNVALMVNSLGATPLMELYV
                     AARAAFSWLAGVKKINVTHAYVGTFMSAIDMNGFSVTVCALDDDTRVQRLEAPCSCSA
                     WPKTAKLTPAKLLSVSAPASDRNETIASGPPTTPEGVMALKAIKRVAKDLIAVEDTLT
                     KYDTAVGDGDCGTTIRKGAEALMKAADTYPIDDVSALMRAIGDTIRQNMGGTSGVLYD
                     IFFTAAADKLAKVAKGKAPSVDIVLLAFSTGVQAMCQYGGARAGDRTMLDALVPALTM
                     ATTTYMSKKSVIEVASEAAKAAANGAEDTKSMKANAGRSSYVNQDVLKETPDPGAVAA
                     ATWINAIFAAVSES"
     gene            complement(<322168..>326691)
                     /locus_tag="OSTLU_26492"
                     /db_xref="GeneID:5004553"
     mRNA            complement(<322168..>326691)
                     /locus_tag="OSTLU_26492"
                     /product="predicted protein"
                     /transcript_id="XM_001420439.1"
                     /db_xref="GeneID:5004553"
     CDS             complement(322168..326691)
                     /locus_tag="OSTLU_26492"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420476.1"
                     /db_xref="GeneID:5004553"
                     /db_xref="JGIDB:Ost9901_3_26492"
                     /translation="MSWPATSALTNATSFANATFDVDGSARATLRPDVEGKYSAALVD
                     TNGCYASQTLEVEVSWTCETSTNTAVAAAFIAFAAFCAYSFGRNLESSDFEDKRNVIL
                     DVGASYKMIGSGEADAELDDEYKRELDELTQEIKSEHITYVTKIDLDRDLKNILVDKK
                     KSARERAAKEAGLWNEAEEQFQKNLYATERAERRRSMVGEQLVATASKLMAWVKYTVR
                     LRSATFALMFRYKLAKVLDKEYWSHNLLRFQLYIEFFAFTAFAWRRSSHSNEMYRDAI
                     ADVFFYPGLFGPDMTERGAKTELTNWFVVLLFGVVICPVVVKFCGRVRDHFDQCMWAF
                     AEYVELGGDKTLTQYSDDPDAESGGGAQVDEETVQVNKLAKVHAMMSKTMRRVLLQPV
                     AMRDDFTPVRDREKQRFKVVPDVAWENGSDEAILRTVRLETTSPLNLRLIPREAAERM
                     ELMAEYALRRRTYSKRVGDFRDRVKAVGFVLRVLILRVALVPMVFASLGFLMVTTSFT
                     PTPWIHVSKDPSASFGDNLMISLFVGLGAIAVSMKMAVVSETLEPNLRPVPIFEMLSI
                     FLKVSLATIAAYMEGELPGHGVPALDSVARLESLNSLRNIMPVVVCLVLLVAHMNIQS
                     LRGFGQKRNESRAGAFGGAFMFAVVTYFSRIFNNPPWMSHGLVPHTGGSNWTRPGVVI
                     GIIMTLIAMVMVRVFNHSLGDHKCIRSELEKLSDPEQVEKVEKIMTPEFIKEQVEAEN
                     RRDRVVALVAFYNLLSTEQRTQLLSPLVKKTNMPRASQTKDGENEDVGDAWDTASDAF
                     EELGIIMHCIIDDPDQEFLQVAGEGFIRSVIHAYVQGTVEIALWCDDDSPASTWEAVK
                     SIVSTVKDCIKGGESKTFQATVATVSMECIQSFDFANLMSTLLFKAHDIDLDMYGEDY
                     VVSARMFRQIIDDAFEIPPRPIAKKLTQAITHVRDPDTDEVRRLDKAERVTYVARSWL
                     RQEVKAKNRPELNWFSSLGYYAAVGRLQNEADEERLELAHDFMKTLLDASLSTDKQIS
                     FYSIRTLATLVRVGDAGPSVFAVDGLKVLFECMEAHAGSSKETFVSEILYALTNADAC
                     RSEFLSALSHLIVSMEPGKEREKIHAIELLHQSIKLEMSAVYRVMNTKSDEGEVSKKS
                     YKAFISMSAAQFVHDALYGMLIDDEAETRELSIHALVDLITLFVWGTEGNFYDFEVPV
                     TGSYTDAAFERFVDAAKRKMPGGALMSKTMYRRLYGDIKVQGLQKDTDKLIAVLLKIV
                     NTDDNAGVRAAAERGISDMRALLSDDSALTAITLYDESSDVRDVRGAAPSRETLHNVS
                     AIIHSSVERQRQKDETISKLRLNEFWRKMKEREHSGNSHRQAKSTRGGRVEIERDSDP
                     SKGPAPPIGGRMTMVKGTTGFKRVPDQATPKIVRHPPPPPPTERLERQRRARSALHAD
                     RLAKREAASDRWYGGENFRRQRSIESANNEASEVVVSSNIAALNERPTFTAPRYGTTK
                     VPREFRRAPRPPE"
     gene            <327320..>330304
                     /locus_tag="OSTLU_26493"
                     /db_xref="GeneID:5004601"
     mRNA            <327320..>330304
                     /locus_tag="OSTLU_26493"
                     /product="predicted protein"
                     /transcript_id="XM_001420272.1"
                     /db_xref="GeneID:5004601"
     CDS             327320..330304
                     /locus_tag="OSTLU_26493"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420309.1"
                     /db_xref="GeneID:5004601"
                     /db_xref="InterPro:IPR000977"
                     /db_xref="JGIDB:Ost9901_3_26493"
                     /translation="MDDVANDSGHRLGTRDGGDDDDDDAEEDGARLTSEPSTSGASLR
                     YATARDVPFRKLCGAFEALQNERGRSKATSARRYRVLDTLHDRCLVSARDGTRVDAFD
                     AYRLILPALDKERGAYFLKHDALAKVVVSAFDMSRASEDAKKLEDWKRKGGGNFPQVV
                     RDVLAGGHLADREKDEDARTLTIGDVNEALDALAACDNKDQRASTLRALFSKMDATQV
                     KWTCAIILKETKISMGEKAILRHYHSEANDLWDWTSDLRRVCEDLPRRDFRMKREDID
                     VGVGLINPQMARRQNSIDAVYRALKGTQFVIETKFDGERIQIHKDGDIINYWTRNMND
                     FGPRGYDVMNALFRHLPKRCILDGELMVWNKLRDQSYPFGALKNLIKAANMRKAKDEL
                     FPLKAHLENRDGGDSDGEEDLMSSKYAWYAENVKKLTYGDLELVYVPFDILYAVDRSV
                     KTHKLRERHELLKEHVREVSVMCGNIRARILLATPDCAFSRVGSTKEDIERALLEAMD
                     NGEEGLVIKDLDGPWIPGDRSNNWMKIKPDYLSSEDLDVVLIGGYYGAGELRGGKISQ
                     FLCGIVEATNDPISTASDGVKIMSFCKVGTGISAMQLDDLRSRLGDFMHREKPQDMNY
                     NVTDAYNEKPDVWIWPPQRSLVVTVKGDIRAIRTTTFATGYSLRFPRVTGIRYDKKWS
                     DILTLCDLLKTIEEEVPTLKVNIDDTRGGTNARKRSRTTGPATLLPAHLMPVDVSGVV
                     QESEIFKNMQVHIANCESREQKQELFKAVIARSGTTSELWHKHVTHSVALNRDGSKFR
                     TASREGDVYTIAWLQECIHEGRVVPPKPRHRLHLSATTWYGTDAMDRYGDDHFSDCNL
                     ADVHALVHQVGDQTKRWKTAEVPALVELDREYPSVCADVKLLTFRGCVFEIDDSLGKD
                     ARVDEQSSMFPSVLAGERRNVEQILRIYGGKLAPEGRMGTHIVRMYDDSVVFEDMDDG
                     RKQVSLSWVKRCIDRSTTADVV"
     gene            <330759..>331688
                     /locus_tag="OSTLU_93452"
                     /db_xref="GeneID:5004554"
     mRNA            <330759..>331688
                     /locus_tag="OSTLU_93452"
                     /product="predicted protein"
                     /transcript_id="XM_001420273.1"
                     /db_xref="GeneID:5004554"
     CDS             330759..331688
                     /locus_tag="OSTLU_93452"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420310.1"
                     /db_xref="GeneID:5004554"
                     /db_xref="JGIDB:Ost9901_3_93452"
                     /translation="MRCATKRARLCAQGILTNVHGRALKEIVTITLKAMISAGPVVAI
                     PTKFPNHARGVVVIGDAFDDLRAMKGLMQSGKVVFNALSCALLASGGNRDTASATTSI
                     FTTLPRARVKEFIPSHVFNAFADGLIGFDDKTPSLSEVCTVAFVRFNPKGDDCVVECI
                     GVVHRVVSQYQGVVLQSIVDDNGPSCLCAFGVPGTPKRGATTRGLRFARDLLKTLDGA
                     LTHARCGLSTGVVNIGAACEVNSKSHSEFSLVGVPVILAARLADAVKPGVAAMDEETR
                     VWAASALNNNARTSRIELCLKGFPRAMTTFIIE"
     gene            complement(<331709..>333613)
                     /locus_tag="OSTLU_88612"
                     /db_xref="GeneID:5004555"
     mRNA            complement(<331709..>333613)
                     /locus_tag="OSTLU_88612"
                     /product="predicted protein"
                     /transcript_id="XM_001420440.1"
                     /db_xref="GeneID:5004555"
     CDS             complement(331709..333613)
                     /locus_tag="OSTLU_88612"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420477.1"
                     /db_xref="GeneID:5004555"
                     /db_xref="JGIDB:Ost9901_3_88612"
                     /translation="MRQAWKDVSADALDDAAKMELGKKMEHVPEELRRVGAKAGGEMF
                     VTFGTASVQDFVFNWAAAAKKLSLEPIFVGALDEEMHTLCVKAGIPSMLLTGRSVLDN
                     RDQEFITQKSKTFKKMGTVKTKFIQDLLELGIAPILSDADVVWMRDPRELFNNGTYAY
                     ADVLISSDCIDTVNDRADNANCRNVNFNTGIVHIRPTEPAKAFVEKWKQKVATSEIAW
                     MRDQPALNLLVREGSPALAPAVAVPDDKRGLPGYRSIVFAANSTIRMGVLPIAQFSNG
                     HTFFVQEHHLYHPEDGEPYAVHTTYQYGDSARYAYGKRQRLRQHGLWYADDDTDYWKP
                     KKYLTISTKGSQMKFNGSRAIGMENDAYLTAITRHFEEDRLRRTTIRNGFALAKALGR
                     IFVLPPARCYCDKIWNTLAGCRALGAETAHLPYACPMDHIYNLEGLHDLGVDFREAGF
                     LEDMRLKGNVREDVIHVKIGAKDDKNMADVVIERGFSASDAVEALESYNDHGVIMIDQ
                     LDEGSFCGFDDKQKDEAFDTAINNALNHDQYFCFNEAYDKQGRPRSGGGKDGKEYEPR
                     VVERHCGIAEGEQSRLATRGVVTEVLKDPITCSCEWAYKLPKALADTRCAAQSRDEDD
                     RTRTGLGDIE"
     gene            <334604..>335338
                     /locus_tag="OSTLU_26496"
                     /db_xref="GeneID:5004602"
     mRNA            <334604..>335338
                     /locus_tag="OSTLU_26496"
                     /product="predicted protein"
                     /transcript_id="XM_001420274.1"
                     /db_xref="GeneID:5004602"
     CDS             334604..335338
                     /locus_tag="OSTLU_26496"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420311.1"
                     /db_xref="GeneID:5004602"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="JGIDB:Ost9901_3_26496"
                     /translation="MGTTPEKVVTMYLDEKFKSATVEGELLAKCENLKTLSCASCGLT
                     TLAGFPALANLKDLSLNDNRIADGLEALVGCKALSSLSLANNKLANVDDLKAVAEELT
                     LSVLELEANPLTENEDYHEKVMTMMPTLNVLDGRDEFGNEIEDDDEDDDEDEDDEDDE
                     DEDEDDDEDDEDADEDEDEDESEEEEEEEEEEMGLADLYGDKPLEDDDDDDDAFVEDE
                     DPESEDIDEEESDDDEDEAAAKKPKI"
     gene            complement(<335562..>335900)
                     /locus_tag="OSTLU_17339"
                     /db_xref="GeneID:5004556"
     mRNA            complement(<335562..>335900)
                     /locus_tag="OSTLU_17339"
                     /product="predicted protein"
                     /transcript_id="XM_001420441.1"
                     /db_xref="GeneID:5004556"
     CDS             complement(335562..335900)
                     /locus_tag="OSTLU_17339"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420478.1"
                     /db_xref="GeneID:5004556"
                     /db_xref="JGIDB:Ost9901_3_17339"
                     /translation="MGGLLTTAAVAETMTLTGGAAGASASAGATASLGAAGTAIGETL
                     GSLGSYTIAVGTYTITAPVALIAGIGVAIAAMASYAVTRRLRASGASETQSLLRGTSY
                     GTTRDGDNMV"
     gene            <336638..>337396
                     /gene="MRPL4"
                     /locus_tag="OSTLU_17340"
                     /db_xref="GeneID:5004366"
     mRNA            join(<336638..337152,337237..>337396)
                     /gene="MRPL4"
                     /locus_tag="OSTLU_17340"
                     /product="Putative mitochondrial ribosomal protein L4"
                     /transcript_id="XM_001420275.1"
                     /db_xref="GeneID:5004366"
     CDS             join(336638..337152,337237..337396)
                     /gene="MRPL4"
                     /locus_tag="OSTLU_17340"
                     /note="Putative mitochondrial ribosomal protein L4,
                     imported to mitochondria"
                     /codon_start=1
                     /product="Putative mitochondrial ribosomal protein L4"
                     /protein_id="XP_001420312.1"
                     /db_xref="GeneID:5004366"
                     /db_xref="InterPro:IPR002136"
                     /db_xref="JGIDB:Ost9901_3_17340"
                     /translation="MRVRWTIAEGQGRGEDAVVPVYSFDGEARGSVELPGRIFDQPLR
                     VDVAHRVVRWQRAKARKGLHKTKSRGEVAGSTRKVRPQKGSGRARVGNLKAPQMRGGG
                     TAHGPVVRSHAHALPKKVRRMGLKVALSAKAAEGKLIVVDSFAGMEPKTRAMKATLER
                     LTGDLGLAAGGDELVRMSARNLPHVEVLPQIGANVYSILRRRTLIVTKSGLEQLIARL
                     DAPIKR"
     gene            complement(<337487..>338251)
                     /locus_tag="OSTLU_6009"
                     /db_xref="GeneID:5004557"
     mRNA            complement(<337487..>338251)
                     /locus_tag="OSTLU_6009"
                     /product="predicted protein"
                     /transcript_id="XM_001420442.1"
                     /db_xref="GeneID:5004557"
     CDS             complement(<337487..>338251)
                     /locus_tag="OSTLU_6009"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420479.1"
                     /db_xref="GeneID:5004557"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="JGIDB:Ost9901_3_6009"
                     /translation="RVALKLARREQISPDAARLTFALPTPSHVLGLPVGQHVGLSYVD
                     AKSGERHERPYTPVSTDDQEGSVTFVIKAYKPCEKFPLGGKVSQHLDGLRVGDSCDFD
                     GPKGMKTYEGGGVFAIRRLRSQGGGFEKRKCSRVGMIAGGSGITPMLQISRAILDNGD
                     KVKMNLLFANQTEADILCREEIESDVAKYGADKFSADYTLDRPPKAGWSHFCGFITKE
                     MIEKTMPPPGKRTQILICGPPPMLKFAVLPALEELGY"
     gene            <338919..>339695
                     /locus_tag="OSTLU_26500"
                     /db_xref="GeneID:5004367"
     mRNA            <338919..>339695
                     /locus_tag="OSTLU_26500"
                     /product="predicted protein"
                     /transcript_id="XM_001420276.1"
                     /db_xref="GeneID:5004367"
     CDS             338919..339695
                     /locus_tag="OSTLU_26500"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420313.1"
                     /db_xref="GeneID:5004367"
                     /db_xref="JGIDB:Ost9901_3_26500"
                     /translation="MLAGAPRARPRDVGARRRRPASRGSVAARTRAAAASRECRHYVN
                     LKNGIEALPTLRDDLGVRSYEFVRIQSSLLENGDCEKMILELDASLLLNLALGRSCFV
                     WDFGSRDVVKGRGNPRALWYGAEFIRYALRKEWFPEGVGDAARRENVPVVRGKQVERE
                     WATKLTMFGRSAKRKIRYYRQFIPDDVRDVRLIGVYRPTTHDDDAEYYREVLLRHEFG
                     DGGDVPDVVRDERETIEAIKRLSYNIFFAGVEEPAWLNQK"
     gene            complement(<339743..>341545)
                     /locus_tag="OSTLU_44217"
                     /db_xref="GeneID:5004558"
     mRNA            complement(join(<339743..340771,340970..>341545))
                     /locus_tag="OSTLU_44217"
                     /product="predicted protein"
                     /transcript_id="XM_001420443.1"
                     /db_xref="GeneID:5004558"
     CDS             complement(join(339743..340771,340970..341545))
                     /locus_tag="OSTLU_44217"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420480.1"
                     /db_xref="GeneID:5004558"
                     /db_xref="InterPro:IPR001126"
                     /db_xref="JGIDB:Ost9901_3_44217"
                     /translation="MTTRAIATHRVVAHLDLDAFYCQVERRDLRAKTAAGRRDGRASA
                     EDVPLVVVQYNPFERGGVRALAPDDDRELRDGFENHSLIAVSYEARARGVKRNMRGRE
                     ARALAPACAVVQVPTRRSKADLTLYREAGREVAAVLARGGTIERASIDEAYLDLTESA
                     KKVLEETAWATILEKARTSHAAGASAVSGKGYASVAWWNRDESEWREEEKLLAAGAYI
                     CFNLRKACVDELGYTLSAGIALNKMLAKLTSGMNKPASQTVLCPDHTSTLLDELPIDR
                     IRGLGAKFGRELADGLNVKTIGELARTPLRKLEEVCGEEKAQWVRKVSLGLDDDPVKA
                     REMPKSIGTGKTFRGALAIRSIASAKHWLAELTAELNDRCEADEEEWNRVPKLLTLGL
                     SSPDERETSSGHCSRRCPLRPGADEMAQDALTLLSKWASGRERWSITGMSVSASNFVS
                     LEKDSGDVVEMFKNATKAAKAPASVSATPAASPIKADQIDKNVLAELPEAIQREIRAS
                     MGLLDKSTGGGVKRKNEITNYFSKKR"
     gene            341643..>342904
                     /locus_tag="OSTLU_19738"
                     /db_xref="GeneID:5004368"
     mRNA            join(341643..341730,341751..>342904)
                     /locus_tag="OSTLU_19738"
                     /product="predicted protein"
                     /transcript_id="XM_001420277.1"
                     /db_xref="GeneID:5004368"
     CDS             join(341721..341730,341751..342904)
                     /locus_tag="OSTLU_19738"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420314.1"
                     /db_xref="GeneID:5004368"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="JGIDB:Ost9901_3_19738"
                     /translation="MRALAALERRSDAKGAKRVLRLEIGQPGFATPARVCDAAVRAIE
                     GGETKYAAPSGAPRLREAVAEYLVRTRGVAYEAENVVVGPGAKPGLFLPTLACCDPGD
                     EVVYPDPGFPTYAAMCAAAGATPRPVPLRSDGASFDMAALEASVNEKTKMIVINSPGN
                     PTGGVMPREDVAAVARLAKKFNCWVMSDEIYSRLIYDDEEEGGENDEKIFSICALDGM
                     KERTILVDGFSKTYCMTGWRLGWVACPKHLAEKIKLLTVHSVGCVAAFTQIAGVEALT
                     GPQDSVKAMRDEYRVRRDFVVDALNDIPGISCPVPKGAFYAFPSFDFPDVTAQELADY
                     LLEDARVALLPGTDFGAAGERHLRLSYVGELSDLREAMARIKTSLAKRFPDFV"
     gene            <344900..>345361
                     /locus_tag="OSTLU_5713"
                     /db_xref="GeneID:5004559"
     mRNA            <344900..>345361
                     /locus_tag="OSTLU_5713"
                     /product="predicted protein"
                     /transcript_id="XM_001420278.1"
                     /db_xref="GeneID:5004559"
     CDS             <344900..>345361
                     /locus_tag="OSTLU_5713"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420315.1"
                     /db_xref="GeneID:5004559"
                     /db_xref="JGIDB:Ost9901_3_5713"
                     /translation="QGYPANNTGYPSNSTGYPSSSTGYPSDSTGSGYPSNSTGYPASG
                     YPANSTGYPAKGYPANSNGYPAKGYPANSTGYPAKGYPANSNGYPAKGYPANSTGYPA
                     KGYPANSNGYPAKGYPANSTGYPAKGYPANSNGYPAKGYPANSNGYPANSDG"
     gene            complement(<347198..>348442)
                     /locus_tag="OSTLU_17346"
                     /db_xref="GeneID:5004560"
     mRNA            complement(join(<347198..348215,348384..>348442))
                     /locus_tag="OSTLU_17346"
                     /product="predicted protein"
                     /transcript_id="XM_001420444.1"
                     /db_xref="GeneID:5004560"
     CDS             complement(join(347198..348215,348384..348442))
                     /locus_tag="OSTLU_17346"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420481.1"
                     /db_xref="GeneID:5004560"
                     /db_xref="JGIDB:Ost9901_3_17346"
                     /translation="MSTTAARRKKSAAAAAEETMVDVEEDAGVTFAEEQSNIVSIDAL
                     QQSGVSATDIKKLRDAGFVTVRQLLMFPRKAIIAVKGFSDAKADKVLEGAVKLLPESE
                     AGGFVTAAEDAERRKDVVHITSGAAAVDAILGGGFESRAITEIYGEWRCGKTQLCHTI
                     AVTTQMPVEMGGGCAKVAWIDTENTFRGDRLVQIANRFGLDADAVLSNVMVARVDTVD
                     QMMHALIAIGAKMAEEPFKLLVVDSIMAIFRVDYVARGELSERQQTLNQFLSRLRKIA
                     EEFNVAVVLTNQVQSDPGGMAFAGVEPKKAIGGHVLAHASTIRLMVRKGRAEARVLKV
                     LQGPTLKEDEAEFQITEGGVTGME"
     gene            complement(<349128..>349496)
                     /locus_tag="OSTLU_8926"
                     /db_xref="GeneID:5004369"
     mRNA            complement(<349128..>349496)
                     /locus_tag="OSTLU_8926"
                     /product="predicted protein"
                     /transcript_id="XM_001420445.1"
                     /db_xref="GeneID:5004369"
     CDS             complement(<349128..>349496)
                     /locus_tag="OSTLU_8926"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420482.1"
                     /db_xref="GeneID:5004369"
                     /db_xref="InterPro:IPR010334"
                     /db_xref="JGIDB:Ost9901_3_8926"
                     /translation="KLDDAPAALARTDATSAMNLRVLRKEDDAIERIVAHSKHAVLYG
                     FDADARQWARKNVEGALFVVRRATEPRDAFVVLNRCGTENLRQRVGGAGFELERSPPY
                     LMYRVGREVNGIWFHDAEECE"
     gene            349602..350745
                     /locus_tag="OSTLU_26506"
                     /db_xref="GeneID:5004370"
     mRNA            349602..350745
                     /locus_tag="OSTLU_26506"
                     /product="predicted protein"
                     /transcript_id="XM_001420279.1"
                     /db_xref="GeneID:5004370"
     CDS             349650..350708
                     /locus_tag="OSTLU_26506"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420316.1"
                     /db_xref="GeneID:5004370"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="JGIDB:Ost9901_3_26506"
                     /translation="MTTQSATTTTARSATTTATTTLCVVTHEKLLNSRPLTERLRAET
                     PRAFDVVVVSNEEEIDKMRRERADGDLAMLWWFATKEVTTAFASRRDVAERVKWMHSG
                     SAGVDHLMAIPSVREHASTLTNGRGAFSASLGEWGVFACMHFAKRVDAMRAAQRRKEW
                     IRMTVGLIEGKKLVIVGYGDIGQHVARRAKAMGMKVCAVRRTPEKTDPNDDYVENVVG
                     FHALKETCAKADYVLVALPSTEETDKMINADVLSAMKDTAVLINVGRGSTVDEDALVD
                     ALRNKKIAGAALDVFAVEPLPSDHPFYTMENVLMSFHCADLTSDYHDLALDCFIKHAE
                     QYATNAPFTNVVDKRLGY"
     gene            complement(<350779..>351300)
                     /locus_tag="OSTLU_44011"
                     /db_xref="GeneID:5004561"
     mRNA            complement(<350779..>351300)
                     /locus_tag="OSTLU_44011"
                     /product="predicted protein"
                     /transcript_id="XM_001420446.1"
                     /db_xref="GeneID:5004561"
     CDS             complement(350779..>351300)
                     /locus_tag="OSTLU_44011"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420483.1"
                     /db_xref="GeneID:5004561"
                     /db_xref="InterPro:IPR001950"
                     /db_xref="JGIDB:Ost9901_3_44011"
                     /translation="PKPRRDAMEVEYCASCACPLEYCDVVGCARVAARALERVALDDD
                     ATATTTTTAAAAATRDDDDGENDDDATRKTTSKKKSKSKAREVVVTRLSRNRKKMITN
                     VVGLERFDVDLKEASKAFGKKFACGCSVTKGATGRDELDLQGDYSEQLAALICEKYEV
                     GAEDVRCVDKSKF"
     gene            <351629..>351946
                     /locus_tag="OSTLU_26508"
                     /db_xref="GeneID:5004371"
     mRNA            <351629..>351946
                     /locus_tag="OSTLU_26508"
                     /product="predicted protein"
                     /transcript_id="XM_001420280.1"
                     /db_xref="GeneID:5004371"
     CDS             351629..351946
                     /locus_tag="OSTLU_26508"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420317.1"
                     /db_xref="GeneID:5004371"
                     /db_xref="JGIDB:Ost9901_3_26508"
                     /translation="MGAREGREMGFRKGFELAEEVGYYAGCAAVWRTCATRDGDARGG
                     RVERLIESFERELEESAIGNPLDEGILERVERLRGRFKTLAALLGRRGEHARADASLG
                     ISF"
     gene            complement(<352017..>354701)
                     /locus_tag="OSTLU_17350"
                     /db_xref="GeneID:5004562"
     mRNA            complement(join(<352017..353198,354699..>354701))
                     /locus_tag="OSTLU_17350"
                     /product="predicted protein"
                     /transcript_id="XM_001420447.1"
                     /db_xref="GeneID:5004562"
     CDS             complement(join(352017..353198,354699..354701))
                     /locus_tag="OSTLU_17350"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420484.1"
                     /db_xref="GeneID:5004562"
                     /db_xref="InterPro:IPR004506"
                     /db_xref="JGIDB:Ost9901_3_17350"
                     /translation="MPGAKPLRVAVLLSGGVDSSVALALLRAAGHECVAFYLQIWFQE
                     DFRNTWDQCPWEEDLRVAESVCERVGVPLETVPLTDEYWNLVVKDSVEEIRKGRTPNP
                     DVLCNSRVKFGAFREWLARTHPGEFDRVASGHYAAVERADVGELARLVMSGDTFKDQT
                     YFLADLSQEQLGSVCFPVGGMPKAEIRALAASAELPNAGRKDSQGICFLGKVKFSEFI
                     AEHLGEMPGDIIEVESGKVLGKHRAYWFHTIGQRSGLFLHGGPWYVAGKDCVNNIVYV
                     TRDYYSLDKARDTFTVAGFNWISGQEPPLESIEGLRVKVRHGENIYACSFQFKDVDGE
                     RCGEVNIGQDDQGLAPGQYAVFYDGDTCLGCGKILEPNVGAIGLVPASGERLDATTSP
                     SA"
     gene            complement(<354872..>355238)
                     /locus_tag="OSTLU_17351"
                     /db_xref="GeneID:5004372"
     mRNA            complement(<354872..>355238)
                     /locus_tag="OSTLU_17351"
                     /product="predicted protein"
                     /transcript_id="XM_001420448.1"
                     /db_xref="GeneID:5004372"
     CDS             complement(<354872..355238)
                     /locus_tag="OSTLU_17351"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420485.1"
                     /db_xref="GeneID:5004372"
                     /db_xref="JGIDB:Ost9901_3_17351"
                     /translation="MDRVKRTSPPSTSGRKREFRVTPGKSGGASAAFSPNIGGSMASP
                     TIFGRVDDVVAGLGSDCESESEAETEEFDEDDGGTQCYEDDYAGGTQVLDSAALCDAP
                     TGLDLVLAARKEEVEPPCER"
     gene            complement(<356002..>357114)
                     /locus_tag="OSTLU_44261"
                     /db_xref="GeneID:5004373"
     mRNA            complement(join(<356002..356624,356700..>357114))
                     /locus_tag="OSTLU_44261"
                     /product="MC family transporter: folate"
                     /transcript_id="XM_001420449.1"
                     /db_xref="GeneID:5004373"
     CDS             complement(join(356002..356624,356700..357114))
                     /locus_tag="OSTLU_44261"
                     /codon_start=1
                     /product="MC family transporter: folate"
                     /protein_id="XP_001420486.1"
                     /db_xref="GeneID:5004373"
                     /db_xref="InterPro:IPR001993"
                     /db_xref="JGIDB:Ost9901_3_44261"
                     /translation="MTRRDAANARASTSSPDVDAFANPQHATNFYRNLARGAPPSALA
                     LLSDKAFANGFSGAIAGTVAATVVCPLDVLKTRLQVSAATTGTTEYLSTYGALRRIVR
                     HEGARGLYRGLGPTVAALLPNWGVYFSTYGALKRIFIADANHFAHILAAAGAGAATIF
                     VTNPLWVAKTRLQVQHSHALASAMPKRVPYTSTINALTRMMREEGLKGLYSGFGPSLI
                     GIAHVIIQFPLYESIKVELAREREVAVNKIEPIDLMVASAIAKMIASTLTYPHEVIRS
                     HMHVHGLGPFSGIGALVRRIYLEGGVAAFYRGCATNLIRTTPAAAITFTSFELVSREI
                     EKLVAAAREDD"
     gene            complement(<357323..>364141)
                     /locus_tag="OSTLU_150"
                     /db_xref="GeneID:5004374"
     mRNA            complement(join(<357323..358035,358201..358328,
                     358389..>364141))
                     /locus_tag="OSTLU_150"
                     /product="predicted protein"
                     /transcript_id="XM_001420450.1"
