GenomeNet

Database: RefSeq
Entry: NC_009367
LinkDB: NC_009367
Original site: NC_009367 
LOCUS       NC_009367             528469 bp    DNA     linear   CON 23-JUN-2017
DEFINITION  Ostreococcus lucimarinus CCE9901 chromosome 13, complete sequence.
ACCESSION   NC_009367
VERSION     NC_009367.1
DBLINK      BioProject: PRJNA19407
            BioSample: SAMN03081420
            Assembly: GCF_000092065.1
KEYWORDS    RefSeq.
SOURCE      Ostreococcus lucimarinus CCE9901
  ORGANISM  Ostreococcus lucimarinus CCE9901
            Eukaryota; Viridiplantae; Chlorophyta; prasinophytes;
            Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus.
REFERENCE   1  (bases 1 to 528469)
  AUTHORS   Palenik,B., Grimwood,J., Aerts,A., Rouze,P., Salamov,A., Putnam,N.,
            Dupont,C., Jorgensen,R., Derelle,E., Rombauts,S., Zhou,K.,
            Otillar,R., Merchant,S.S., Podell,S., Gaasterland,T., Napoli,C.,
            Gendler,K., Manuell,A., Tai,V., Vallon,O., Piganeau,G., Jancek,S.,
            Heijde,M., Jabbari,K., Bowler,C., Lohr,M., Robbens,S., Werner,G.,
            Dubchak,I., Pazour,G.J., Ren,Q., Paulsen,I., Delwiche,C.,
            Schmutz,J., Rokhsar,D., Van de Peer,Y., Moreau,H. and
            Grigoriev,I.V.
  TITLE     The tiny eukaryote Ostreococcus provides genomic insights into the
            paradox of plankton speciation
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 104 (18), 7705-7710 (2007)
   PUBMED   17460045
REFERENCE   2  (bases 1 to 528469)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (22-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 528469)
  AUTHORS   Grigoriev,I., Grimwood,J., Aerts,A., Salamov,A., Zhou,K., Lou,Y.,
            Pitluck,S., Schmutz,J., Myers,R.M., Lucas,S., Detter,J.C., Glavina
            del Rio,T., Putnam,N., Rokhsar,D. and Palenik,B.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (21-FEB-2007) US DOE Joint Genome Institute, 2800
            Mitchell Drive B100, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP000593.
            URL -- http://www.jgi.doe.gov/ostreococcus
            JGI Project ID: 3436080
            Source DNA was provided by Brian Palenik (bpalenik@ucsd.edu))
            Stock culture is available from CCMP (http://ccmp.bigelow.org/) as
            strain number CCMP2514
            Contacts: Brian Palenik (bpalenik@ucsd.edu))
                      Igor Grigoriev (ivgrigoriev@lbl.gov)
            Annotation done by JGI-PGF
            Manual curation done by the Ostreococcus User Community
            Finishing done at Stanford/JGI, Stanford Human Genome Center
            (www-shgc.stanford.edu)
            The finished chromosome has no gaps. The sequence has less than one
            error in 100,000 bp.A
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. It is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..528469
                     /organism="Ostreococcus lucimarinus CCE9901"
                     /mol_type="genomic DNA"
                     /strain="CCE9901"
                     /db_xref="taxon:436017"
                     /chromosome="13"
     gene            <487..>1578
                     /locus_tag="OSTLU_6409"
                     /db_xref="GeneID:5005190"
     mRNA            join(<487..894,985..>1578)
                     /locus_tag="OSTLU_6409"
                     /product="predicted protein"
                     /transcript_id="XM_001420841.1"
                     /db_xref="GeneID:5005190"
     CDS             join(<487..894,985..>1578)
                     /locus_tag="OSTLU_6409"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420878.1"
                     /db_xref="GeneID:5005190"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="JGIDB:Ost9901_3_6409"
                     /translation="TTRAPVGLRGSLNMGNTCFLSSILQTLVSTAPVVEYFLRENHAR
                     RAGGCEIDDCVACAFDEYVSKAYDDARVATSSAPSTASTALVAGELLYAWWVNEPSMA
                     KEQQQDAHEFFLSFLSVAHANVLGRSIRPRKKRAEDAATCECVFHTAFAGVLRSDIAC
                     ASCGASTTTREATTGVSLDVPPATKSSRVSLMECLSNFTAMETIENTSRRVCSACAVV
                     SESHGKQTRFERVPKILNFHFKRFEGDFKSMRKNDIHVDFPFDLDMSPYHAHDCKETN
                     HDAAYELYSVVQHSGVLEGGHYVAYVRRDGAWFLCDDAVVREADENEVKSSQAFMLFY
                     "
     gene            <1732..>5265
                     /gene="BRAT3501"
                     /locus_tag="OSTLU_17718"
                     /db_xref="GeneID:5005085"
     mRNA            <1732..>5265
                     /gene="BRAT3501"
                     /locus_tag="OSTLU_17718"
                     /product="predicted protein"
                     /transcript_id="XM_001420842.1"
                     /db_xref="GeneID:5005085"
     CDS             1732..5265
                     /gene="BRAT3501"
                     /locus_tag="OSTLU_17718"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420879.1"
                     /db_xref="GeneID:5005085"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="JGIDB:Ost9901_3_17718"
                     /translation="MTRPRAASRSARRSYAESEQASSEDDEHRADDAEVDAEEKFESE
                     EEEEPLKRRRRATTTTTTTYGTTMVRREKRRSSRQENKPRKRYVDDDDDDEFVAEQDD
                     DDDDEFEEEDEEDFIEDESDDEPVRRSTRARERVNRLSPTFKQRNDDDEEEELEDGEE
                     ETDDDDIGDVANKTYPKRTRGPPPERFAPQRPESGKDRSNSGRPGLFERRGTTWKDDR
                     DKTSSRERSRRQTSGRWIDDSEDSDDGEFNLGAGAMDAFKAPPAYPLAGAGPSSAAPG
                     PNVDAEITPVTVDPTLSFSSVGGLDKYVDALKEMVFLPLLYPEVFARFKMSPPRGVLL
                     YGAPGTGKTLIARALAASCSRAGSEVAFFMRKGADVLSKWVGESERQLRLLFEEAQKR
                     QPAIIFFDELDGLAPVRSSKTDQIHNSLVATLLALMDGLDNRGRVVVLGATNRVDSID
                     GALRRPGRFDRELAFPLPGVKARGEILRIHTKAWEQRPSEALIDDLAAKCVGYCGADL
                     KALCTEAAVHALRRRYPQIYESDERLSIDPKQVIPSRADFRAALAAIVPASHRAARTH
                     ARPLTPLQKPLLEGVLEACLESIRKTFPPATFITLDGDGEAVGVNSGARQITDAVAEE
                     EDEDILAQAAVSDEAAGALPSESAATAALEFMRRPPCQRTALCIHGAETSGYNQLTSA
                     LLHALEQFPVHAIGMPSLLGDSGRSPEEALVTAITEARRAAPSILYLPEIRLWWESST
                     PTLRAALTTLLRDIPADLPVMLITTADVATVDELEESLRASFASVRWNPIAMPTTYDD
                     ASLTKFYRPLCDAAFNIAQRRDVAASRGELIDGRAPASALKREVLTRAPRPTEGSGRE
                     AVKRGSQKLSQAAIAAENHLLRQQRMFLRDVVTKLLYKKAWNVLAAPINDDELPGYSQ
                     RVTDPMDLSTLLWKVDSEKYTTIDAFLKDANLITKSAHEYWGERPESNDGRQMLSKAH
                     ALEDTIAQMVSALDPQLVTRCNEIDQARKEREGKTSAHASPAEAAADSGSDRDRPTRK
                     RDEAAKGAPVWQNPDFVKDPEALARQLKRKAREEEERKNGAVDEKAADDPTPMEQDAA
                     EDVVAAQPPTPVSKPGPPAKEDAEVEKIKTSAVATFVKAARKSGYDFTRLESSASDIA
                     RVANDAASKVSERGLRADALKEAFAKLYGEA"
     gene            complement(<5533..>6063)
                     /locus_tag="OSTLU_7305"
                     /db_xref="GeneID:5005086"
     mRNA            complement(<5533..>6063)
                     /locus_tag="OSTLU_7305"
                     /product="predicted protein"
                     /transcript_id="XM_001420987.1"
                     /db_xref="GeneID:5005086"
     CDS             complement(<5533..>6063)
                     /locus_tag="OSTLU_7305"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421024.1"
                     /db_xref="GeneID:5005086"
                     /db_xref="JGIDB:Ost9901_3_7305"
                     /translation="SQKKRDQAAARKQYNNEWQIGLMNAPCADPGFCCYAFFCGQCAA
                     YGQRKLQMGPAWPSQYTCCNGGTCISGRCGEQSNPELCLCCEVVCCFPSAMATTRFMI
                     QDEQRVMNTQCDNCLIGFMLLTQQIAFCLRCVAMVSQNPDIERLADAVDCLADLTYAS
                     VCACMLTQQQVQIRYRD"
     gene            complement(<6523..>7193)
                     /gene="PRPS21"
                     /locus_tag="OSTLU_26982"
                     /db_xref="GeneID:5005055"
     mRNA            complement(join(<6523..6702,6908..6991,7131..>7193))
                     /gene="PRPS21"
                     /locus_tag="OSTLU_26982"
                     /product="Plastid ribosomal protein S2 small ribosomal
                     subunit"
                     /note="imported to chloroplast"
                     /transcript_id="XM_001420988.1"
                     /db_xref="GeneID:5005055"
     CDS             complement(join(6523..6702,6908..6991,7131..7193))
                     /gene="PRPS21"
                     /locus_tag="OSTLU_26982"
                     /GO_component="plastid small ribosomal subunit"
                     /note="Chloroplast ribosomal protein S21; Chloroplast
                     small ribosomal subunit protein S21; imported to
                     chloroplast"
                     /codon_start=1
                     /product="Plastid ribosomal protein S21 small ribosomal
                     subunit"
                     /protein_id="XP_001421025.1"
                     /db_xref="GeneID:5005055"
                     /db_xref="InterPro:IPR001911"
                     /db_xref="JGIDB:Ost9901_3_26982"
                     /translation="MAFILGGFSHIFAFKGAFQAEVTVGENENAESAIRRFRKAVMSS
                     GHIQETRRRRYFENKQDILKRKQSTPRNKKGGKPKTAAQAIAEKEAAALNPQGQRAGG
                     RARFNN"
     gene            <7725..>9371
                     /locus_tag="OSTLU_17719"
                     /db_xref="GeneID:5005056"
     mRNA            <7725..>9371
                     /locus_tag="OSTLU_17719"
                     /product="predicted protein"
                     /transcript_id="XM_001420843.1"
                     /db_xref="GeneID:5005056"
     CDS             7725..9371
                     /locus_tag="OSTLU_17719"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420880.1"
                     /db_xref="GeneID:5005056"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Ost9901_3_17719"
                     /translation="MTMRAPAASAIGAMHHRASTRAASTSSTRGGKPTRCSSATSTSR
                     TASWVDRSARRARTTRRKTIVRDGAEFANDSGGYERYLSSDAAEGGEGDGEDGAAARA