                     /db_xref="GeneID:5004374"
     CDS             complement(join(<357323..358035,358201..358328,
                     358389..>364141))
                     /locus_tag="OSTLU_150"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420487.1"
                     /db_xref="GeneID:5004374"
                     /db_xref="InterPro:IPR006133"
                     /db_xref="InterPro:IPR006134"
                     /db_xref="JGIDB:Ost9901_3_150"
                     /translation="GAGADGRTKAQVAAEEDALQKELGFGTHVDGEDRIGWMINASST
                     QVEDKESGKAYAAVNCYFMAQDGSTFKAQVKYAPYFYLATKTGCEHEVEALLRRKYGE
                     QVLDVEMVDKEDLDLKNHLSGLQQTYLKVSFATTQELMDVRREILPIVSKNKKKSSAA
                     AAYEALSHQESLDAGIKPKKKALTDYEEAMIDIREYDVPYHMRYMIDTDVRCGKWYSV
                     RAEHGAVTLTLQEQMLDRGEVRVCAFDIETTKLPLKFPDAEHDQVFMISYMLDGQGYL
                     IINREIVSEDVEDFEYTPKPEYKGPFIVWNVPNEQALIRTWFDHMRETQPSIYVTYNG
                     DYFDFPFIETRATKNGMDMYREIGFKCEQSGECRSNSALHLDCFAWVKRDSYLPAGSH
                     GLKAVTKAKLKYDPVEVDPEDMLPYAQSHPQMMASYSVSDAVSTYYLYMKYVHPFIFA
                     LSTIIPLSPDEVLRKGSGTLCEALLMVEAYHGNIVCPNKQVSAGEKYYEGHLLNSETY
                     IGGHVECLEAGVFRSDIPCDFKLNPEGYQRLLDNLDDDLDYALRVEGKGLGKDDCADY
                     DEIRAQIAEKLEYLRDNPNLNMEPLIYHLDVAAMYPNIILTNRLQPAAIVNEDVCAAC
                     DYNRPGKGCLREMEWVWRGEHFASTSSEYAAIKAQLQVDKFAPSHPGGPQRTWAELPY
                     EEQQEQKKQRLKLYTQKVYRKVMEKPVTATKKASICMRENPFYIDTVKAFRDRRYVYK
                     GENKKWKNNLDEAKQSGNIIEIQKAANMVVLYDSLQLAHKCILNSFYGYVMRKGARWY
                     SMEMAGVVTNTGAKIIQMAKQLVDDIGKPLELDTDGIWCCLPRAFPETFTFTLPNKNK
                     GYKISYPCVVLNRMTALQNTNDQYQTLKVVDGKSSYEVSSEMSIEFEVDGPYKAMILP
                     ASKEEGVLIKKRYAVFNEDGSLEELKGFELKRRGELKLIKVFQAEVFDYFLKGETLEE
                     VYKAVGNIGNRWFDMLKTQGRNFDDEELLEFISESSVMSKPAIDYGDRKSTSLTTAHR
                     LSQFLGADLIKDKGLVCKYIISKKPLGAPTSARAIPVSIFNAETAVARAYLKEWTKDA
                     LPGADDEMPNMREMVDWEYYKTRLAGAIQKIISIPAALQGVENPCPDVKHPDWLHKRI
                     REKNDKFSQRNLKTMFQTQFANGAPLAGKDLNILDIEDGGAKSTPTRPRVRTFRRDGD
                     APQTPDQRATPSGEAPKTPGSASASAAAPDRATDYDGWLKHYKSKWKTLRANIKRERV
                     EDEKERAQIEREGGVMRRKRRSGAFGLESFVESREETIAHSTMHIIQVEQTQVPGIFA
                     VWVLVNGTMQVIKVDVPRRLVIATRETDREGDLGLEGKRRITATLPRGFIAPHLYEIN
                     VQERNFASGLEIAALLADPSVIGVYEKNVPLIDRFIYNIGCVMAVKKSEQKRALDIGD
                     ESYGMNMFQMKATAEVSSYLPKLSHITFYFAGVSGDKGRGIYVLHNSRESKGTVIVHQ
                     PGKGVREVTPELWSSFMHSMSGDEQTDDEARAEAASKWNVLYARNMEQVGKHLNHAIG
                     AYISASSGGTVLLVQAPPGAGVDPAQDTSSVREGLAGRLSALMPASGRLPIVFRPPNL
                     SDSDLSTDAARGWQLDAAKIASARVVESAEWLKEHVEIASYAHIPVGNLKSDWWVHTA
                     DAFFARTLHDAEQVLWTGPGGEPDLGGGASAVSLSGLDDAYGASRMEVTAPGAYRSVC
                     VELQVHHLAVCAISKSSILNDLEQGALLGFETGTKGTTRMGGHEAAGAFKTLNKLVDN
                     WLRDATDHHNTYADQLLSQIHRWLFSPSSALRDPALKNLVELCMKKVFTLLLAELRKL
                     QVEVVYADMRRIIIATGKHDLASASACVEGLKTALHQRELFSWLQLDRVKQWHSLLFR
                     GPFDYAGISAVNLPGESHEGALDMHWNIARFLPEAIQDHFHAIIGEFLLLPWKHDKEE
                     SDDKVIWLEQQLESHFGPKLLRYAQDIQRVLGLAGPRSPPEHQFPSPPGANLSKKLRG
                     TPALAFVRTVIAVLSLDARVEGPVSLLRRNALKMIQVAEFSPEAEFVEPCVSFTLRDV
                     ICSACSDCRDLDLCRDPDLAAGHWACTARDDDHGPPCGQPYDMQWIEGALVAEVNERV
                     RKYQLQDLKCARDGRIKVGHLANRCACGGLYACSAKPGALGDDLRVFSNIADAHDFKI
                     LRDTVDWV"
     gene            complement(<365196..>366524)
                     /locus_tag="OSTLU_26513"
                     /db_xref="GeneID:5004375"
     mRNA            complement(<365196..>366524)
                     /locus_tag="OSTLU_26513"
                     /product="MFS family transporter: multidrug efflux"
                     /transcript_id="XM_001420451.1"
                     /db_xref="GeneID:5004375"
     CDS             complement(365196..366524)
                     /locus_tag="OSTLU_26513"
                     /codon_start=1
                     /product="MFS family transporter: multidrug efflux"
                     /protein_id="XP_001420488.1"
                     /db_xref="GeneID:5004375"
                     /db_xref="JGIDB:Ost9901_3_26513"
                     /translation="MSGHACASPVLPMLAREFGANATEIGATMSAFAAGRLLFNLPCG
                     WYADAVGRRPLMIAGPAATTAGMAWSYCSTGLGELLCARAVAGIGSSMYMSGATAMLA
                     DLSTRHTRARILGANQAAVLAGAAAGPALGGAIAGADGMSIRSPFLAVGALSSFASVY
                     SFARIEETRPESVKPEREFAASKHWYCDGHPIEDTKMCLELDEFGKPVVHRDGQVYEL
                     LETKSPDGAATTTAVDPATAQDAAMGRLVKSMDFWAVCGLNAALFFSGAGGRGTLLPI
                     LAYQNFGFTPESLGALFSAMAVTSLLGLGPASALTDAVGRKAVIAPCVVASAASVALM
                     GTTTDPTAFTAASILWAASGSLMGTAPAAYAADISPKNIRGSALAIYRTCGDVGLLLG
                     PLALGALADEVGIPIALGVNAALLTISGGVFHFTAREIRRKAQTAAAKIS"
     gene            <367155..>367943
                     /locus_tag="OSTLU_26514"
                     /db_xref="GeneID:5004376"
     mRNA            <367155..>367943
                     /locus_tag="OSTLU_26514"
                     /product="predicted protein"
                     /transcript_id="XM_001420281.1"
                     /db_xref="GeneID:5004376"
     CDS             367155..367943
                     /locus_tag="OSTLU_26514"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420318.1"
                     /db_xref="GeneID:5004376"
                     /db_xref="JGIDB:Ost9901_3_26514"
                     /translation="MVGTTTRADASGTTARTAKGERRGVAFFDLDHTIIDVNSSWLWV
                     KSEINSGRVGMSLIGTALYWFSRYAFGYGDGAETAGRDAASIYRGEDERMFRERITEF
                     FRMELAHRTRPGFKAVLEAHKANGERCVMCTSTWQHPAAIGAEIYGLETGEANVVSSI
                     MGVDEDGLMDGTIQVVAYGDGKYETTKKWCELNGVDLKECYFYTDSMSDVKLLENVGY
                     PVCVNADARLKKHAAERGWPTVDWGMSDSGMKKPRYGACLSCSA"
     gene            complement(<368027..>368728)
                     /locus_tag="OSTLU_93455"
                     /db_xref="GeneID:5004563"
     mRNA            complement(<368027..>368728)
                     /locus_tag="OSTLU_93455"
                     /product="predicted protein"
                     /transcript_id="XM_001420452.1"
                     /db_xref="GeneID:5004563"
     CDS             complement(368027..368728)
                     /locus_tag="OSTLU_93455"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420489.1"
                     /db_xref="GeneID:5004563"
                     /db_xref="JGIDB:Ost9901_3_93455"
                     /translation="MRNPAPFITASASSARGALARRDRAREDDDAVLEYWARVRAGVE
                     PAPRPGAEAKRNKRLCAHLESHLDDVLAHAGAGGADEGRSRLANEAATALEVGEHLAH
                     DDVMELKRRAREQRGEALSAREVARLKSLAGGRTRREASPEAAYASPEAAYAMPEAPA
                     GEVFEEFDDDEDDEGEFFEYGRSELPRHMRDWYEPPASEYGSFVENQPAAGATTSLDE
                     QKYATVRNLRSHALW"
     gene            <370557..>371334
                     /locus_tag="OSTLU_26516"
                     /db_xref="GeneID:5004377"
     mRNA            join(<370557..370772,370882..>371334)
                     /locus_tag="OSTLU_26516"
                     /product="predicted protein"
                     /transcript_id="XM_001420282.1"
                     /db_xref="GeneID:5004377"
     CDS             join(370557..370772,370882..371334)
                     /locus_tag="OSTLU_26516"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420319.1"
                     /db_xref="GeneID:5004377"
                     /db_xref="JGIDB:Ost9901_3_26516"
                     /translation="MPSARELSQNVRNLSGPMSGAARRAKGAMRPGNGGRGARNRADD
                     VIERRRKIEREMKSQMVEKEVESLVKKRARRALDVERIDLRDGSILFKFKVQNEPAVS
                     AEEERLLAMEVEKRLWGDTKTNDNVIARWFMTVKYLASTLSFENALVYVATTPFRMVF
                     WSLAYVLRAVFWIVTGRSGVSVRASGRAKRQLRQINTVVTTGPERGFNPFGSVKSRPN
                     WRAE"
     gene            <373504..>376047
                     /locus_tag="OSTLU_193"
                     /db_xref="GeneID:5004564"
     mRNA            join(<373504..374334,374368..375476,375555..>376047)
                     /locus_tag="OSTLU_193"
                     /product="predicted protein"
                     /transcript_id="XM_001420283.1"
                     /db_xref="GeneID:5004564"
     CDS             join(<373504..374334,374368..375476,375555..>376047)
                     /locus_tag="OSTLU_193"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420320.1"
                     /db_xref="GeneID:5004564"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="JGIDB:Ost9901_3_193"
                     /translation="RKLLELELAKESTKEWLGMQEIRRKLPAHNLKSVVLEAIESSNA
                     AVVSGATGCGKTTQVPQFIFEEAIRAGKAGDTSIIITQPRRLSAIAVAERVANERCER
                     IGDTVGYSIRLESKQSEKTRMLFCTTGILLRRLQTDPNLTGVSHVVVDEVHERDLLSD
                     FLLVILRSLAARRSDFHLVAMSATVNADLFKNYFESHLKTTCPVVEIPGRTFPVAEYR
                     LEDAIEATGYVCEPDGEFALGVEQSRGGRIFKMAGGGGARGAALREAVEESFERSAMS
                     EYSETTWKSLQVIDEEKINYELMELLVALIADEYEEGAILIFLPGMAEIRTLHDRLRA
                     NLKDSESRFLLIPLHSTLSSEEQRLTFNKAPPGKRKVVMATNIAETSITIDDVVFVID
                     SGRVRETQYDPVSRMSALVTAWCSKASSRQRRGRAGRVREGYCFHLYSTKTEATVLAD
                     FTTPEILRTPLDALCLQIKILGLGDIRKFLSMAIEPPPEGAIASALKSLHELDAVDSK
                     DELTALGHHLAELPVDARLGKMMLYGAMFSCLDPILTIAAGVGFRSPFLAPMDKRDEA
                     DAAKRKIAAQASDHLTLVRAYAGWIHARAKGRGFERDYLSKLFLSGQTLKQISEMRQQ
                     YTDLLDQIGFLRSGAGALGAVSAVNAGNESLVRAVICAGLYPNVALASAPAKTDDGRA
                     RSRYPTSSVAVRTKHDTDVHMHPTSVCYGMSPSVDSRFLLYHEKVRTTKVYIRDATAV
                     GSYPLLLFGGKIKINHERSSATCDNWINFRAAPRVAVLFKHLRAELDALLMEKIASPD
                     MDISHRRDVVKSI"
     gene            <376248..>377477
                     /locus_tag="OSTLU_26518"
                     /db_xref="GeneID:5004565"
     mRNA            join(<376248..376538,376830..>377477)
                     /locus_tag="OSTLU_26518"
                     /product="predicted protein"
                     /transcript_id="XM_001420284.1"
                     /db_xref="GeneID:5004565"
     CDS             join(376248..376538,376830..377477)
                     /locus_tag="OSTLU_26518"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420321.1"
                     /db_xref="GeneID:5004565"
                     /db_xref="JGIDB:Ost9901_3_26518"
                     /translation="MLRRALLRSRSSIALNASRALAPSFKARALSTDDDAKAKTRAQA
                     EAEAAKKINAGASPLFSWTEVDVSNADRTIPRWQNAAFVVVVGAFFAYFGNKLTSRAG
                     RRAARGIRAAATDPATKISFPDTNSAGLTVLGAGCRVKRVAIIDVKIYALAMYVDADA
                     ARAQKGKGLLNGDYDKELAIELARDVDGKTFMEAMDESLGPRIREIATNMATAEDEDG
                     NFMASVAEAAEKAEEAAVDSLDAMRDGFSSLKLKQGTKMTITWTSNGCAIAVAGAAKM
                     EFESAEFAKALLDVYVGEGPVAPAAAQTFEKGLAAL"
     gene            complement(<377564..>379057)
                     /locus_tag="OSTLU_2732"
                     /db_xref="GeneID:5004566"
     mRNA            complement(<377564..>379057)
                     /locus_tag="OSTLU_2732"
                     /product="predicted protein"
                     /transcript_id="XM_001420453.1"
                     /db_xref="GeneID:5004566"
     CDS             complement(<377564..>379057)
                     /locus_tag="OSTLU_2732"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420490.1"
                     /db_xref="GeneID:5004566"
                     /db_xref="InterPro:IPR003789"
                     /db_xref="InterPro:IPR006075"
                     /db_xref="InterPro:IPR006107"
                     /db_xref="JGIDB:Ost9901_3_2732"
                     /translation="ETVVGVEIHARLATRSKLFSGAASAYGGDANARVAPFDAALPGT
                     LPVLNAGAVARAIKLGIALEGTVQLKSSFDRKHYYYADLPHGYQITQQREPIVRGGIV
                     RCVGVENAREGDRDGGRTRRGWLTVGIERVQMETDTGKSQTVGAEAEAAQGTLVDLNR
                     AGQALVEIVSEPDMRSGEDAAACVEALQRMLRYLHVSDANMEEGSLRCDVNVSVRTAE
                     ERERGVFGERVEIKNLNSLRSIVRAVKYEAKRHVDVLTAGGRIERETRAFDTNTGKTT
                     VLRTKENLLDYRFTPEPDLPPLVLNPADVEAIANRMPELPNAAFERLMESGASESAAS
                     TIIAFPSTLKYYDTAVDSCGAAKASDVANFIANEIIGAARKDAGASHKEPLSSLPRAA
                     SARRVGELLGKVANGDLSGRMAKQVLEALMNSDERALAEIVEDVCGGGQMSSDDQLQD
                     ICRAVVDEMPKEVELFRGGKSKLMGALVGEVMKRTNGRANPKDASKML"
     gene            complement(<379348..>379800)
                     /locus_tag="OSTLU_26520"
                     /db_xref="GeneID:5004378"
     mRNA            complement(<379348..>379800)
                     /locus_tag="OSTLU_26520"
                     /product="predicted protein"
                     /transcript_id="XM_001420454.1"
                     /db_xref="GeneID:5004378"
     CDS             complement(379348..379800)
                     /locus_tag="OSTLU_26520"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420491.1"
                     /db_xref="GeneID:5004378"
                     /db_xref="InterPro:IPR005806"
                     /db_xref="JGIDB:Ost9901_3_26520"
                     /translation="MSISTRARATPTLGRRARATRTNALRDTGVTRDGLRAAEKQRVV
                     VDVDGVGKVLLQEFANDVYAVSNKCPHLGLSLQGKTPLLSATVSDGAIACPAHGSAFD
                     LKTGEARGEWCPKLPALPVVGKKYCGEPTAIASYAVSVDESGAIKIDA"
     gene            <380186..>381829
                     /locus_tag="OSTLU_26521"
                     /db_xref="GeneID:5004379"
     mRNA            <380186..>381829
                     /locus_tag="OSTLU_26521"
                     /product="predicted protein"
                     /transcript_id="XM_001420285.1"
                     /db_xref="GeneID:5004379"
     CDS             380186..381829
                     /locus_tag="OSTLU_26521"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420322.1"
                     /db_xref="GeneID:5004379"
                     /db_xref="JGIDB:Ost9901_3_26521"
                     /translation="MATARTATARTATVTTRRRARARSGRRAGARARRARARGEDEAA
                     ARDAGETATLAALALAPKEVVDAISVPAELVEVRAYVRWEEAGMPSDTTDAWRQREYD
                     EALLDLKIELLRGTTMNEIRARYKMAPVEGGDAKMFNEDADLARRVKAAAVMKVRASV
                     DEVQGAHEETETIEFIESVVVEDAVVEDGEPEAAAADDDAEEAETVASEVEDAIAAAM
                     ENAVAEDTDAIVDVFAALTEEEIADMEASFSAQATWSTREELVAAITATPSAEDDNEV
                     DLLKDLEETKLALSASEEALQKTKTELEDIEAEIVVLQATSDKALAEMKEGWAAEVSH
                     LEAQLKQAVARVGMDEGEIAAQIAKFERDAEEARRRVEALEAEKAVVAKQLEDTKVAQ
                     IKAEAVRDANSEVILMLKKELESTKDELREMKSNSVSEKEFTAMQSELDRAWEAAAEL
                     QTMWDNDRKVIEFLTKSIDDEKVKKEARQGLNIPVAAKGLLSWARTTISKRANDVSVV
                     SQQTLETVSQAYQELEASTGEFSDDVISDDSESDFMRDM"
     gene            complement(<382016..>382522)
                     /locus_tag="OSTLU_26522"
                     /db_xref="GeneID:5004567"
     mRNA            complement(<382016..>382522)
                     /locus_tag="OSTLU_26522"
                     /product="predicted protein"
                     /transcript_id="XM_001420455.1"
                     /db_xref="GeneID:5004567"
     CDS             complement(382016..382522)
                     /locus_tag="OSTLU_26522"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420492.1"
                     /db_xref="GeneID:5004567"
                     /db_xref="InterPro:IPR004575"
                     /db_xref="JGIDB:Ost9901_3_26522"
                     /translation="MDLLARATRARQRVLAVFNARQSDFESLRAWNDHLERVEELIFN
                     LTEGVDASATESAIAEHKRRNASEIARYAARARDEGRAAMGETAEAMDAGEGYAPETA
                     NGDVVAQPVPTSAVRRGLEKTSLDYDENTEEGRKARAAAIARACGFDGRAVAKARCLR
                     EAFATIWA"
     gene            <382792..>383127
                     /locus_tag="OSTLU_26523"
                     /db_xref="GeneID:5004380"
     mRNA            <382792..>383127
                     /locus_tag="OSTLU_26523"
                     /product="predicted protein"
                     /transcript_id="XM_001420286.1"
                     /db_xref="GeneID:5004380"
     CDS             382792..383127
                     /locus_tag="OSTLU_26523"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420323.1"
                     /db_xref="GeneID:5004380"
                     /db_xref="InterPro:IPR001607"
                     /db_xref="JGIDB:Ost9901_3_26523"
                     /translation="MTRTCAHGARVDARRAREACEACEACGTRRELWRCLTCGDASCG
                     RYANGHSRAHARASEGGCVVMLSWDDLSVWCHECESYVDPESSAALRACVAAAALAKF
                     GDRDGGGAV"
     gene            complement(<383927..>385510)
                     /locus_tag="OSTLU_44098"
                     /db_xref="GeneID:5004568"
     mRNA            complement(join(<383927..384070,384173..>385510))
                     /locus_tag="OSTLU_44098"
                     /product="predicted protein"
                     /transcript_id="XM_001420456.1"
                     /db_xref="GeneID:5004568"
     CDS             complement(join(<383927..384070,384173..385510))
                     /locus_tag="OSTLU_44098"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420493.1"
                     /db_xref="GeneID:5004568"
                     /db_xref="InterPro:IPR000642"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="JGIDB:Ost9901_3_44098"
                     /translation="MEFLAYSVGGLAFMIGSIYLGIVRRTSVPQDQFQAMQFAQSRAG
                     ARRDGTVDVTLEDVGGLENIIEDLEEVVAFLKEPERFAKVGARPPKGLLMEGGPGVGK
                     TLIAKAIAGEAKVPFYSMSGSEFVEIIVGVGAARVRDLFKRARINAPCLIFVDEIDAL
                     GTKRAAAGTRGTEEHEQTLNQLLTEMDGFTPDTGVVFIGATNRADLLDPALLRPGRFD
                     RKVRVGLPNVEARAKILQIHLSKRNCNPEIDTKRLAQNLPGLSGAEIANICNEAAVHC
                     VRRQGEQIEEHDVLDAVERVVSGIRLTAHPKESVTTRKLAAHEVGHALVQNLLHKSNG
                     LIEDIEMISIIPRGFEPAITLIQRKRDEDYRYPTRARMCERVQVLLAGRSCEKVLFGE
                     ASTRGSEDVCEANDLLRNMIVNFGLGQPGMMTTYTYDPKHLNKSERRVARLQGAMVQI
                     LQEAEANCLAIIAAHEDAVNAMVDRLIENETLSLAEFEEILAAH"
     gene            <386964..>387899
                     /locus_tag="OSTLU_4512"
                     /db_xref="GeneID:5004381"
     mRNA            <386964..>387899
                     /locus_tag="OSTLU_4512"
                     /product="predicted protein"
                     /transcript_id="XM_001420287.1"
                     /db_xref="GeneID:5004381"
     CDS             <386964..>387899
                     /locus_tag="OSTLU_4512"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420324.1"
                     /db_xref="GeneID:5004381"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="JGIDB:Ost9901_3_4512"
                     /translation="SGLTNGGNTCFAASALQCLRRATPLTAWFDGVEKFHDVARCAET
                     RKFCVVCEYSQHLERAMASRDAHSIGRLTKDISKVARQFRRGRQEDSHEFINALLDAM
                     HVIFLKDLGGEKKYDLRTRETTVIYHVFGGYTLGTVKCLECGYVSKNFQSTLDIPLEV
                     TGKIGSVEEALRENFCTEEVLSGSNKYKCSKCKALVRAKKGSKIHVSPNILTIPLKRY
                     STGRFSKITKYIKYPSNFSLAEFMSDDAPYEVTAPEYELFGVLVHQDFYASAHSGHYV
                     AYVKLRDDSWVLCNDSRVSPSSEKDAMKQKAYILFY"
     gene            complement(<388507..>389273)
                     /locus_tag="OSTLU_17365"
                     /db_xref="GeneID:5004569"
     mRNA            complement(join(<388507..389144,389207..>389273))
                     /locus_tag="OSTLU_17365"
                     /product="predicted protein"
                     /transcript_id="XM_001420457.1"
                     /db_xref="GeneID:5004569"
     CDS             complement(join(388507..389144,389207..389273))
                     /locus_tag="OSTLU_17365"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420494.1"
                     /db_xref="GeneID:5004569"
                     /db_xref="InterPro:IPR002818"
                     /db_xref="JGIDB:Ost9901_3_17365"
                     /translation="MGGKQSKRRERTIAIVCTSADSMDGHATGAWLEEIATPYYALLD
                     AGFAVDVVSVKGGKVPIDSASESGDFFTADCQKFYDDEDAKKALANAKALKGVKSGHY
                     AGIYLAGGHGTCVDFLNNATLTRVIEETLAADKPVAADCHGPVALLACKKPNGDSILK
                     GTNATCFTDAEETAVGLAEKVPVLLETEFKKLGAQFNGAADWTPNAVTDGKLVTGQNP
                     ASSKACVDAFLALLKK"
     gene            <389564..>390091
                     /locus_tag="OSTLU_93459"
                     /db_xref="GeneID:5004382"
     mRNA            <389564..>390091
                     /locus_tag="OSTLU_93459"
                     /product="predicted protein"
                     /transcript_id="XM_001420288.1"
                     /db_xref="GeneID:5004382"
     CDS             389564..390091
                     /locus_tag="OSTLU_93459"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420325.1"
                     /db_xref="GeneID:5004382"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="JGIDB:Ost9901_3_93459"
                     /translation="MTLADARDGDAAFEANRVAGNAAYDREAFVEATARYTECVEALE
                     KRLGSAEGEGTARRACAIRANRAACFVKRGKHALAMEDASWVIARPLEAGAGILAKAL
                     YRRARAREGVGDVEAALADLRAAEKIDPHDALIQSALNNFTSVFHIAVVLDRASPEVL
                     ARQPAWRNFKPETRP"
     gene            complement(<391124..>392371)
                     /locus_tag="OSTLU_44108"
                     /db_xref="GeneID:5004570"
     mRNA            complement(<391124..>392371)
                     /locus_tag="OSTLU_44108"
                     /product="predicted protein"
                     /transcript_id="XM_001420458.1"
                     /db_xref="GeneID:5004570"
     CDS             complement(<391124..392371)
                     /locus_tag="OSTLU_44108"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420495.1"
                     /db_xref="GeneID:5004570"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="JGIDB:Ost9901_3_44108"
                     /translation="MIRVRPALRRETREGRGAYQRAVAATRGGKACAASAGGERALAG
                     NGEGGTFADDGAHERQRTYEFGFDAVYDERATQEEVYARSAKPATLNALRGYNATVLA
                     YGQTGTGKTYTMEGDRGTMLAYGQQRFGLPGNAPVTDGRERGIIPRAIEDIFDYIAKD
                     SHARSKYLVRVSYLQIYNETVSDLLKPERTNLNIREDKKRGVFVEGQSEWVVRTPSEI
                     YGLLERGAQLRATGSTKMNELSSRSHAVFTIIIEHSTTEDDEPVDGVDVGEGAPAQRQ
                     SITVGKLNLVDLAGSERVSLTGATGKRLDESKKINQSLSALGNVISALTDSKGRSHIP
                     YRDSKLTRILEDSLGGNCITTVIAMVSPALEAFAESLSTLKFASRAKEIKNTATLNED
                     LDQKSLLRKYERELRQLRTELDTR"
     gene            <392946..>394637
                     /locus_tag="OSTLU_88630"
                     /db_xref="GeneID:5004383"
     mRNA            <392946..>394637
                     /locus_tag="OSTLU_88630"
                     /product="predicted protein"
                     /transcript_id="XM_001420289.1"
                     /db_xref="GeneID:5004383"
     CDS             392946..394637
                     /locus_tag="OSTLU_88630"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420326.1"
                     /db_xref="GeneID:5004383"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="JGIDB:Ost9901_3_88630"
                     /translation="MADALASTLDGLTLDGARHRYSKIYDRVPIESVLATAEKDAIGR
                     TIVVGGWVKTGREAERGALLFLAVNDGSGPGNLQVVVKSETYAELGELKTTGTSVVIE
                     GELRAPPESAKGQAIEMHATRVLMVGKCDGATYPIAKKKQTLEFLREKIHLRPRTNTI
                     ASVARVRSALAYATHTFFNQNGFLYVHTPCVTQSDCEGAGEMFQVTTLLSEAEKPEAL
                     EATVKPEEIEAKRAEVSACGGEIKSMKESGADSKEVKKAVKTLDKLKQELSQMESAAR
                     KIGGIQRAEDGSIDYSRDFFGGKSYLTVSGQLQVETYACALSNVYTFGPTFRAENSNT
                     TRHLAEFWMIEPELAFADLNDDMQCAEDYVRFCCNYLLENCYGDLEFFAKMYDSTCID
                     RVKEIATTPFGRVSYTEAIDLLEKAVADGKEFVYPVSWGIDLATEHERWLAEEHFKKP
                     VIVYNYPKDIKAFYMRLNDDNKTVAAMDVLVPKVGELIGGSQREERLDVLERRMVECD
                     LVPEEYSWYLDLRRYGTVTHAGFGLGFERLILLCTGMENIRDVIPYPRWPNNCIS"
     gene            complement(<394731..>395417)
                     /locus_tag="OSTLU_93460"
                     /db_xref="GeneID:5004506"
     mRNA            complement(<394731..>395417)
                     /locus_tag="OSTLU_93460"
                     /product="predicted protein"
                     /transcript_id="XM_001420459.1"
                     /db_xref="GeneID:5004506"
     CDS             complement(394731..395417)
                     /locus_tag="OSTLU_93460"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420496.1"
                     /db_xref="GeneID:5004506"
                     /db_xref="JGIDB:Ost9901_3_93460"
                     /translation="MRALAPSRVVAAPRRARKSRCRSTPRPDVAAPLQRVVEYAEDES
                     SWELHRGVPSEIQRDIDALIASARVDGGIDNAVRGDGDWRVFAAPHIVRLATPLGVLF
                     HPLRYVIRDGTISSDVRHRGRFVPDGWLSASGTVQAAESRVCEGMVRPACRIGFDTFW
                     VGAGASADEPRAGPGSGVVDKAINAVGKLGFVDAIATFPVLFYDERAGVVIFQFPPLK
                     SNIAAFRRRG"
     gene            complement(<395461..>398985)
                     /locus_tag="OSTLU_26531"
                     /db_xref="GeneID:5004384"
     mRNA            complement(<395461..>398985)
                     /locus_tag="OSTLU_26531"
                     /product="predicted protein"
                     /transcript_id="XM_001420460.1"
                     /db_xref="GeneID:5004384"
     CDS             complement(395461..398985)
                     /locus_tag="OSTLU_26531"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420497.1"
                     /db_xref="GeneID:5004384"
                     /db_xref="JGIDB:Ost9901_3_26531"
                     /translation="MGERATTPTRREEAAFATTPTTPRAREDAPTGFVEVANGDLGAL
                     FGGCEGDDDWLTPTGGGGEVGASASASAGAEASAGAVRAAATATAAATYATNAPFASP
                     AASRDDGMGFFDDLDAAEETVSAPAVIPFEARASGAAEAPARETYAASENVAEANEIA
                     SVAAEARAPVIEATSFAPTDSAPDRAFYEETHAPAAEYPQAEFVGERETSDDFGMGMT
                     SHAHATAYEQHAPEQYARQGFSQPLASASHEDQPNRALELREPPRSAYADYRENDVTA
                     DLSAPPIVPAYSSENLHSRVSSSNSVSDMQAPPQTPPKPTFMVPTPIEDSPMAYVHAV
                     PHALASASPVPFTPPPRASAGYDTYEPARVAQPEYPPVPAPSANHGGYAPSYEAHSTQ
                     QLEYAAYSETETLKPANYDDTDRSPHGRPQHVAMSFGFGGSLILSGPGYPGGRISHGT
                     SIPPCSLRVHSVGSMLKDGNTLGMSYVRSMEAFDGPLGNRRQADVTKMMDSALSSGGE
                     RQQSEVTLYRVLQTMLRHKGEISTPGDLLGENRKGAVAELASVLAGDAQAASDGGWVS
                     ANVAASPLNPSGEGDAQQIVQIENLLIAGRRGEALQAAVAAKLWPHALLLASHMGGRH
                     YHETVSIMAKSVCRVGSPLHTLEVVMAGIPQELTTSGVEAAPNVHGMQVPEVSQIREL
                     LPRWREHIAILCSNPAKGSDFVLKALGDELWCQNDITAAHVAYALSKQRPTPYSFNSR
                     LCLIGADHRKFPRTYVTPRAVHLTEIFELAVLGSNPQAQLPSLLPYKLLYAGALAEVG
                     KLKPALAYVESVLKSVRSLDRNSPEVNGALVGMLAAQMEDRLHNSLRGKTGRLADAAA
                     GAAKVLVSGVKGLLDRSVSSLFGDGGEFQASPLGPPHEPRPHTPPDAYQQQPVQMHHT
                     LSSAHSQAAPVVQPPPAHVARHERTPSGNLLRSMSSLFGGVAPKPQPANEPTMSQENV
                     FYYDDERKMWLERGRAPPKEAPPVGAPPLRSEQSAASEIAGPPPVMAPSTHAKQQGGV
                     HTRYVSTFSTTSTPTVAPQGFVPVAPNAGACAQAPAQFFMPSAVAPAHSAHSRNESSE
                     SQSSASYAAHERTASQDGFYGYEASASESSHPPPAGAIPRPPTIDPALLAPSFATSAP
                     LPVIHHTSASAAPSVDVVADDFTDLRLQ"
     gene            399429..400618
                     /locus_tag="OSTLU_25246"
                     /db_xref="GeneID:5004385"
     mRNA            399429..400618
                     /locus_tag="OSTLU_25246"
                     /product="predicted protein"
                     /transcript_id="XM_001420290.1"
                     /db_xref="GeneID:5004385"
     CDS             399875..400612
                     /locus_tag="OSTLU_25246"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420327.1"
                     /db_xref="GeneID:5004385"
                     /db_xref="JGIDB:Ost9901_3_25246"
                     /translation="MLCELLNDVLKKIVPEACHAVGKLPPVLSIVMDSAQKYASLEMR
                     SSALATAALGLDQMHVLGRPLHITRPAGYFDDPDAKRQVLNVEHVLPAPEKLQQVYDY
                     LDARKIEESKSKDEAIERAKKMAVSVSESVAHAAAPTTAEATEYLCLENMVDVKTLLS
                     ARERKELRYDIEDECGKCGKVVRVVVPTPSDEEVERKAASRAYVYFARVGSAESAHKV
                     MHGRKFGGRIVQARYIEASEFEAFDKK"
     gene            complement(<400700..>401719)
                     /locus_tag="OSTLU_26533"
                     /db_xref="GeneID:5004507"
     mRNA            complement(<400700..>401719)
                     /locus_tag="OSTLU_26533"
                     /product="predicted protein"
                     /transcript_id="XM_001420461.1"
                     /db_xref="GeneID:5004507"
     CDS             complement(400700..401719)
                     /locus_tag="OSTLU_26533"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420498.1"
                     /db_xref="GeneID:5004507"
                     /db_xref="JGIDB:Ost9901_3_26533"
                     /translation="MPRVNVLVRALDGRTRCVECDLDDRDRSRDLARVVDALRARDAA
                     LVPYGARVAFSRSARARGDATVRASDALIAHVTCGLLGGKGGFGTQLRASARRGTQTT
                     NFDACRDLSGRRLRAVNGEKKIAAWEAEKAERDAEAKAEKYLKSQAGGSGAARLRELE
                     EKEREAYHAESAKVSESVNDAVASGFKNAAAIEAAKRKKAKKGKAVVGNDDESESESE
                     SDEDFDDSALLFPAAKKARVVPAAPAPALARANEPEASTSQSPTLAPTMAPPVMEQKE
                     EGPLDLTRFDSAEALEAVGLERLKAELTAQKLKCGGTLRERAARLFLLRDNTRDEIDK
                     KHWSK"
     gene            complement(<401868..>402896)
                     /locus_tag="OSTLU_26534"
                     /db_xref="GeneID:5004386"
     mRNA            complement(<401868..>402896)
                     /locus_tag="OSTLU_26534"
                     /product="predicted protein"
                     /transcript_id="XM_001420462.1"
                     /db_xref="GeneID:5004386"
     CDS             complement(401868..402896)
                     /locus_tag="OSTLU_26534"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420499.1"
                     /db_xref="GeneID:5004386"
                     /db_xref="JGIDB:Ost9901_3_26534"
                     /translation="MSENAAFAVAGTCAIVFIGASCYFEEYVYKSLPNFDYYWTVALA
                     ELMVFALISSASSIADGTLFAKRKAPLELYALQALLLAAYSAVGKLCYKWINYATGTV
                     LRSSKLVFTMAISAVWLRRTYKPHQVVAASLLVVAVAFFGIAERELGSNEATMPTPAT
                     ATTNDGEAVLGLSEDVKLALGFGLSVVAIFLGSLQTNVSEHAMRNYGAGVRENILYTN
                     AIGTVFAFLFVVIFEGSGSITYLRTVKGAFVLLFARSVTFYFGAYFFSTLTRHFGATS
                     ATAVTTVRKALTVISSFILFPKDKPFAGFFVYGLFFFLLSVLAESSLHIRAFFHRVRA
                     GRRGEYSL"
     gene            404163..406161
                     /locus_tag="OSTLU_46903"
                     /db_xref="GeneID:5004387"
     mRNA            join(404163..404717,404841..406161)
                     /locus_tag="OSTLU_46903"
                     /product="predicted protein"
                     /transcript_id="XM_001420291.1"
                     /db_xref="GeneID:5004387"
     CDS             join(404325..404717,404841..406133)
                     /locus_tag="OSTLU_46903"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420328.1"
                     /db_xref="GeneID:5004387"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR003097"
                     /db_xref="JGIDB:Ost9901_3_46903"
                     /translation="MNEVEPEDVIKPGAVITFVVSSTGDGDAPDNCDTFFTRLKRKAK
                     KEKGEGAIGVQYAVLGLGDQNYSAFMAVPRQFSQTMENLGAKCFAKRGECDDTLGLYE
                     QVDAWTSTFWSHLEVARGNSHKLREGETIWLPKTTEVVANRVAPGPDSEGAYTVSSPY
                     MATIHKREVLTNLKSDRRVLHMEFDLGSSGISYKPGDSIGIVPQNDAELVRAIVDRLG
                     LDQAAIFTLNWKKGDTNEHATHPLPHIHTPCTVKSVFTNYIDITGCPRKSLLRVLAEH
                     CGNAEEKDALLHLSSRGGRAEYETQIRAQSPTLLTLLNNYPSCCPPLAELLDALSPLA
                     PRLYSITCAPEVAPTTPSVAFSVVRFQVPSGEHRLGVATNWLDEISVDDKCEHKVPVY
                     IKPSLKFGLPEDSSAPLVMIGPGTGVAPFRGFLQSRRAKAQKGGRLSEAMLFFGCRKA
                     DEDFLYEADWKSFTADGSLTKLVCAFSRETAEKVYVQHKIEEHATEVARLISEGAYVM
                     VCGDGAHMAKDVHAALVRVVAQAGVCGVSDVKAAEALLADFTKSGRYVRDIWS"
     gene            complement(406419..407535)
                     /locus_tag="OSTLU_25248"
                     /db_xref="GeneID:5004508"
     mRNA            complement(406419..407535)
                     /locus_tag="OSTLU_25248"
                     /product="predicted protein"
                     /transcript_id="XM_001420463.1"
                     /db_xref="GeneID:5004508"
     CDS             complement(406523..407386)
                     /locus_tag="OSTLU_25248"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420500.1"
                     /db_xref="GeneID:5004508"
                     /db_xref="JGIDB:Ost9901_3_25248"
                     /translation="MNRCRRGDMCLRHPARLCAAVAVAIFDWRLVLVESYPTELRLDA
                     RCEGGMARVHPTRRAAGHGAPIDATNTSVLLSWANHTDVEDAQYDENEPTRQIPAAWT
                     FPPGKREYCDGCRLGLAASHEDPNSMMLITASAGSFHDQGVLLNGNVNRPATACSGRR
                     MYTTRKATVHNLIWCAPEKSASIETVEFHITASGGASMPFKRYVFVLQRNITLEPDED
                     LHGALCFASERSPQNSYFSCLTLVYVTLGLLATTMVSVWAVSTRARRSRCRYSALGAE
                     ALDREIEMPQT"
     gene            408008..409846
                     /locus_tag="OSTLU_26537"
                     /db_xref="GeneID:5004388"
     mRNA            408008..409846
                     /locus_tag="OSTLU_26537"
                     /product="predicted protein"
                     /transcript_id="XM_001420292.1"
                     /db_xref="GeneID:5004388"
     CDS             408043..409713
                     /locus_tag="OSTLU_26537"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420329.1"
                     /db_xref="GeneID:5004388"
                     /db_xref="JGIDB:Ost9901_3_26537"
                     /translation="MQIERRKRNARALCALVVSATLANTASAQLTYIAGYEPRSNVVQ
                     HSQVDLDIRDIISSFPKWKGGDSIYNGGLLNDCTTVAGACNWNGTSSLYPTLWDGTCT
                     HTCPAADSANPGQKCTLSAADACLSTYGIYKYGKGSFKGNNKDDAASMRTLRGFATKL
                     GDKGASARVAAKNNPFINKMNKYWAKQGLNELTWGQDIIEAAFKGTCVKNGNSCVKSG
                     GVNLLDFGTVGNDFRVEVIKKGIIYLNIFPYVIWEFQDAINDCHGGDLGANDEIPGGG
                     SVHAWDEAVAFYTGSLEGILKGGNNGLASCDDGNCELQFQLSDYRCTNFGTCTADADG
                     DPWSGYSKNNEEIFKLFQQGEGEITEAAASSNTAATKCDLPDRTHEKAVTKMLVPFVQ
                     GCMRYLWKTKDSQKAKEAGELFAFASAALPFIDAVDPVAATKLFTRAWKLDFTTYTYE
                     ETKQGIEGTLSRLGAGEGIGTISCADIGDLVDSSDQLLAAGCTDPSSPSSSNNDTTLG
                     LGIGIPLGAIAITALVFVVLLWRKSSANSKRVEELTMQLRGPGKDFYP"
     gene            complement(<410384..>410542)
                     /locus_tag="OSTLU_26538"
                     /db_xref="GeneID:5004509"
     mRNA            complement(<410384..>410542)
                     /locus_tag="OSTLU_26538"
                     /product="predicted protein"
                     /transcript_id="XM_001420464.1"
                     /db_xref="GeneID:5004509"
     CDS             complement(410384..410542)
                     /locus_tag="OSTLU_26538"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420501.1"
                     /db_xref="GeneID:5004509"
                     /db_xref="JGIDB:Ost9901_3_26538"
                     /translation="MSLAVAATLCTRDLRREHQRKQVSPSRAPSECSSADETASHALR
                     SLNVSGDA"
     gene            411139..>412578
                     /locus_tag="OSTLU_50814"
                     /db_xref="GeneID:5004389"
     mRNA            411139..>412578
                     /locus_tag="OSTLU_50814"
                     /product="predicted protein"
                     /transcript_id="XM_001420293.1"
                     /db_xref="GeneID:5004389"
     CDS             411373..412578
                     /locus_tag="OSTLU_50814"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420330.1"
                     /db_xref="GeneID:5004389"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR003097"
                     /db_xref="JGIDB:Ost9901_3_50814"
                     /translation="MATIHKREVLTNLKSDRRVLHMEFDLGSSGISYKPGDSIGIVPQ
                     NDAELVRAIVDRLGLDQAAIFTLNWKKGDTNEHATHPLPHIHTPCTVKSVFTNYIDIT
                     GCPRKSLLRVLAEHCGNAEEKDALLHLSSRGGRAEYETQIRAQSPTLLTLLNNYPSCC
                     PPLAELLDALSPLAPRLYSITCAPEVAPTTPSVAFSVVRFQVPSGEHRLGVATNWLDE
                     ISVDDKCEHKVPVYIKPSLKFGLPEDSSAPLVMIGPGTGVAPCRGFLQSRRAKAQKGG
                     RLSEAMLFFGCRKADEDFLYEADWKSFTADGSLTKLVCAFSRETAEKVYVQHKIEEHA
                     TEVARLISEGAYVMVCGDGAHMAKDVHAALVRVVAQAGVCGVSDVKAAEALLADFTKS
                     GRYVRDIWS"
     gene            <412890..>414290
                     /locus_tag="OSTLU_2583"
                     /db_xref="GeneID:5004510"
     mRNA            join(<412890..413239,413282..>414290)
                     /locus_tag="OSTLU_2583"
                     /product="predicted protein"
                     /transcript_id="XM_001420294.1"
                     /db_xref="GeneID:5004510"
     CDS             join(<412890..413239,413282..>414290)
                     /locus_tag="OSTLU_2583"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420331.1"
                     /db_xref="GeneID:5004510"
                     /db_xref="InterPro:IPR001360"
                     /db_xref="JGIDB:Ost9901_3_2583"
                     /translation="FPPSFAFGVGTSAWQIEGNGGDRPRSVWDAFVSELGEEKRVEAE
                     RGIGFHERYAADAQMMADAGVKHFKMSLSWPRLMRADGSAIDEGFEYYQNVFGALRER
                     GVEPHVTLFHWDTPIVCEGAWVKDEILKDFEKYADAVFSRLGKGIKYWTTISEPKTVA
                     EMGYGAGLHAPGRRSVEEQLKVGHNMLRAHALAVALYREKYSQFGGKLSINLNSAWVE
                     PASDSPDDVRAAANAMDEELGWFADPIYKGDYPASMRARLGSFLPEFTEEERVLVKGS
                     VDYFALNHYTSYFAKHVTDAQASSQLGLSGRPQPWEITLESEKSKKPIGKEAQSDWLH
                     IVPWGLEKVLLHIKDRYDDPAIMISENGVDIAERGDIAETLDDTTRVKFIDAYLGAAR
                     EAMRKGANVVGYFYWSMFDNVEWVDGRSKRFGLVYVDYDGKYGEKMKRYPKKSLEHFS
                     SYM"
     gene            <415746..>416543
                     /locus_tag="OSTLU_93463"
                     /db_xref="GeneID:5004511"
     mRNA            <415746..>416543
                     /locus_tag="OSTLU_93463"
                     /product="predicted protein"
                     /transcript_id="XM_001420295.1"
                     /db_xref="GeneID:5004511"
     CDS             <415746..416543
                     /locus_tag="OSTLU_93463"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420332.1"
                     /db_xref="GeneID:5004511"
                     /db_xref="InterPro:IPR008547"
                     /db_xref="JGIDB:Ost9901_3_93463"
                     /translation="VRAIKLAPYCELLTRSNDAERPLAICVGWFGASLKHVKKYAAMY
                     VDANCDAVAIAPPSAAMLVPAAVDAYADVILRALARHVRGKCVVHVASNGGFIFAGNL
                     MLKAANGDATARTIFERTKGVVFDCAPGNLRPDIVARAFAAVVGGASATSEPSPYFEV
                     FASWLLGRRVLSERLLRIDELWGKAGAPESILLRCPSMFMYSEADVLISPREIEAFAT
                     LRQDQTGHRSTLHKYDDAGHCEIGRDDYEDYKSKVTDFLERVVHSAA"
     gene            complement(<416586..>418775)
                     /locus_tag="OSTLU_44388"
                     /db_xref="GeneID:5004512"
     mRNA            complement(<416586..>418775)
                     /locus_tag="OSTLU_44388"
                     /product="predicted protein"
                     /transcript_id="XM_001420465.1"
                     /db_xref="GeneID:5004512"
     CDS             complement(416586..>418775)
                     /locus_tag="OSTLU_44388"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420502.1"
                     /db_xref="GeneID:5004512"
                     /db_xref="InterPro:IPR003385"
                     /db_xref="JGIDB:Ost9901_3_44388"
                     /translation="VWTIEFQVDASELPFEYSYALRDGDDVVEDARGARECSLSDDGD
                     VANAVERRLIHRDGVFTHGGVWKGSGMALPVFSVRTAQSVGCGDFVDLRQMVDFASTT
                     GMSVVQVLPVNDTCVYGTFWDSYPYSSLSVHALHVMYLRVQELSGVTAELAEEIEAAR
                     VALDLKEIDYEATVKEKLSFARRAYYTDGEKVLASDDFQTFYKANESWLRPYGVFCVL
                     RDLFGTAEHWRWGVFATFSKEILDKIDCPGGDLYESTRFFFYLQYNLHTQLVTTAQYA
                     KSKGVILKGDLPVGVDKRSVDTWMHPRLFRMDTSTGAPPDAFDANGQNWGFPTYNWET
                     MAEDDYAWWRARMQHLEQYFSAIRIDHILGFFRIWELPASATTGRMGRFRPSLPLTRD
                     ELAARGLWDLNRLTQPYIQWHELEVLFGENVHEIAYRYMIEVDDQRGLWQFRREFDTE
                     QAIFAATKPRGDFPMHLNDEQLLVRAGLMQLFQNRCLLTDVENIDHFYPRFGLEETTS
                     FQALEGWMRDALRDLSNDYYFGRQTNTWRKQARKVLPALLKSTEMLVCGEDLGFTPMC
                     VPPVMDELGILGLRIQRMPPVGESSEFGRPHTYSYLTVCSPSCHDTMTTRAWWEEDAE
                     RRARYDEMFQCGNDDACTPSVMRRILTQHIESPSVLAIFPIQDVLALDERYAKRPALE
                     ETINDPTNPKHYWRFRIHVACEELLANASFVKEIKDLVRVRSQTTST"
     gene            <419949..>421616
                     /locus_tag="OSTLU_44322"
                     /db_xref="GeneID:5004390"
     mRNA            <419949..>421616
                     /locus_tag="OSTLU_44322"
                     /product="predicted protein"
                     /transcript_id="XM_001420296.1"
                     /db_xref="GeneID:5004390"
     CDS             419949..421616
                     /locus_tag="OSTLU_44322"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420333.1"
                     /db_xref="GeneID:5004390"
                     /db_xref="InterPro:IPR002917"
                     /db_xref="JGIDB:Ost9901_3_44322"
                     /translation="MDREARTYATAWANELASTLSEDARALERRLFGDEGGASERGED
                     EDEDASEEETVGTSGRKGKARADARVRRKTRRDWSKVPDEALPRVAVVGRPNVGKSAL
                     FNRLTGTKRAIVYDEPGVTRDRMYVRAYWGEHEFMMVDTGGLENLPANPEGGPKTDTV
                     GGVEILPGMIEAQAAEAVREASVLIFVVDGQVGLTAADMDIFAWLRRTHSKIPLHLAV
                     NKCESTTKGEDQILEFWSLGDVTPLAVSAISGTGTGELLDNMCATLPPPPQVSEDENA
                     EEEDIPVTVAIIGRPNVGKSSLLNGLAGEARSIVSDFSGTTRDSIDTLVEDKYTGRKF
                     TLIDTAGIRRRTQVKSGTDGAEKLSVGRALQAMKRADVVVLVIDGTEGPSQQDFVLAE
                     RATQEGCAIVLCINKWDLVDKDTHTMNKYTDDMRLKLRVFEYAEIVYTSALTGQRIQK
                     ILDAAQVASENHRKRLTTATLNSVVQEATLWKLPPSRNSRKGKIYYITQASIRPPTFV
                     FFVNDPKLFPDTYRRYMERQLRENIGFPGTPIRLLWRGKGVEKGPRK"
     gene            complement(<421771..>422349)
                     /locus_tag="OSTLU_26544"
                     /db_xref="GeneID:5004513"
     mRNA            complement(<421771..>422349)
                     /locus_tag="OSTLU_26544"
                     /product="predicted protein"
                     /transcript_id="XM_001420466.1"
                     /db_xref="GeneID:5004513"
     CDS             complement(421771..422349)
                     /locus_tag="OSTLU_26544"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420503.1"
                     /db_xref="GeneID:5004513"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="JGIDB:Ost9901_3_26544"
                     /translation="MDADASATTSGRATTSARGRGRGDGATTTRDAGEDEGARRRSAG
                     AVRRTSRASFDSDVARGDGEGGTKEKFECNVCFEVAREPVVTPCGHLYCWRCINTWLS
                     VGDNVACPVCKGEMTKDMLIPLYGFGANTARGGAKREGGGAPPLESAAGLATLLGLRS
                     SDELSTEQASQLLLSRYLLAIGTLVIVCLLVI"
     gene            <422966..>424255
                     /locus_tag="OSTLU_2927"
                     /db_xref="GeneID:5004391"
     mRNA            <422966..>424255
                     /locus_tag="OSTLU_2927"
                     /product="MFS family transporter: sugar"
                     /transcript_id="XM_001420297.2"
                     /db_xref="GeneID:5004391"
     CDS             <422966..424255
                     /locus_tag="OSTLU_2927"
                     /codon_start=1
                     /product="MFS family transporter: sugar"
                     /protein_id="XP_001420334.1"
                     /db_xref="GeneID:5004391"
                     /db_xref="JGIDB:Ost9901_3_2927"
                     /translation="TRYRMVVVSLVAFALMLCNADRVIMAVAGVPLAAANGWGERAVG
                     LVQSSFLWGYALTPLVGGMLADRYGGKVVLGAGIAVWSLATVATPFAATSGGLAPLLV
                     ARAVMGLGEGVALPCMNNVISRWVPRTERSRAVAISMGGFQSGSMIGLLAAPALLARG
                     GVPGPFILFGALGLAWAAIWHFAATTYPKDCKMVGARELNYIVDSPGGALTSSSSTLK
                     DAAPPPFKLLLSKAPTWACIIANFVNNWGFFILLAWMPLYFKQVVGLNLREAAWFSAL
                     PWATMAASGVVAGTLADNLINSRGWSVTATRKFIQGVGFIGPAICLIILAAYGAQMTA
                     ARAVTTLTVACGCTAFTQAGFLVNFQEIGPKYAGVLHGMANTAGSIAGMVGTYATGAV
                     LEATGGNWSAVLYITAVVYALGAATWLTMSTGERVFD"
     gene            complement(<424821..>425231)
                     /locus_tag="OSTLU_17380"
                     /db_xref="GeneID:5004514"
     mRNA            complement(<424821..>425231)
                     /locus_tag="OSTLU_17380"
                     /product="predicted protein"
                     /transcript_id="XM_001420467.1"
                     /db_xref="GeneID:5004514"
     CDS             complement(424821..425231)
                     /locus_tag="OSTLU_17380"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420504.1"
                     /db_xref="GeneID:5004514"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="JGIDB:Ost9901_3_17380"
                     /translation="MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRP
                     GTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEASEAYLV
                     GLFEDTNLCAIHAKRVTIMPKDVQLARRIRGERA"
     gene            <425662..>425973
                     /gene="HFO3502"
                     /locus_tag="OSTLU_44220"
                     /db_xref="GeneID:5004392"
     mRNA            <425662..>425973
                     /gene="HFO3502"
                     /locus_tag="OSTLU_44220"
                     /product="predicted protein"
                     /transcript_id="XM_001420298.1"
                     /db_xref="GeneID:5004392"
     CDS             425662..425973
                     /gene="HFO3502"
                     /locus_tag="OSTLU_44220"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420335.1"
                     /db_xref="GeneID:5004392"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="JGIDB:Ost9901_3_44220"
                     /translation="MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGV
                     KRISGLIYEETRGVLKVFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFG
                     G"
     gene            <426411..>426860
                     /locus_tag="OSTLU_26548"
                     /db_xref="GeneID:5004515"
     mRNA            <426411..>426860
                     /locus_tag="OSTLU_26548"
                     /product="predicted protein"
                     /transcript_id="XM_001420299.1"
                     /db_xref="GeneID:5004515"
     CDS             426411..426860
                     /locus_tag="OSTLU_26548"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420336.1"
                     /db_xref="GeneID:5004515"
                     /db_xref="InterPro:IPR005307"
                     /db_xref="JGIDB:Ost9901_3_26548"
                     /translation="MVSLTKEQCGGTTARYAWTQSEDEIVVSFAAPADATSRECEVTL
                     TSTAATVRVRGQTLLDGELTRAIVKDDSYWELESDGSQKVLRLSLTKLRRTCAKFHWP
                     SVCVGEPEIDVAAFGDPVMGVTGNLNGDAMKTMMEDVAAMRRDAEKN"
     gene            complement(<426906..>427712)
                     /locus_tag="OSTLU_17383"
                     /db_xref="GeneID:5004516"
     mRNA            complement(<426906..>427712)
                     /locus_tag="OSTLU_17383"
                     /product="predicted protein"
                     /transcript_id="XM_001420468.1"
                     /db_xref="GeneID:5004516"
     CDS             complement(426906..427712)
                     /locus_tag="OSTLU_17383"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420505.1"
                     /db_xref="GeneID:5004516"
                     /db_xref="JGIDB:Ost9901_3_17383"
                     /translation="MSTPPTPTARRRARRRARATRLLALLAAVVARAVTRAEARATAR
                     RPTTLTPGTRARDVELAFGRAHAYDVRDLKANTAYEVKVSYRATSAAAIAVELDSGWL
                     GGGGWFGGGGGWVGGTTSDGRTELRRRLLNVEKLVLSRRTLGEGMTRARVVVRAEREG
                     VYWAGATAPEYVTYDVEVQPLFAAGKFGEIPRQSLGMICVCVAFVALAIAGARFVGDD
                     VVWRACDALDARKRQYAAAHASAADGLDDAMNVSLRETVPVPVTTITSDD"
     gene            427746..429458
                     /locus_tag="OSTLU_26550"
                     /db_xref="GeneID:5004393"
     mRNA            427746..429458
                     /locus_tag="OSTLU_26550"
                     /product="predicted protein"
                     /transcript_id="XM_001420300.1"
                     /db_xref="GeneID:5004393"
     CDS             427917..429389
                     /locus_tag="OSTLU_26550"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420337.1"
                     /db_xref="GeneID:5004393"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR007865"
                     /db_xref="JGIDB:Ost9901_3_26550"
                     /translation="MRAESARATFERGQDTLRVSYELHRENRARAVEAMRARGDGDGV
                     VAMTGGRQTRRYSTDNEPLFRQESYFHWMFGVLEGDCHGALDARTGKSTLFVPRLPQE
                     YAIWMGAIETRESFAERYLVDEVMYADEFEGYLKALDTKIYVLKGVNSDSGDVTDGLG
                     AELEAALGATKIDATDALFNVITELRTVKTAREQEVLKYASKISSMAHVEVIRSLKPG
                     MMEYQLESLFKHTCYSRGGMRNESYTSICAAGKNGATLHYGHAGAPNSAQIKEGDLVL
                     MDMGAEYHCYAADITTTVPAGGKFTPDAKIIYEGVLAAHQAVLKALKPGCAWLDLQRL
                     AETHILRALVDGGFLVGDIDEMMAKRVSATFMPHGLGHHLGVDTHDVGGYGLPGTPAR
                     STEPGLKNCRTASLMKEGNVMTIEPGCYFIDVLLDRALADGSDIKQYFVADRVNACRS
                     MGGVRLEDNVVVTADGCQSWTSVPRTVAEVEAVMAGASWP"
     gene            complement(<429483..>429896)
                     /locus_tag="OSTLU_26551"
                     /db_xref="GeneID:5004517"
     mRNA            complement(<429483..>429896)
                     /locus_tag="OSTLU_26551"
                     /product="predicted protein"
                     /transcript_id="XM_001420469.1"
                     /db_xref="GeneID:5004517"
     CDS             complement(429483..429896)
                     /locus_tag="OSTLU_26551"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420506.1"
                     /db_xref="GeneID:5004517"
                     /db_xref="JGIDB:Ost9901_3_26551"
                     /translation="MASRRGVPAGTPRHFATMSARDAETRAPATARGGTAVPAHVLEA
                     IYGTTTTTTTTTTTTTKTTVVETATKAARYDESLKTWWRTYSERKNDEEEEHVADSLL
                     YDYRHLPRTTPAPNFREDRLAPTSTKETKETKETK"
     gene            <430186..>431022
                     /locus_tag="OSTLU_93465"
                     /db_xref="GeneID:5004394"
     mRNA            <430186..>431022
                     /locus_tag="OSTLU_93465"
                     /product="predicted protein"
                     /transcript_id="XM_001420301.1"
                     /db_xref="GeneID:5004394"
     CDS             <430186..431022
                     /locus_tag="OSTLU_93465"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420338.1"
                     /db_xref="GeneID:5004394"
                     /db_xref="JGIDB:Ost9901_3_93465"
                     /translation="VYAEEEEDRDDGVDWDGLPPGADPFGTNKKGGRERGMRKRNQVM
                     TFVKHLRALLSLRGRREIKRCVDFGCGTGNVLMTCAATFPEIDFVGVDLNATSIEILN
                     SRIRKSGLTNVSAVVGLIEDGDTFGADCALALHVCGSATDRVLNSAVRARIPFVIAPC
                     CVGKVQEGGMRSLNRMRNDLISLDKIEDIERPRSRLMRAAGFDFEAYMSAATLADWSG
                     HQGVDPSDPNEPLAALPRRAKSAIEADRGEFAREHAYDVTLHKMPAQSGIRDDVLVGI
                     PL"
     gene            complement(<431367..>431900)
                     /locus_tag="OSTLU_10480"
                     /db_xref="GeneID:5004518"