                     KEGAQMSTSSAQAREREREVGASYDDEFVALVRARKEATEEETRKRWNEGAATPRVAY
                     DLGQDYIRRVSVAYPYAVVGSARGDVAVCDVVDASALAVSPAAHKKDWSDVDARPLGE
                     RVLLGAHDGGAVTAVAITKDAPKQEKYDFAHVASGGRDGVVRLYKACKNSAALHELGC
                     ANHDDVVTGVTFARGSLWSVALDGRLCRWSLATSHAKVKSAKHAKESLIDADEYVREQ
                     APALTKEGEWRSGQPTLCLNACESSGLISIGNADGSAALLSAEVSHTTIGETAVVNAW
                     IAHEGSTVRAIAHGPNGNTVVTGGGDGVIRVWYLVEEQTVGGFRSMNRQKLGLPQVTP
                     ILVAELRGHTSAVVSLSTGCPGRLVSGAHDGTIRVWDLDVKPPPKVANIKAVRRDARY
                     AVLGHTIWLGGTYADAERIICDGANNVLLEYDFSNAPQDV"
     gene            <9573..>10403
                     /locus_tag="OSTLU_13156"
                     /db_xref="GeneID:5005087"
     mRNA            <9573..>10403
                     /locus_tag="OSTLU_13156"
                     /product="predicted protein"
                     /transcript_id="XM_001420844.1"
                     /db_xref="GeneID:5005087"
     CDS             9573..10403
                     /locus_tag="OSTLU_13156"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420881.1"
                     /db_xref="GeneID:5005087"
                     /db_xref="InterPro:IPR000304"
                     /db_xref="JGIDB:Ost9901_3_13156"
                     /translation="MRVGFIGYGNMADALACGFVSANMIKFTDLTMCNKSNVERREAF
                     AKRGGVVAPDAVSVAKSSDVVFLAVKPPYIKSVLEEVYGGCDADELKPKVFVSVAAGV
                     TLDVMEGVWTSKNATPPPMVRVMPNTPCLVGAAASGLCVGSTCSDDDRNKALALMSAV
                     GVCKVIMESQMSALTGVSGSGPAYIFILIEAMADGGVRAGLPRDVALQLAAQTFYGAA
                     KMVLETGEHPGVLKDKVCSPGGTTITAVHELEKAGVRQAMMNAVVAAAARGDELAKLS
                     "
     gene            complement(<11563..>11850)
                     /locus_tag="OSTLU_9404"
                     /db_xref="GeneID:5005088"
     mRNA            complement(<11563..>11850)
                     /locus_tag="OSTLU_9404"
                     /product="predicted protein"
                     /transcript_id="XM_001420989.1"
                     /db_xref="GeneID:5005088"
     CDS             complement(<11563..>11850)
                     /locus_tag="OSTLU_9404"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421026.1"
                     /db_xref="GeneID:5005088"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="JGIDB:Ost9901_3_9404"
                     /translation="EQEDELLRRQIERLGGPGNWTAIAEALTGRSSKSCRLRWCNQLN
                     PSVKRGPFTAEEDSTILAQHAIHGNKWAVISRSMPGRTDNQVKNRFNSTLRR"
     gene            <12809..>16951
                     /locus_tag="OSTLU_41836"
                     /db_xref="GeneID:5005057"
     mRNA            join(<12809..16504,16769..>16951)
                     /locus_tag="OSTLU_41836"
                     /product="predicted protein"
                     /transcript_id="XM_001420845.1"
                     /db_xref="GeneID:5005057"
     CDS             join(12809..16504,16769..16951)
                     /locus_tag="OSTLU_41836"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420882.1"
                     /db_xref="GeneID:5005057"
                     /db_xref="InterPro:IPR001241"
                     /db_xref="InterPro:IPR002205"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="JGIDB:Ost9901_3_41836"
                     /translation="MIEQKPTSKKPKSPLGNATNKTKNNKSVEEIYQKKTQLEHILLR
                     PDTYVGSCERAEEKAWVYDAATKSLTHKQVSFVPGLYKIFDEILVNATDNKVRDPKMK
                     ELRVDIDVEQGLIRVYNDGNGIPVEMHKDEGVYVPELIFGHLLTSSNYDDNEKKVVGG
                     RNGYGAKLANIFSTEFIVETCDGSRGKRYRQVFKNNMSVKGEPELSKCKKSENWTCIT
                     FKPDFEKFGMESLVNEDVAALMCKRVYDAAGNIGKNTNIYLNGEKLEVKGFSDYVSLY
                     LDGQANAPKIFEKTMDRWEVCVTISDTAQFQQCSFVNGICTMKGGTHVNSVADQISQK
                     LLEKIQKKEKSCKNLKAFQVKNHLWVFVNALIENPAFDSQTKETLITRPNKFGSAYAP
                     SDAIIKKLMESGVVDNIMSWAQFKQSKELKKTDGAKRSRLTGIPKLDDANDAGGRNSE
                     SCTLILTEGDSAKALAVSGLSVVGRDKYGVFPLRGKLLNVRDASHEQIKNNTEINHIK
                     QILGLQHGKEYDSAKSLRYGKLMIMTDQDHDGSHIKGLLINFLHAHFPSLLKIPGFLL
                     EFITPIIKATKGKQSKVFYTMPEYEAWKEANDGTSGWSIKYYKGLGTSTANEAKEYFA
                     SLDHHRKSFVWQSDGDGDLIDMSFSKKRVVDRKAWLTAYEPGTFLDMTGEDIRYDEFI
                     NKELILFSRADLLRSIPSMVDGFKPSQRKVLFSCFKRKLKSDIKVAQLSGYVSEHSAY
                     HHGEASLAMTIVNLAQDFVGSNNINLLVPSGQFGTRLQGGKDHASPRYIFTRLHEVCR
                     AMFPECDDALLNYLDEDGQRIEPDYYYPVLPLVLVNGAEGIGTGWSTSIPNFNPRDLI
                     ANIRLVLEGESPVQMHPWYRHFKGSITEELVKGETRYNVTGSYNIRDECTLEVTELPL
                     RSWTSDYKEFLEEMLVPKTKTAKPFITDYKEYHTDSTVHFVITMPPENLAAAQASGIE
                     KKFKLSTKLNITNMHLFNEQGVITKYSSPVAILEAFVPLRLKAYSQRREMLIRLAESQ
                     LKRLSNKMRFILAVVDGSLVVNRKKKQELIAELEALCYDRLPKTDKGSVAELDEDGEF
                     IANDVAGSYDYLLGMPLWNLTLEKVDELCAEKEAKEAEVAELHKTTEKDLWMKDLDTL
                     EQTLELLDAEDEESRIVLEKQQRAAARNNTAAGKKAAKKKMAKQRAANSSDEDEWDDD
                     FSDDDFEIAKPKKAAAKPKAAAKPKAAPDFGGESDSEVVAPVAPRSTARPARARTAKT
                     YVVDDSDDSEDDVSEEDDDDDDESDFSESE"
     gene            complement(<17043..>18530)
                     /locus_tag="OSTLU_41794"
                     /db_xref="GeneID:5005089"
     mRNA            complement(<17043..>18530)
                     /locus_tag="OSTLU_41794"
                     /product="predicted protein"
                     /transcript_id="XM_001420990.1"
                     /db_xref="GeneID:5005089"
     CDS             complement(17043..18530)
                     /locus_tag="OSTLU_41794"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421027.1"
                     /db_xref="GeneID:5005089"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Ost9901_3_41794"
                     /translation="MASNKRARATPATTPATTLADANLIAQLVDVDGVAAGPELDLPP
                     DVGARELQSLLRELLRASSANPEDDDRLTTPYAFYVDGEEVTGALAATIVERKISVEQ
                     VLKIVYQPQSVFRVRAVTRCSAAIAGHAEAVLSVAFSSDGKHLASGSGDSTIRMWNLD
                     SQAPKHTLKGHTNWVLCIAWSADNVYLASGGMDSAVRLWDPITGEARGGPMKGHKKHV
                     TALAWEPAHVAYPVVRFCSASADGSVRVWDAVRRACLFTMSAHTKAIASVKWGGEGLI
                     YTASRDTTIYVWDANDGKVVRQLKGHGHWVNSLALSTEYALRTGPYDHTGKKPENDAQ
                     AKAQALTRYKAATGGKPERLVSGSDDYTMFMWEPSTTKTPLQRLTGHQQLINHVLFSP
                     DGRYFASASFDKGVKLWDGLTGKFITSFRGHVGAVYQLAWSADSRLLMSASKDSTMKV
                     WDARLKKLKEDLPGHADEVYAVDWSPMGTKAASGGKDKMLRLWMH"
     gene            complement(<18737..>20602)
                     /locus_tag="OSTLU_93571"
                     /db_xref="GeneID:5005058"
     mRNA            complement(<18737..>20602)
                     /locus_tag="OSTLU_93571"
                     /product="predicted protein"
                     /transcript_id="XM_001420991.1"
                     /db_xref="GeneID:5005058"
     CDS             complement(18737..20602)
                     /locus_tag="OSTLU_93571"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421028.1"
                     /db_xref="GeneID:5005058"
                     /db_xref="JGIDB:Ost9901_3_93571"
                     /translation="MSVATSRAPSRAPASRPRRRARRGRRATTRALLATTRGTCTAHG
                     LDGAFELTHDARGTTFVERVTLARGDDADALTTESGRDDDGTTWDADWYGDRRATTLD
                     GAHASAMMTWVRTNQWNDELAAAGRLRRKKLAEGVEATAALRRYGVEAPTPAKVEKRG
                     RGRAKRRTGRGFGGFGGFGASSDARAPRVPRCATSVYAVSMLDGGRVGGRVFVDEATG
                     FAWRAEFYHQRGVETWMFEGWERVAVSETDEVAVPRLAHRTHAEGQVTTFRAESTSSA
                     SEDRETYAALPSSSVAPWASERAWSGDDATIATCRGEGGHILVKATLESSDDGGASLT
                     DWFVLDTASTGLAVAPHVADAVSMPSFGSMAIVGVAAPLEGALRRGKKLSVGALSLSS
                     PIFMEQNLDGALRVPNGERLAGVIGLSVLGAHAIVRIHAPLRVPGSRDPPKLDVRVFR
                     PEAYEPSAEIERAWEPVVFIDGVPYVECSYTIANDGFQGVTEMTTERRGLFKLALGTG
                     GVGVVLGDRVAVEADVANRTKALQPGGIMSGPGESAGRLQRVGDEIVTGRIETVRFKS
                     FEFKNVRAVVHLDGAPPDADLSPHADGAACADLFRGCEFVLDLRPSNPRIAVCPP"
     gene            complement(20698..21846)
                     /locus_tag="OSTLU_51237"
                     /db_xref="GeneID:5005059"
     mRNA            complement(20698..21846)
                     /locus_tag="OSTLU_51237"
                     /product="predicted protein"
                     /transcript_id="XM_001420992.1"
                     /db_xref="GeneID:5005059"
     CDS             complement(20756..21838)
                     /locus_tag="OSTLU_51237"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421029.1"
                     /db_xref="GeneID:5005059"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="JGIDB:Ost9901_3_51237"
                     /translation="MRPRVASRSTRRDRRASSARASPTAPNVRTILGTMTFGWRHASE
                     ACDDDASARMLDAFARAGHDEIDTAIAYANGETERILGRVDAGRRARVDTKANPWPGG
                     TMTPSAGRGGLGANELRAQVRRSVESLRGTKIRTLYLHAPDADTTLEEALRECERLRV
                     EERAFEDVGLSNFSAWETVKAHELCEKYGWKRPTIYQGMYNALTRNVEAELVPALRAT
                     KMRFAAYNPLCGGLLTGKYKGNTDVGAVSGGRFAGNDMYQSRFWLPCYHEAVAEVVEA
                     CEKRGVAPADASLRWLYRHSALDGAEGDAVIVGASSAAQLEANLASAAREEPLHRDIL
                     DAFDAGWEKCRASAAPYFRGHCKIAR"
     gene            <24012..26286
                     /locus_tag="OSTLU_51262"
                     /db_xref="GeneID:5005060"
     mRNA            join(<24012..26236,26256..26286)
                     /locus_tag="OSTLU_51262"
                     /product="predicted protein"
                     /transcript_id="XM_001420846.1"
                     /db_xref="GeneID:5005060"
     CDS             24012..25178
                     /locus_tag="OSTLU_51262"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420883.1"
                     /db_xref="GeneID:5005060"
                     /db_xref="JGIDB:Ost9901_3_51262"