     mRNA            complement(<431367..>431900)
                     /locus_tag="OSTLU_10480"
                     /product="predicted protein"
                     /transcript_id="XM_001420470.1"
                     /db_xref="GeneID:5004518"
     CDS             complement(<431367..>431900)
                     /locus_tag="OSTLU_10480"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420507.1"
                     /db_xref="GeneID:5004518"
                     /db_xref="InterPro:IPR006145"
                     /db_xref="JGIDB:Ost9901_3_10480"
                     /translation="RVLYENDAVVIVNKPPGVSFHSEFEPGALARLRASRDAREERLR
                     AVHRLDKGTSGTLVFAKTADAAKKLSDGFATRAIVKYYVGISGKKPKKKMGTVTGDMA
                     RARRKAYKLTNTKDNPAVTKFVSFGAKGRRMFIFRPLTGKTHQLRVCAKSLGAPLLGD
                     DVYSGAVAERCYLHACAI"
     gene            <432190..>433293
                     /locus_tag="OSTLU_44277"
                     /db_xref="GeneID:5004395"
     mRNA            <432190..>433293
                     /locus_tag="OSTLU_44277"
                     /product="predicted protein"
                     /transcript_id="XM_001420302.1"
                     /db_xref="GeneID:5004395"
     CDS             432190..>433293
                     /locus_tag="OSTLU_44277"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420339.1"
                     /db_xref="GeneID:5004395"
                     /db_xref="InterPro:IPR011084"
                     /db_xref="JGIDB:Ost9901_3_44277"
                     /translation="MASQTGAIKRLASKAFRGVNVDGFAFQSPDVRCYVLTHFHADHY
                     CGLSGSFGKDGDEAKIYCSEITARLVVEFLGVKRERVVGCELGRGTTLRGAGTRGDDV
                     EATFVDANHCPGACLVFFRNKITGETLLHTGDFRAAARVRNDGTLRELLTTCRDGSVD
                     EVMLDTTYCEKKWTFPDQDVVLNKMRQIARDELAREPRTLFLCGSYSIGKERAIQAVC
                     QGAQSRASVTARRKKSLELSGWWRDDAFVCEDDDAEEAARCQVRVCGLGKGSNHRAMM
                     EIMAKEAPRWRAAVAFSPTGWSYTKKMDEDGFNVNPWIENEGRTRTYAIPYSEHSSYT
                     ELREFIKFLKPKKITPTVNAITPKDREKLVNKHF"
     gene            <434200..>434982
                     /locus_tag="OSTLU_5051"
                     /db_xref="GeneID:5004519"
     mRNA            <434200..>434982
                     /locus_tag="OSTLU_5051"
                     /product="predicted protein"
                     /transcript_id="XM_001420303.1"
                     /db_xref="GeneID:5004519"
     CDS             <434200..>434982
                     /locus_tag="OSTLU_5051"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420340.1"
                     /db_xref="GeneID:5004519"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="JGIDB:Ost9901_3_5051"
                     /translation="GSSGEAFLASWRGARVVVKTMKLLHDDDAARRALARRAFVRECE
                     IMARLRHPNVLAFYGANANGRDASVVCEYAPGGTLKQWLHENKGKKRSLSARLGMALD
                     IARAFAYLESRTPRVMHRDLKPSNVFVSVDGRALVADFGLARFVAPRGEDLTGETGTY
                     IYMAPEVIKSQHYDERADVFSYGILLYELVTGIEPYQPHHFTGIQIATAVADRAFRPK
                     IPDSTHAGLTAIIEMCWQQDASNRPSFERVRESMETMVPDILK"
     gene            <435405..>436031
                     /locus_tag="OSTLU_7168"
                     /db_xref="GeneID:5004520"
     mRNA            <435405..>436031
                     /locus_tag="OSTLU_7168"
                     /product="predicted protein"
                     /transcript_id="XM_001420304.1"
                     /db_xref="GeneID:5004520"
     CDS             <435405..>436031
                     /locus_tag="OSTLU_7168"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420341.1"
                     /db_xref="GeneID:5004520"
                     /db_xref="InterPro:IPR001254"
                     /db_xref="JGIDB:Ost9901_3_7168"
                     /translation="CGGTLISNVHVMSAAHCFFDRAGVSNVGAYSSVVVRFGAHADVN
                     AGAMTASVVRIDGHPEFSDITWDNDVSVLTLSSPVDVASYPPVVLAWNPADINVGQIA
                     HVVGWGTRDDNMLSKVMMEGTVPIVSHAQCTAAGSYAPSEILPSMVCAGYAQGGVDAC
                     QGDSGGPLIQNSKQIGIVSWGEGCALPQKYGVYFAVRAAQGFLALATDS"
     gene            <436593..>436802
                     /locus_tag="OSTLU_26558"
                     /db_xref="GeneID:5004521"
     mRNA            <436593..>436802
                     /locus_tag="OSTLU_26558"
                     /product="predicted protein"
                     /transcript_id="XM_001420305.1"
                     /db_xref="GeneID:5004521"
     CDS             436593..436802
                     /locus_tag="OSTLU_26558"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420342.1"
                     /db_xref="GeneID:5004521"
                     /db_xref="JGIDB:Ost9901_3_26558"
                     /translation="MQEFEAAKSAILKVKPSANVIANRVDAYPITVRVSVGEREVWSG
                     RQQLLFRKNGRPAMKDIEEAMRKLG"
     gene            complement(<437152..>438339)
                     /locus_tag="OSTLU_88641"
                     /db_xref="GeneID:5004522"
     mRNA            complement(<437152..>438339)
                     /locus_tag="OSTLU_88641"
                     /product="predicted protein"
                     /transcript_id="XM_001420471.1"
                     /db_xref="GeneID:5004522"
     CDS             complement(437152..>438339)
                     /locus_tag="OSTLU_88641"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420508.1"
                     /db_xref="GeneID:5004522"
                     /db_xref="JGIDB:Ost9901_3_88641"
                     /translation="VRTATRTRASDESSSTTTRASYADAATAVNEGLRLFERGEHEAA
                     TRAFTRALEMKPNEDEARAASYNRACGYVKMNMYDEAKDDLIAAVNVHNLKFKVLTSD
                     PDLDAFRASTQYGEVAAAVKGGRGASTMVNLRAEAQEPFRFFKLYLFGGLAAGAGLGL
                     FIIGTRLIKAVQGGEGAPDLTETVTNLGINTVGLLAFSVLLRGELQGREKIIQKVERE
                     EELGRLGVTLGDGDKNVLFSRLRGSYRVFIVAGSEEHITKTLESLERFKEKLTKNKIV
                     ILPVAMDESGEESGDELPFGQRRRKAKTSKTTELTASAAAALLGGDKKLKLMPVDNGA
                     WKRWIINQIESSGFDPTVRDVFFGVAKNGTIWKSGAGIPNWMKLFEDLPDEDSIQGKV
                     TGV"
     gene            <439033..>439692
                     /locus_tag="OSTLU_26560"
                     /db_xref="GeneID:5004396"
     mRNA            <439033..>439692
                     /locus_tag="OSTLU_26560"
                     /product="predicted protein"
                     /transcript_id="XM_001420306.1"
                     /db_xref="GeneID:5004396"
     CDS             439033..439692
                     /locus_tag="OSTLU_26560"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420343.1"
                     /db_xref="GeneID:5004396"
                     /db_xref="JGIDB:Ost9901_3_26560"
                     /translation="MDVLAFRRLSAMMNTFEKNVETHGIARQVVVITAGADTRAFRLP
                     FPSGTAIFECADGTVHTKAAAVMKKVGAKPSKGCSHRRVPVDATATDAAYGDLEERLE
                     RAGYRPDVRSLWLVQDVHAWDHSRLSNFITESADLMTTGSELIIDASALTSTDDIIRR
                     EFASNGVMPEVVRIPADEGREPIRLVLGCAQRVSLKESEYYREQLRAAEDEADEDGFE
                     D"
     gene            complement(<439736..>442948)
                     /locus_tag="OSTLU_88642"
                     /db_xref="GeneID:5004523"
     mRNA            complement(<439736..>442948)
                     /locus_tag="OSTLU_88642"
                     /product="predicted protein"
                     /transcript_id="XM_001420472.1"
                     /db_xref="GeneID:5004523"
     CDS             complement(439736..442948)
                     /locus_tag="OSTLU_88642"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420509.1"
                     /db_xref="GeneID:5004523"
                     /db_xref="InterPro:IPR000733"
                     /db_xref="JGIDB:Ost9901_3_88642"
                     /translation="MGKKERAKARARALEVGGMSRADARAACGLGATPAPAARKTNAM
                     TTMGTTTGGSGGARRGNAPSPALLTANVKNARSLREVYALRDESAGRMNHIHLSAVWT
                     SVGRMRCDGERASSSDGDGMNDAHERLIAHTIEFVRDERSKMGGRELANVAHGAAKGG
                     GSEELFAALAKAIERHLGGIDRGQELANIAWAFAKADYKCERLFSALARMAERHAERF
                     NSQELTNTCWAFASVGHADARLFKALARCVERRLGEFNTQGLSNTAWGFAKSGFVDVG
                     LFRAMSQKAQERLDDFNAQDFSNLIYAFAKAGQYDAKLFTTLAKHAERHLSALNAQGL
                     TNTVWSFSKCGHLDAELFSKFGRSIERRMTANASEFNSQDIANTAWAFGKACHHDEKL
                     FTSLASLSERCLADFNTQDLVNTTWAFAKLGRYDAKLFVAARKSILDHRLNDLDAPNI
                     ANIVWTFDQASQLSEALFVALASAAEHQADNFNAQDLVNVAWTFANSGQVNDALFTAL
                     ARSVKRLMDEFSDEELNNLEWAFTTAGQHSVVKHLKQQRHGANNEKYGPPVDVSKCGR
                     VIIAGGGIGGAAAAVALQSKGFDVIVLESDESFDARAQGYGLTVQAQDAIQAMGVDIS
                     QDDAPSTSHYTFDAEGHIIGFFGEAFGAKSRERREVQNSGRFIHIPRQVLRSRIIEAV
                     QPGTIRWNSKLKSFVARENGVSVASTDGTELDGALLVGSDGIFSTVRRHLDLPGDRLN
                     YVGLCVVLGIVDEKIMNVPLAHRRIFETVDGATRLYAMPFTTTSTMWQLSFPCSEETA
                     RQYTKDATTLKEEIVRRCAQWHDPVPDLLRNTPLDCMSGYPVYDRELLDPVLLRPTDE
                     SKRRVTLIGDAAHPMTPFKAQGANQAMSDAVLLADTLVDGVRKHGPNSGFDFALPIFE
                     QKMLSRSSRMVVGSREKAKEMHSPLALQPARKAQREAEFDMQKTLRVLREKGIGAQNA
                     SDPRGLDDLIETEAISSPLDSTSDHTAIDWMEQGGGDSQGKKVVFEDSEADEDAPEAE
                     VKDKKRKTHEFKKEKKAKKAKKEKKEKKEKKEKDGKKSKL"
     gene            <443047..>443763
                     /locus_tag="OSTLU_26562"
                     /db_xref="GeneID:5004397"
     mRNA            <443047..>443763
                     /locus_tag="OSTLU_26562"
                     /product="predicted protein"
                     /transcript_id="XM_001420307.1"
                     /db_xref="GeneID:5004397"
     CDS             443047..443763
                     /locus_tag="OSTLU_26562"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420344.1"
                     /db_xref="GeneID:5004397"
                     /db_xref="JGIDB:Ost9901_3_26562"
                     /translation="MAPGVEMVRVERAERAYDREKALGRDAASVFPSLARDGDGAADG
                     DARKDDDDATRKKFVTESELERLRALGGSDGGDASGASDARNDDANAGKPLYQILAER
                     REEKDREFQEQWASMKVGKNKPLDEEEVEFLDEIESERRAAETKRKREEDGELEAFKR
                     AQRGDDQGGMTTTKGDGETATTSAPAAVVARKRPSAGVRAKPKTAIASETKETDDASE
                     GLGGLLGDYGSDSDDDIADS"
     gene            <444496..>446874
                     /gene="HMA3"
                     /locus_tag="OSTLU_13063"
                     /db_xref="GeneID:5004524"
     mRNA            join(<444496..444612,444700..>446874)
                     /gene="HMA3"
                     /locus_tag="OSTLU_13063"
                     /product="P-ATPase family transporter: copper ion; heavy
                     metal transporting P-type ATPase-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_001420308.1"
                     /db_xref="GeneID:5004524"
     CDS             join(444496..444612,444700..446874)
                     /gene="HMA3"
                     /locus_tag="OSTLU_13063"
                     /GO_component="membrane"
                     /GO_function="ATPase activity, coupled to transmembrane
                     movement of ions, phosphorylative mechanism"
                     /GO_process="cation transport"
                     /codon_start=1
                     /product="P-ATPase family transporter: copper ion; heavy
                     metal transporting P-type ATPase-like protein"
                     /protein_id="XP_001420345.1"
                     /db_xref="GeneID:5004524"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="InterPro:IPR006121"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="JGIDB:Ost9901_3_13063"
                     /translation="MLDVHGMHCGGCAASVRKILEGDDAVRSASVNLANESAMLAELV
                     TAAGFPTSLRDAGGVAVAGVTGAEATKLKRDERLRRIKESTQRVIVAWALASACLLGH
                     VSHFFHASAPWLRVLHSNPVHITLSLFAMAGPGRQILIDGWQSLRRGGPNMNTLVSLG
                     AMASFSMSTAAMMLPGLGWPTFFEEPVMLLAFVLLGRAVEERAKLQATSDMSALLNLV
                     PETARLVSSTSTANGDEPYYRTVPTSVIEVKDKIIVLPGDRIPIDGTVVSGCSTVDEA
                     AITGEPIPRPKKAGDTVAAGTVNCDGVLTIEVVSSGEETQVAGIVRMVESAQQREAPV
                     QRLADQVSGKFVYGVMAASAATFTFWSTVGTKVFPGVLATAASATNAPILIALQMTAS
                     VLVVACPCALGLATPTAVLVGTALGARHGLLIRGGDILEKANNLDTVIFDKTGTLTIG
                     KPVLTETRTSGGFSDAEIIALAGAVERNCRHPLALAITEAADKQGIPRHSVDEGTFKQ
                     EPGAGASAVVNKKLVSVGTTFYIQGNNTVPMELINAVDNPGRTPVYVGIDGKIVGVLE
                     MQDEIRKDAAETIKRLHAKNIQTIMISGDRLETAQAVGKLVGIDEKYVYGDVRPEGKA
                     ELVQDFQSKGKCVAMVGDGINDAAALAQADIGIAMAGGVGAASEVASIVLLGDRLPQV
                     GDAIDLSRATFNKIKQNLCWAFGYNLIGIPIAAGALLPAYGLSLTPSVAGAIMGFSSL
                     GVMGNSLLLKLKGRELSKAEEDD"
     gene            complement(<446950..>447738)
                     /locus_tag="OSTLU_26564"
                     /db_xref="GeneID:5004525"
     mRNA            complement(<446950..>447738)
                     /locus_tag="OSTLU_26564"
                     /product="predicted protein"
                     /transcript_id="XM_001420473.1"
                     /db_xref="GeneID:5004525"
     CDS             complement(446950..447738)
                     /locus_tag="OSTLU_26564"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420510.1"
                     /db_xref="GeneID:5004525"
                     /db_xref="JGIDB:Ost9901_3_26564"
                     /translation="MRTKTTKRFVVAHAAGKDNAVSELAAMDAVIDLMLASASEEELG
                     KIVVENVLMFDQKMWMRFASRSDTATESATKTKIMDTATKCMKLIEAMVEKTESTMEE
                     ASESLQRVVGAAADPSSGEFDVPLRADALERMRNELQAVTVDERTLNTLYAWIRKSDE
                     NGLDGMVHILQRLLQLYAARELDEKSSALDKVIRSNAEAWPTSFAEISNEGYNETAFA
                     KDLQRRMEGVVLNLPNGSYAQRVQAEYLKEIEDRGKEFFAQAQK"
     gene            <448037..>448849
                     /locus_tag="OSTLU_44289"
                     /db_xref="GeneID:5004398"
     mRNA            <448037..>448849
                     /locus_tag="OSTLU_44289"
                     /product="predicted protein"
                     /transcript_id="XM_001420309.1"
                     /db_xref="GeneID:5004398"
     CDS             448037..448849
                     /locus_tag="OSTLU_44289"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420346.1"
                     /db_xref="GeneID:5004398"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR010493"
                     /db_xref="JGIDB:Ost9901_3_44289"
                     /translation="MASTSKSPRDDPIWTSLRAGAQALVDKEPLMGGFVYATILNQPT
                     FERALGFLLASKIANATILAGQWNDLIMDAMNATNEGKNREYNGPGTGSIGDAARADL
                     KAIVERDPACPSYTHAFCFFKGFQGLQAQRVAHWLWGHQRKVLACKMQSLISEVYGMD
                     LHPAARFGRGIMIDHGHGVVVGETAVVDDDCTLLHGVTLGGTGKVRGDRHPKLGKRVV
                     VGSNASVLGNIKVGHDCKIGAGAALMHDLPPRTTVVGHKGRVVTKKQITSKL"
     gene            complement(<448943..>451909)
                     /locus_tag="OSTLU_17395"
                     /db_xref="GeneID:5004526"
     mRNA            complement(<448943..>451909)
                     /locus_tag="OSTLU_17395"
                     /product="predicted protein"
                     /transcript_id="XM_001420474.1"
                     /db_xref="GeneID:5004526"
     CDS             complement(448943..451909)
                     /locus_tag="OSTLU_17395"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420511.1"
                     /db_xref="GeneID:5004526"
                     /db_xref="JGIDB:Ost9901_3_17395"
                     /translation="MRPGRHFVDDPRCAREDMTKPRETTTTRARASSSSRPAIALGRP
                     VRAHVEPPPRTRAEARDGTRFPSEKLTRELVRRGYDEEKHREWRIARTVKTIDGKTTF
                     DDGTFMSPRALQEMLTRMATSETLKAIRANANEGAKETRRVPKRGRRDDGSYDVELRG
                     EALKTWSAPELVHARAEESAAFFRDLASDVGLHALERRVPHGVRKRNLFETLHGYNVP
                     IHRAMWMVKVNYLSQCKRDFDACRRAWTEDLLAHIFDVLRDEEMVAQSGEGVETELKY
                     VLALANYSVEEDLVDQQKYLHEFLRFMNEQKRQRTGSAHDFARALSPALRTLVPQASK
                     SHADSVGLVDRVSWCLQEILKERGQSDKYLVISLSDVVASVAAANMDAFVAAPRDGGL
                     NIITNLRRDFQRKKMPLSQRLCSVLDDVDNRVKSLAQAASPELITIKARNLIETLHKL
                     LESNLDQVASRTIARKYIDREESEELAMKSMVKTSCDWCMDVSEDEAMKRRTAVRIFF
                     VELAETSSRLNIYVFDWIKERTMIVAREDYTKCISELLIELLWGKVVDLSQLLNFIMV
                     EGIVEHKDSGASQKSLAAFREYMSQIVRNNDERESKLDDSMVRTLKQLLESANEMSDA
                     TISRALTPPHSTADVSKHFEISTDEEKRLLELFHAVTYADLLSKLEELKCVHDEFKCS
                     RDAHSVFSRVVVGALVLKPSRVRLLAELVGGIGDDVTTDVLSYVGGRVCDDANVDGVL
                     QGAYWDDSNAARRWEIAQSLVEFRLCLLHNIVKRKRDAAIGIVKGAIQQLKELALSTR
                     DVSHKLLLIWVQILTLIPLIGYVLMSNELKDDFLQLIVEVLDSFIGKTIVEESEEDLV
                     AESFAGESLVDRLIALFSVIWRSEVPQWLPAIPKLPFWDVSSKMVPMTEFIDSKTLAG
                     VVCVRLKRAIGGPARGKLGDVNAWKTLASGASTLSARSKISEKAEFWLQGTVRRPGGN
                     LAWENVSAEPNADHLK"
     gene            <452078..>453841
                     /locus_tag="OSTLU_17396"
                     /db_xref="GeneID:5004399"
     mRNA            join(<452078..452764,452798..>453841)
                     /locus_tag="OSTLU_17396"
                     /product="predicted protein"
                     /transcript_id="XM_001420310.1"
                     /db_xref="GeneID:5004399"
     CDS             join(452078..452764,452798..453841)
                     /locus_tag="OSTLU_17396"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420347.1"
                     /db_xref="GeneID:5004399"
                     /db_xref="InterPro:IPR000120"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="JGIDB:Ost9901_3_17396"
                     /translation="MEKTTEADELGAFVEAAEDLSERLTTTTTTTTTTTTHRPLKNVK
                     FVVKDIFDIEGRRCGFGSPAFKRTGGKGGTAGAKRHARCVRTLLEAGASAVGMTTMDE
                     LAYAINGENAHYGTPINPRARALVPGGSSSGSAVACAAALRGCEFALGTDTGGSVRVP
                     ASYCGVYGIRTSHGSVSMRGVQALAPSFDTVGWFARSIDVLQRVGDVLLPEPDKHAPT
                     EPSRWLLLEDACAAVAAVTALHEIAPADFKRMNLTEHLLVGCPKFRSLVNGREDYGLD
                     CLREMVRVLMGAEIWENLGKWYTEEKPKLGAAVKARMEAASKLDADEVERLKEVREEV
                     REEVDRILDGGAIFILPTTPGKAPKRGQSDQATESWRRKCFELLCIASLCGLPQVSIP
                     LEAPNIEGPQGLSLIAGYQMDKMLIGAARQIVPALVEAYPDILEAELERLNPPEAPGE
                     SEKTKGNEALKQGKYQDAIEYYSVAIGKNPKSKIFVANRAMAHLKLGNYQLAEDDCTE
                     AIKLDARYVKAYLRRAAARSVAGNYLEALMDYEEALRFEPNNSDAKREVYRMKKIIGM
                     ADPGMDVGDM"
     gene            complement(<453876..>456105)
                     /locus_tag="OSTLU_43956"
                     /db_xref="GeneID:5004527"
     mRNA            complement(join(<453876..453995,454056..454391,
                     454444..454758,454837..>456105))
                     /locus_tag="OSTLU_43956"
                     /product="predicted protein"
                     /transcript_id="XM_001420475.1"
                     /db_xref="GeneID:5004527"
     CDS             complement(join(453876..453995,454056..454391,
                     454444..454758,454837..456105))
                     /locus_tag="OSTLU_43956"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420512.1"
                     /db_xref="GeneID:5004527"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="JGIDB:Ost9901_3_43956"
                     /translation="METLREGRERGGGDASTSDARKANGAPTGAKREEIDRVRKSLPI
                     YRAKDRLMEEIRKSETVIIIGETGSGKTTQIPQYVYEDMTLTNGLMIGVTQPRRVAAV
                     SVSRRVADETGTAHGTLVGYAIRFEDVSSEETRIKFLTDGMLLREAVGDPLLSKYGVI
                     MIDEAHERTLQTDFLLGTIKGVQRRRRESLGEDQYGRALPPLRVIVMSATLEASSFSK
                     FFDGAPVIYSRGRTFPVEMFYTEEPEEDYLDAAMWTVLQVNEEEAAGDVLVFLTGQEE
                     IESLGRMLREKASELPSNVLKLNVVLLFAALPPEEQMKVFEPTPLGTRKVVLATNIAE
                     TSLTINGIRYVVDSGLSKLRTHHPRSGVDELLVTPIAQSQAQQRAGRAGREAPGKCFR
                     LYTEEIMPSLEKYVKPELLRTNLSGVVLQLKAMQVDDILSFPFIDPPPKEALLRSLEL
                     LYSLDALDDDGKLNDVGKKMARFPLEPMAARCVIAAEIEGCAIETLAVLSMLSTDSVF
                     QFSREADGQKNVARHKLKRKEGDHLTLLRVFNEFSACSPKRSRDWCREHQINHRAMTK
                     AVKINEQLTRAAMSQGINLTSCEDDFTLVLRSLVSGFFMNTASKEMDGSFKVFTTGQK
                     LTIHPSSVMFQSPPETILFNELVRTNKMYARDVSSIKKSWLSELASKTFSRRSTN"
     gene            <456546..>457265
                     /locus_tag="OSTLU_93468"
                     /db_xref="GeneID:5004400"
     mRNA            <456546..>457265
                     /locus_tag="OSTLU_93468"
                     /product="predicted protein"
                     /transcript_id="XM_001420311.1"
                     /db_xref="GeneID:5004400"
     CDS             456546..457265
                     /locus_tag="OSTLU_93468"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420348.1"
                     /db_xref="GeneID:5004400"
                     /db_xref="JGIDB:Ost9901_3_93468"
                     /translation="MWTIRRRLRTTRIASLTRDALARALATAPAGDDARGVVLRCALR
                     VDGGTASSTRARREGRVPGVVFAPGSERGTMITVCEREMNAAVRKHTLAGVACEVFDL
                     EVQTTTATGEESGETRRVRALAKQVQMHAYNQMVDNVCFLEVKPETEVKVRVPVATQG
                     EDVSPGVKRGGFVQIMRQTVPVRCRSDSIPKRFLMDVSTLDAGKVIKIGDVTVPEGVK
                     LLDADLNLPLVRIGGRVKSAE"
     gene            complement(<457349..>458800)
                     /locus_tag="OSTLU_44173"
                     /db_xref="GeneID:5004528"
     mRNA            complement(<457349..>458800)
                     /locus_tag="OSTLU_44173"
                     /product="predicted protein"
                     /transcript_id="XM_001420476.1"
                     /db_xref="GeneID:5004528"
     CDS             complement(457349..458800)
                     /locus_tag="OSTLU_44173"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420513.1"
                     /db_xref="GeneID:5004528"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR002867"
                     /db_xref="JGIDB:Ost9901_3_44173"
                     /translation="MIERAKALLDVRTEEAEALLSHFSYDFEAAATAWFEDTRKVRET
                     SGLIDAKTRRENSEAAMSSGGTRGCGICFEDFPGDALTTVGCAHEFCDECWSGWVTSK
                     VNDGLSVVNTRCPMCPAKVPESMIRKFLSDEDETKFDTFLRRSFLENNAKLRPCIGVD
                     CECAIAVEQLPTNPVSVKCNCGAEFCFSCQSEPHVPVNDCEVAKKWMDKINSDGVNSE
                     WMLANTKGCPKCHRPILKNGGCMHMHCSQCHCSFCWLCLGPWDSGPYACARRCNKYSG
                     DKTGDENRRKRARDSLERYVFYYERYRAHEDASKKAEQDVERFKDSVLDILIDLQRTS
                     KQQVVFIMDALRQVTECRKILKWTYAYAYYEFADDQSKKEFFEYIQGDMERCLELLSR
                     MIESDIKPFLPPEPEDDEQKQNVSPPSTLTDELQDGKYQYAPEKQESLENDFALYKAR
                     LIDTTAVLRKFTDTLVSEMAKGLLGARNIDKTD"
     gene            complement(<459185..>460131)
                     /gene="RPS19"
                     /locus_tag="OSTLU_44019"
                     /db_xref="GeneID:5004401"
     mRNA            complement(join(<459185..459535,460039..>460131))
                     /gene="RPS19"
                     /locus_tag="OSTLU_44019"
                     /product="Ribosomal protein S19, component of cytosolic
                     80S ribosome and 40S small subunit"
                     /transcript_id="XM_001420477.1"
                     /db_xref="GeneID:5004401"
     CDS             complement(join(459185..459535,460039..460131))
                     /gene="RPS19"
                     /locus_tag="OSTLU_44019"
                     /note="Cytosolic 80S ribosomal protein S19; Cytosolic 40S
                     small ribosomal subunit protein S19"
                     /codon_start=1
                     /product="Ribosomal protein S19, component of cytosolic
                     80S ribosome and 40S small subunit"
                     /protein_id="XP_001420514.1"
                     /db_xref="GeneID:5004401"
                     /db_xref="InterPro:IPR001266"
                     /db_xref="JGIDB:Ost9901_3_44019"
                     /translation="MATKNAPRTVKDVPAQEFVIALAQYFRSTGKMEVPQWVDTVKTA
                     TYKELAPYDPDWFYIRAASVARKLYTKGNMGVGALRKSYCGAGNKGVRRHHHQIGSGS
                     VARAVLKQLESIGVVEKDAKGGRRITPSGQRDLDRIAGRVSVPSF"
     gene            <460302..>460876
                     /gene="RPL29"
                     /locus_tag="OSTLU_26572"
                     /db_xref="GeneID:5004402"
     mRNA            join(<460302..460359,460652..460695,460805..>460876)
                     /gene="RPL29"
                     /locus_tag="OSTLU_26572"
                     /product="Ribosomal protein L29, component of cytosolic
                     80S ribosome and 60S large subunit"
                     /transcript_id="XM_001420312.1"
                     /db_xref="GeneID:5004402"
     CDS             join(460302..460359,460652..460695,460805..460876)
                     /gene="RPL29"
                     /locus_tag="OSTLU_26572"
                     /note="Cytosolic 80S ribosomal protein L29; Cytosolic 60S
                     large ribosomal subunit protein L29"
                     /codon_start=1
                     /product="Ribosomal protein L29, component of cytosolic
                     80S ribosome and 60S large subunit"
                     /protein_id="XP_001420349.1"
                     /db_xref="GeneID:5004402"
                     /db_xref="InterPro:IPR002673"
                     /db_xref="JGIDB:Ost9901_3_26572"
                     /translation="MAKSTNHTAHNQSYKNHRNGIKKPKRVGKPSTKGMDPKFLKNQK
                     FAKRGSLKAAGKK"
     gene            <461263..>462339
                     /locus_tag="OSTLU_26573"
                     /db_xref="GeneID:5004529"
     mRNA            <461263..>462339
                     /locus_tag="OSTLU_26573"
                     /product="predicted protein"
                     /transcript_id="XM_001420313.1"
                     /db_xref="GeneID:5004529"
     CDS             461263..462339
                     /locus_tag="OSTLU_26573"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420350.1"
                     /db_xref="GeneID:5004529"
                     /db_xref="InterPro:IPR006773"
                     /db_xref="JGIDB:Ost9901_3_26573"
                     /translation="MGDSVPNFFGGQGGGASGLSFGGGASFGADAGPLFEMKCGKLVR
                     DGAKMRADPRRGTLKIVKSEVDDTLKQIQWGVRDPSTAFEAEDDFIILPDEAVLKTMK
                     RDGCFMLAFIEERDRDMYFWSQESDGKDAMEAKLLKFNRAVNTNVGEALEENIAASEA
                     QTAMETGDAPNAVPSETPAATTLMPPPANVIPSPVDPTPAPTSFPAQTPAAPAKVSEG
                     MRTPASAGNFTPIVSSDALKGVFASLGGATPQTPPVGLPEILTPELVGPLLRDEQIRG
                     RLLEYLPEEHRETQDLEELIRTPQFRSQLETFSQALQSGEMDMAQFGLKQNGVANLET
                     FLKAIQAEVDESSGKNEEEDAMES"
     gene            complement(<462461..>462868)
                     /locus_tag="OSTLU_26574"
                     /db_xref="GeneID:5004530"
     mRNA            complement(<462461..>462868)
                     /locus_tag="OSTLU_26574"
                     /product="predicted protein"
                     /transcript_id="XM_001420478.1"
                     /db_xref="GeneID:5004530"
     CDS             complement(462461..462868)
                     /locus_tag="OSTLU_26574"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420515.1"
                     /db_xref="GeneID:5004530"
                     /db_xref="JGIDB:Ost9901_3_26574"
                     /translation="MRDADADGVSVRAETTTVDGTKTTKTTKTTKTTKTTRARGAQVE
                     NETVERGVQSERGGLVNAGVACADESDGDGEVLDDETFARALGGALRRCEEALTARRS
                     YGDVMEDEFARMRRYAEQNSLWTRLGAHRRAEG"
     gene            <463383..>464080
                     /locus_tag="OSTLU_17401"
                     /db_xref="GeneID:5004403"
     mRNA            join(<463383..463602,463706..>464080)
                     /locus_tag="OSTLU_17401"
                     /product="MC family transporter"
                     /transcript_id="XM_001420314.1"
                     /db_xref="GeneID:5004403"
     CDS             join(463383..463602,463706..>464080)
                     /locus_tag="OSTLU_17401"
                     /codon_start=1
                     /product="MC family transporter"
                     /protein_id="XP_001420351.1"
                     /db_xref="GeneID:5004403"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="JGIDB:Ost9901_3_17401"
                     /translation="MESTKMDAEALREKLVAVREKTQEAMKKIEVPKVEDLRMLIEDI
                     RQEQTEAKYHPDRRRLESVADFFAYTEEEGRKFFDEVDRSKKGKLTLDDLKFAMKKRN
                     LPQSYAKSFMEKAKGPKIFARTITWGDFQSVMNERESTMLRTFNSMSASRNGLLKTSD
                     VKQVLEGLGLAATDENARAMVRHLRGSSEYSRQGYVTY"
     gene            complement(<464245..>466433)
                     /locus_tag="OSTLU_25255"
                     /db_xref="GeneID:5004531"
     mRNA            complement(join(<464245..464273,465299..>466433))
                     /locus_tag="OSTLU_25255"
                     /product="predicted protein"
                     /transcript_id="XM_001420479.1"
                     /db_xref="GeneID:5004531"
     CDS             complement(join(464245..464273,465299..466433))
                     /locus_tag="OSTLU_25255"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420516.1"
                     /db_xref="GeneID:5004531"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR007708"
                     /db_xref="JGIDB:Ost9901_3_25255"
                     /translation="MKIAIEGCCHGELDAIYAAIAHLEVVEKVKIDLLICCGDFQAVR
                     NLDDLECMSVPDKYKELGTFYKYYSGEKTAPIPTLFIGGNHEASNYLWELYYGGYVAP
                     NIYYVGHSGVVNFGDLRIGGLSGIFKTHDYKKGHHERPPYSGHAVKTAYHVREFDVFK
                     LKQVKSEIDVFLSHDWPRGIAQFGNKHELFRKKKFLKDEIESNTLGSPPAEELLKRLK
                     PKYWFSAHLHVKYAALVKHEDEKTTKFLALDKCLPHRDFLQVIDLPEKSAEGGFALDE
                     EWLAILKANHEYHSVTHRPAQLPAYGTPEAIDLEPHKKWVSERLQAAGSSATVPPEFV
                     ATRPAYDPSSETRRKGRAPADVDVNPQTKALMDLLELDLKITTPRMHHTRRRR"
     gene            complement(<466615..>468948)
                     /locus_tag="OSTLU_44386"
                     /db_xref="GeneID:5004404"
     mRNA            complement(<466615..>468948)
                     /locus_tag="OSTLU_44386"
                     /product="predicted protein"
                     /transcript_id="XM_001420480.1"
                     /db_xref="GeneID:5004404"
     CDS             complement(466615..468948)
                     /locus_tag="OSTLU_44386"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420517.1"
                     /db_xref="GeneID:5004404"
                     /db_xref="InterPro:IPR006895"
                     /db_xref="InterPro:IPR006896"
                     /db_xref="InterPro:IPR006900"
                     /db_xref="InterPro:IPR007123"
                     /db_xref="JGIDB:Ost9901_3_44386"
                     /translation="MPGAASATGATSRIDPSQIPRPQYASHEERVTYNTRSEMDQATH
                     PPSATLEYVGCDLGSANPRYMRSTLSSLPNTGDLLTTSGMPLSIMTRPLALPHPEEAP
                     IHLIDNGKTGPIRCGRCKAYMNPYMRFLDHLRFECNFCYFVTEVPHEYMCNLGANGKR
                     TDWTERQELCRGTVEYVAPQEYMVRPPMAPTYLFLIEVTSQAIHSGVTTSACEVIMRT
                     LDSVPKDAQVGIATVDSAIHFYHLKDGAEKPSMLIVPDVEDSYAPLKSGLVVSLAKNR
                     EAIESLLKMIPETFSSTAPGPNASTAAIKAGIECLKPTGGKVMAFMATIPNVGLGKLE
                     ARTGTAGQRTGNIEKEPLKCMAPADKAYHTMATYAAEHQVCIDLFLCVSSAVDVATLG
                     VLPRLTGGSLYRYPGFNVQQDFAQLHNDLRWNFIRPQGLEAVMRVRASSGLGVQDYNG
                     FFCKRTMTDIDLPAIDSDKTIAVTLRYEDKLVDGREAYVQCALLYSTTSMERRIRVHT
                     IALPITSVLGALFRSADLDAQSDWAVRKAANALLSGNGTLASAKDASLQQCIATLFAY
                     RRFCASNNSSGQLILPEGLKTLPLYTLGLHKSYGLRSDASPDDRAAWLYRALHAPPEL
                     ATPAVYPRLFSIHDLPQDSSFPPIPPCMWLSSEKLNQDGAYLLEDGQEILIWIGRQLP
                     VETLRDLFGTENVDDIVSTRATIPNLDTPASKALNSFINAIRKQRGAFMRARILKRGD
                     TLEALFYNRLSEDRSPAGMSYVEFLCHCHRLIMNKSN"
     gene            <470096..>471388
                     /locus_tag="OSTLU_2890"
                     /db_xref="GeneID:5004405"
     mRNA            <470096..>471388
                     /locus_tag="OSTLU_2890"
                     /product="CaCA family transporter: sodium ion/potassium
                     ion/calcium ion"
                     /transcript_id="XM_001420315.1"
                     /db_xref="GeneID:5004405"
     CDS             <470096..>471388
                     /locus_tag="OSTLU_2890"
                     /codon_start=1
                     /product="CaCA family transporter: sodium ion/potassium
                     ion/calcium ion"
                     /protein_id="XP_001420352.1"
                     /db_xref="GeneID:5004405"
                     /db_xref="InterPro:IPR004837"
                     /db_xref="JGIDB:Ost9901_3_2890"
                     /translation="GGIFAYLVGVIYLFIGIAIVCDDFFVASLEKICEALGLSDDVAG
                     ATFMAAGSSAPELASSAMSLINSGTDNALGVGTIVGSAVFNILVIIGTTVIFAGQTLK
                     LDWKPLARDCSFYFAAIVGIVATFNGGRVNWWEGLIYVFLYCLYIAFMWKNVYFMKLL
                     DDKFGDYLGRPDAAVEMEEAAGGGLGAQSASKATTSAMSKELSFTGSIYVGFAAQRFK
                     AGLGNKQHRAKALSPGQLRAIRNATEKVTWSHHHVKHAPTEDGVASEDGDDETNPFVM
                     PAEWKDRPIWALSLPWYALFTISIPPCHNPKWEKWYFGSFLASIGWIGIISHFMVEWC
                     ARIGCLLKIPAIVMGTTVLAAGTSIPDALSSISVAKDGFADMAVANAVGSNVFDIWLG
                     LGLPWLLYLSWQKPSYITVSTTELLPSSLILLGVLILYV"
     gene            complement(<471572..>472243)
                     /locus_tag="OSTLU_26579"
                     /db_xref="GeneID:5004532"
     mRNA            complement(<471572..>472243)
                     /locus_tag="OSTLU_26579"
                     /product="predicted protein"
                     /transcript_id="XM_001420481.1"
                     /db_xref="GeneID:5004532"
     CDS             complement(471572..472243)
                     /locus_tag="OSTLU_26579"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420518.1"
                     /db_xref="GeneID:5004532"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="JGIDB:Ost9901_3_26579"
                     /translation="MDGVEIEGSPFEVFYSAPLDGPLVNERRARGVPLLARGEPAPAG
                     VCRDFLLGNCDRVICKFKHDVPPPPPPPPPGASGGDAVGVVNVPPPPVPEELRRTAHV
                     SNYPVGLTTEQVKQLFSFCGSIAECREGGPGKNFCFIEFESNKEALAACALNGMQVGG
                     RNLRVELAKTPKLLNPRSFSLAPAPAKVDIDAKAAQSEAAARAAAISARLAAKGGSSV
                     RHKPY"
     gene            complement(<473735..>474522)
                     /locus_tag="OSTLU_26580"
                     /db_xref="GeneID:5004406"
     mRNA            complement(join(<473735..474040,474094..>474522))
                     /locus_tag="OSTLU_26580"
                     /product="predicted protein"
                     /transcript_id="XM_001420482.1"
                     /db_xref="GeneID:5004406"
     CDS             complement(join(473735..474040,474094..474522))
                     /locus_tag="OSTLU_26580"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420519.1"
                     /db_xref="GeneID:5004406"
                     /db_xref="InterPro:IPR003657"
                     /db_xref="JGIDB:Ost9901_3_26580"
                     /translation="MATTTTHGTRVYDDDAGDRPRRSYPHSTSRSTTTVAAHAPSSAH
                     ADGYRWRKYGQKNIKGSSFPRSYYRCTERGCPARKKTELRRASEDGEMETVVCYEGEH
                     THAKPSGGGGRAETLAPGSTKSFGTRASGDSTATNARRGTTRFHDVCGGGGGGGKSSS
                     GQATESDAEDSAASEEDSTRTAVEHDETEALGVRKIAKWSSITDDVQRIRTVRARAPR
                     ILVQRRRGEEAETRRESAEPVVRRHG"
     gene            <475291..>475959
                     /locus_tag="OSTLU_17407"
                     /db_xref="GeneID:5004407"
     mRNA            <475291..>475959
                     /locus_tag="OSTLU_17407"
                     /product="predicted protein"
                     /transcript_id="XM_001420316.1"
                     /db_xref="GeneID:5004407"
     CDS             475291..475959
                     /locus_tag="OSTLU_17407"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420353.1"
                     /db_xref="GeneID:5004407"
                     /db_xref="JGIDB:Ost9901_3_17407"
                     /translation="MSDGAMRPWFLRDEDRRRSLVYGVGAVAFALLGLVVTTGSRTEY
                     KVVAYKPSLYEHVGSHQVKAHYDIYPDTHDIHQADHPSEDPADPEEELVYKYNGKHVS
                     SANENRIRALYSPSGSSFIDVVKREGVDDATIFETCLYPTVTAEFRTYYGHDLTIEPD
                     TTSKDLGKPVNQVEAHQFGCVWEKLLNKLAESNWKFVTSETIMTEKTFYEMHMITFSR
                     KKTT"
     gene            <476665..>476886
                     /gene="RPL38"
                     /locus_tag="OSTLU_17408"
                     /db_xref="GeneID:5004533"
     mRNA            <476665..>476886
                     /gene="RPL38"
                     /locus_tag="OSTLU_17408"
                     /product="Ribosomal protein L38, component of cytosolic
                     80S ribosome and 60S large subunit"
                     /transcript_id="XM_001420317.1"
                     /db_xref="GeneID:5004533"
     CDS             476665..476886
                     /gene="RPL38"
                     /locus_tag="OSTLU_17408"
                     /note="Cytosolic 80S ribosomal protien L38; Cytosolic 60S
                     large ribosomal subunit protein L38"
                     /codon_start=1
                     /product="Ribosomal protein L38, component of cytosolic
                     80S ribosome and 60S large subunit"
                     /protein_id="XP_001420354.1"
                     /db_xref="GeneID:5004533"
                     /db_xref="InterPro:IPR002675"
                     /db_xref="JGIDB:Ost9901_3_17408"
                     /translation="MRKQPKEISEIKDFLHTARRKDARSVKIKKTAGVTKFKVRCSKY
                     LYTLCVKDSDKASKLKQSLPPGLQVMEVA"
     gene            complement(<477054..>478227)
                     /locus_tag="OSTLU_26583"
                     /db_xref="GeneID:5004534"
     mRNA            complement(join(<477054..478001,478117..>478227))
                     /locus_tag="OSTLU_26583"
                     /product="predicted protein"
                     /transcript_id="XM_001420483.1"
                     /db_xref="GeneID:5004534"
     CDS             complement(join(477054..478001,478117..478227))
                     /locus_tag="OSTLU_26583"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420520.1"
                     /db_xref="GeneID:5004534"
                     /db_xref="InterPro:IPR001564"
                     /db_xref="JGIDB:Ost9901_3_26583"
                     /translation="MRTESRLGFQAVWVDPAQDFERAFTLFYYPEDGDVELIEDKRKK
                     AFLRKCAPETPIALDELFIGATVTIWSRRLTVRGYADERTATAMKTKREESFALVSSE
                     NVCRIGRIVHAMQENGLTIAEMKTVAFGTSRLEELETALPRNARALASGTSCAIRAIG
                     CEANAILARLFAHTNDVVRSMDEEHARALGELATGSSSKSPTEHSSLVVVKPSGMAHL
                     GAILDFLCEKKGLDLIQARTLALTRLEAEAFYAVYVDVLDKEEVKMMIDELSCGACVA
                     LQLSRLRSPETLVDDIREIVGPRDPEIARVLRPESLRARFGEDKQRNAVHCADLTEDG
                     ELEVDFMFNLPRRTSVVA"
     gene            complement(<478345..>479673)
                     /locus_tag="OSTLU_26584"
                     /db_xref="GeneID:5004408"
     mRNA            complement(<478345..>479673)
                     /locus_tag="OSTLU_26584"
                     /product="predicted protein"
                     /transcript_id="XM_001420484.1"
                     /db_xref="GeneID:5004408"
     CDS             complement(478345..479673)
                     /locus_tag="OSTLU_26584"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420521.1"
                     /db_xref="GeneID:5004408"
                     /db_xref="JGIDB:Ost9901_3_26584"
                     /translation="MPATAARVDARLARPSRARSTRARRASTRRAVADADARGTTTFD
                     PASTLRHARVDVGAHGRGLFVTGTGSALVSVAIDALVCAPAAVGEGAEGRAATAIRET
                     YREGWRRHFGVDVPECLIEFVISAPFAKDVRLAAMLAWAVKNAEAWRAYGAEVVPAAF
                     DCGYLANEEELEMLQDAEIRVMAERSKAGYEATWNAAMEAFPDVKAALGTSSEDELRW
                     CRSWVHTRAISGKLGDADCAFLAPTIDLANHRVESTAKYGVSADGKNFELTWNEDSIE
                     GPTPVANTEVFISYGDRMNNALLMLHYGFIDDENRNERLPMEFIAPGARRVHGSRVAD
                     ACKALDDAGDKAAALAGSNLLMVASRGPPPGVADAPAPPETDPEVIQALRQAVDSYLS
                     ACPTTLAEDEALLASAEAASLSPRALLAVRYRASRKRAAEAYLRFLSILK"
     gene            complement(<479862..481138)
                     /locus_tag="OSTLU_26585"
                     /db_xref="GeneID:5004409"
     mRNA            complement(<479862..481138)
                     /locus_tag="OSTLU_26585"
                     /product="predicted protein"
                     /transcript_id="XM_001420485.1"
                     /db_xref="GeneID:5004409"
     CDS             complement(479862..481082)
                     /locus_tag="OSTLU_26585"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420522.1"
                     /db_xref="GeneID:5004409"
                     /db_xref="InterPro:IPR008551"
                     /db_xref="JGIDB:Ost9901_3_26585"
                     /translation="MCVAFIALVRTTSANAPIKLLVAFNRDEDYARPTKACAAWPSER
                     DDEAYEIFGARDELGGGTWFAMCRKTGRWGLVTNAANGTTTTTTTTTNGGTTKSPKKT
                     VSAYVTRGMLVTDYLKSPEIDSGKYAMEVFAKRMRFDGFNLVVGDASRGTAHYVGNRG
                     SANAETPMELRAGRVYGLANDVLDAPWPKVVRGKAKLEEILRAYSRYSADALPTRALE
                     EQVLRDVLHAPLDARPLAIDAAERLSYSSSDRDAPAPSAAARELWRHQQSFVAGGRRR
                     ESHVDCDDDVDASIDIDVDEDDEEDEEFVVEQIEACESERSFVRPGELPGLPNCGTRT
                     SQVVLVSADGRCSWCEHHFVPVLPDRRRARRPAAVARASAAAPDAFLVAALERASHAF
                     VIPAVAPRPRTPIA"
     gene            complement(<481337..>482779)
                     /locus_tag="OSTLU_93472"
                     /db_xref="GeneID:5004410"
     mRNA            complement(<481337..>482779)
                     /locus_tag="OSTLU_93472"
                     /product="predicted protein"
                     /transcript_id="XM_001420486.1"
                     /db_xref="GeneID:5004410"
     CDS             complement(481337..482779)
                     /locus_tag="OSTLU_93472"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420523.1"
                     /db_xref="GeneID:5004410"
                     /db_xref="JGIDB:Ost9901_3_93472"
                     /translation="MTTTTTATTATTATRGRGRRALSTTTTTATRARGRGATARAARF
                     EREGGFRRRRGRANARTDGATSEDGEEEGRTFLGRTGRRTGDAESIAKNYAEKEAETL
                     AKSAGRQYAFGKPQSPKETWEPFAREARMGLVEEYRRGAKGDAVTASMHLAVEDDAVQ
                     GRTSVCLPREAYTKRMDKLVNEFVQRDLSYMSAEDKADADKMIEAVERYLFEEQQYRT
                     PTGWREAFSPYRTYFHNVIAQKVGIPATLAAIYIGFLERLKAKGELDACGDIKVLLRV
                     RRGADPTPRRPQGIKASDAAPDGSVVCTPDMVVRMQLMALKRAFWPWEWDDSRDSGFL
                     LAVEAAAYGKDDRMNTAAGVVGIIQPTGRPFGDLQMALLVTERLAELDENVGYEQRDM
                     GVLLYHSGYRRDALDALVAFENWKATTKLAAVEIDDSSSYSINAPTPDFAWESGDPVE
                     AARLALREDEALAKVILELNRDVLERQFDV"
     gene            <483314..>485488
                     /locus_tag="OSTLU_26587"
                     /db_xref="GeneID:5004411"
     mRNA            <483314..>485488
                     /locus_tag="OSTLU_26587"
                     /product="predicted protein"
                     /transcript_id="XM_001420318.1"
                     /db_xref="GeneID:5004411"
     CDS             483314..485488
                     /locus_tag="OSTLU_26587"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420355.1"
                     /db_xref="GeneID:5004411"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="JGIDB:Ost9901_3_26587"
                     /translation="MLASTNSFRAPRAGTKAALEVHVSTWNVGNKAPRADAASGWLRD
                     ARRSDIVAVGAQEASYVKTRKTIKPVAVSAACGDEANFKSRFRKGFFKSTKWTRVGMV
                     AGGAFAGGVMAAPVAPMGVMCGMFTGWFASKRLVQEIKVRIHWFDFLHSALGHEFELL
                     QTQILLQMRLAVFVKKELVPRIRSVKVGSKATGLGNLVGNKGGLLVHIELENGETIAF
                     LSCHLAAHEQPKYLEARNHMVHEILEGTWIDCVEKPKCALPVVTDVNSALFDAGSEMI
                     NKMKGTSRQVYERTSDAFQGATGARLAIGSGMAPRKNQAPELLDVATHVFFFGDLNYR
                     LDPGKVVGNEWDTHWDKTAPEMTSTKLANKYDVDKVPLSKFPAARPVAQPGMIEEESD
                     DEITESSPFQIGRTAVIESVGAQEFDQLVKADQLIKSMKEGKVFANFHEMPLKFFPTF
                     KRASNNLKDGKGKKAPAQEQSVAEPGSAEYYNEKRVPSWCDRVLVHSLTGAKDSCSPL
                     EYGARHDVTTSDHAPVYARFRVRLRDLPPLKALPRAKLTLTNLSVTRNTIEDDFRGSS
                     VYVHLFVPHTRTVVPEAREVSSGHVARDESQPKTIGKYTFSGDVLPSCIVGYDAADEV
                     TFAEQEKAAARFALLTTEERIALKENEDAEKSEELPTPVGMDAYGKFVGIITLVDSRY
                     GDKLGTCTVLLPSKGSSSFDVPLLLRSANVGRIKGSWELSSI"
     gene            <485594..>486451
                     /locus_tag="OSTLU_44281"
                     /db_xref="GeneID:5004535"
     mRNA            <485594..>486451
                     /locus_tag="OSTLU_44281"
                     /product="MC family transporter: 2-oxodicarboxylate"
                     /transcript_id="XM_001420319.1"
                     /db_xref="GeneID:5004535"
     CDS             485594..486451
                     /locus_tag="OSTLU_44281"
                     /codon_start=1
                     /product="MC family transporter: 2-oxodicarboxylate"
                     /protein_id="XP_001420356.1"
                     /db_xref="GeneID:5004535"
                     /db_xref="InterPro:IPR001993"
                     /db_xref="JGIDB:Ost9901_3_44281"
                     /translation="MPLRAHEEITAGFLAGCADALACHPVDVVKTQAHVNRGANVPFT
                     QALVAQARAHGLPSLYRGVLPACLRPQALCMYVGYEWSKKAVCEDAKKMTTREAFVAG
                     WLTAYVESACVTPFETVKVRMQTKENMSRYASSLGCAREIARTEGMKGLYAGFWPTCL
                     RNNVFNSFYFGTIHYCKDEYLSAPDSLVEQAAQNVGVGIIAGLVATVFKMPFDILKSR
                     MQGQVPNASGALEYPTMMEAAVRIFRNEGVGAFYKGTGVTAARITLGFPVSFVAFEAV
                     ASMFENEIR"
     gene            complement(<486544..>488019)
                     /locus_tag="OSTLU_88658"
                     /db_xref="GeneID:5004536"
     mRNA            complement(<486544..>488019)
                     /locus_tag="OSTLU_88658"
                     /product="predicted protein"
                     /transcript_id="XM_001420487.1"
                     /db_xref="GeneID:5004536"
     CDS             complement(486544..488019)
                     /locus_tag="OSTLU_88658"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420524.1"
                     /db_xref="GeneID:5004536"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="JGIDB:Ost9901_3_88658"
                     /translation="MAALQAAPDALAHRYGDAEMVQSKEITGRAWTRVDALNETLKDR
                     EVLLRGRVHNVRGKGKSAFIVLRQQTATVQVTLFVDDVNVSKGMVKWASALARESVVD
                     VKGLVVHPEVPIESCTQKEVEVVCREIHCISRSDPELPFLIEDASRPDSAFEAEDTQF
                     VRVLQDTRLNNRVMDLRTPANNAIFKIQSGVGTLFREALLRRNFTEIHTPKLIAGASE
                     GGAAVFKLDYMQVGPACLAQSPQLYKQMAIMGDLEGVFEIGPVFRAEDSNTHRHLCEF
                     TGLDMEMTIKEHYDEVLDVLDELFVSMFDGLNERFKREIGVVNEQHPFEPLQYCRPSL
                     RLTFEEGVKMLQEAGEEVDPLGDIGTETERVLGRLVKEKYGTDFYMLTRYPLNARPFY
                     TMPAPDDPNYTNSFDIFIRGQEIISGAQRIHDPKLLAERAEACGIELPTIQPYIDSFK
                     YGAMPHGGCGVGLERVAMLFLNLPNIRKTSMFPRDPKRLTP"
     gene            complement(<488410..>489927)
                     /locus_tag="OSTLU_17414"
                     /db_xref="GeneID:5004412"
     mRNA            complement(<488410..>489927)
                     /locus_tag="OSTLU_17414"
                     /product="predicted protein"
                     /transcript_id="XM_001420488.1"
                     /db_xref="GeneID:5004412"
     CDS             complement(488410..489927)
                     /locus_tag="OSTLU_17414"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420525.1"
                     /db_xref="GeneID:5004412"
                     /db_xref="InterPro:IPR001206"
                     /db_xref="JGIDB:Ost9901_3_17414"
                     /translation="MATVDAVARVATTGRGRATLVLGDGTRVVRVEDVVRVEVRRRRR
                     RHRHHRDEDDDARTLAVTAIARRRGFPGISTRKRSARRLKTHETACATAAVANEARTR
                     CAEACGLDDADASGTARERRRRVLVIVNPRSGRGEGTKIWETKARAVLEAANIECATR
                     TTKARGEATNIARELDASLYDGVVAVGGDGTVAELFQGLSEREDREEIYAKMPIGIVP
                     AGSGNALCKSIQHAGGEPCDPVSCALTIARWRTRALDRSEVRFQDSKTASGWGDDSKV
                     THSLLSTSWGFFSDVDIESERFRFLGGARFTLQAIVRILARRKYQCELLYETTEEGEA
                     YNAQHCDGPHGEPVPGRPGWRRVAGDVLGLWALNVPWGTESTLAAPHAKFDDGSIDVV
                     LVNVTNRKNMLKLLLDFDAGDHARNRAVRYIKAKSFEIYPAAAAAAAATAAAIVDASS
                     ETNATAPGGGGYIAVDGEVLASRRFRAAAAAAFPYGPFRCDVIRAACAVFAPPSA"
     gene            490220..>490851
                     /locus_tag="OSTLU_26591"
                     /db_xref="GeneID:5004413"
     mRNA            490220..>490851
                     /locus_tag="OSTLU_26591"
                     /product="predicted protein"
                     /transcript_id="XM_001420320.1"
                     /db_xref="GeneID:5004413"
     CDS             490486..490851
                     /locus_tag="OSTLU_26591"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420357.1"
                     /db_xref="GeneID:5004413"
                     /db_xref="JGIDB:Ost9901_3_26591"
                     /translation="MPMRAIADAIGDAFGPALDAIAEERRRRGEARRDGGETEDETEA
                     GLYVPDIPAFLCATRLARDSPMVRSVLVVDERAPRTKPRLSWYDVDDEGWAPRGWWED
                     GVKADFAYYFGERRESSTR"
     gene            <492403..>492630
                     /locus_tag="OSTLU_26592"
                     /db_xref="GeneID:5004419"
     mRNA            <492403..>492630
                     /locus_tag="OSTLU_26592"
                     /product="predicted protein"
                     /transcript_id="XM_001420321.1"
                     /db_xref="GeneID:5004419"
     CDS             492403..492630
                     /locus_tag="OSTLU_26592"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420358.1"
                     /db_xref="GeneID:5004419"
                     /db_xref="JGIDB:Ost9901_3_26592"
                     /translation="MDVSGVGESAGGETGAAAAAAAAAAAPARTPRKKYEDVDESELV
                     PGTTLPDGRVVVEDWKGDPMVLNPGDRMPRF"
     gene            complement(<492790..>493605)
                     /locus_tag="OSTLU_17416"
                     /db_xref="GeneID:5004420"
     mRNA            complement(<492790..>493605)
                     /locus_tag="OSTLU_17416"
                     /product="predicted protein"
                     /transcript_id="XM_001420489.1"
                     /db_xref="GeneID:5004420"
     CDS             complement(492790..493605)
                     /locus_tag="OSTLU_17416"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420526.1"
                     /db_xref="GeneID:5004420"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="JGIDB:Ost9901_3_17416"
                     /translation="MTDIMRTPTSTPTSTTSRERDSIFSSSPPLSRASVGSASSEEAA
                     EMLADAIRDGLLFATPKATSGGRGLVMKTPGSVKTPRYAYGESDCAVCQSPLDRTRPE
                     ASDNPDKVELVTGLTCRHVFHRCCLVQCREHNIQKCPTCQAPLPRGFTPENVREEREK
                     HRIRDRIIARSRRATDAIRLARARAIANGTLSPGMGSMSDSARTPGTPGMVSLSQDTG
                     TDAYDAGLPPRAPRFAAEREASSSSRAHPYSPLTRSPTSESGGDDEFFITMTQ"
     gene            complement(<493850..>494467)
                     /locus_tag="OSTLU_26594"
                     /db_xref="GeneID:5004414"
     mRNA            complement(<493850..>494467)
                     /locus_tag="OSTLU_26594"
                     /product="predicted protein"
                     /transcript_id="XM_001420490.1"
                     /db_xref="GeneID:5004414"
     CDS             complement(493850..494467)
                     /locus_tag="OSTLU_26594"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420527.1"
                     /db_xref="GeneID:5004414"