                     /translation="MVEGLAKAGVNVIRLGRPEAVRPDLARYQIENAIPPGATKHEAY
                     EAQLRAVRYAQAVCATCSGSGSDFLDRINFSAVMLDEASQVTEPMALVPLANGCQQLV
                     LVGDHKQLPPTVVSREAELAGMTLSLFDRLIRAGVKPYLLDTQFRMHPAISYFPSLSF
                     YKGLVKSGTPAAERPAPKGFAWPIPSVPIAFCPSPQDAMETNDNMSYSNKVEAERVMK
                     ILTDLLQAKELRECNIGIVTPYASQVRLIRSMLRARGVRTGVDRETGEAGVEVSSVDG
                     YQGREKELMIVSTVRANNLNTIGFVADARRCNVTLTRARRGVIVVGHASTLSRDRRTW
                     GPWVRWVQKSGLTLGVKGRREDIEAVRAIEADVQNAPARRLVPPPRGLVPRGMR"
     gene            <26466..>27278
                     /locus_tag="OSTLU_26992"
                     /db_xref="GeneID:5005090"
     mRNA            <26466..>27278
                     /locus_tag="OSTLU_26992"
                     /product="predicted protein"
                     /transcript_id="XM_001420847.1"
                     /db_xref="GeneID:5005090"
     CDS             26466..27278
                     /locus_tag="OSTLU_26992"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420884.1"
                     /db_xref="GeneID:5005090"
                     /db_xref="JGIDB:Ost9901_3_26992"
                     /translation="MALDVASRCVANLRRVDARRRFPRRRAVASSSARDLLDAIAREA
                     DDDAIRARVDELTETFELDRAFGGDGDAVAAALHGTWRLAHASKSAFDPRAPLGRRTD
                     ATTPGLEAAFATLFDDANASGSGSGSANASGSSSPIQRAVLSKLSDGGFAVRQGVRLR
                     GEARKRRVDQAVCFGDGYGWFRLSANARLDAREGRIDYGFDLAYVDLKKPIAVRVPYP
                     VPFRLLGKEAMGYLTCDYVGDGVRVCTGNKGTTFVFVKEDDDALPYANEFYD"
     gene            <28108..>28770
                     /locus_tag="OSTLU_41681"
                     /db_xref="GeneID:5005091"
     mRNA            <28108..>28770
                     /locus_tag="OSTLU_41681"
                     /product="predicted protein"
                     /transcript_id="XM_001420848.1"
                     /db_xref="GeneID:5005091"
     CDS             28108..28770
                     /locus_tag="OSTLU_41681"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420885.1"
                     /db_xref="GeneID:5005091"
                     /db_xref="JGIDB:Ost9901_3_41681"
                     /translation="MPSLGVPAWRVAVKAALKKNGKSACAKFAQLATVRASTGAPAVR
                     TVVFRGFGDAFRDDDDDDARDDGDEANALTFCADARSEKIRDIAGDARGEIAWYFPET
                     REQFRVTGTLACATSETAAKDARGEARRRNLWRKMRRGARGQFMWPAPGETRAEVGEG
                     GRDPHDVDEDDARLDDETVGEHFALVALRADRIDHLSLRKNERVMHEIVDGTWTSTRV
                     NP"
     gene            complement(<28887..>29690)
                     /locus_tag="OSTLU_93572"
                     /db_xref="GeneID:5005092"
     mRNA            complement(<28887..>29690)
                     /locus_tag="OSTLU_93572"
                     /product="predicted protein"
                     /transcript_id="XM_001420993.1"
                     /db_xref="GeneID:5005092"
     CDS             complement(28887..29690)
                     /locus_tag="OSTLU_93572"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421030.1"
                     /db_xref="GeneID:5005092"
                     /db_xref="JGIDB:Ost9901_3_93572"
                     /translation="MRRLATPRVAVAGVGRREDARGNRRDVARARRSETASTTRSETR
                     TTTRDGIEKSSATTRATTTTDDGGAGGWFGGGGGWLGGGGGGGFGGDGDDATRGARRA
                     AFALAAATATGAGGAREANATTTTTRRRGDGGRRATKLGDMATSALYGFAAFYGIKIA
                     LKRLFAPFALFWGTTQLLFRMHAVKISPAMLHERLVRPYLPIEYQKSLNDFGVAAMKT
                     KAAKNAMRDGWWDKQERRFWTCAHRLLPACDSAMGERAFVFGVILAGLA"
     gene            <29759..>30883
                     /locus_tag="OSTLU_17729"
                     /db_xref="GeneID:5005061"
     mRNA            <29759..>30883
                     /locus_tag="OSTLU_17729"
                     /product="predicted protein"
                     /transcript_id="XM_001420849.1"
                     /db_xref="GeneID:5005061"
     CDS             29759..30883
                     /locus_tag="OSTLU_17729"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420886.1"
                     /db_xref="GeneID:5005061"
                     /db_xref="InterPro:IPR000905"
                     /db_xref="JGIDB:Ost9901_3_17729"
                     /translation="MPDAASTRAAPTASTASSTTLAIGFEGSANKISVGVARADGTIL
                     ANPRETYVTPPGTGFLPRETAKHHRDVVVELARRALEEAKASMRDVDAVCFTRGPGMG
                     APLTTAAACARTLALLFDKPLVGVNHCVAHIEMGRLVTGARDPVVLYASGGNTQVIAY
                     NERRYRIFGETIDIAVGNMLDRFARVCGLSNDPAPGYNIEQEAKKGTKFIEGPYGVKG
                     MDVNLSGILTFYETYAKEHLGAGEVTVADLCMSMQETVFSMLVEITERAMAHTNAKDV
                     LIVGGVGCNLRLQEMMAIMASERGGKLYGLDEDGRMDDRFCIDNGAMIAYTGLLQYEN
                     GETTPLEKTWCTQRFRTDEVLVTWRSEAVKRPASCEPPTV"
     gene            complement(<30938..>32425)
                     /locus_tag="OSTLU_93573"
                     /db_xref="GeneID:5005093"
     mRNA            complement(<30938..>32425)
                     /locus_tag="OSTLU_93573"
                     /product="predicted protein"
                     /transcript_id="XM_001420994.1"
                     /db_xref="GeneID:5005093"
     CDS             complement(30938..32425)
                     /locus_tag="OSTLU_93573"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421031.1"
                     /db_xref="GeneID:5005093"
                     /db_xref="JGIDB:Ost9901_3_93573"
                     /translation="MTSDDANEDDARRRPSSDVIDELASLFLDEDYANRRRVVDDAST
                     SKDDANTPARRGESSPLMRSSSATTPARRTAPPATVRGWFSELWRSLLAEDDDEWADA
                     RRGRGGTPTGARAIENIDLGMEQEMEVVLRKTATPASSERLRRTSSSFGNRRRSSGSG
                     GGGYFFGDDEDEIVRSSSSSSDEEVSSRFVARDLPDVFPGKKVMTVGEGVMDEIAAES
                     QRLWGAPNAFVTADDCRRAVRSLAEAKVVCAAMDERLEAWVVKTRVRDADGEMFDGDD
                     LLEYWRRRAKDMCEVFLKTLVNVGGRLESCSTTPKHRDSLLRVVEGYVTGGVQRKLFK
                     VGIHPKFAREDEFTAIRLEQLASLPIDALGLEVERYAKVVDDEDIIASLSSLGDLSSP
                     SHMATRLVDVSTRIRQAGGDEDDPMNADDLLLVLLALVARAKPERAYSLVRYVETFHA
                     LVSNAHKGEEGFALANFSGAVRYARGDACGAIIEKSSTARLEHTQ"
     gene            complement(<32718..>33376)
                     /locus_tag="OSTLU_95041"
                     /db_xref="GeneID:5005062"
     mRNA            complement(join(<32718..33020,33326..>33376))
                     /locus_tag="OSTLU_95041"
                     /product="predicted protein"
                     /transcript_id="XM_001420995.1"
                     /db_xref="GeneID:5005062"
     CDS             complement(join(32718..33020,33326..33376))
                     /locus_tag="OSTLU_95041"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421032.1"
                     /db_xref="GeneID:5005062"
                     /db_xref="InterPro:IPR000782"
                     /db_xref="JGIDB:Ost9901_3_95041"
                     /translation="MIAKAASYSLFGAAITKSGVEAEFTCEGPITVFAPNDDAFADFC
                     KAQGLSKVEIMTYDGLKDVVLNHVAKGAFTAANMPAEVTMVSGKTVATSTFNYKKNDI
                     KVDNATIHAITAVVA"
     gene            <35521..>36171
                     /locus_tag="OSTLU_7186"
                     /db_xref="GeneID:5005063"
     mRNA            join(<35521..35913,35998..>36171)
                     /locus_tag="OSTLU_7186"
                     /product="VIC family transporter: potassium ion channel"
                     /transcript_id="XM_001420850.1"
                     /db_xref="GeneID:5005063"
     CDS             join(<35521..35913,35998..>36171)
                     /locus_tag="OSTLU_7186"
                     /codon_start=1
                     /product="VIC family transporter: potassium ion channel"
                     /protein_id="XP_001420887.1"
                     /db_xref="GeneID:5005063"
                     /db_xref="InterPro:IPR005821"
                     /db_xref="JGIDB:Ost9901_3_7186"
                     /translation="IELFSVIMFTIEYVLRSLCCPNYRKFVRQPLNVVDLCAILPFYL
                     EAIFPLSVSSLQIIRTIRLVRVLRIVRLGVKFGRLSIIGSSIRECIDMLLVSLAIGSV
                     CTVIFSTLIYYAEHGDYVASLDIYARRTDSPYKSIPASFWWCMVTLMTVGYGDHVPAT
                     GWGKLVACLTMVTSVLLLALPISVIGTEF"
     gene            complement(<36964..>37773)
                     /locus_tag="OSTLU_5006"
                     /db_xref="GeneID:5005094"
     mRNA            complement(<36964..>37773)
                     /locus_tag="OSTLU_5006"
                     /product="predicted protein"
                     /transcript_id="XM_001420996.1"
                     /db_xref="GeneID:5005094"
     CDS             complement(<36964..37773)
                     /locus_tag="OSTLU_5006"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421033.1"
                     /db_xref="GeneID:5005094"
                     /db_xref="JGIDB:Ost9901_3_5006"
                     /translation="MIGDTARTDAYRDALEKNPTLIQGKRVLDIGCGTGILSMFAARG
                     GASAVVGVDGAKHIAEVAKANVKHNGFSDRIQIVYGKLEDIEGDIPGAPFDVLVSEWM
                     GYGLLFESMLDTVLVARNRFLKPGGAVLPDIATIHIAGFDRKATDFPFWEDVYGFEMP
                     EIKKQLFQGAMKTAVVTHVDGARLTTSGSQVCELDLATCSIADTEFTTEFSLSAKDGR
                     IGEETHGIVLWFDTEFSKRFCADLAVMLSTSPEAKKTHWVQTMLHFREPITL"
     gene            complement(<37987..>38541)
                     /locus_tag="OSTLU_17734"
                     /db_xref="GeneID:5005064"
     mRNA            complement(<37987..>38541)
                     /locus_tag="OSTLU_17734"
                     /product="predicted protein"
                     /transcript_id="XM_001420997.1"
                     /db_xref="GeneID:5005064"
     CDS             complement(<37987..38541)
                     /locus_tag="OSTLU_17734"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421034.1"
                     /db_xref="GeneID:5005064"
                     /db_xref="JGIDB:Ost9901_3_17734"