                     /db_xref="JGIDB:Ost9901_3_26594"
                     /translation="MGASARDGDDAGDGVRDDGDDANDANDEEEEEEDFVGACRVCLF
                     DVTREDIRDARAVRLGCACVSGVVHVDAECLEAWVLRAPRKSADCEICLERMTNVPTR
                     AELRKERRLRREKYRARTVSSSSSASARDDDARDDDARARDLEIGAERIGDVSRGERC
                     CLYACAPLACAYAIVHAFCAHRSCVFAFILLAIGVAVLTRVSILL"
     gene            <495479..>497158
                     /locus_tag="OSTLU_1511"
                     /db_xref="GeneID:5004415"
     mRNA            <495479..>497158
                     /locus_tag="OSTLU_1511"
                     /product="predicted protein"
                     /transcript_id="XM_001420322.1"
                     /db_xref="GeneID:5004415"
     CDS             <495479..>497158
                     /locus_tag="OSTLU_1511"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420359.1"
                     /db_xref="GeneID:5004415"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="JGIDB:Ost9901_3_1511"
                     /translation="SFEECGLPASMVKHLMENVGFGAPTAVQAKTIPRLLAGRDVLVR
                     AETGSGKTLSYIAPLYSKIGGITPRVTREEGTRGLVLVPTRELATQVEDTARRVGRPF
                     HWVVTSSIMGGENRAKEKARLRKGVSLLIATPGRLLDHLRMTESFNVDNLRWLVLDEA
                     DRLLDLGFEEDLNAILNEIGRRTEGASLCTALLSATLTPGTARLAERMTDPVTIVVEP
                     EKDDLEIVGADGSDDEEGGTMDVDGLKRMAKIMAGGERVRMPEGLNHTVVEVSMKARL
                     PALAGLLAGWMQGSISKAIVFFSSCESVEYHYKTLRWLAAGGKGKVKDDDDSIQGPYE
                     IFRLHGLLSQGDRASVFRNFANTKAGVLLCTDVGARGLDFVGVGATVQVDAPTDATTY
                     IHRVGRTARLGSEGEAVLFLQPKEREFAEVLTEKGVNFANGSVVAMLDVLEDSKDASE
                     RDKSMFKSMPHLHPASQRMLKKLVAKVASDKQYDVLAKDAFRAHVRAYATFPSAFKHI
                     FHVKRLHLGHVAAAFGLKDAPQLIGASATKAALKAQKDAARKKSNVDARRKK"
     gene            <497716..>498405
                     /locus_tag="OSTLU_6595"
                     /db_xref="GeneID:5004421"
     mRNA            <497716..>498405
                     /locus_tag="OSTLU_6595"
                     /product="predicted protein"
                     /transcript_id="XM_001420323.1"
                     /db_xref="GeneID:5004421"
     CDS             <497716..>498405
                     /locus_tag="OSTLU_6595"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420360.1"
                     /db_xref="GeneID:5004421"
                     /db_xref="InterPro:IPR001727"
                     /db_xref="JGIDB:Ost9901_3_6595"
                     /translation="TILGSCVLMGLILYISLDLGSTTFVNNAWQKVVNATAKSGFTAA
                     FALIFVSELGDKTFFIAALLAMRLGRLRVLVGATSALAAMTVISVAIGRAFQRLPSSL
                     MTTLPVGEYAAVAMLLFFGIKTLRDALSMDPSGATPEDHGELAEATEVVCKSTSAQKR
                     SPGLAALIETFSLIFIAEWGDRSMLATVALGAAQNPVGVAFGASLGHFIATSIAVVGG
                     SLLSKRISERTV"
     gene            complement(<498547..499510)
                     /locus_tag="OSTLU_26597"
                     /db_xref="GeneID:5004422"
     mRNA            complement(<498547..499510)
                     /locus_tag="OSTLU_26597"
                     /product="predicted protein"
                     /transcript_id="XM_001420491.1"
                     /db_xref="GeneID:5004422"
     CDS             complement(498547..499233)
                     /locus_tag="OSTLU_26597"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420528.1"
                     /db_xref="GeneID:5004422"
                     /db_xref="InterPro:IPR002610"
                     /db_xref="JGIDB:Ost9901_3_26597"
                     /translation="MAKYAGDAARGAARAAKGALRGAGPSRRTAAYDGVFALLFINFA
                     LFACDHWAHMAFVKTLYLNHAKPTWWQFATSTFCHANWAHLSSNIFFLYIFGKLVEEE
                     EGAFGVWMSYLVTGIGANVASWLLLPKSVGGVLGIGGAATVSLGASGAVFGLFAVSVL
                     VKLSWNWRRLLEVVILGQFVVDRFLSEAKMVAAAGSGVGAGNVNHVAHLGGAFAGVLL
                     IFFLTRMVPP"
     gene            <500237..>501334
                     /locus_tag="OSTLU_2831"
                     /db_xref="GeneID:5004416"
     mRNA            <500237..>501334
                     /locus_tag="OSTLU_2831"
                     /product="predicted protein"
                     /transcript_id="XM_001420324.1"
                     /db_xref="GeneID:5004416"
     CDS             <500237..>501334
                     /locus_tag="OSTLU_2831"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420361.1"
                     /db_xref="GeneID:5004416"
                     /db_xref="InterPro:IPR001015"
                     /db_xref="JGIDB:Ost9901_3_2831"
                     /translation="KVGVLLLNLGGPETLDDVQPFLYNLFADPDIIRLPPPVQFLQGF
                     LANTLSASRAPKSREAYESIGGGSPLRRITEDQANALQAAMQARGIQAKTYVGMRYWK
                     PFTEDAIDAIKRDGVTRLVVLPLYPQFSISTSGSSLRLLEQYFAEDEELASVRHTVIP
                     SWYQRPGYVKAMAVMIAQTLKTKFEDDKEPLIFFSAHGVPVSYVEQAGDPYKDEMEAC
                     VRLITEELGSMGVNNEHVLAYQSRVGPVEWLKPYTDDTIRELGKKGTEALCAVPISFV
                     SEHIETLEEIDMEYRELAEESGIKKWGRVPALDTDPLFIDDLADAVIEALPYTTRMSK
                     TRASASGLNVPPAEVGELLASYDRAKLAIPVP"
     gene            <502172..>503407
                     /locus_tag="OSTLU_44068"
                     /db_xref="GeneID:5004423"
     mRNA            <502172..>503407
                     /locus_tag="OSTLU_44068"
                     /product="predicted protein"
                     /transcript_id="XM_001420325.1"
                     /db_xref="GeneID:5004423"
     CDS             502172..503407
                     /locus_tag="OSTLU_44068"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420362.1"
                     /db_xref="GeneID:5004423"
                     /db_xref="InterPro:IPR002036"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="JGIDB:Ost9901_3_44068"
                     /translation="MSHCELSVALCSDEYIRSLNAGYREKDSATDVLSFPAESFGPMA
                     VLGDVIVSVDTASAQAREVGHSLRDECRVLLVHGTLHLLGMDHEVSESEAEVMAAAEQ
                     EVLKALGWKVTGLTRRASGESTSDSSSTTLTTQRSVLVTDLDGTLLNENSVITPRVAD
                     ALRRAMASGVEVVVATGKARPAAIKAAATQGLDGIIVGKNTPGVFLQGLEVYGRGGAL
                     VYEAKMPEDVTRDAFMMMDDVVHDGLALTAFCGDNCATLAPSVLLDELHHTYHEPASE
                     IAGSVDEILSNNTVRKLLLMGPSKESIDGVRSIWEAAFRGRAEVTQAVADMLEILPLG
                     NDKSKGVRAVLKSMDVNPMTDVVAIGDGENDAEMLRFVGCGVAMANATEKTKSGAAHV
                     LDASNTQDGVAEAIDRFVL"
     gene            <503692..>504678
                     /locus_tag="OSTLU_44226"
                     /db_xref="GeneID:5004424"
     mRNA            <503692..>504678
                     /locus_tag="OSTLU_44226"
                     /product="predicted protein"
                     /transcript_id="XM_001420326.1"
                     /db_xref="GeneID:5004424"
     CDS             503692..504678
                     /locus_tag="OSTLU_44226"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420363.1"
                     /db_xref="GeneID:5004424"
                     /db_xref="InterPro:IPR000209"
                     /db_xref="JGIDB:Ost9901_3_44226"
                     /translation="MRFARLFAVFADDKEVNALRTCVPALDFEEDVEVFSQGVTTWSR
                     DRLNGRDGLDGKLLPRDPPEDGYGSIVHVYLLDTGVRRTHVEFKDQAFGRGVDLVDDD
                     AEPDDCDGHGSHVASTINQIAYSGKTVLHSVRVLDCNGNGELSGLIEGLEWVLGVATP
                     SEPAVVSLALGVRNGIWSRALERVVQTLTGRGVFIVCAAGNQKGDACTISPGNVAETL
                     TVAASDQADAPYAYGNSGRCVDLFAPGVQILGACGGSTACEHPSDTAYAFQSGTSMAV
                     AHAVGAATRLLMFSPRMSPENLKKHLTSTASRDKIRGGSLLPGTPNLLLYVK"
     gene            complement(<504747..>505523)
                     /locus_tag="OSTLU_26601"
                     /db_xref="GeneID:5004425"
     mRNA            complement(<504747..>505523)
                     /locus_tag="OSTLU_26601"
                     /product="predicted protein"
                     /transcript_id="XM_001420492.1"
                     /db_xref="GeneID:5004425"
     CDS             complement(504747..505523)
                     /locus_tag="OSTLU_26601"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420529.1"
                     /db_xref="GeneID:5004425"
                     /db_xref="JGIDB:Ost9901_3_26601"
                     /translation="MSRIVAVASPTPSTAPRTTLRRRDTFIAPLLASCLVRPARASLV
                     DETSATRVFAETSKSVARVAVVAPNGEISGRGSGVVWYIDDAYAYIATNAHCVVKGNE
                     NEKLVVMLASGAAAALDKDASYFVNRSTDIGFLKVPIGSFGADAPVAAKIGTSDNLRV
                     GQSAFSLGFEEDGAAVLSSGTINGLKRKIPSRNGVGLKGLIQTDAQVTEFTSGGALCD
                     SAGRVIGLNVVAYAGSQKRDPQGVNFAIPIDAVRLAAEQM"
     gene            complement(<505619..>509131)
                     /locus_tag="OSTLU_25262"
                     /db_xref="GeneID:5004417"
     mRNA            complement(join(<505619..507492,507817..>509131))
                     /locus_tag="OSTLU_25262"
                     /product="predicted protein"
                     /transcript_id="XM_001420493.1"
                     /db_xref="GeneID:5004417"
     CDS             complement(join(505619..507492,507817..509131))
                     /locus_tag="OSTLU_25262"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420530.1"
                     /db_xref="GeneID:5004417"
                     /db_xref="InterPro:IPR002656"
                     /db_xref="JGIDB:Ost9901_3_25262"
                     /translation="MMKFIVRRPRDDVNERTVAEDKIEMTAAESHGDAAGESQPNPRA
                     EMVDQSPDEASGGAPVVAQRVLNVDEIDTSAITGLRAITALQIACGHWLLFYGNSESP
                     YLDFQGGVAVSIFFLITGFVMYIAYHEKVEKQGFKYWEFIKRRYIRVLPLHWFALAWF
                     APFLAFNYRTIVADYNFWQNKSGEVNLIMGIVLTPLLMQSWIFSLCYWNSVCWSLSCQ
                     LGYYFCFPWLTRKLNALVRKFEEKAAIDFPIADDLENKSSTESSRFDSVQKSCRKYLM
                     YAYHASYMAPLGVMGAVNSPAFRNVWRDANFESRAHVVVTALDGDMDGMRAYFCGRAW
                     FPVRIPLFFMGMLVGAMRLRLARRGVTPQTERFWAKFTDYFSLGFASWLIGSVITSGL
                     VADSKNVRIFNEFFLTAPCAFWLYGLTVTRKSYTVQVLRNPVAQAIGHTSSDAHGAAL
                     SLKDAQTTDTRVMHAVDAARALTTRRGRSLLDHCWGDAAHASSNHTGGEWMRFIAWLV
                     MLCMAVVFLIVAVKKWPPPQRVFPRRKPLMSVPWCLAARLLGYGVFDWRTGKLTPWWD
                     FIKERHDILNIFAGDAAFITQRGRFAHLATELASTAAASMVLTDLTSARVSGGFWTNQ
                     IWVFVLLLTYDIVLGIALRLATLGATKVSFEAAENVGFMCAESGEIQDLEDEEQLIEM
                     GIKASHAFNLTQYRLLEACVAFSFVNVLVCSLWAHLANPADGCGDAFNTFVAYIYVFG
                     LYQGFSLTVISPFALTVRWCAAAFLITRIDEVQTPEETMDCCWKHMCPRLCGCRPPLV
                     TPLEQRTVSKLFMSPRKDNGVMTGNIVKAAAVVGKSRYDAQDSPLTPRPESMNRDVES
                     GSADLFTSATEGKEDTDDETPENIGARPQLTLSPSEKYAIFRRQASLRKDIALEDIDC
                     AQYPDGDFDHRPSYELGHSDQIAGESAFAAARMALISAGKLTPEQVVRTRDFKHDWSA
                     RKSRYDSASDSGGESTEDSDPELGVNDKTADDVDDVIVRTDVANMESSASPTVRWSRK
                     LKDAASPADDTIDDDELFDEELDSDPWGDGSA"
     gene            <509406..>510584
                     /locus_tag="OSTLU_17423"
                     /db_xref="GeneID:5004477"
     mRNA            join(<509406..509525,509667..>510584)
                     /locus_tag="OSTLU_17423"
                     /product="predicted protein"
                     /transcript_id="XM_001420327.1"
                     /db_xref="GeneID:5004477"
     CDS             join(509406..509525,509667..510584)
                     /locus_tag="OSTLU_17423"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420364.1"
                     /db_xref="GeneID:5004477"
                     /db_xref="JGIDB:Ost9901_3_17423"
                     /translation="MARHRRDLNHGIVLNTESERIARKWRARQPNRVQQNQRYLPVET
                     KTAKLDLAADSAADSAADWVVDWVADWAADWAADWAADSAADWAADWAADWVVDWVAD
                     WAADWAADSAADSAEDLVADSAEDLVADSAADSATDSAVDLVVDSAVHLVADSAVDLV
                     ADSAVDLVVDSAVNLVADSVADSAADSAADSAADSAADLLATPKALVEIAVVADLAAD
                     LAADSAVDLVVDLAADSAADSAADSAVDLVVDSAVDLVADSAVDSMVDWAVDLVADSA
                     VDLVVDSAAVDSAVDLVATPKALVEIAVVADSAADLAVDSAADWAADLSVDSAADSAA
                     DSAVDSAVPPP"
     gene            <511135..>512418
                     /locus_tag="OSTLU_44170"
                     /db_xref="GeneID:5004426"
     mRNA            join(<511135..511185,511318..>512418)
                     /locus_tag="OSTLU_44170"
                     /product="predicted protein"
                     /transcript_id="XM_001420328.1"
                     /db_xref="GeneID:5004426"
     CDS             join(511135..511185,511318..512418)
                     /locus_tag="OSTLU_44170"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420365.1"
                     /db_xref="GeneID:5004426"
                     /db_xref="InterPro:IPR005140"
                     /db_xref="InterPro:IPR005141"
                     /db_xref="InterPro:IPR005142"
                     /db_xref="JGIDB:Ost9901_3_44170"
                     /translation="MKITSRAFEKNAKGWIKFVPESADDVWHAYNLIAVDDEVECATM
                     RKLKNEHAGELRESSSKVVKLTLRVRCEDVEYDAEGATIRVKGQNKTECEEVKLNAYH
                     TLEIGIGRAVKIEKTAWDSVDVGRLEEAADPSATADLAAVLIVDGLANVVLVGATQTI
                     VKGKIEASMPRKRGMALMGYEKAETKFFSNVASVVERHVDFDRVKCLVIAGPGFTKDT
                     FTDFLKLEAVRKNWKTLQTNFSRVIKAHASSAYVHSLSEVLENPTVRALISDTKAASE
                     VKALDDFFEMLANDPARAFYGPAHVMAAHELNAIDKLLITDTVFRTRNVAQRKMWVRV
                     TEEVTKSGGIVHIFSSAHASGEQLEQITGAAAILRFPLPDLADAELPAL"
     gene            complement(<512489..>513298)
                     /locus_tag="OSTLU_88668"
                     /db_xref="GeneID:5004427"
     mRNA            complement(<512489..>513298)
                     /locus_tag="OSTLU_88668"
                     /product="F-ATPase family transporter: protons (vacuolar)"
                     /transcript_id="XM_001420494.1"
                     /db_xref="GeneID:5004427"
     CDS             complement(512489..513298)
                     /locus_tag="OSTLU_88668"
                     /codon_start=1
                     /product="F-ATPase family transporter: protons (vacuolar)"
                     /protein_id="XP_001420531.1"
                     /db_xref="GeneID:5004427"
                     /db_xref="InterPro:IPR002699"
                     /db_xref="JGIDB:Ost9901_3_88668"
                     /translation="MSSAGARLNVTPTVTTLAVIKSRLAGAQRGHRLLKKKADALTLR
                     YRGILRDIVEAKRKLATSMRDAHFAWTRAKYAGGDAVKHAVLDGVDRANVRVMAHEDN
                     VAGVKIPKFTCRKCGADERRMELTGLARGGARVREAKASYGEAIGLLSELASLQTAFV
                     TLDEAIKTTNRRVNALENYVTPRLQNTVKYILSELDELEREEFFRLKKVQAKKKKDIE
                     ETEMMEAEEEKRITQAVDAELRAFGDVIGGEGGRGAGGNLIESEHDEDLLF"
     gene            513380..514610
                     /locus_tag="OSTLU_26607"
                     /db_xref="GeneID:5004478"
     mRNA            513380..514610
                     /locus_tag="OSTLU_26607"
                     /product="predicted protein"
                     /transcript_id="XM_001420329.1"
                     /db_xref="GeneID:5004478"
     CDS             513547..514578
                     /locus_tag="OSTLU_26607"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420366.1"
                     /db_xref="GeneID:5004478"
                     /db_xref="InterPro:IPR003675"
                     /db_xref="JGIDB:Ost9901_3_26607"
                     /translation="MANLDSALGTRARDGDGAATREARSTRDEASDDATRGRADPLAA
                     YDADRDWLGAGPRWDVPHGGARFAATMLAVDASFYAAGCLAPMVEHAARASREGRDAP
                     ESAEALAEDLRRAFDDPSAFADILLDAEIIQIALGAGILALSVKKFAPLPLGWFNDAF
                     SSSDAAVNATGRDASKWKRDAAAKAQNERASASASEAGRAILGTFLGVALVTWVLYAA
                     GLRGGDGNGSSSVDVIEKAFAAGPHGIANLVVTTVILAPIFEETVFRGYMLPSLTKFM
                     DTTPAIGVSALIFALIHQHGVGDTVQLVAVGLATGIVYARTRNLAASIAVHAAFNASV
                     IALFALWVS"
     gene            complement(<514617..>515387)
                     /locus_tag="OSTLU_26608"
                     /db_xref="GeneID:5004428"
     mRNA            complement(<514617..>515387)
                     /locus_tag="OSTLU_26608"
                     /product="predicted protein"
                     /transcript_id="XM_001420495.1"
                     /db_xref="GeneID:5004428"
     CDS             complement(514617..515387)
                     /locus_tag="OSTLU_26608"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420532.1"
                     /db_xref="GeneID:5004428"
                     /db_xref="JGIDB:Ost9901_3_26608"
                     /translation="MGAAGVGQWLVWEDVGRVTLEDVLARGDGLALARETFGDLSDDA
                     AAFRFLASTLARAVASVHAFDMIHRDVKPANVILSDARKRTLLCDVGACADVQTGRNM
                     DGAEAIFDPTYGAPEQFRKVASSPPLGGFPSIGGLFGRKKNAEASSANGFTLEPSGEP
                     PTVLLDAYSLGVTLLRCGVPSLRGESAIVRARKDIDACGGDLDLWRREVCVPGVNDFT
                     LLDELGAWATITRLAAVDPNERFSVRRALDADEFLSSA"
     gene            complement(<515843..>516781)
                     /locus_tag="OSTLU_17427"
                     /db_xref="GeneID:5004479"
     mRNA            complement(<515843..>516781)
                     /locus_tag="OSTLU_17427"
                     /product="predicted protein"
                     /transcript_id="XM_001420496.1"
                     /db_xref="GeneID:5004479"
     CDS             complement(515843..516781)
                     /locus_tag="OSTLU_17427"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420533.1"
                     /db_xref="GeneID:5004479"
                     /db_xref="JGIDB:Ost9901_3_17427"
                     /translation="MSTARARDAAVVAVRSRGAVDRRRRRDARGRRRGGANANANGNG
                     TTTTTTTIGRGARVVVVGARGGVGQVICAKLHARGYDVVAVSRGRGTEETTTTGPRSV
                     GGVDCRDARSIEASGAFDGDVEAVVCCLGTTAFPSARWRDEDGKFTNGPEATDYVGAR
                     NVVEATKKLAPNLKRFVFVSSVGVLRTNVMPFVVLNAFGVLKWKRKGEECVENSGLPY
                     TILRPGRLTDGPYTSYDLNTLLKATSGARRDVQIGGGDDKLLPEATSRLVVAEAACAA
                     LVCASAAGRAYELGSTEGGDGPQDDVQKWQKLFDSV"
     gene            <517387..>519159
                     /locus_tag="OSTLU_17428"
                     /db_xref="GeneID:5004480"
     mRNA            <517387..>519159
                     /locus_tag="OSTLU_17428"
                     /product="predicted protein"
                     /transcript_id="XM_001420330.1"
                     /db_xref="GeneID:5004480"
     CDS             517387..519159
                     /locus_tag="OSTLU_17428"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420367.1"
                     /db_xref="GeneID:5004480"
                     /db_xref="InterPro:IPR001672"
                     /db_xref="JGIDB:Ost9901_3_17428"
                     /translation="MGTQGGTALISTTAEWRALKEHFANEIDKTHLRDLIADAKRCEE
                     LVIESDGVYCDFARQRVTHDTMTKLYDLARAAGVKEKINAMFNGEAINSTENRAVLHV
                     ATRAPKDKVINVDGKNVVPDVHDVLDKIKDFSERVRNGEWVGETGKPLKDVVAIGIGG
                     SFLGPLFVHTSLRTNPEAADEARGRQLRFLANVDPVDVARSLNGLDPETTLVIVVSKT
                     FTTAETMLNARTVRAWIRASLGEAAVSKHMVAISTNLKLVEEFGIDPDNAFAFWDWVG
                     GRYSVCSAVGMLPLSLQYGYDTMEQFLKGAWSMDQHFANAPFEKNLPLTLGMLSVWNV
                     SFLDCPARAILPYTQALAKLAPHIQQVAMESNGKGVAIDGTPLDYETGEIDFGEPGTN
                     GQHSFYQLIHQGRTIPCDFIGIIKSQQSVYLKGEIVSNHDELMCNFFAQADALAVGKS
                     AIELRAESCPDALIPHKTFTGNRPSLSILLPELNAYTTGQLLSLYEHRVATQGFVWGL
                     NSFDQWGVELGKVLASRVRTSMNSKRTKGEIMTPGDGFNPSTTALLNRYLAGKAKLIY
                     PEPKDVFPCDLIDGDECRPPTSYV"
     gene            <519451..>520218
                     /locus_tag="OSTLU_88671"
                     /db_xref="GeneID:5004429"
     mRNA            <519451..>520218
                     /locus_tag="OSTLU_88671"
                     /product="predicted protein"
                     /transcript_id="XM_001420331.1"
                     /db_xref="GeneID:5004429"
     CDS             519451..520218
                     /locus_tag="OSTLU_88671"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420368.1"
                     /db_xref="GeneID:5004429"
                     /db_xref="JGIDB:Ost9901_3_88671"
                     /translation="MIARLARSRVARASNGEGDEEFRASVDGLREPCDDFVCKSSPAV
                     ENTLKSLIKDINAARGTNRSAAPYSPDVTYDDGALRFAGSEKYKRYCSYIENNLRQVT
                     TRVTEISMEGSLDVATVKWELNAVNDIGRVGVDVTATYKMNLITGRVLEHREQWVVNP
                     ARTDAQAGALLESTRKAHALPLNAMEVADEAKKKFREISKSFASEDDQENSNIYVDPN
                     DPMKFFQQDDTSKTDLLQLSLVAAVIYLLTKVFQVLN"
     gene            complement(<520252..>521238)
                     /locus_tag="OSTLU_26612"
                     /db_xref="GeneID:5004430"
     mRNA            complement(<520252..>521238)
                     /locus_tag="OSTLU_26612"
                     /product="predicted protein"
                     /transcript_id="XM_001420497.1"
                     /db_xref="GeneID:5004430"
     CDS             complement(520252..521238)
                     /locus_tag="OSTLU_26612"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420534.1"
                     /db_xref="GeneID:5004430"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="JGIDB:Ost9901_3_26612"
                     /translation="MSNARSRATRRRATWYVTLFACASAFACVASRVRGVEASTTYEF
                     IHYARNDFYGALDVARDANSTIIAKKYRKLALSLHPDKLPKEMDRAQRQKAKKHFEVI
                     AEAKKILLDETLRKEYDDVIASLPKFARPKFGKRSAFDKEEVKFSAWLVMTVFTAFCV
                     SFVSVAQYTSRAADKQSLMQSAFYLQKLKSRNKNLPKPDRVTAEEYFEEFLVEFGLTD
                     LTGWEHTTGGKLLARLRGRIPENEKAETTEATETSDASTSASASASGRDGEDAVTSLR
                     RRGKKKGKNKGRRDGGSSGGGSVDRRAATALKHLRSEGEARRMMFGDSYDIE"
     gene            complement(<521380..>522333)
                     /locus_tag="OSTLU_17430"
                     /db_xref="GeneID:5004481"
     mRNA            complement(<521380..>522333)
                     /locus_tag="OSTLU_17430"
                     /product="predicted protein"
                     /transcript_id="XM_001420498.1"
                     /db_xref="GeneID:5004481"
     CDS             complement(521380..522333)
                     /locus_tag="OSTLU_17430"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420535.1"
                     /db_xref="GeneID:5004481"
                     /db_xref="JGIDB:Ost9901_3_17430"
                     /translation="MKRATKPARVDDADVARVVLRYLERQGYEGARKAFLKDAATTLG
                     DDAPRGGGRKTKDLKRVIDEYVRLKDAEHRRRHCTGVVGKMMKVIDDALAGRESKSRD
                     EGRGRGRRGTRDDASGASGSESDAVDDDERSESESEEIVEREIAATRRAADAAPAPAG
                     SNRRKKASVAPKRFVPGRGPTANGNAVASTSGARSMHGTPKLTPLSAKAPLGSLRPFH
                     MPELADGAAQKKMADVIVGALGGRGKVQLSKYGDPAKGELIDEGTVENVMQSLMDADD
                     ELGEFLFSMIDEVERDVALRAVDAQGPPEHAFGSPRKKSKN"
     gene            522446..524130
                     /locus_tag="OSTLU_26614"
                     /db_xref="GeneID:5004482"
     mRNA            522446..524130
                     /locus_tag="OSTLU_26614"
                     /product="predicted protein"
                     /transcript_id="XM_001420332.1"
                     /db_xref="GeneID:5004482"
     CDS             522562..524076
                     /locus_tag="OSTLU_26614"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420369.1"
                     /db_xref="GeneID:5004482"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR004099"
                     /db_xref="JGIDB:Ost9901_3_26614"
                     /translation="MFSSVAIGTPRKLVTPRKPLARTLARAFATSGEEQDVVIVGGGP
                     GGYVAAIKAAQLGLKVTCVEGRGTLGGTCLNVGCIPSKALLNASHKYEEAKHGMAKHG
                     ITFGGEVAIDVETMMGHKSKAVTGLTKGIEGLFKKNKVTYAKGWGKLLSANEVNVTME
                     DGSSEVIKTKNVVLATGSVPSALPGVDADEETIVTSTGALELKKVPETMVVIGGGVIG
                     LELGSVWSRLGAKVTVVEFADKICGAGIDDEIRTTFQRSLKKQGFNFKLSTKVTKAVK
                     KPEGGVTLTLEPSAGGEQTELEADIVLVSTGRRPFTDGLGLEDVGVETNRMGQIVIEP
                     HTFKTNVPGVFAIGDIVAGPMLAHKAEEEGVSVVEQIAGKKGHVNYDTIPSVIYTHPE
                     VAWVGKTEAEVKEMGIEYIVGKFPLAANSRARANDDSEGVVKFLTDKATGKILGAHIV
                     SGGAGELLAECVLAMEYGATAEDIARTCHSHPTVSEAVKEAAMAATPGMGSIHF"
     gene            complement(<524127..>524948)
                     /locus_tag="OSTLU_88673"
                     /db_xref="GeneID:5004431"
     mRNA            complement(<524127..>524948)
                     /locus_tag="OSTLU_88673"
                     /product="predicted protein"
                     /transcript_id="XM_001420499.1"
                     /db_xref="GeneID:5004431"
     CDS             complement(524127..>524948)
                     /locus_tag="OSTLU_88673"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420536.1"
                     /db_xref="GeneID:5004431"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="JGIDB:Ost9901_3_88673"
                     /translation="LRRQGRIDASRTLVVPLPDDDLADLLGVVPEATTFIETALASAS
                     SSVVAVHCHAGESRSAAVVAAYLMRFEQLEIEQAMASVEARGGAPNEGFQAQLSLWAQ
                     MGCRVSTANEAYKLWSVAKVARERDERGYLESTSVMRDPGAADAVDDPEGGGWLACRK
                     CRRRLARSTHVLCHEHGEGIDAFSWKARRKEGSKGINRDCAGARQCSSMFLTPLSWMK
                     GIEDGDGGETRGKLCCPQCETKIGAFDWAGIQCSCGAWVSPAFQIQRAKTDAFGM"
     gene            complement(<525222..>526592)
                     /locus_tag="OSTLU_17433"
                     /db_xref="GeneID:5004483"
     mRNA            complement(<525222..>526592)
                     /locus_tag="OSTLU_17433"
                     /product="predicted protein"
                     /transcript_id="XM_001420500.1"
                     /db_xref="GeneID:5004483"
     CDS             complement(525222..526592)
                     /locus_tag="OSTLU_17433"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420537.1"
                     /db_xref="GeneID:5004483"
                     /db_xref="JGIDB:Ost9901_3_17433"
                     /translation="MRALAREREARQLEARERERWNRDVREALRRGTREEALQRRLEA