                     /translation="MSRSSDDDDADAYDDGEDDALEDAVRDLIDADVAHASATAALRR
                     ARDAHGLDARDVARGRGCEEAHYDVVKWLNYVRAEAEKKRGTMTKEAMVEAIRAGAKA
                     RAWDDDAYLKPTLEDDGALFGWEAYVEGREEEEEEEEENEDGEDEDGTPSKEEMARKL
                     RVENEALRVRLCEVMTAAGMVDEAS"
     gene            <39424..>42413
                     /gene="CHB3501"
                     /locus_tag="OSTLU_17735"
                     /db_xref="GeneID:5005065"
     mRNA            join(<39424..41538,41820..>42413)
                     /gene="CHB3501"
                     /locus_tag="OSTLU_17735"
                     /product="predicted protein"
                     /transcript_id="XM_001420851.1"
                     /db_xref="GeneID:5005065"
     CDS             join(39424..41538,41820..42413)
                     /gene="CHB3501"
                     /locus_tag="OSTLU_17735"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420888.1"
                     /db_xref="GeneID:5005065"
                     /db_xref="InterPro:IPR000433"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR001853"
                     /db_xref="InterPro:IPR007526"
                     /db_xref="JGIDB:Ost9901_3_17735"
                     /translation="MRATLAASADEPGVTHVLRTDDSVNDDEIEDGALWRITETRVAT
                     SSGKTEQRLHFWFYPDSYDAWYADSSISGKGKAPWAPETSVILRNKAEKRNDLPHNVR
                     ARWLRDSHTFNEWMNELDYEYDVTREMLSAPRHAWDPSNAPQNKRARAPENFEGDAEI
                     LAPGEEERVPWGFAVTRRRVVRAHPVVAAAASQDDGALVLQDDEELITKEFMIAKTLR
                     MQNISVDQLPWNATPSMRKAERKAEPLTEYRVPTHSAWFKWGEVHAIERRALPEFFDD
                     DDTCQKYIACRNEIMNQFRFKGQEVTLHEVSSSRTTKNIVDAAAHQRIFSFLEQWGLI
                     NWQFTSGRDVIDLKQKPLAAWRRIVTGEDGAARVEKTDPLAAFKGTLFEFSKCRATTA
                     SGLHPLEPQSRYAPSSETQLERQSLDALFASHDALSKRGVDVKFACNACGADLKSTGV
                     FYHAFLTRDFDLCPSCFSKGVYPHGQASGDFVKAMYPDFHAEAVSADEIVDDAEWTPQ
                     EVAALLDAISQSNELNWNDIASAVGTKSEDECLKHFARMPIEDAAIENIERELLVPRG
                     AIIDDEGAKILDPVPFSFAPNPTMAQLEFLVSMISPRVAAASAKAALTKIALGGSLDA
                     ADLNVDGLAAAAIQAKILAQDEEHEVHRIIASALDVLLKKLEIKLRFLGRLVDDEPET
                     ASRLAKLREESARNRTNDLYTRDLVSSHDWRRMGADVARAGVNKRSWYNERFGADTVA
                     TFEPRLASAFAKAGIEGAYTLDGNTGDTRPAHRVAAYAEETHGPAAQDAFMRAMFHRY
                     FIEALAPCDEAVMRDAASAAGLDEAAVSKVLADGEASPFETVVEEQMSATRARVRGVP
                     HFIITCDGDGASRKIEIGGAQPPEAFLDAFAELLDLDADDVAATKS"
     gene            42238..>43105
                     /locus_tag="OSTLU_27002"
                     /db_xref="GeneID:5005095"
     mRNA            42238..>43105
                     /locus_tag="OSTLU_27002"
                     /product="predicted protein"
                     /transcript_id="XM_001420852.1"
                     /db_xref="GeneID:5005095"
     CDS             42677..43105
                     /locus_tag="OSTLU_27002"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420889.1"
                     /db_xref="GeneID:5005095"
                     /db_xref="InterPro:IPR004360"
                     /db_xref="JGIDB:Ost9901_3_27002"
                     /translation="MRATRTKSLAEEIEIQGVHHVAVICDDLERSMAFYGGLLGLKIN
                     PERPEDKLPYRGAWLWIGPEMIHLMELPNPDCAHAEFRPTHGGRDRHFCIGVKRIQPL
                     IDALERENIAYTASKSGRPAIFFRDPDCNTLEVVEGLEWR"
     gene            complement(<43221..>44507)
                     /locus_tag="OSTLU_27003"
                     /db_xref="GeneID:5005096"
     mRNA            complement(<43221..>44507)
                     /locus_tag="OSTLU_27003"
                     /product="predicted protein"
                     /transcript_id="XM_001420998.1"
                     /db_xref="GeneID:5005096"
     CDS             complement(43221..44507)
                     /locus_tag="OSTLU_27003"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421035.1"
                     /db_xref="GeneID:5005096"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="JGIDB:Ost9901_3_27003"
                     /translation="MAPDAAAPDGDDVHDVVLFYAYTAIERPDAVASTLKSFFAEHAA
                     HFKGRVLVAREGVNGTACGSRRSGALPMFQALLRELVPGCETMPYKTSLASEQVFHDA
                     RVETVRELVGWGERLAHERREKVVHLSPKEFHEALKARDGEATVLDLRNENESIVGKF
                     RGARCPDARNMQELGRFLDSAARESSGKEVFMYCTGGIRCEKAAIYLEKKAPDVAKVY
                     QLQGGIHEYLEAYGGSEECLFLGKNFTFDKRGVMPKSGKVDCDGEVWNCQRCRDGEPK
                     LRSCAVCVVCRFPLVLCERCQTSTSNRGEWTCSHHANLDGVYSMYAVPHLTAEDLTAR
                     IERMKCMERELFDADPKSTANKRRTLRKCFTRMEAELKRREAGGACDRRDVAFCRNSG
                     RELATCAGDCMGFWGPGHVIEKPPTTLCGVDATSVE"
     gene            complement(<44646..>45794)
                     /locus_tag="OSTLU_88888"
                     /db_xref="GeneID:5005066"
     mRNA            complement(<44646..>45794)
                     /locus_tag="OSTLU_88888"
                     /product="predicted protein"
                     /transcript_id="XM_001420999.1"
                     /db_xref="GeneID:5005066"
     CDS             complement(44646..45794)
                     /locus_tag="OSTLU_88888"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421036.1"
                     /db_xref="GeneID:5005066"
                     /db_xref="JGIDB:Ost9901_3_88888"
                     /translation="MRAVAADAEAKEAAERARVEEEKRRQEAEEAARKKAEEDAEAAK
                     KRAEEEAKEKAREEEAKRKQAASDYVSGKATGEIPRVAAAAEALEQETNLAKTLVEAR
                     AMVAEYQSHPTAKLERRKLTNTIVVHVQQIAATKEQINKKSRDIMMLLVQLQEPQKTF
                     ALMSIAKKMLSQCDVQVAKLNRYAFALAEVAVSIAIDVPRFGVLLVALIHEVCVNAVP
                     KYYPFVPGRYATDDEYYSLMGYVKNDEGTAFETTDSYVDRMTGSMLFYAAFLQVDAPN
                     HPHGVDAAWRWLARLLNRCPPNRHTAVALDSFLKIAGFRMYAAYRGQFVKVLELIHRE
                     FLPKLDAKNDPDIRPVSSRIATYLQESLYTKSPEGRDMPNTDTSSHTF"
     gene            <47012..>49231
                     /locus_tag="OSTLU_88889"
                     /db_xref="GeneID:5005067"
     mRNA            <47012..>49231
                     /locus_tag="OSTLU_88889"
                     /product="predicted protein"
                     /transcript_id="XM_001420853.1"
                     /db_xref="GeneID:5005067"
     CDS             <47012..49231
                     /locus_tag="OSTLU_88889"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420890.1"
                     /db_xref="GeneID:5005067"
                     /db_xref="JGIDB:Ost9901_3_88889"
                     /translation="LEIAGEGASSETETYEKRVALMDELEIVRAWVERGGAVVAMSET
                     MSPRERYLVRACVACGQAHLFDFQDDDDAGEDALEGRIARLVAVLGKVETFYDMLGGV
                     VGYQCTALELCLEYATGEPAMLHSGADCYGVDCYGVPGDVDFHVPPGVDLRASDGAFA
                     ATAARWGLEELPNMAEIYPLGGAGDRLGLVDAETGESLPAALLPYNGRPLIEGLVRDL
                     TAREWLYYKLTGEHHKTPVAVMTSAAKGNHRRITALLKENNWFGRGEENYRLFEQPLV
                     PVISMDGGRWVREGFSQMALKPGGHGAIWKLMHDDGVFDWLESRDRTGGIVRQITNPM
                     AGTDTTLLSLSGVGIKGDKALGFASCERHVGASEGVNVLIEKKNALTDEFVYGVSNIE
                     YTDLDRLGVSDKANGDGGTESAYPANTNVLYVGLKHIRDALVGSSRAAFPGMLINLTK
                     PVLANGTKGGRLECSMQNIADALMRRSSHRLGPEDFDNLPTFVLYTLRRRITSSAKKK
                     RAPESMNLAQTPDGSFLDLLRNASDLLKRCNVAHPPPDDQPLEEYLSDGPEFIYSALP
                     SIGPLWDVVEQKIQGGEIKKGSEVRLEIAEIEWRDVSVQGSLFVESSSPFGTTSAESV
                     CFDESACGRCRLNNVVVSNAGIDWSEASNVYWSNFITRRERCSIVVEGNGEFDAKDVA
                     LEGDVRYVVPTGKRLMLRPDGAGGVQETWSDISMPSWRWKYTFGDDDRVNVVMEELS"
     gene            complement(<49373..50510)
                     /locus_tag="OSTLU_25372"
                     /db_xref="GeneID:5005097"
     mRNA            complement(join(<49373..50418,50500..50510))
                     /locus_tag="OSTLU_25372"
                     /product="predicted protein"
                     /transcript_id="XM_001421000.1"
                     /db_xref="GeneID:5005097"
     CDS             complement(49373..50074)
                     /locus_tag="OSTLU_25372"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421037.1"
                     /db_xref="GeneID:5005097"
                     /db_xref="JGIDB:Ost9901_3_25372"
                     /translation="MKMKKSGKAGKEKKNGPSGKRRHKFSLEAKLGKLVSQKCYEETL
                     RADALGAGLAVLDVTASSTTATKETRQPTALATLGACPLVSPVVLGDATREVPIAVVE
                     ICTGKDCRKSGSEAIVDALNAELPRGWKCRGSGKCISSCKRGINARLTTAIGREKFSY
                     LDEKSARALFVPMALATNELNASFDELDDPASKFMTPRERRKSPIVAAAEAISNAVEA
                     SHSDVPPGFLPRVQT"
     gene            51023..53244
                     /locus_tag="OSTLU_27007"
                     /db_xref="GeneID:5005068"
     mRNA            51023..53244
                     /locus_tag="OSTLU_27007"
                     /product="predicted protein"
                     /transcript_id="XM_001420854.1"
                     /db_xref="GeneID:5005068"
     CDS             51573..53147
                     /locus_tag="OSTLU_27007"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420891.1"
                     /db_xref="GeneID:5005068"
                     /db_xref="JGIDB:Ost9901_3_27007"
                     /translation="MNGHVMLEATTSSGDGRGGDQPPAKARKIVAAPKGLGPHAMKNV
                     PSSVLDESERKLRRPKVQTHEVYGLLRAHYDLGDIDRESLKELPSYDDKNWYFCAYTD
                     DPKTGEKVKHEYVAKVHNGMDSSGVSRGVLAAQERIIGYLAAHGVEVPNVVKSKLAMY
                     TTPGPNGTVNLVSEGTPGAKREFCTRVTFLASNQVAHTMRVLTYVRGKTIVQVPMPHS
                     IDFVRRSGLFVGQVCHALSKWPTPKEMEIQQDRRELGDAVTLPYVEQHAMCWKVLTSR
                     SRLWDLRFFMDVQHFMTDLIMRELFEDETRIMMCNTVFNAFKHLVLPVADKLRIGILH
                     NDLNEQNIIALESGPDPVKFPANVKFAAIDFGDVVVSWRVNEIAVACAYCALDKEDPV
                     HDMSMMLAGIQSVYPLTPLEMRVLPCLIAARLVTSLIMGMYSYHMQIVGEQNDHASDA
                     AAGQANSNADPSGEPASADTPRGNVYVLTTQKSAWTALTRILTVGAETMFKRFIIDAY
                     SEGSSVVVPQAAGYPA"
     gene            complement(<53370..>53696)
                     /locus_tag="OSTLU_9238"
                     /db_xref="GeneID:5005098"
     mRNA            complement(<53370..>53696)
                     /locus_tag="OSTLU_9238"
                     /product="predicted protein"
                     /transcript_id="XM_001421001.1"
                     /db_xref="GeneID:5005098"
     CDS             complement(<53370..>53696)
                     /locus_tag="OSTLU_9238"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421038.1"
                     /db_xref="GeneID:5005098"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="JGIDB:Ost9901_3_9238"
                     /translation="LHDAARYGDVEAVEDFIAVGKDINARDSSSRTPIHYAIAFGKGD
                     AGEEIFNLLLEAGADLTATDEKKNTPLHYACGYGKPFAVKALLEKGCDKTATNGTGKK
                     PIELVKL"
     gene            <54884..>57823
                     /locus_tag="OSTLU_41654"
                     /db_xref="GeneID:5005069"
     mRNA            <54884..>57823
                     /locus_tag="OSTLU_41654"
                     /product="predicted protein"
                     /transcript_id="XM_001420855.1"
                     /db_xref="GeneID:5005069"
     CDS             54884..57823
                     /locus_tag="OSTLU_41654"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420892.1"
                     /db_xref="GeneID:5005069"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="JGIDB:Ost9901_3_41654"
                     /translation="MRAPTTTHGFRLVREDYIAEYDAKAFLFKHEKTGAEVMSLSNED
                     ENKTFGVTFRTPPSNSTGIPHILEHSVLCGSRKYPIKEPFVELIKGSLNTFLNAMTWP
                     DKTAYPVASCNLQDFRNLTDVYLDAVFHPRCISNEKTFEQEGWHYELDDASGPMTFKG
                     VVFNEMKGVYSSPDSVLARECQQALFPDNTYGVDSGGDPTVIPELTFAEFKEFHAKFY
                     HPSNSRMWFYGDDDVEERLKILASFLDEFDRREVDSTIATQKFFTEPRRVVKTYSTGE
                     GEDAQKSFVQVNWLLSEEPFDPETGLAVGFLDHLLMGSQSAPLRLALEESGLGEAIVG
                     YGLEDELRQPTYALGLRGVAQEDIPKVEKLIHDTIAAIAEEGFSNEAIEAAINSIEFS
                     LRENNTGRFPRGLSLMFRSMSTWLYEGDPFEPLRFEEPLAKLKARIAAGDIFRPLMRR
                     LLIENTHQVTVELNPDSTLAEKEAAEEQSKLDAKRASMTPEELEKMVQATKELKELQE
                     TSDSPEALACVPTLAISDIPKEAKGIPTDISAVGATKVLTHDLFTNDILYAEHLLDLK
                     TVPAHLLPLIPLWTRALGRMGTKTKSFIEFDQLISAQTGGISVSPFTSGMRDSDEMAA
                     FMVVRGKATSDKVGVMHELMSELMLEAKFDDKNIFKQLVLETRAGMESRVQGSGHSVA
                     AGRLDAQDSVAGWVSEQMGGLAQLDYLRELVKRVDNDWDGVLADLYTISACLNNRAGS
                     VTNLTADAKTLDLSMPSVEAFLNSLPATGAGKSEQWTGINAKQNEILTVPTQVNYVGK
                     AANLYKAGYELHGSSYVINKLLGTTWLWDRVRVSGGAYGGFSDFDSHSGMFTYLSYRD
                     PNLLKTLDNYDATVDFLRNLEIGKEELTKSIIGTIGDVDSYQLPDSKGYTALMRHLLK
                     VTDEERQERRDQILGTTQKDFKDFADALETVRGADATSVSVASVEAAKTAVAERPDLN
                     FVVKSVM"
     gene            complement(<58095..>58337)
                     /locus_tag="OSTLU_8430"
                     /db_xref="GeneID:5005099"
     mRNA            complement(<58095..>58337)
                     /locus_tag="OSTLU_8430"
                     /product="predicted protein"
                     /transcript_id="XM_001421002.1"
                     /db_xref="GeneID:5005099"
     CDS             complement(<58095..>58337)
                     /locus_tag="OSTLU_8430"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421039.1"
                     /db_xref="GeneID:5005099"
                     /db_xref="InterPro:IPR001646"
                     /db_xref="JGIDB:Ost9901_3_8430"
                     /translation="AVLTLTGCDYSGKQLRGKILSGVVMDGTNFENADASETEMSRTS
                     ARNSNLRGVNFASANAYEARFDGSDLRGANFANALLS"
     gene            <61130..>62374
                     /locus_tag="OSTLU_41640"
                     /db_xref="GeneID:5005070"
     mRNA            join(<61130..61807,61856..>62374)
                     /locus_tag="OSTLU_41640"
                     /product="predicted protein"
                     /transcript_id="XM_001420856.1"
                     /db_xref="GeneID:5005070"
     CDS             join(61130..61807,61856..62374)
                     /locus_tag="OSTLU_41640"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420893.1"
                     /db_xref="GeneID:5005070"
                     /db_xref="JGIDB:Ost9901_3_41640"
                     /translation="MAKSSTTTTFFVVNQFTGELFGKPTIVDVAAAHVLPFTLPTGED
                     ALIVVDAEGRAATYPKRAEPSALDALNSLSYYKVDQTTNEVRGYKLRKASDGMTTMDS
                     LHTWTVSFPPAAGSIVGFANKPTSEERVNSWTRVPGDRSTLFKYLNPNTIFVATSDGT
                     AVHVSLIDGVTGRILYRVRHGDARGPVKAVVCENWVAYHYFNTRAKRYAMSVLEMFDD
                     GEERRNLATSSSLNPPPLRIIGQSYYVRPEAKMISVTRSKRGVTEPAVLLATANDQVA
                     AIDKRFLDPRRPNKPSAADREEGLIPYTEVIPIFPGSWVTHKRVVHGLRGLVTAPAEL
                     ESSIHFVAHGLDLFYARITPSQSFDALDDDFNYVLLVFTLVALAVGAFVTKRAADAAD
                     ANHAWR"
     gene            complement(<62460..>63536)
                     /locus_tag="OSTLU_93575"
                     /db_xref="GeneID:5005100"
     mRNA            complement(<62460..>63536)
                     /locus_tag="OSTLU_93575"
                     /product="predicted protein"
                     /transcript_id="XM_001421003.1"
                     /db_xref="GeneID:5005100"
     CDS             complement(62460..63536)
                     /locus_tag="OSTLU_93575"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421040.1"
                     /db_xref="GeneID:5005100"
                     /db_xref="JGIDB:Ost9901_3_93575"
                     /translation="MATRRRARGARAAKRALACALALVACVTVGARWRSGGEASSTAS
                     TSSATTSVDDDAREGAEAATAARDDATRSTLKATLLAGAKDEGACTNERDVRGRFATR
                     DFALVREVERRTRARVGFGWARWGDAEMISSARDGSPMRLAVRALMSVSATPNCVLNV
                     GVHWLCNGALRNNWNAAMDGVDVNDTIGHAFFFLPMGDPGDDDRSMWKENGVDGYINV
                     VREAKRKVILVGPPHVEGLPFIGHSAFVDASGKGMGGDGAADSVVQRIFEIGDAFDEP
                     PVVIMAAGMAAKTAILSAQDRINSKGWGLIDAGTTLDGYAGVKSRDYNDPRVYCRKSR
                     ERARDEHDGVDFWFAKGVCEKFGA"
     gene            <64632..68573
                     /gene="GTB3501"
                     /locus_tag="OSTLU_51236"
                     /db_xref="GeneID:5005071"
     mRNA            join(<64632..65028,65170..68573)
                     /gene="GTB3501"
                     /locus_tag="OSTLU_51236"
                     /product="predicted protein"
                     /transcript_id="XM_001420857.1"
                     /db_xref="GeneID:5005071"
     CDS             join(64632..65028,65170..68510)
                     /gene="GTB3501"
                     /locus_tag="OSTLU_51236"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420894.1"
                     /db_xref="GeneID:5005071"
                     /db_xref="JGIDB:Ost9901_3_51236"
                     /translation="MFAARNRTGGAKEDVVEELSEDEESDGDELDTFIEKDGATEEDY
                     EQAKAASDARKAAKAARKSAGRKSSGGETKDWASQTFEPSVIKEQMLTAKDDAIRAQD
                     LPERQQLKPRPAHAPTDWGMEAMWIFDRIMEEEITRCIALLLTLTFDHHLEIPYIVSQ
                     RRDDLLPLLRGRAEEARPALTEDGDNYQRLLRRFDVIDAIMEWDERYVKLELRKARIA
                     SALEQAANEKGESEQGHVARQCMELVRVAYLDKHVDDAEAKANLFFASLDANSKLRRP
                     GRKTQYDAHVKRGIRDLVNMSGPTAEAFGEAIKSGIPSELMANLTPEDVAKVYFDQGY
                     ANSDEVMQAFVNVAATEIGAESEVRKWFRDEFLGHATITTQPTPEGTDIIDPWHPIAP
                     VKRLLKMPVYILQGEQFAQILEGKRRGLLKVDIGFGDERLTSVIERMEKAYLSESMSD
                     LASTWNEVRRRVIRAALEEHLLPTFSRETASQLALDARDALNRACADGAWNYICHAPW
                     RPANTEDQDIEVRVVAAVSGSPATFVALDSAGELVDFIQCHTLGRNIGGPGNVGGAQM
                     MNQQDEIQALMDFIVQHRPHVCCVGASGMDSKRVKESLNLVVGRIIEEQPRAIPEEVS
                     EIAVHFVDDSVAKLCENAKETKAEMPEQQPSVLRAVALGRGLLNPAAVVASLVSGGEV
                     ASLRMCPLQDSMLSKDDRVAIVERQLINLVNQVGVDVNMASAHPWCSVLLRYVGGLGP
                     RKATLVINAVRTTEGGVVDSREDLKSALGEVVFRNAASFLRITEADMLDSTRCHPERY
                     EQAMAIVVNALELEANLAAMDKYERERILQKVFDPKTWEQKVAPLILEEYAEYLESEG
                     AGKSLEALREIRIEFRHPFEELRPPWMPLTAEDEFALLTGETMHTLSAGKLIQCTVKK
                     IEGPRDGRGARAVCTLDSGLTGYVEKYDVSDDQSFSRIEEKVALGQVITARVKPDGVD
                     VHNFSVQLACSSSALHPDETLQWEQHLHYTEANGYYSMVKQPGEVRLKKQKSKKDMQK
                     RTFVPRNIDHPNFQNVSWAEAVERLDTADIGEVIIRPSGRGTKNIDCSIKVYDGVVSN
                     INIKETKKDSGVGNLGLGTPLIIDDEEYEDLDEVMARHIEPIVSNVKHMLKHRKFMRG
                     SAEDIDNALKQQLARNPGIRPYALGVVEQRVNKGMVLFCISFIMSSSGRVHHEYIKVI
                     PAGFYYRKMEFPSVDRMLAYFKVNCSKPPPGARDMDNGGWN"
     gene            <69202..>70065
                     /locus_tag="OSTLU_27014"
                     /db_xref="GeneID:5005101"
     mRNA            <69202..>70065
                     /locus_tag="OSTLU_27014"
                     /product="predicted protein"
                     /transcript_id="XM_001420858.1"
                     /db_xref="GeneID:5005101"
     CDS             69202..70065
                     /locus_tag="OSTLU_27014"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420895.1"
                     /db_xref="GeneID:5005101"
                     /db_xref="JGIDB:Ost9901_3_27014"
                     /translation="MSLRELYYVMNSRGRRGGWPSGSTQTRVTEHQIAATIRKISQAL
                     GAPRIALGIVAASKGQVAGRCHIETASGARFDCTACGNDGWAITGDLFELDATKIHSD
                     AAYVIVVEKDAVFNRLCAERVFEKLPCVLVTAKGFPDLATRKFLHLLRRALEDNDRGN
                     EAQFFGLVDWNPSGCWILSTYTVGNSSSAMDVSEYVTPLKWIGLRSQDLYLIPECAFQ
                     ALSSRDEAMINNALNETAATHPLRPFASELEVMQARGQKAEIEALYANDDISFLLTDF
                     VSSKIAAFEEE"
     gene            complement(<70181..>71047)
                     /locus_tag="OSTLU_88895"
                     /db_xref="GeneID:5005102"
     mRNA            complement(<70181..>71047)