                     LDAEFGDDAARATTAATRGDATEGGRDGARDDTMRRASTLERASRAKANEERRASREA
                     STAARALETDAMRALRARLSAMETHAIRNNQIEEKKALEKLEMERQRALDAEMERERL
                     EGVARDERERAAKLAKKIAAREALDAQHAERALRMSKRAMEKEDERRKMAQLVKKIEA
                     EDEEERREAIARRECAKRDAAKALEEKRARVAREAEAVKALEEQIMRHDEMVARREAK
                     EEEEKRKEEKRKERARVSVETSQTRAAQERADFDELISRLRFEEFEEACRVKEAEERE
                     NAARRRDEQRREYEAAVAAREAREAQALEEKKQFQRDLAAKLAEDDRVEQLSAQKRRM
                     KLLEHSREVRRLAEEKFAEREARLELERRELDASRREREAMDAAIECGREKLLAEFHN
                     KTASLA"
     gene            <527206..>528119
                     /locus_tag="OSTLU_17434"
                     /db_xref="GeneID:5004484"
     mRNA            join(<527206..527947,528049..>528119)
                     /locus_tag="OSTLU_17434"
                     /product="predicted protein"
                     /transcript_id="XM_001420333.1"
                     /db_xref="GeneID:5004484"
     CDS             join(527206..527947,528049..528119)
                     /locus_tag="OSTLU_17434"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420370.1"
                     /db_xref="GeneID:5004484"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="JGIDB:Ost9901_3_17434"
                     /translation="MPPRRDAPLEACEACSTDDEDALRATLATTPCTIVDARGNTLLH
                     LCCANDALRCAKLVVSRCVFASTPPERAYLTLRNSDGETAADVAEACGSARCAEWLAK
                     MTGAERVATNDARRKDVGKGERRRADDERRRKRSGDGETEATTRARESLVRSIREALN
                     IGPGDDGDERAAVRQVLREVLNLVSDRESARRELEEAHRKIEAMERDAERERANVVEA
                     LGMAEKRAKEMISEREAREKDICAEKTALNEAREERFREQRVGERDAGAGDG"
     gene            complement(<528346..529094)
                     /locus_tag="OSTLU_26618"
                     /db_xref="GeneID:5004432"
     mRNA            complement(<528346..529094)
                     /locus_tag="OSTLU_26618"
                     /product="predicted protein"
                     /transcript_id="XM_001420501.1"
                     /db_xref="GeneID:5004432"
     CDS             complement(528346..528987)
                     /locus_tag="OSTLU_26618"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420538.1"
                     /db_xref="GeneID:5004432"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Ost9901_3_26618"
                     /translation="MATCLDWRSDGALAASAADGSFRVMREDASAIEIVDTVEGAHDL
                     EMWAIAFDATRADVLYTGADDCAFKAWDLRDASRAQMVNRKTHCAGVTCVVPSPRDEN
                     TVVTGSYDDHVRLWDVRSMKSPVSELNVGGGAWRCRWHPTRNALACAAMGGGAVLVDV
                     DDASGALKEVFTYDEHESIVYGADWVQLDGDDDSSDVLVTCSFYDKSVRCWHV"
     gene            <530216..>531058
                     /locus_tag="OSTLU_44336"
                     /db_xref="GeneID:5004485"
     mRNA            <530216..>531058
                     /locus_tag="OSTLU_44336"
                     /product="predicted protein"
                     /transcript_id="XM_001420334.1"
                     /db_xref="GeneID:5004485"
     CDS             530216..531058
                     /locus_tag="OSTLU_44336"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420371.1"
                     /db_xref="GeneID:5004485"
                     /db_xref="InterPro:IPR000007"
                     /db_xref="JGIDB:Ost9901_3_44336"
                     /translation="MSCPAPLPPWADARARRKFTLEALPNDGTHARCHVLRKRGPLGV
                     FPTYVLYLDGRETTTATLGDAVPILVARKRKKSKCTHYVIGDDGAERAVNEAHASYVG
                     KLKANFIGTHFELLDSGVRPRAWGAPRHLDDEADDEEQGPPRRALANIRYAVNVLGAG
                     GPRALSVSLLGDDVDDPNAVAHELESARPTWNPSAQAYVLNFNGRVTRPSVKNFQLVS
                     SGLAAAGAPSRADAESRTLTRGVLQFGRVDDDLFTLDFAHPLSPLTAFAACLSAFESK
                     FARE"
     gene            <531156..>531566
                     /locus_tag="OSTLU_93480"
                     /db_xref="GeneID:5004433"
     mRNA            <531156..>531566
                     /locus_tag="OSTLU_93480"
                     /product="predicted protein"
                     /transcript_id="XM_001420335.1"
                     /db_xref="GeneID:5004433"
     CDS             <531156..531566
                     /locus_tag="OSTLU_93480"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420372.1"
                     /db_xref="GeneID:5004433"
                     /db_xref="JGIDB:Ost9901_3_93480"
                     /translation="VTSWHDFDGDARVARSTIEGAGYGLFARRRLATGDVVERATYSG
                     DVLSLAEALKLGDDEKAYVMAMHFNVHVDARRHYGYLARYVNDAEGTPFETNVKFEKD
                     VAQRRATLRAVKDVEVGEELFAAYGRGYWRAKVG"
     gene            complement(531564..>533593)
                     /locus_tag="OSTLU_50812"
                     /db_xref="GeneID:5004434"
     mRNA            complement(531564..>533593)
                     /locus_tag="OSTLU_50812"
                     /product="ABC(ABCB) family transporter: mitochondrial
                     ATM1-like protien (ABCB)"
                     /transcript_id="XM_001420502.1"
                     /db_xref="GeneID:5004434"
     CDS             complement(531647..533593)
                     /locus_tag="OSTLU_50812"
                     /GO_component="membrane; integral to membrane"
                     /GO_function="ATP binding"
                     /GO_process="transport"
                     /codon_start=1
                     /product="ABC(ABCB) family transporter: mitochondrial
                     ATM1-like protein (ABCB)"
                     /protein_id="XP_001420539.1"
                     /db_xref="GeneID:5004434"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="JGIDB:Ost9901_3_50812"
                     /translation="MPARESGDENAYFRAGDVSLDGPIPPPPRTSDLRDVLPYLFAVS
                     LSRRGTAWRLCAALTFLVIQKSFGLAVPVLFKVAVDHCTAAAAATGMVATEAAKAAAA
                     ALLVSGCLKAISGVATELRTVMFTPVAQASGRRVALEVFNHVLNLDLSFHLERRTGAL
                     QRIIDRGTRSVSMVFRAVVFTFLPTAMELALVCGLLWHAFSWHFVVIVLTTFVAYVWW
                     TMHMTGVSAEKRKLANHMDGLSTGKAVDALLNYETVTFFGNVELESQQYDKLLRGYHE
                     AALGSERASSLLNAGQAVILACGMTTILSCAALGLWKVDPAGGLASRVGDLVMANGLL
                     LQLWAPLQFLGFFYRELRQSLVDMEAMFDIMATETKIPDGEIALPAHAGGADLELDNV
                     TFRYGNGRDVLKGVSLKLKPGESVGIVGPSGSGKSTLLRLILRVYDVSSGKISIDGYD
                     VRDLKIDSLRDSVAVVPQDTVLFNDTLDHNIRYGRPTANDDEVAMAATRARLNKTIEQ
                     MPKGRETMVGERGVKLSGGEKQRVAIARAFLREPRMLVADEATSALDTATEQGILESL
                     EDVARGRTAVFVAHRLSTVRSCDRIIVMEQGRIVEEGTHAELLDGTSRGTKIGMYAAM
                     WKAQAQEDEKERSSVVKPDDMVMV"
     gene            <534515..>536038
                     /locus_tag="OSTLU_1996"
                     /db_xref="GeneID:5004486"
     mRNA            <534515..>536038
                     /locus_tag="OSTLU_1996"
                     /product="predicted protein"
                     /transcript_id="XM_001420336.1"
                     /db_xref="GeneID:5004486"
     CDS             <534515..>536038
                     /locus_tag="OSTLU_1996"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420373.1"
                     /db_xref="GeneID:5004486"
                     /db_xref="InterPro:IPR008380"
                     /db_xref="JGIDB:Ost9901_3_1996"
                     /translation="WSTTNEAERAERAATKVFCNRSLNMKRINAIGFDMDYTLAMYKP
                     ETFEMMSYSETKKKLVESYNYPRALLESFEFDPDYMVRGLVVDKKRGNVLKMDRHNYV
                     KVAYHGFTALDTDERLATYCETSKRQSFDGPEFSALDTLFSMGEAYLFSQLVEAKDSG
                     KHGEFFERKTFMQMYDEIRAAVDLCHRDGSLKHAVAENPSKYITKDADLVPLLKALRA
                     SGKQVFLLTNSLWDYTNVVMNYLIDDNVGDQKKLEWLNLFDVVVTGSAKPGFFANDSA
                     TIFEVDTATGLLHNTDNGAPLTPIGSVSDSTHKRALASGLRATGKGPARVYQGGSYTH
                     LHAMLGIEIGSRLLYVGDHIYGDILRAKKEIDWRTMLVVPELAHEIDCLERMKEKPHA
                     LRRLRTLRDSLDDQVARHAWLAANAADPKANEEELERARQLSATARTAHREGMREYHK
                     SFHYVWGQLMKAGSQNSRFAFQVERYACLYTSHVRNLWGYSPEKVFRAPADFSPHDLD
                     "
     gene            complement(<536169..>536744)
                     /locus_tag="OSTLU_26622"
                     /db_xref="GeneID:5004435"
     mRNA            complement(<536169..>536744)
                     /locus_tag="OSTLU_26622"
                     /product="predicted protein"
                     /transcript_id="XM_001420503.1"
                     /db_xref="GeneID:5004435"
     CDS             complement(536169..536744)
                     /locus_tag="OSTLU_26622"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420540.1"
                     /db_xref="GeneID:5004435"
                     /db_xref="JGIDB:Ost9901_3_26622"
                     /translation="MGKREQFGIDLKSLCVKPGRARWTLTVDCACACDRGSMLDALSV
                     GVRAALADTKIPKVTVAGVGEDGAGGELEIDDDPEACSRVDVSRCGVVVTTTKIGRHG
                     VVDATEEETACSEATMSVGVDREGTICAEFGAGGESLDRGTAQAMRKLACKVGVELIE
                     HMDGYLARAIAVDVDDDDEGDDRVLKVKIRR"
     gene            <537667..>538503
                     /locus_tag="OSTLU_6042"
                     /db_xref="GeneID:5004487"
     mRNA            join(<537667..538051,538103..>538503)
                     /locus_tag="OSTLU_6042"
                     /product="predicted protein"
                     /transcript_id="XM_001420337.1"
                     /db_xref="GeneID:5004487"
     CDS             join(<537667..538051,538103..>538503)
                     /locus_tag="OSTLU_6042"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420374.1"
                     /db_xref="GeneID:5004487"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR006011"
                     /db_xref="JGIDB:Ost9901_3_6042"
                     /translation="QMASAIGHGIHRTSLKLERLNQLAKSSSLYDDKSREIAETSAVI
                     KLDIQALNESIVELQGAAARTRERGEANKSASDHSVTVVDTLKNRLATATKTFKETLT
                     TRQANIKAGEERRAMFGASAGPSAFDGASGFGNLQGNANAFVPRPSAPGAGVSGAPMM
                     QTQGQMQLYNQNTAYADSRQEALQNVERTITELGGIFQQLATMVSEQGELAIRIDENV
                     DDTLANVDSAQTQLLKYLNTVSSNRWLILKIFAVLISFFSFFIV"
     gene            <538626..>539654
                     /locus_tag="OSTLU_17441"
                     /db_xref="GeneID:5004436"
     mRNA            <538626..>539654
                     /locus_tag="OSTLU_17441"
                     /product="predicted protein"
                     /transcript_id="XM_001420338.1"
                     /db_xref="GeneID:5004436"
     CDS             538626..539654
                     /locus_tag="OSTLU_17441"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420375.1"
                     /db_xref="GeneID:5004436"
                     /db_xref="JGIDB:Ost9901_3_17441"
                     /translation="MKRGSDADDPRAPALTSVSRAVSGETFRILTRASTSAIDVSARD
                     ASGKTFVGRLDLQRAPFERFGEFARAALGDPRRERVERAFTFTFERAEENGDEYELVW
                     RFREAEAEATLDDGAEFATTRAKTANDGKNYGAVRTGVCGMRRVESDDAFCDGGFAYE
                     ALGEALEMEARRRFNAERDGKRAIEARERANENCETALREMDALKERLAQNFLSLLNE
                     KKKGMRKMAEELEAARAENDELKADLASARLEHSKPDVDGFVAVKGERSVDADVDEDR
                     DESEDEYNTDDETERTRRRGRKRDASQPSQRKSQPSQSQPSQKRARNATAKKKSFLAD
                     TLALLDAD"
     gene            complement(<539698..>540168)
                     /locus_tag="OSTLU_88679"
                     /db_xref="GeneID:5004437"
     mRNA            complement(<539698..>540168)
                     /locus_tag="OSTLU_88679"
                     /product="predicted protein"
                     /transcript_id="XM_001420504.1"
                     /db_xref="GeneID:5004437"
     CDS             complement(539698..540168)
                     /locus_tag="OSTLU_88679"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420541.1"
                     /db_xref="GeneID:5004437"
                     /db_xref="JGIDB:Ost9901_3_88679"
                     /translation="MTAVSDEANDRVAWANAMRLCVTRRDALNDDGSIDQQFFKPKRV
                     VFETRAKKWGDEERAKLYEGIETYGIQEWGTIRENLLPDWDTLNLRVKAARLMGTQSL
                     SRYPKGWKGTKAEVEAEYAKHKKIGEATGCWKNGQLVEDDNGTAAKYMAEHGLL"
     gene            <540450..>540875
                     /locus_tag="OSTLU_26625"
                     /db_xref="GeneID:5004488"
     mRNA            <540450..>540875
                     /locus_tag="OSTLU_26625"
                     /product="predicted protein"
                     /transcript_id="XM_001420339.1"
                     /db_xref="GeneID:5004488"
     CDS             540450..540875
                     /locus_tag="OSTLU_26625"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420376.1"
                     /db_xref="GeneID:5004488"
                     /db_xref="JGIDB:Ost9901_3_26625"
                     /translation="MSKKNNRTTAANRVEHAKRVEREALVKKEARRVRKMAAMALASD
                     AMAVDGAGGKGGTAGRARLEAKNVRKAQSLRLAGGVRKVRAGKNTHKVVRGVPVGKAK
                     LRKNAVVMGIKIVDAATKQAALDAIAEARGDGGATAMRR"
     gene            complement(<540978..>541658)
                     /locus_tag="OSTLU_17444"
                     /db_xref="GeneID:5004438"
     mRNA            complement(<540978..>541658)
                     /locus_tag="OSTLU_17444"
                     /product="predicted protein"
                     /transcript_id="XM_001420505.1"
                     /db_xref="GeneID:5004438"
     CDS             complement(540978..541658)
                     /locus_tag="OSTLU_17444"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420542.1"
                     /db_xref="GeneID:5004438"
                     /db_xref="JGIDB:Ost9901_3_17444"
                     /translation="MAPSPSNLASMAKIATHESVYPPAEDSFLLVDALAALWDDELAR
                     SRPKLCIELGTGSGYIACSNALLARAHGCGDVTRTRASDINPDAVAACRATCEAHGVS
                     GTECATALGDLLEPHADALADAGGCDVLVFNPPYVVTPSEEVGGRGIEASWAGGARGR
                     EVLDRLLPSVRSALAPRGMFLCILLAQNEPEEVMEIMRRDGLRCSLVSSCNADEEALF
                     VLRCDRDA"
     gene            complement(<541752..>543932)
                     /locus_tag="OSTLU_93482"
                     /db_xref="GeneID:5004489"
     mRNA            complement(<541752..>543932)
                     /locus_tag="OSTLU_93482"
                     /product="predicted protein"
                     /transcript_id="XM_001420506.1"
                     /db_xref="GeneID:5004489"
     CDS             complement(541752..543932)
                     /locus_tag="OSTLU_93482"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420543.1"
                     /db_xref="GeneID:5004489"
                     /db_xref="InterPro:IPR001293"
                     /db_xref="JGIDB:Ost9901_3_93482"
                     /translation="MSRPRRDAVRGARALAPAVEDAPVRTRDDARSSDSSEDEARARR
                     RDKHLTTQKFVESIANAKGALLAEDVERLYAARCEEVAHDGRDQSDTESDASEEERGK
                     WWPLTAVTTPKSAAEACAAEAKRAEEEGIVPEGTMATSELMIHNWFHLSESLTRWRRA
                     GTMVLTPPPDELRCHTCRDFAAEPLVNAQGRLFCAPCGRENEGDARAKLFGLDVQTQM
                     RLDALPVMCCNVATPHAGGDNLVWKVALDGCRAVSTLGKVRAHEETCEYTLMRCSLPA
                     ESTNKAEKCHAVVPRRTMDSHRATCEYRIQKCADCDRSVQVRKMRAHVMICGQIEVHC
                     PYRRCKWRGARDGVDAHVATECLLHPVVCRLEDSETRETCKETVPRERIAQHRASCQY
                     QQRPCEYCTREVSLRRMGDHKLRCKAREFQCPLCRRIMPAEQRESHEKTTCPMIESVC
                     EHARFGCDVKVPKEHYRQHAIECFPEHVAHVAFGTDGVSEFVSAPSDDQVDAVELLKR
                     MQRNREAMLADFASFETMCHKVSCKLNARAELCSTASHAAKDVEETTAAFERQAERER
                     CASAFALREKHSLDRDEDYNDMIVSRNLVGARIIDEMRRFDETTAKLRLKSEALYAAL
                     DEKRDFATRRLEDEIDAHTPAADLIADAKDEATKYVATVDAERRRLAARLIDMKSNVF
                     SAKMSLVENVEHRKRRSETLRAKLTAFARGERFVDGDGVHTTHS"
     gene            complement(<544063..545037)
                     /locus_tag="OSTLU_26628"
                     /db_xref="GeneID:5004490"
     mRNA            complement(<544063..545037)
                     /locus_tag="OSTLU_26628"
                     /product="predicted protein"
                     /transcript_id="XM_001420507.1"
                     /db_xref="GeneID:5004490"
     CDS             complement(544063..544902)
                     /locus_tag="OSTLU_26628"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420544.1"
                     /db_xref="GeneID:5004490"
                     /db_xref="JGIDB:Ost9901_3_26628"
                     /translation="MGTPRGKKRKATKPLFASMKSMKRARAVTTEFHGVTRVLDDAKA
                     SKEAKARAKATLEAIGGRDAYQEASALTTRRHRTAKWTFSVLTKKNRRPKRGERALKT
                     LEVGAINTDLMSAKFLDVRAIDVKSRHPKIEQLDFFDMPVEAESYDVIHSSMVVNCVP
                     TAELRGEMIARTATFLRPKGLFFMMLPLRCVTASTRMSQEKMSRLLRACGLRVVEQKR
                     TPKIVFYCCEKLGKPTETLIGKDLVKRDAREAFAKSERAKDAGGDPSHFGIILKDEHL
                     CGY"
     gene            <545658..>546560
                     /locus_tag="OSTLU_6061"
                     /db_xref="GeneID:5004491"
     mRNA            <545658..>546560
                     /locus_tag="OSTLU_6061"
                     /product="Annexin family transporter: Annexin A13"
                     /transcript_id="XM_001420340.1"
                     /db_xref="GeneID:5004491"
     CDS             <545658..>546560
                     /locus_tag="OSTLU_6061"
                     /codon_start=1
                     /product="Annexin family transporter: Annexin A13"
                     /protein_id="XP_001420377.1"
                     /db_xref="GeneID:5004491"
                     /db_xref="InterPro:IPR001464"
                     /db_xref="JGIDB:Ost9901_3_6061"
                     /translation="EAQTVMRAIKGFGTDEATLITILCTLAEEDILPLQMAFSSRYEK
                     SMEQAVLSETSGKFKRVLLLAGCDGVGESYAKVINSAVAGLGTDTKAIIRLMVTATPE
                     QLDATREAYSRIYKKDLIRAVGSEWKVRGDFKRIIEALAKRHPANVNDDADIDYSADV
                     RAMRNAVEGMGTDEAAVIALLANKSHKQIEAFREAYKIETGELLRERIRNETTGLFES
                     KLFRETLMGLLTPREEQIAIYLGEAMAGWGNDDWGLISMLVHRTEEEKMAIRTKYTEH
                     FGGDLIADIRSNCRGDYEDALVACI"
     gene            <547458..>549044
                     /locus_tag="OSTLU_44385"
                     /db_xref="GeneID:5004439"
     mRNA            join(<547458..548399,548622..>549044)
                     /locus_tag="OSTLU_44385"
                     /product="predicted protein"
                     /transcript_id="XM_001420341.1"
                     /db_xref="GeneID:5004439"
     CDS             join(547458..548399,548622..549044)
                     /locus_tag="OSTLU_44385"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420378.1"
                     /db_xref="GeneID:5004439"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="InterPro:IPR007856"
                     /db_xref="InterPro:IPR008138"
                     /db_xref="JGIDB:Ost9901_3_44385"
                     /translation="MDASDEERSAPKRGGVDVHNYMDAQYYGEIEIGNPRQKFQVVFD
                     TGSSNLWVPSSKCGFLQIPCDLHAKFDSRASETYEADGTPFAIQYGSGSLSGFLSKDE
                     VKVGDLVVQGQYFAEATKEPGIAFLFSKFDGILGLGFDNIAVDKVKPVFYNMMEQGLV
                     ENKMFSFWLNRTSTKDGMPSEVGGELIFGGSDPDHFIGEHTYAPVTREGYWQIKMDDF
                     KVDGRSLGACDGDDGCQVIADTGTSLLAGPTEIVNKINDYIGAHSMIGEECRLLIDQY
                     AEQFVEDLENYSSEQICASIGACDADGVEAMEADDDDDLGKSSSSFEGQIACTACKTV
                     VNYAQDMLAQNVTEKIIVNEVKRVCDMVPSVGGTASVDCDNIPNMPDVEFVIGGVPFK
                     LTPEQYVLKVYQDGEAQCVSGFMGMDIPKPAGPLWILGDVFLGPYHTEFDYANRRVGF
                     APAA"
     gene            <549309..>549563
                     /locus_tag="OSTLU_9831"
                     /db_xref="GeneID:5004440"
     mRNA            <549309..>549563
                     /locus_tag="OSTLU_9831"
                     /product="predicted protein"
                     /transcript_id="XM_001420342.1"
                     /db_xref="GeneID:5004440"
     CDS             <549309..>549563
                     /locus_tag="OSTLU_9831"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420379.1"
                     /db_xref="GeneID:5004440"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="JGIDB:Ost9901_3_9831"
                     /translation="LNVKTWHGVGAWTWGAGDVGDVCGICRIAFDGCPPDAKFPGDDS
                     PVVWGKCGHAFHLQCITKWLSGANAEAPRCPICRGAWEFKE"
     gene            complement(<549750..>552104)
                     /locus_tag="OSTLU_17449"
                     /db_xref="GeneID:5004441"
     mRNA            complement(join(<549750..551613,551815..>552104))
                     /locus_tag="OSTLU_17449"
                     /product="predicted protein"
                     /transcript_id="XM_001420508.1"
                     /db_xref="GeneID:5004441"
     CDS             complement(join(549750..551613,551815..552104))
                     /locus_tag="OSTLU_17449"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420545.1"
                     /db_xref="GeneID:5004441"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="JGIDB:Ost9901_3_17449"
                     /translation="MAAKAQGARDAAPVPSGKARGASASAKRAKEDARKRAGKRGAAA
                     TARDDGATTAREASGVRGYWQAPEEQALKRAVRKHGIGAWEKMRNDPEFAALRSRTGV
                     QLKDKWRNLIKFQHLRVDEAAKVPYKAAVKAANAANATGGKAGRGADKGGARGASAAN
                     AKGGKAASAASARKTNAAVNAKKGKGASASSAKKGAGGKKTMAVSRDALPKKGGGGTT
                     NVAGAPTMSAKEKLKARFGHRHDDDDQDEDDEYEEIAGVGRPSTGAKAKFDAGVDAVV
                     TQLKAKRAGMVNEVEHAESELARMKTVVEEAEAVYSSARARVHEALVGAHGEDEYYED
                     GEGEDTADWDKYLHFGEHEDEDDDEEVARAAEAAAEAHEAVKRGIKKPSEKKPSEKRP
                     KAAVDEDATDHDDDSDEEIDEDLVDSDEDDDDLDEEERAVRIANEVLAEAGLPPMHEI
                     EHVLLTELKKLEAANAAVVHARLALEAVDAEFAEALVSAHNNAAANAKATTSAAFDHD
                     DDLEKSFTMDGDEDEDDEDEDDEVDDEDDEEIDEDLVDDEEIEEEIRPQPTSKSKAKP
                     KAKSAPSQNDGADAAGGRVVEDRRYGIYDARRYRSEAENDAAEAAASKGGKVSAASKR
                     KAPTSSSAAAPKKSAKQTVKVEDTEIWYEQPNVAKAGAAVMPKKSQQFRAAPQSAPGS
                     IPSWRRKRAATRVTIGRPVAGPTSWAAIGQHIIKE"
     gene            <552668..>553465
                     /locus_tag="OSTLU_26633"
                     /db_xref="GeneID:5004492"
     mRNA            <552668..>553465
                     /locus_tag="OSTLU_26633"
                     /product="predicted protein"
                     /transcript_id="XM_001420343.1"
                     /db_xref="GeneID:5004492"
     CDS             552668..553465
                     /locus_tag="OSTLU_26633"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420380.1"
                     /db_xref="GeneID:5004492"
                     /db_xref="JGIDB:Ost9901_3_26633"
                     /translation="MRATRRRRLVAVVAGDSTACGVGCGDDGRGRTRGETAAGEAGPT
                     LARAFARGLGERMTADVEWRALGFKGADVRGLRDKLIPALREATEGAGGRGDDDDDAS
                     ERDGRGRRASVDAVVIMCGLNDLKHSIVGRRSETFRTELRELVREVRDVVGDECVVVL
                     PATPLEAATLFPPPLAWVATRMNDLWDEQKAHVSRLFAHNVLFVSKPSLDAMRERAAK
                     HTGRVAESISLICGDGIHPNDDGYDAWARHIADECVPSLERALAAQK"
     gene            complement(<553584..>554291)
                     /locus_tag="OSTLU_6627"
                     /db_xref="GeneID:5004442"
     mRNA            complement(join(<553584..553854,553924..>554291))
                     /locus_tag="OSTLU_6627"
                     /product="predicted protein"
                     /transcript_id="XM_001420509.1"
                     /db_xref="GeneID:5004442"
     CDS             complement(join(<553584..553854,553924..>554291))
                     /locus_tag="OSTLU_6627"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420546.1"
                     /db_xref="GeneID:5004442"
                     /db_xref="InterPro:IPR001240"
                     /db_xref="JGIDB:Ost9901_3_6627"
                     /translation="KPIVKVCGITTVRDCESACEHGANFVGMILWPKSKRSVDEATAK
                     EIVACAKAKGAVPVAVFVDEDASEITRVCDAIGCDHAQLHGDGARDALETLPMRLKAI
                     WVLNADANGQIVSKFPGDEENGPRRVVDWLLIDGVNAGSGTAFDWSKLKAPRGASRKG
                     WLLAGGLNPENVAQAIETANPTGVDVASGVADEGGVVKDAAKIAAFIGNARAA"
     gene            <554798..>555412
                     /locus_tag="OSTLU_26635"
                     /db_xref="GeneID:5004493"
     mRNA            join(<554798..554805,554986..>555412)
                     /locus_tag="OSTLU_26635"
                     /product="predicted protein"
                     /transcript_id="XM_001420344.1"
                     /db_xref="GeneID:5004493"
     CDS             join(554798..554805,554986..555412)
                     /locus_tag="OSTLU_26635"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420381.1"
                     /db_xref="GeneID:5004493"
                     /db_xref="InterPro:IPR001564"
                     /db_xref="JGIDB:Ost9901_3_26635"
                     /translation="MIKPDGVQRGHVGEIISRFEKKGMVMKALKTYQCPKAVAEEHYQ
                     DLSSKPFFGDLVNYICSGPVVAMIWEGPGVVKSARLLIGATNPLESAPGTIRGDLAVE
                     VGRNVIHGSDSVESAEREIELWFGDKAGCVDWQPTITPWVRE"
     gene            <555560..>556570
                     /locus_tag="OSTLU_26636"
                     /db_xref="GeneID:5004443"
     mRNA            <555560..>556570
                     /locus_tag="OSTLU_26636"
                     /product="predicted protein"
                     /transcript_id="XM_001420345.1"
                     /db_xref="GeneID:5004443"
     CDS             555560..556570
                     /locus_tag="OSTLU_26636"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420382.1"
                     /db_xref="GeneID:5004443"
                     /db_xref="JGIDB:Ost9901_3_26636"
                     /translation="MADVDGACARLKRALRRAKFPRSRAGTRIDTELKRGDGKTFVAI
                     LRHALCARSKPVSRRVYDRGHDLVGVESPLRFTERAFRATIDVFGYKPKLSASQFAST
                     NGFAVVKMMTVIDVLAHVEAMEVNIEREVAREASRRRTSGGLTGSLLDAGPRRRSALE
                     PRFARGRVEDERGVDESNDAHAHTFCDTDNWVTRLGDEYDDVVYEAPIRGVVYTNPGY
                     VVHRRARSPREPVFDASVSIDSLRVEFAEVLGRLTRVENELTEVAARCLKLERREAQT