                     /locus_tag="OSTLU_88895"
                     /product="predicted protein"
                     /transcript_id="XM_001421004.1"
                     /db_xref="GeneID:5005102"
     CDS             complement(70181..>71047)
                     /locus_tag="OSTLU_88895"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421041.1"
                     /db_xref="GeneID:5005102"
                     /db_xref="InterPro:IPR003774"
                     /db_xref="JGIDB:Ost9901_3_88895"
                     /translation="VGARDDGGLTRTRAERRTQDVAPALESDWREFRAQLLARERAVT
                     PEEERARAAAVSEENLKVLETQNPRLAASAPWAHVIGAPEKGCLLVAADHEFRMSQQY
                     FHQAVILVLEHHENGSMGVILNRPTQYDMGYVSGEANGPFAKNALYFGGDVGDGTVSF
                     LHGREDVKGSVEVLPGVYLGGYDSACELVQQDGSTCHADEFKFFARYCGWAPGQLESE
                     CERGVWFPVAAAKELSLKQVIQLPKPLWREISELCGGELEEMARKAYQTYEAEQTFSL
                     DNLDADERATDE"
     gene            <71889..>73145
                     /locus_tag="OSTLU_2634"
                     /db_xref="GeneID:5005072"
     mRNA            join(<71889..72137,72219..>73145)
                     /locus_tag="OSTLU_2634"
                     /product="predicted protein"
                     /transcript_id="XM_001420859.1"
                     /db_xref="GeneID:5005072"
     CDS             join(<71889..72137,72219..>73145)
                     /locus_tag="OSTLU_2634"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420896.1"
                     /db_xref="GeneID:5005072"
                     /db_xref="JGIDB:Ost9901_3_2634"
                     /translation="TCAGSAMETARRGFAAAYATRAGISLAAHVVRTLRRGSARKCLD
                     LGHLVGEETLRYREDAARFGLFAGGFAGTYSATRCWLCYRSAREPFTPESAASIAGGV
                     AGLSIFFLKPKYRRAFSLYLLAKLAQASWASAQKEHPWMKERGPAAWRHTNFALFTLS
                     SAQIMYAYVMRPDTLDPGFWNFIVNAGPIDKQTLGAVRESVRSGASAAVVGCDHTHGS
                     TGALWCSSHVAASSFSTFKKCFPFYFSIHYVPYVVLNLSKAVQKPLSTLYRATKATVR
                     SSTMISTYVGLYMSTVCLHRNSGLRDHRALYYLAGVVASGALLVEDEGRRTDLTLWIV
                     PRAVDSLVLVLVRKGILPHVANFESYLFALVMSGVMNLYEREPDVLERNLTRFIARFV
                     "
     gene            <73356..>74555
                     /locus_tag="OSTLU_27017"
                     /db_xref="GeneID:5005103"
     mRNA            <73356..>74555
                     /locus_tag="OSTLU_27017"
                     /product="predicted protein"
                     /transcript_id="XM_001420860.1"
                     /db_xref="GeneID:5005103"
     CDS             73356..74555
                     /locus_tag="OSTLU_27017"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420897.1"
                     /db_xref="GeneID:5005103"
                     /db_xref="InterPro:IPR002893"
                     /db_xref="JGIDB:Ost9901_3_27017"
                     /translation="MSTIVIDDKYALSDSDSVDADAPRCANCGVASDRLKKCAKCRRA
                     HFCNAACQRAAWDAHARECVADANAKPAYKPPEPPRMPTKAEKEEAKESETRRIRETT
                     LPRARAALRRDGVSTTVDLDELIEGLEDAIVFAIGEEDQGLTREVRLVLARAYLEAKR
                     ADECLHYLAPALEEARKEGGAASADAHTLAAKAHCAKGEKEQCRKELTAALDCASEST
                     SDEAQCDTLLDAGIILHDLGDWERCAPLLSTAGEAAEKLGRLREAARAYNRAGSALLR
                     SGRPDYAGRCWTRELRVLEADDSTDPGTLAQAFANCASAFLLTRGEDDDAFNLHKKSA
                     LTKARESGNDAEARVYLQLGNAYKLAGDAIDDSLARAKDCFEKAKSLSATDAGEIASR
                     ALEMLSL"
     gene            complement(74538..76467)
                     /locus_tag="OSTLU_25378"
                     /db_xref="GeneID:5005104"
     mRNA            complement(74538..76467)
                     /locus_tag="OSTLU_25378"
                     /product="predicted protein"
                     /transcript_id="XM_001421005.1"
                     /db_xref="GeneID:5005104"
     CDS             complement(74686..76242)
                     /locus_tag="OSTLU_25378"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421042.1"
                     /db_xref="GeneID:5005104"
                     /db_xref="JGIDB:Ost9901_3_25378"
                     /translation="MPKRLVSQGMLPDVFQQYIMKYLDDTDCNVLSRVSHGCLDAVIE
                     SGRDPVCAMRVSKFVHSPAMLRWAQTQGVPWDWRLCRAAAASGKLESVQWLREQGFYA
                     GPKPEEWGYRNGCPWTADTCVAAARGGHLDILKWAHAHGCPLNSAVFANAANGGYFEM
                     MCWLREVGCPWDELTPICAARGGHLEILRWLKAEGCPWGSAVCAKAAKNGQLAVLKWL
                     KRHNFHWHSSAIQYACEGGHLEALKWLRAEGETWDEQAVWDAAKGGHLHVLEWLRAEN
                     CPWPHSAGDVAARFGHLDCLKFLHSQGGILHDWTCQEAAVGGHLDMLKWLRMQGCPWN
                     LWTPVQAARHGHLEVLKWAHKQGCPVDARVCAAAAYGGHVELLEYLRAEEVPWDEQTC
                     AHAALGGHLSVLQWARARGCPWNMYTCEYSAWEGNLHILKWARQHGCLWNSRTCAFAA
                     IGGHLDVLKWLRQHGCPWDGWTIQKATEEGNFELRDWALKHGCLSTSASTEFNLSNFP
                     NDEFLQMLDG"
     gene            <76938..78736
                     /locus_tag="OSTLU_25379"
                     /db_xref="GeneID:5005073"
     mRNA            join(<76938..78695,78732..78736)
                     /locus_tag="OSTLU_25379"
                     /product="predicted protein"
                     /transcript_id="XM_001420861.1"
                     /db_xref="GeneID:5005073"
     CDS             76938..78671
                     /locus_tag="OSTLU_25379"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420898.1"
                     /db_xref="GeneID:5005073"
                     /db_xref="InterPro:IPR004326"
                     /db_xref="JGIDB:Ost9901_3_25379"
                     /translation="MLHVFEHLQLELMLLGTLSLLLTALQDALMKICVKEEGSYGTDE
                     CPKGEGPLWSATTLHQTHIFIFILACTHVSYVAVSAYVCSWKLRQWRRWETEGEVKVH
                     ALNPKINPRNATGIVHLVWRAFWSQFRFAVDKGMYLSLRRLFLERTGATHDFNFYDYL
                     RESMEEDMSSLIGMTVLMWSMATIFVTVPQALFLSAGIVCLGVMLFVGTMLESVALRL
                     AQAAYERFADENELEERLAEEELDISIEKSPTVRRRELRKEIDSQNFFWLGRPRLLLK
                     VYQFVLFENAISLSMLIFSMWQDKKWLTYNASMSVGTAWALFAVDVCVLMHSALFILP
                     VYAITSTVGSHCATSLQEYADKLGITREAALQAYLERANESMSTADAAEVAAYDLSLL
                     GRDVKEVVSSGDFDQEAVPVSALPKDLQAVAGASSRQLSAGLKDIQARGQARKSWAKA
                     AGKLAAGQKDYSRENEKSITSLLGAILSNQMKAELAKQKREKEAKEAARAASPGVVGA
                     LQRTFSKKDIATMSVGQPSADDVTEDSPIPSSKVLVSKPSMKDVFSMASPPPKPTMRS
                     SLDEEKIVEEP"
     gene            complement(<78773..>79525)
                     /locus_tag="OSTLU_6820"
                     /db_xref="GeneID:5005105"
     mRNA            complement(join(<78773..79283,79329..>79525))
                     /locus_tag="OSTLU_6820"
                     /product="predicted protein"
                     /transcript_id="XM_001421006.1"
                     /db_xref="GeneID:5005105"
     CDS             complement(join(<78773..79283,79329..>79525))
                     /locus_tag="OSTLU_6820"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421043.1"
                     /db_xref="GeneID:5005105"
                     /db_xref="InterPro:IPR006652"
                     /db_xref="InterPro:IPR011498"
                     /db_xref="JGIDB:Ost9901_3_6820"
                     /translation="VIGGSDGNEALRSVEEYRESVGKWRVVDPMSVPRIWCASTMIDG
                     VTFACGGYDGEYYLHSMEANKTGVGSQPSSSWVTCAPMSEGRATLGVANLGGKLYAVG
                     GFSGTGEILDLCEVYDPRADTWTTGQPLKHKRRDLGVASLNARGMMLTVGGRDERSVL
                     NLVEAHDPREAKRGWWDLAPMHYRRQLHATVVDPSGDAVYAIGGFDGVSAIAAVEVYD
                     VRANKWREVAPCSTARLG"
     gene            81061..82921
                     /locus_tag="OSTLU_47312"
                     /db_xref="GeneID:5005074"
     mRNA            81061..82921
                     /locus_tag="OSTLU_47312"
                     /product="predicted protein"
                     /transcript_id="XM_001420862.1"
                     /db_xref="GeneID:5005074"
     CDS             81082..82428
                     /locus_tag="OSTLU_47312"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420899.1"
                     /db_xref="GeneID:5005074"
                     /db_xref="JGIDB:Ost9901_3_47312"
                     /translation="MLRPRALRESRRAVQAWAELGVIMFLFWFCDRSGAVREAKKSYD
                     RDLLFAVFALLGTYGWKTTLKESKTHAPLHREQTEEMKGWMQVLFLLYHYFDAGEMYN
                     LIRVFIAAYVWMTGFGNFSFYYVKKDFSAVRFAQMMWRLNFFVFVTCAVMKNDYMLYY
                     ICPMHTLFTLLVYGALAIAREKNSEPKWIYGKFIACFAIVAAVWEIPGAFKRIFTPFT
                     FLFRYVNPAKPDVHPLHEWQFRSGLDRYVWIYGMACAYFHPKYELTMKWIDERSTTRE
                     RMMYQGGVVALASGALYWWWVTFFTLDKVEYNKYHPYTSWIPITAFFVLRNSTKKLRE
                     NHIELFCICGKVTLETYIAQFHIWLSTSQMPNAQPKMLMSLVPGYPLLNLMVCSYIYI
                     GISHRIFDVTNVLKSACIPSKADNATLANNAIFGGIVVATALGLGTFTSLIFTGKT"
     gene            complement(<82894..>84840)
                     /locus_tag="OSTLU_41686"
                     /db_xref="GeneID:5005106"
     mRNA            complement(<82894..>84840)
                     /locus_tag="OSTLU_41686"
                     /product="VIC family transporter: inwardly rectifying
                     potassium ion channel"
                     /transcript_id="XM_001421007.1"
                     /db_xref="GeneID:5005106"
     CDS             complement(82894..84840)
                     /locus_tag="OSTLU_41686"
                     /codon_start=1
                     /product="VIC family transporter: inwardly rectifying
                     potassium ion channel"
                     /protein_id="XP_001421044.1"
                     /db_xref="GeneID:5005106"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR005821"
                     /db_xref="JGIDB:Ost9901_3_41686"
                     /translation="MEICFDIIFIADIAINFYRPIEKYGKLIWDKHAIAMKYLGGWFV
                     IDLLASLPIDLMFAGATTPGTVAARVLAALGMLRLLRLYRIRRMMSELEGNPNLPYLG
                     FVALKFALLIALASHWSACFLYYLARWQKFDENTWVYAYDPDLPSRTFSDKYTTSLYW
                     ATVTLTTVGYGDISPVSNLERAFSMIIMILNMGVTAYILGNVTQIVTKDDSTIMDFRD
                     HIASLQRFMRRNDIPRAVREKINAHMQLEYDMRCRDDEAVLNFCPPTIQSELRHAIYQ
                     HYINRCGIFSNASAVFIQYFLECITVEYYHPGTLLTSKGLDATAMYYVCLGKVDIVSE
                     KYVREPTLSNKINTILPGEWLNIAAVLCRRTCFHTSIVTSTCKVLVVSSSKLDNVLAR
                     FPRDVKQILRTLKEKYLLELSAMGPRAEDGFELYTNFVQALDQKSTDLYESELHELNV
                     AAVTGDTTALDMALADEPRNAHLTDSAGRTLLMVAVENKQNNVVKLLLKWGADPNAMS
                     KAGYSPLSRAVSVGSLPLVKILVTAGGLYHSPDDQTVLHSAISQDQVQRIKLLIVAGV
                     NLSSQDYQGSTALHVAARLGMPTILRILFDAGIEDNLLDKDGRSAEDVANISGNPGCA
                     KVIRERKQLRSTRSGVPSHTPMSP"
     gene            <85791..>87611
                     /locus_tag="OSTLU_27024"
                     /db_xref="GeneID:5005075"
     mRNA            join(<85791..85819,86045..>87611)
                     /locus_tag="OSTLU_27024"
                     /product="predicted protein"
                     /transcript_id="XM_001420863.1"
                     /db_xref="GeneID:5005075"
     CDS             join(85791..85819,86045..87611)
                     /locus_tag="OSTLU_27024"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420900.1"
                     /db_xref="GeneID:5005075"
                     /db_xref="InterPro:IPR006876"
                     /db_xref="JGIDB:Ost9901_3_27024"
                     /translation="MSAPSESYNWFLIVVAIVVTALALACNVYVLVHFQHPDDRNQAW
                     FPKIVVVTGLTLSVLSILLLPLDVANRAACDEAIIESACRYTLPMEDFWYATYLTMFA
                     YMFVLVPWTLFYYEQDSEATLGKKLVSSSIWSVATLFVLLMAMLLAYYVGGEAEFELK
                     SVKSGMALIGNSALNGATSCIALPSSPTTVTNFATYTATMSGMDCDAYGPNVGTETFT
                     VRPTFIVYMIAVASIISWFIFLVYAGVGIVALPVDMIKGFMNRPQKVIPKSEYIRCAT
                     ILARDAQAIHQQIKNVQKEQRETGRTKKTKKDLKELQVKLSQLEDDEVELMTVFPQGE
                     QREATWLMTVLAYYIQCFLGGLSVILSTLWTLHIIITVLVKPAAHPFLNSFFIWLDSG
                     WSLLGTAAFALFCFYLVFCVIKGNTRLGLRFFFMKLYPMKLGRTSMSSLLFNTGLIML
                     GSISIVQFCAQVFNVYAAETAVTDIFGGNIENLKGLGYLFKYNVFIYSFFAMICLSCI
                     IIPFETWKTPKPKKTWERDSGRI"
     gene            complement(<87937..>88767)
                     /locus_tag="OSTLU_5707"
                     /db_xref="GeneID:5005107"
     mRNA            complement(join(<87937..88110,88171..>88767))
                     /locus_tag="OSTLU_5707"
                     /product="predicted protein"
                     /transcript_id="XM_001421008.1"
                     /db_xref="GeneID:5005107"
     CDS             complement(join(<87937..88110,88171..>88767))
                     /locus_tag="OSTLU_5707"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421045.1"
                     /db_xref="GeneID:5005107"
                     /db_xref="JGIDB:Ost9901_3_5707"
                     /translation="DHIAYRSFAHEDYGVEGVCEVFERLGWETVSASEGGRLEFTEKR
                     VRARWMKPPKTPRGETPLPRIFVSELVVDACDEELKGYLTQHFERVGEGKVLRSMEWA
                     KGRNARWQLPPASVYAKVERLSEYASWTLLHGYAVNHVALSLFQLRKMYPETPLRTLE
                     DLETSFASNAAFSRIRWNESGGRIKRSPSGLLAQSALMSEDHEDTFKDYGLPGSYVEF
                     VQRLPKPQNADKSFEELQECDLREGFEAGNASKIFDSTS"
     gene            <89461..>90240
                     /locus_tag="OSTLU_17757"
                     /db_xref="GeneID:5005076"
     mRNA            <89461..>90240
                     /locus_tag="OSTLU_17757"
                     /product="predicted protein"
                     /transcript_id="XM_001420864.1"
                     /db_xref="GeneID:5005076"
     CDS             89461..90240
                     /locus_tag="OSTLU_17757"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420901.1"
                     /db_xref="GeneID:5005076"
                     /db_xref="JGIDB:Ost9901_3_17757"
                     /translation="MGGGCEARSRRTGAIETAAIEDAATAIEDAHFVDFPVVFASVDG
                     GGRRMAIGGDGELVLALASVVALALVNAALKAVRGARFAGEVANDDAPASAESVPWQE
                     LVGEMNALKVKQIVREQRERAAHLAPTAEWTVTAKSPALDYFAPRTNTRDLVFDFLTS
                     HPFSIAPKHVDREWDSDADSCDGNDAVPWLSTHGLETSDVDSAMEYDLFGTAFHPGAD
                     FSMTIRGHGPPPVARKVMSDIASCRHFTDMDLKFFEDKHEE"
     gene            complement(<90529..>91527)
                     /locus_tag="OSTLU_3910"
                     /db_xref="GeneID:5005108"
     mRNA            complement(<90529..>91527)
                     /locus_tag="OSTLU_3910"
                     /product="predicted protein"
                     /transcript_id="XM_001421009.1"
                     /db_xref="GeneID:5005108"
     CDS             complement(<90529..>91527)
                     /locus_tag="OSTLU_3910"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421046.1"
                     /db_xref="GeneID:5005108"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="JGIDB:Ost9901_3_3910"
                     /translation="VKSAYRRMALATHPDKNDGDSRAFKRVAMAYKILGDAERRAAYD
                     ASGGVEGEDARDALETEIDISEVGFANTLVASVISSLGVNIKTAVPVKALEAVRRGET
                     TGGVVDATMGCKLSESARKGEIRLFRCALSEEDVRRGVVVSATSPSGDKFKLLKFDRA
                     SNGDGGLELSLQEVSAKFDSVKPKRSHAGFYFTGHKSYNYEPFELIKMSKLESRDLAM
                     FHALDNWTPRECVSISPGEHVFGVYGDNFFDKCKFEFEIFVVGTKTSDGAVLEPSKIH
                     EIETKMSKKRDDLMRFEKEYLAAKSAFEKVVVRHQQEADEVKALIAAREAAYCALTL"
     gene            complement(<91739..>92362)
                     /locus_tag="OSTLU_6635"
                     /db_xref="GeneID:5005077"
     mRNA            complement(<91739..>92362)
                     /locus_tag="OSTLU_6635"
                     /product="ABC(ATP-binding) family transporter: cobalt ion"
                     /transcript_id="XM_001421010.1"
                     /db_xref="GeneID:5005077"
     CDS             complement(<91739..>92362)
                     /locus_tag="OSTLU_6635"
                     /codon_start=1
                     /product="ABC(ATP-binding) family transporter: cobalt ion"
                     /protein_id="XP_001421047.1"
                     /db_xref="GeneID:5005077"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="JGIDB:Ost9901_3_6635"
                     /translation="VRALRGASLRVPRGTLFMLLGPNGCGKSTLLRALAGLVKTDAGA
                     LEAPERKAFVFQNPDHQVIMPTVGADVGFGLGNDHTLSEDDVRERVVRALRTVNLTDD
                     DAFERQVATLSGGQKQRVAIAGALVEEPELLLLDELTTFLDEADQRGVIEAVRRAVDE
                     SDGRVTALWVTHRLEELEFADGAAYMEDGVVVKLGTGKDIREFIREKQ"
     gene            complement(<93162..>94446)
                     /locus_tag="OSTLU_41510"
                     /db_xref="GeneID:5005078"
     mRNA            complement(join(<93162..94124,94261..>94446))
                     /locus_tag="OSTLU_41510"
                     /product="predicted protein"
                     /transcript_id="XM_001421011.1"
                     /db_xref="GeneID:5005078"
     CDS             complement(join(<93162..94124,94261..94446))
                     /locus_tag="OSTLU_41510"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421048.1"
                     /db_xref="GeneID:5005078"
                     /db_xref="InterPro:IPR004823"
                     /db_xref="InterPro:IPR011442"
                     /db_xref="JGIDB:Ost9901_3_41510"
                     /translation="MSAPSRVHVDSVRAIAATIGAPPVDADAARALASDCEYRLRQVF
                     QDAMKCMRASKRTTLSAEDVNAALRLRNCEPLYGFGAGTSDYEYKQTREDPDVFYVED
                     REIDMRELLTRKLPRPPIEVNLVPHWLAVEGVQPMIPENPMVPAAEPVAIEPPRGMKR
                     PRPRAMGAKENGGDPDAGGLLPVVSHTLSRELQFYFDKVTALIRQAGRADASDREVEL
                     LSTALRSLSADVGLHNLMPYFTQFITEETTQNLRDLPRLRVLIQMIRALISNPDINVE
                     LYLHQLMPSVVTCVVAKRLCQNLDEDHWSLRDDAAYTMAFICGKFGDAYPSIRPRITR
                     TLLRALLDTKPMTTHYGAIRGLHALGPKVVRETVMPNLRSYLNTLEPLL"
     gene            <94533..>95723
                     /locus_tag="OSTLU_17761"
                     /db_xref="GeneID:5005079"
     mRNA            <94533..>95723
                     /locus_tag="OSTLU_17761"
                     /product="predicted protein"
                     /transcript_id="XM_001420865.1"
                     /db_xref="GeneID:5005079"
     CDS             94533..95723
                     /locus_tag="OSTLU_17761"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420902.1"
                     /db_xref="GeneID:5005079"
                     /db_xref="JGIDB:Ost9901_3_17761"
                     /translation="MGARDAASPVRSLDVARARATWTALDEAIRGDAGAWTFDDDDDD
                     ARATTSGREERDAGDAIRALGYAIVPRCANRALARRVATLARGLAARGLDPTYVFVYE
                     DAWTLLRTIETACKSRGCFGGLIMNYDVLAWCVDPVSDGEATTAFCPHRDRQPDDSPG
                     SFSENGDAKYATAWVALANDATPENSCLYCVPRPHDPGYYDGDDDDANAKDPLSVALD
                     SKKAFQYVRALPCKAGDGVVFTHRLIHWGSIGEGREDRPRINISFGFACESFEPAYLT
                     SRSRVPSFDERLALVAGQLICYHERFPPNAKELGVLKKLFDGMKSSFDDAYVRKVNKE
                     FANAALRGENDDEVEEDALDAMLDAADDFDDDFDDFEDGVEGDAYGRVADGDDALAKR
                     SKRK"
     gene            complement(<96125..>97150)
                     /locus_tag="OSTLU_17762"
                     /db_xref="GeneID:5005109"
     mRNA            complement(<96125..>97150)
                     /locus_tag="OSTLU_17762"
                     /product="predicted protein"
                     /transcript_id="XM_001421012.1"
                     /db_xref="GeneID:5005109"
     CDS             complement(96125..97150)
                     /locus_tag="OSTLU_17762"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421049.1"
                     /db_xref="GeneID:5005109"
                     /db_xref="JGIDB:Ost9901_3_17762"
                     /translation="MTGAEGRARTIDVDGTFAGEGEDMIAALIAASANPATRGGAGRG
                     EGTTRGFEKDGDVVKAKRSFERELVPFDFEDGTSAVDAVVRETNVEVEAKPRERKMTA