                     LKKVDRAPAASRDASPSILSDSVEIRQADSPSKESTEEFIARYLRKLRDVVREEETRF
                     DC"
     gene            complement(<556616..>557419)
                     /gene="TPR3a"
                     /locus_tag="OSTLU_26637"
                     /db_xref="GeneID:5004444"
     mRNA            complement(<556616..>557419)
                     /gene="TPR3a"
                     /locus_tag="OSTLU_26637"
                     /product="TRP-containing protein"
                     /transcript_id="XM_001420510.1"
                     /db_xref="GeneID:5004444"
     CDS             complement(556616..557419)
                     /gene="TPR3a"
                     /locus_tag="OSTLU_26637"
                     /note="contains a tetratrichopeptide repeat"
                     /codon_start=1
                     /product="TRP-containing protein"
                     /protein_id="XP_001420547.1"
                     /db_xref="GeneID:5004444"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="JGIDB:Ost9901_3_26637"
                     /translation="MRVGERVGIVVPSGGAPFASEPFSPAPRNVYVEWEVELLSVTRE
                     EKPSVDASVEEVLRYCERKKEEANALFARGEEENGYARALRRYEDAATALRRTIMSTA
                     RAGAKDALALAVKCHVNSATCLSKLQRHSEAILHAEAALDLDATAVKAMYRKAMALEQ
                     QGRDEEALTSLRDALELSKDRAIREAFVRVRRRMNAVHEGEREVCARMVQTDPTTEPT
                     TRGFGERAAQLYRKRPALAGAITVAAFAAMVMYFRRSEKSASTTTATSD"
     gene            complement(<558042..>558293)
                     /locus_tag="OSTLU_26638"
                     /db_xref="GeneID:5004494"
     mRNA            complement(<558042..>558293)
                     /locus_tag="OSTLU_26638"
                     /product="predicted protein"
                     /transcript_id="XM_001420511.1"
                     /db_xref="GeneID:5004494"
     CDS             complement(558042..558293)
                     /locus_tag="OSTLU_26638"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420548.1"
                     /db_xref="GeneID:5004494"
                     /db_xref="JGIDB:Ost9901_3_26638"
                     /translation="MTDGAATQYGFPQYDAPARAASRQLGFKVGKEHETVALTRGRDG
                     ADAYEAIANTAYLKQAAANAMKYGWEKSKQTPGVRKYMK"
     gene            complement(<558657..>558971)
                     /locus_tag="OSTLU_26639"
                     /db_xref="GeneID:5004495"
     mRNA            complement(<558657..>558971)
                     /locus_tag="OSTLU_26639"
                     /product="predicted protein"
                     /transcript_id="XM_001420512.1"
                     /db_xref="GeneID:5004495"
     CDS             complement(558657..558971)
                     /locus_tag="OSTLU_26639"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420549.1"
                     /db_xref="GeneID:5004495"
                     /db_xref="JGIDB:Ost9901_3_26639"
                     /translation="MSEFAPPSYTGDPNLARCSEEYFKLGFWGLQFGLAFCALGGARF
                     SRIAPGLSGDTALALSEEAANRRREKAGKRRRSHLQKGFGDKTGNAYQLRALDFRRQN
                     MM"
     gene            complement(<559178..>560053)
                     /locus_tag="OSTLU_17454"
                     /db_xref="GeneID:5004496"
     mRNA            complement(<559178..>560053)
                     /locus_tag="OSTLU_17454"
                     /product="predicted protein"
                     /transcript_id="XM_001420513.1"
                     /db_xref="GeneID:5004496"
     CDS             complement(559178..560053)
                     /locus_tag="OSTLU_17454"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420550.1"
                     /db_xref="GeneID:5004496"
                     /db_xref="InterPro:IPR001345"
                     /db_xref="JGIDB:Ost9901_3_17454"
                     /translation="MTSARARGLASIAFASVCAGLGVQGVAVSPHARAEPSVAAAEAA
                     RLSKRKIIVDARARTSWDWNWDGRSSGGDPTPSDSVAASAAPTKVYWLVRHGQATEET
                     PETDAAADGERKLTDLGRKQASFTARRLKELIPSTASVKMTHSTMVRAKETADIIAAE
                     AFPNATRKSSELIREGAPVRPEPDTWRQAEHVHVTDAPRIEAGFRETFHRAPSPSSAA
                     TKPPPPEHEIVVCHGNVIRYSVLRALQLPPDAWLRIGLYNGSITRVEVRGDGGVSLRC
                     LGDAGYMTADMLTHN"
     gene            complement(<560289..>562223)
                     /gene="SUT2"
                     /locus_tag="OSTLU_2073"
                     /pseudo
                     /db_xref="GeneID:5004497"
     misc_feature    complement(<560289..>562223)
                     /gene="SUT2"
                     /locus_tag="OSTLU_2073"
                     /pseudo
                     /db_xref="GeneID:5004497"
     gene            complement(<562803..>563344)
                     /gene="RPL28"
                     /locus_tag="OSTLU_26642"
                     /db_xref="GeneID:5004498"
     mRNA            complement(join(<562803..562865,563042..>563344))
                     /gene="RPL28"
                     /locus_tag="OSTLU_26642"
                     /product="Ribosomal protein L28, component of cytosolic
                     80S ribosome and 60S large subunit"
                     /transcript_id="XM_001420514.1"
                     /db_xref="GeneID:5004498"
     CDS             complement(join(562803..562865,563042..563344))
                     /gene="RPL28"
                     /locus_tag="OSTLU_26642"
                     /note="Cytosolic 80S ribosomal protein L28; Cytosolic 60S
                     large ribosomal subunit protein L28"
                     /codon_start=1
                     /product="Ribosomal protein L28, component of cytosolic
                     80S ribosome and 60S large subunit"
                     /protein_id="XP_001420551.1"
                     /db_xref="GeneID:5004498"
                     /db_xref="InterPro:IPR002672"
                     /db_xref="JGIDB:Ost9901_3_26642"
                     /translation="MISHVPASDDFLWQVTKKHNAFTRASTSGHGARFSAEPGNVTAE
                     VSFRASGLANAKTIDIREHDGGKGKPAATCDGKKLCGSFKSQAGEVKIAAKARPDLEK
                     AALARISAINKAGRVKCAA"
     gene            <563531..>564123
                     /locus_tag="OSTLU_26643"
                     /db_xref="GeneID:5004499"
     mRNA            join(<563531..563572,563710..563772,563854..>564123)
                     /locus_tag="OSTLU_26643"
                     /product="predicted protein"
                     /transcript_id="XM_001420346.1"
                     /db_xref="GeneID:5004499"
     CDS             join(563531..563572,563710..563772,563854..564123)
                     /locus_tag="OSTLU_26643"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420383.1"
                     /db_xref="GeneID:5004499"
                     /db_xref="JGIDB:Ost9901_3_26643"
                     /translation="MAIDKLMMISGAGTLSYGVQMKFMPKVASKMYWKEGERNNIDTV
                     QSGWLGTVLLGSGALQVMSALDGECTKNQMGGAALAWAVTLPEYVAQRDDFKGPMLYA
                     NTAMATALTAVLVKSYLDKRDK"
     gene            <564302..>565765
                     /locus_tag="OSTLU_26644"
                     /db_xref="GeneID:5004289"
     mRNA            <564302..>565765
                     /locus_tag="OSTLU_26644"
                     /product="predicted protein"
                     /transcript_id="XM_001420347.1"
                     /db_xref="GeneID:5004289"
     CDS             564302..565765
                     /locus_tag="OSTLU_26644"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420384.1"
                     /db_xref="GeneID:5004289"
                     /db_xref="InterPro:IPR002618"
                     /db_xref="JGIDB:Ost9901_3_26644"
                     /translation="MGCASSKSSSLTLARARYASLPGPEQKTIVGALERAATSDADAA
                     RLCAALANVECERAVDVFQRSALAHETSTSGTLEPVRCDCEIVPGSDDAERWRRRGLE
                     CVKRGKLAVVLLAGGQGTRLGSANPKGMYDIGLPSKKTLFELQGERLAKLGALAGARA
                     PTWYVMTSPFTHDATVAFFKSRDYFGLNARDVVFFKQGTLPCFTEDGEIILKSFGEVS
                     EAPDGNGGIYAAMAREGVIADMRKRKIEHVYAYCVDNALVQVGDPTFVGCCVERECEA
                     GAKVIAKAYPTEPVGVFACRKNEATGAKEYHVVEYSEIPESLATAKDKKTGELKFNAA
                     NIALHYFSFDFLSRCCLDIALPHHVARKKIPYLDVNTGKTIEPSSPNGIKLEAFIFDT
                     YKYAKSVCVVRGDRALDFAPVKNAEGAGKDSPDTAREAILSLHARWILQAGGVIVDEN
                     DVPVPTDRARCEVSPAVSYAGESLASRLRVRVGGVVR"
     gene            <566308..>566949
                     /locus_tag="OSTLU_43913"
                     /db_xref="GeneID:5004290"
     mRNA            <566308..>566949
                     /locus_tag="OSTLU_43913"
                     /product="predicted protein"
                     /transcript_id="XM_001420348.1"
                     /db_xref="GeneID:5004290"
     CDS             566308..>566949
                     /locus_tag="OSTLU_43913"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420385.1"
                     /db_xref="GeneID:5004290"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="JGIDB:Ost9901_3_43913"
                     /translation="MELASKDDAKGRCPACRTEYDEDAISFDAVPEEELAANAQRAKK
                     REGKAGAANANANGTNGIKAGSGTGANAAQSQSRKHLQNVRVIQRNLVYVVGLSARCC
                     KEEVLRKNDFFGKYGKILKLQVSVNRNGSSSYAGRNADDTGSAYVTFYEENDAMQCIQ
                     HIDGTPLDGRILRACFGTTKYCNAFLKYQPCNNPDCLYLHDIGRDNDSFTKEEM"
     gene            complement(568220..569958)
                     /locus_tag="OSTLU_50892"
                     /db_xref="GeneID:5004291"
     mRNA            complement(join(568220..569669,569854..569958))
                     /locus_tag="OSTLU_50892"
                     /product="predicted protein"
                     /transcript_id="XM_001420515.1"
                     /db_xref="GeneID:5004291"
     CDS             complement(join(568237..569669,569854..569929))
                     /locus_tag="OSTLU_50892"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420552.1"
                     /db_xref="GeneID:5004291"
                     /db_xref="JGIDB:Ost9901_3_50892"
                     /translation="MASASARDAVKQFVTYFYRHIREKNVYETLTMYERSFPAIGERF
                     FKKTAWPTPDAIATYAENDPVFKMLYAELYYRHLHQATTPSANERKGSWENYCELFGA
                     LLHGDANMQLPNVWLYEMVDEFVYQFQSFRQFKGSSKRTSEELQAIKALDAQVWDRTS
                     MLNFLKALVDKSDIVRVLERERAGEISFAANEGYALDSSNVLPTLGYCAQIGICRLHV
                     LTGDYEGALAALDAVDLDKDGLFKKIPGAYVATSYHVGFAYFMLGRYTDAIRHFNESI
                     QYVERLRFGAARPHALPLLLKKQEQMYALIAITMALVPGQQYLLDGSVSLGLHQKYSE
                     KVNRMTSGEVAVFDDLFSYACPKFVASGDGDNSEAHKTQLKAFLDSVATHAVIPKLRG
                     YLRMYTSIKLDKLAALVETPVESLKASLKAFVQGYTVKEWTGGASALDGEEVYCGDMS
                     VILDGDVVRVEETKKAKSAREFFARTNQKLAASLEDLAQAKPLLIKPSAIVG"
     gene            <570214..>573162
                     /locus_tag="OSTLU_43971"
                     /db_xref="GeneID:5004500"
     mRNA            join(<570214..570341,570402..>573162)
                     /locus_tag="OSTLU_43971"
                     /product="predicted protein"
                     /transcript_id="XM_001420349.1"
                     /db_xref="GeneID:5004500"
     CDS             join(570214..570341,570402..573162)
                     /locus_tag="OSTLU_43971"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420386.1"
                     /db_xref="GeneID:5004500"
                     /db_xref="InterPro:IPR001900"
                     /db_xref="JGIDB:Ost9901_3_43971"
                     /translation="MHRVGKTFVKTTKRGQAVTKVRRERYLRDDVYVGCGDAAVEARE
                     RTIALIDSNVALHQMDALADARVTDVVICATVMEETRNKSRTSYERLRGLCKDKEKRF
                     YVFSNENHAETYAEDVAGESANDRNDRAIRKAAAFYRRAIPRAACERVTLVTNDRGNA
                     RKAREENIDVMSVIEWIQSISNDASLVDLVVPGGGAEIPEDERDAKRAKSGGGASASV
                     FEAYLDANDIKEGLASGKLIKGGVRTSRYNPFEAHVMNEGTGEGVLLSGRAAMNRAID
                     GDLVAVEILPESQWIRPGGMIITGTAEEDKETSSADVDAKDDAGGLAPETADETDVAV
                     AATKASGVVPTGKVVGIIRRNWRERGYAASVDMGRDGKGPTAAGGGFASRVLCVPSDR
                     RFPKIRIQTRQLEGLLDQRIVVVIDDWPADSMYPEGHYVKSLGLIGSVDAETQALLLE
                     NDVDDRPFAPAVYACVPALPWKVTDDHLAEPGREDLRDLLVCSVDPPGCKDIDDALSA
                     RDIDDERIEIGVHIADVTSFLFPDTAMDEEAARRGTTTYLVQRRLDMLPGALTTDICS
                     LVGGQERLAFSAFWIVQKSTMLPDETVKPRFTKSVIKSAAALTYEQAQTRIDDASLND
                     DLTLSLRRLRDVARQLRKRRMANGALTLASPEVRFEMDQQSSDPLDVGMYVTRETNQM
                     VEEMMLLANVSTAERILQAYPAAAMLRRHPIPEQKMFEPLLKAAKACGVDIDTQSNRT
                     LAASLDAAVRPEDAYFNTLLRLQATRCMSQAVYCSSGQYAGPERMHYGLAMPLYTHFT
                     SPIRRYADVIVHRLLSAAIGLCPRHKSLEDSDHVKSVADVCNVRHRNSQQAGRASVEL
                     HTLVFFRKRKIVADARVFKVRANGLVVFVPKFGIEGPVLFVEGENSDTATCTLDEDAM
                     TVTHKGKTWKVFDRLTVRVEVEQLPAHRSRLLITIVPDDTPRGEIASA"
     gene            complement(<573221..>573925)
                     /locus_tag="OSTLU_88691"
                     /db_xref="GeneID:5004292"
     mRNA            complement(<573221..>573925)
                     /locus_tag="OSTLU_88691"
                     /product="predicted protein"
                     /transcript_id="XM_001420516.1"
                     /db_xref="GeneID:5004292"
     CDS             complement(573221..573925)
                     /locus_tag="OSTLU_88691"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420553.1"
                     /db_xref="GeneID:5004292"
                     /db_xref="InterPro:IPR006055"
                     /db_xref="JGIDB:Ost9901_3_88691"
                     /translation="MQSPARDETRTYDPYAVSPRVVSIDVECVANGTTHNDRAVAQIA
                     IVDARTEQTLLNVYVKQEKPVVSYLTPLTGLTEQLLAERGVSFAEAVAATKKALDARC
                     VIVGQGVLKDVEQWLGLVRGVDYGDLIDLCGIWRVFNAQYKSWSVFGQDHLVRCLLAT
                     EVAETHDAAGDCVKSVRLYRHWYALKDDDEKLACEKAKLLAIAPEPSFSKRFPSFEGV
                     CQGNRRTCVCKAPFFS"
     gene            complement(574046..>578548)
                     /locus_tag="OSTLU_26649"
                     /db_xref="GeneID:5004501"
     mRNA            complement(574046..>578548)
                     /locus_tag="OSTLU_26649"
                     /product="predicted protein"
                     /transcript_id="XM_001420517.1"
                     /db_xref="GeneID:5004501"
     CDS             complement(574094..578548)
                     /locus_tag="OSTLU_26649"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420554.1"
                     /db_xref="GeneID:5004501"
                     /db_xref="InterPro:IPR005151"
                     /db_xref="JGIDB:Ost9901_3_26649"
                     /translation="MASVRAEAAMKITRALGDAGTGTPALGLSQYERDLARAKTAENR
                     ALRRAPRPPTSARTFSASGTPRLGRDASNATSGARNATTTGYPSEDDEDAYGDEQDGY
                     SDETEPERDERLVIKGVETVLERTRERLIDADSEDESVLGYYRLPTMASGKIAFVSET
                     NIWIASADGGVASRLSSTYSREGVPRLSPDGSHIAFLGLTYDGYDVFVAPTDGGVATQ
                     VTFGGKTQDIADWPEDNEILLISTAFSKSASTQLVTLNPDTRAMSPLPFARAIEGVKE
                     SGGCYVFVPLRQTSSTKRYEGGEQSRLWRWCRADSEAKPLTPEETWGVRGAWSPSVSV
                     AKGLENFIFFISDKSGVANVWSMTTDGEFAMQLTNECLFDVQEFTVDGDVLVYRRGGS
                     LYRRAISAHTARAPALGEEVELTYSLVSEFRKTMPTEIEDPYSSISELVLTNDGAFAA
                     FVIRGQVFHSALVPFLGTRVEKVTRYSGAVRYKHIQFVNDASSDGQPKLLALSDASGE
                     YEYVLLERQIEGGPWRETKITTGGKIKGAMEFSSISPDNTALLLADTDGNLKLVNLTE
                     TAVNTALYRTTEPEPISAKLAKRQSKPGRPDASPAGPQRPKPMLGRSPAARRAARRAA
                     RVGRRVSGRRASLHLASIGLGKEKSDDKASSVYADIDGIASIDTMLNGFRPEGVYGLA
                     WSPDSSYIAFAKDEENDFSSIHVLNVTSGESTRITTPSYNAHSPKFSPDGLYLYYFSD
                     QQIASGGSSPYGARGAEPMFYETSRLMCVPLRIGMTCPFFIGDELNPEGSVFDAEFGK
                     ALPTMISTKNIEQRAQVVPDLPEAQYLGFNIIGDGSGMLLTLVEDDQVIVAVYSMYSR
                     QILPLYPDPMAVVVSGDMQVFTLVTEQGVALLSAKGVLQPGLDQESALRGAEVWYPPD
                     TFGVIVNPREEWLQMYEEAMRNMRDAFYDPKLHGVDWTSITDRYRPLVYKISAKGELR
                     DILAQAFGELSALHVFVSVHSDDPVLPLGSPSACLGANFEMTPLGLKIAYIHESSGIL
                     EAPQSSLSRSSLYSHVKLQAGDIIAKIDGVLVNSTELPLSNLLRGKAGMQVLLEVIKS
                     PRSEQERKDEEDLQKMKELRMMQQMMGGGMGMASSQLGGASTATKTLRDPHMASLVRK
                     HATPGAPRLPLGQPRHSVGPLKNGDVHADAKLAGKEHKGDDENEQPAPTTEMIIVMPL
                     MLEECDVLEAADAVVQKREYVKSQTNDDVAYVYLEDMEQEGRGSSNSFDDFAAQFYPN
                     VRKKGLIIDVRRNAGGNIDTWLLERLRRVAWMFDTERSGAGDTTMQYTFRGKVVVLID
                     EQTSSDAEMFALGIQQLGIGPVIGERTWGGAIGYSGHPELRLVDGSGFTIPSFGPYIN
                     GDWAIEQKGVTPDVLVSNLPVATFHGKDAQLDAAIASILDLMGTESVELPPKPTYPNR
                     AFDSTSCAAGETGVDSAYLVSTQAAQDDASTPAVESATQVIQAETAVP"
     gene            <579194..>580482
                     /locus_tag="OSTLU_17464"
                     /db_xref="GeneID:5004502"
     mRNA            <579194..>580482
                     /locus_tag="OSTLU_17464"
                     /product="predicted protein"
                     /transcript_id="XM_001420350.1"
                     /db_xref="GeneID:5004502"
     CDS             579194..>580482
                     /locus_tag="OSTLU_17464"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420387.1"
                     /db_xref="GeneID:5004502"
                     /db_xref="JGIDB:Ost9901_3_17464"
                     /translation="MASRRRDAPRGDARASARRERGRDIRVTTTTFYRAESAQGRDLG
                     VLAALTTRRRLEVLDATCASGARAARYAEAGVLKSMHANDVNADVEDVVRENLADLLS
                     PASEVDVKLTFDDAQRVFARAWLEKTFYDVVDVDGFGAANFGDALKCVKYGGLFYATS
                     TDARALCGQNPETLSRAFGNAVVAPSRPGVNEIALRVFIGDVVRRGAAIGISATPLFS
                     LFHPHGPVFRVMFRVEKARGGAYDAFASNRDAAMGFVGFCDRCGDTSVVRAPLIDVYG
                     HTKTIAPGDDDATTQCARCRGEGSAEDTRSAALAISGPLWLRSLHDRDTVLAMIEAAD
                     AQGWFAADDESDTGPVKGQLSLRDLLDAFVGEADAGLERTPHHLRTDELGRRGRAKRV
                     PPRDVLITALRAEGFAATRSHIDPRGLKTNATMADVVA"
     gene            complement(<580593..>581639)
                     /locus_tag="OSTLU_17465"
                     /db_xref="GeneID:5004293"
     mRNA            complement(join(<580593..581399,581562..>581639))
                     /locus_tag="OSTLU_17465"
                     /product="predicted protein"
                     /transcript_id="XM_001420518.1"
                     /db_xref="GeneID:5004293"
     CDS             complement(join(580593..581399,581562..581639))
                     /locus_tag="OSTLU_17465"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420555.1"
                     /db_xref="GeneID:5004293"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Ost9901_3_17465"
                     /translation="MHDCAYDYYGRRVATCSSDRTIRIFDGEANRARGTHVATITGHD
                     GPVWSARWAHPKFGTLLASASFDHHVRVHKETEPNAFSLAYQTPTGTHDGSVNAIAWA
                     PHEYGAKLACASSDGSISVISYDGQASWTVEKIPNAHAIGCTGVSWAPAATPGALVSA
                     GGGASVVDAKRLVTCGCDNLVKIWRFDEERRVWGCEATLSAHGDWVRDVAWSENMGLP
                     MNTIASCGQDGKVFIWTQSEPRGAWQSRELHDFGAPVWRVSWSTMGNILAVSDGNNTV
                     TVWKESLDGAWNQISAAA"
     gene            <583157..>584497
                     /locus_tag="OSTLU_1531"
                     /db_xref="GeneID:5004503"
     mRNA            <583157..>584497
                     /locus_tag="OSTLU_1531"
                     /product="predicted protein"
                     /transcript_id="XM_001420351.1"
                     /db_xref="GeneID:5004503"
     CDS             <583157..>584497
                     /locus_tag="OSTLU_1531"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420388.1"
                     /db_xref="GeneID:5004503"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="JGIDB:Ost9901_3_1531"
                     /translation="YVHELRYVDLSDNLFTGDLPRDLFKMTQLQSLVLSGNRITGALP
                     EDVGALTNLRHIDLSANAMRGALPESLGALSELKVLYLGESGLENKNDFAGPIPESWR
                     RLKSLKSFSLAGNSNIGGTLPDWLLNNLDSLEELTLSRCGLTGEIPPNVDQMKSLRVL
                     DLGENSFSGVVPVESLSRLRRLKHLRLAGNALIGSLGPSVAHLREIETFDVSSNRLTG
                     DLPKELFSLRLLEILDVSNNAFTGTLAPPDGAETSNLRVVDAESNRLVGVLLDGEFFK
                     RAPHLRYLRLSNNRISGAFTDGAFDDAGELVELHASNNDLLGPLPDSVRHLTKLKSLR
                     LSGNARLGAGRGMPDALSECWNLRVVELARAGFEGDIADDAFARMRRLSSLNLAENKF
                     SGNVPASLKSAEFLRKLEIQNNAFVGEIPSWLVELPHLELADFTGNKFTGAIPDS"
     gene            complement(<585015..>586592)
                     /locus_tag="OSTLU_88696"
                     /db_xref="GeneID:5004294"
     mRNA            complement(<585015..>586592)
                     /locus_tag="OSTLU_88696"
                     /product="predicted protein"
                     /transcript_id="XM_001420519.1"
                     /db_xref="GeneID:5004294"
     CDS             complement(585015..586592)
                     /locus_tag="OSTLU_88696"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420556.1"
                     /db_xref="GeneID:5004294"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="JGIDB:Ost9901_3_88696"
                     /translation="MTTEGDEPAVAPDAAASGEKSEKLLKREAEKAAKKAAKDAAKAS
                     KAAAAEQRSRGQNAVVSVQCSTTPPVELEACSGTRDWYPEEFRLQRWLYEKFRATARA
                     TGFEEYDAPVLERQELYKRKAGEEITQQMYAFVDQDGVEVTLRPEMTPTLARMVLGRA
                     QSMMLPLKWFSIPQCWRFETTQRGRKREHYQWNMDIIGCKSVSAETELLFAVCEFFKS
                     IGITSADVGIKVNSRKVMASVLDSYGITAEKFAPVCIVMDKLDKIGADAVKAELVDTQ
                     GLPAETAAKIVECLACKTVSDLEALCGEGADQTGIDELKRLFELAEDYGYGDWLIFDA
                     SVVRGLAYYTGIVFEGFDRAGELRAICGGGRYDRLLSLYGAVTEVPACGFGFGDCVIV
                     ELLKDKGLLPELPKSIEFVVAAFNEGMQGKAMKAASMIRAGGSDVDMLLEPKKKVAST
                     FDYANRIGARYIVFVAPQEWENDMVRIKDLRADYTDKDEEKQLDVKLSDLGRVSEVLA
                     AHAAAIGAANKMGGMAV"
     gene            complement(586721..589302)
                     /locus_tag="OSTLU_26654"
                     /db_xref="GeneID:5004504"
     mRNA            complement(586721..589302)
                     /locus_tag="OSTLU_26654"
                     /product="predicted protein"
                     /transcript_id="XM_001420520.1"
                     /db_xref="GeneID:5004504"
     CDS             complement(586724..589225)
                     /locus_tag="OSTLU_26654"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420557.1"
                     /db_xref="GeneID:5004504"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="InterPro:IPR004342"
                     /db_xref="JGIDB:Ost9901_3_26654"
                     /translation="MVGFSKTLNRYRVGEWHTMYIDYEQLKTLVTEQKRIRELEAPAG
                     TTSADDDYRGRDSVDETQWNRYANAPTLTTELVEIEKTPGEREALETLWDALGMDYEP
                     MLAVKSTLQDNGNGVAEVLVRFYQALDVQANRCNSFYETLVEMQAKALATALKRVEVI
                     DASLNVATPVVSPRESEAEVDQGGETEIKPVRAGGRHSRHGSLSTTSGTDLHALFSKY
                     KEKDKITDSSEAAAKRAAQALVDTNTSSSTAKSRETTVKALLHDIKEIYYSVCMIQNF
                     STLNAVAIRKITKKMDKEAGTRTSGIYCTTCDELAFWPDLKESTFQCKTMAKLCEEAF
                     LTCHALIRRIEATKTGLVRFNTRTQSFATLRRKERVELLEKLRSTGNRIKDDGTKVNL
                     DRDSPDNPILYFTGGFFWGIAFPALLIPLWYLVVSCGLQSTDDRCRRELAAFVTLRGA
                     MLVFGQSLLWGPTVYVWQKLMVHWELIFFRSAGKTGLRAEYAIIATVLPWICFVIILT
                     TSTVLWSSGNANTQWVKPLTMALFIAFAVPVPASWEWADNPRYWFIQPPMTTRRFIGR
                     HVMRIMSTPWTNVVFPDFFIADQLTSQSTAIADLMITFHLASETASTRVIAATIPHYW
                     RFIQSFRRARDSVVHKRGGALSTHLLNAGKYGCSIVAIWLRFWALRSSQSDNHSSPPW
                     IVAYIATASSVCYSLYWDFFMDWSIFTFNPESKWRVEFLSRRSLVKSRAVWVAAIVFN
                     VFARSAGLFAAVPGLPMRHLSTQVLVTGLSAVEVIRRAIWNVFRVEAEHAVNCGGFRA
                     SADSQFDALEDPFVAHVDELSRELQYVPVKGGQKV"
     gene            <589550..>592843
                     /locus_tag="OSTLU_17468"
                     /db_xref="GeneID:5004505"
     mRNA            <589550..>592843
                     /locus_tag="OSTLU_17468"
                     /product="predicted protein"
                     /transcript_id="XM_001420352.1"
                     /db_xref="GeneID:5004505"
     CDS             589550..592843
                     /locus_tag="OSTLU_17468"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420389.1"
                     /db_xref="GeneID:5004505"
                     /db_xref="InterPro:IPR002921"
                     /db_xref="JGIDB:Ost9901_3_17468"
                     /translation="MRERAVRATPRAGPSTSTRRLKSSTPSRASIVRRARGKGDKDDA
                     STPTSSTPDPEELKLALARARTRLERSRKGLPALVEENESEGFTSDEVVEESSTAENG
                     DLRRIVSDWFGAVGGVFDSLNSDDEAMDARDENPAIAAQDDASSSRDDDEDSSAPVEA
                     GGWFRWKSPWRVSGVGESIATATSSWMPNKSVDGDGSFVVNTDAIGVSTASDGASSSS
                     SDRGVEPTNLLERVPLPPWIRQRVDGSSDGDSSSDDEEDDEMAYDTTISNENVGSAIR
                     DASETAVSVTTAAVEKLNSALLGIETVEKSAVKDGRFENNASALKALQESLRDARASA
                     KEAREASQSLEEAVREVSRAQEALRAEGDLKKEEAIKALEAAKAAVIRQATSSNAAVA
                     DALRQVSYVATRVEKLGSWTLEDDGEASSRALDTSKAQKRGVRRGLMGAIASARESAQ
                     DALVASELTQTVSRLASLATQRGDGKSKKSEELSEMVKPALQRVVANSLVPVESDIEI
                     GSARLACSLAAWVYYLPQMQHALPRNGLKLITSSLDVEEIIPSTEFRAGKSLLEESAW
                     RAEQAVEEAVVAARVAASKDAKLEIAASKAAAESAELAAQALKLAAELRSQDAQDEST
                     RLKARKTARAAKALAVEAQKKLDEASAIAERNKRKLKKWAMQRELADLQSQMQQTVIE
                     QQRKVEAERVRQERAENASLPVNFCVAAQDDTATLWVVVEGSTNFASWQANLTFQPVT
                     FEDPALGVEVHRGAYTAAKTMYRRIEKAVKEHVAKHGARARVRITGHSIGGSIAMIIA
                     MMLLVRNGAPRYAIADVWAFGAPYVMTGGEALMTRLGLPRSFIRMIMMGDDVVPRSFS
                     CYYPQWARRVLDNAPGPFNVNTSTANFLDEQMFYTPMGDLYVLQANNGSEHPLLPPGP
                     GLYILDGDGVYEMLATRARLGENEDGDDESWLNRRPSSKHWDEAAAYDVDGDFSSSED
                     EKANKLRMHQLACLTQSDAALTASLIISHIKQDELLPSEGGIAEVLNQRGRDAAQRVL
                     FNSPHPLSILSKPDAYGDAGIISRHHNPFQYAKSLSLSRKRKPGVADLISSLPKKSID
                     GAPASGGPR"
CONTIG      join(CP000591.1:1..593542)
//
DBGET integrated database retrieval system