                     VPTPKVRGNEEPTKAKTKERRPKPKAVPAPKTVGLIDPRVRANQVCEPQQPALTPEQQ
                     AAVLAADGSGKKSKGKVKTATNDERWAQASFQNAPAADQLPMPSFLKDIAPTNSPRVA
                     SSSAPPRLDVATPRPQASAAGLKNLLGVKPAAAPQQAKGHALFNNILNSANGDAHPSP
                     PPMMAPSHYAAPPPPQGVQQKLNTLFGVQPQPAQPFPVAPPYPTAPETSGGSFQTLMA
                     KLNAGRV"
     gene            <97613..>98092
                     /locus_tag="OSTLU_7826"
                     /db_xref="GeneID:5005080"
     mRNA            <97613..>98092
                     /locus_tag="OSTLU_7826"
                     /product="predicted protein"
                     /transcript_id="XM_001420866.1"
                     /db_xref="GeneID:5005080"
     CDS             <97613..>98092
                     /locus_tag="OSTLU_7826"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420903.1"
                     /db_xref="GeneID:5005080"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="JGIDB:Ost9901_3_7826"
                     /translation="LVMQTTLGDVTLALYDHDDAARATAAHVLEAFELGLYDTNHFFR
                     VDAGFVAQIADCAGGRRAAMSERQRELATRTVRGEFDASVKHARGKLSMARWSDPDSA
                     TSSFSVMLGTAPHLDGEYAVFGEMVEGEETLRKIEAVETTKSGIFVMPKERIEILSTY
                     "
     gene            complement(<98301..>99377)
                     /locus_tag="OSTLU_17763"
                     /db_xref="GeneID:5005110"
     mRNA            complement(<98301..>99377)
                     /locus_tag="OSTLU_17763"
                     /product="predicted protein"
                     /transcript_id="XM_001421013.1"
                     /db_xref="GeneID:5005110"
     CDS             complement(98301..99377)
                     /locus_tag="OSTLU_17763"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421050.1"
                     /db_xref="GeneID:5005110"
                     /db_xref="InterPro:IPR000715"
                     /db_xref="JGIDB:Ost9901_3_17763"
                     /translation="MRLLPTVGAKTLARNMSGYDLNKKGTALGERRVPESGGLAAGCA
                     YAVALTMQQLCQRGIRWWFGQSASGTNAWALEQNSALACVGFMIFLGFVDDVLDLPWR
                     VKIVMPGFAALPLLLSYSGGTTVLIPSPVRALLELPAGVRSIDVGPLYLCYMWLLVVF
                     CSNSINIHAGLNGLEAGQSLIIAGAILLLNVLSLANDPSTEPVTAGAHLFSIFLTLPF
                     FATTLALLRHNWYPSKIFVGDTYTYFAGMTLGVVGTLGHFSETLLLFFLPQVLNFVYS
                     TPQLFKIVHCPRHRLPIFDPKTGLLHPSMATETRYNMNLVTLFLRLFGPCTERVLCAR
                     LLAFQFLSCAFAFVARHALTGVWK"
     gene            complement(<99661..>99837)
                     /locus_tag="OSTLU_27034"
                     /db_xref="GeneID:5005081"
     mRNA            complement(<99661..>99837)
                     /locus_tag="OSTLU_27034"
                     /product="predicted protein"
                     /transcript_id="XM_001421014.1"
                     /db_xref="GeneID:5005081"
     CDS             complement(99661..99837)
                     /locus_tag="OSTLU_27034"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421051.1"
                     /db_xref="GeneID:5005081"
                     /db_xref="JGIDB:Ost9901_3_27034"
                     /translation="MTRAVNAFVVVVVLGTALGVRAVHESQVDERRRLREGVARDAER
                     LRARATREKARLES"
     gene            <99886..>100629
                     /locus_tag="OSTLU_27035"
                     /db_xref="GeneID:5005082"
     mRNA            <99886..>100629
                     /locus_tag="OSTLU_27035"
                     /product="predicted protein"
                     /transcript_id="XM_001420867.1"
                     /db_xref="GeneID:5005082"
     CDS             99886..100629
                     /locus_tag="OSTLU_27035"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420904.1"
                     /db_xref="GeneID:5005082"
                     /db_xref="InterPro:IPR005645"
                     /db_xref="JGIDB:Ost9901_3_27035"
                     /translation="MRAPTRAPPTTTPTTTCATRDAATAEPPRLKILSLHGFRTSREI
                     FDAQARVARWREDYEDVARFHAIDAPHEGAGAATAEVRAFFGEDARSREWWNATTGRD
                     GKTTYRGIEASLREIERACEEDGPYDGVLGFSQGATLAAIALATPELAERFAFGILVS
                     GMRARAEETKGCDYGAIAVPTLHVVGLKDDVMPKAMSAGLYDAMTSSERTRETHDGGH
                     RLPRVNVDGTPILRDFLAARLAARENSKL"
     gene            complement(<100665..>101786)
                     /locus_tag="OSTLU_17764"
                     /db_xref="GeneID:5005111"
     mRNA            complement(<100665..>101786)
                     /locus_tag="OSTLU_17764"
                     /product="predicted protein"
                     /transcript_id="XM_001421015.1"
                     /db_xref="GeneID:5005111"
     CDS             complement(100665..101786)
                     /locus_tag="OSTLU_17764"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421052.1"
                     /db_xref="GeneID:5005111"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="JGIDB:Ost9901_3_17764"
                     /translation="MTRALALALAPLACVAVVVLGPTKRFERSALGRAHRALGDAAPR
                     VATALVTIAVCDRKRGAAVASACFDALDRPNPLGQIVYLTLAIGGHASFVEGVEKRLL
                     DGGDARGWTAATSAAFAFACATWALVCCSEPGTITRENNEEYLKAYAYDEIVYHRKRC
                     RTTGKDAPARSKWCTTTERRVARFDHFCVWVNNTIGANNLRWFLLFLFAQLVLVGYVT
                     LACAHAVRRSMTRRDCWSLRFQHETPSGARATLGNDKALLYRFVVYHYAPAVTLGVFC
                     ALVFVLLSVFLGYNVWLAAKNVTTNETFKWELVRESVETMKGERAGGSGDEQIDWGEM
                     TRNKYDVGIWGNIKEVLFPPVKTPSAFALPWDALKAKRP"
     gene            <101949..>102568
                     /locus_tag="OSTLU_27037"
                     /db_xref="GeneID:5005083"
     mRNA            join(<101949..102119,102251..>102568)
                     /locus_tag="OSTLU_27037"
                     /product="predicted protein"
                     /transcript_id="XM_001420868.1"
                     /db_xref="GeneID:5005083"
     CDS             join(101949..102119,102251..102568)
                     /locus_tag="OSTLU_27037"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420905.1"
                     /db_xref="GeneID:5005083"
                     /db_xref="JGIDB:Ost9901_3_27037"
                     /translation="MAAPRRPVLLLDVDGVLNRTATAKQIALDEDLIALLRDVAERSA
                     CEVVLTTYWRYFEEYLAYAFERHGLPKGAVAGRTAGEPHRSDSVAHDSKVPELRVLEI
                     ERYMRETHGEDETAWPPFAVVDDKEVVSAEHRWRGRFVRTKHDVGLTKAQADALIDIL
                     SR"
     gene            complement(<102675..>104882)
                     /locus_tag="OSTLU_17765"
                     /db_xref="GeneID:5005112"
     mRNA            complement(<102675..>104882)
                     /locus_tag="OSTLU_17765"
                     /product="VIC family transporter: potassium ion channel,
                     potassium voltage-gated channel, subfamily H
                     (Eag-related)"
                     /transcript_id="XM_001421016.1"
                     /db_xref="GeneID:5005112"
     CDS             complement(102675..104882)
                     /locus_tag="OSTLU_17765"
                     /GO_component="membrane"
                     /GO_function="ion channel activity"
                     /GO_process="ion transport"
                     /codon_start=1
                     /product="VIC family transporter: potassium ion channel,
                     potassium voltage-gated channel, subfamily H
                     (Eag-related)"
                     /protein_id="XP_001421053.1"
                     /db_xref="GeneID:5005112"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR005821"
                     /db_xref="JGIDB:Ost9901_3_17765"
                     /translation="MMALLCYTAIVTPMEVGFYTPSFNALFYINQFVTACFVTDLVLN
                     FFIATPHHRTGHLVYNQAYVARTYLKKWFVIDFLSAIPFDAMYLGVGSSALAQLSILR
                     TLRLLRLVKLVRILRVNRIYKRLELVYTIDYSLLELMKFGLTAIMFAHWLACGFGLVE
                     DLEGTKYSWTRSTEFGDLVIGPDGGEPREIVGSLRLYLAALYWSTMTISTIGYGDIVP
                     VTTGERVYVIMAMLIGAFEYGYIVGAVSNVIATRNEKVNKFQGVMRDLNGFLIDHGFP
                     QDLRVRLREYFKYQLDGADADVYRRLLDKMSPALRSECTMRMNTWIRNIDFFKHCPEP
                     LVIHLSTRVVEHTFPPEETLFRPGDAVSTIFLIRRGVVQVDGLIKMSGKTIAEEALYS
                     SDTLLYGAQALTYANIYTLEREDFHESLAPFPATKKFFRLKGIKIIFRGEIIAYTKAY
                     TALKKYGLDADLSREVSARPAFYLQKLRIIYGDDGEGLDDPKILEQKTKAAVVIQKRF
                     RGMIHRVSLHRLLVERGVQGIFHKVLRERDPMSYTARAVDVFHWRLAYSLTEMHRKLN
                     SLLDHGNIEDVVTNESSGPPSLMATALQAATGKAMTAPRKGANKASTDGAPPQTPVTS
                     ARAPVITAAAAGWDTTSTENPLQRLQTRVDELTNRLVPLDRKITSSQAKQTAALAETN
                     ERLSEVTAQLETLLNLTVSNMETGLAEARVVARASRPRRQSLSPPPRSEALSR"
     gene            complement(<105694..>106680)
                     /locus_tag="OSTLU_41751"
                     /db_xref="GeneID:5005084"
     mRNA            complement(<105694..>106680)
                     /locus_tag="OSTLU_41751"
                     /product="predicted protein"
                     /transcript_id="XM_001421017.1"
                     /db_xref="GeneID:5005084"
     CDS             complement(105694..106680)
                     /locus_tag="OSTLU_41751"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421054.1"
                     /db_xref="GeneID:5005084"
                     /db_xref="InterPro:IPR005511"
                     /db_xref="JGIDB:Ost9901_3_41751"
                     /translation="MQLGESPIWSQERQTLYWVDAPSGTLFSWDLKSAPTRNNFGETL
                     GCVALRSNGTLLLGLESGLHAFDPSTKKLKLLSEFEPGLNTRPNDGRVDRAGSFVIGS
                     YNNAHRVDAAPIGGLWRLPGNGGELEEILDYKFRCSNCICFSRSGTTMFFCDTPTRKI
                     YQFDYDSRVGPSNRRLLYELPSSMSGGPDGAQCDEDGNLWAAISGAGQVIRITPQGAV
                     DLVVELPVKAPTSVTLGGPELDTLFVTTRAEPGRMDAGSLFACRVCDTRGIPEPEFLD
                     QTPLGADCETLAPGIGRATAGASRGAKFCISCGVGFDKPAAKFCAFCGAKRG"
     gene            complement(<106756..>107725)
                     /locus_tag="OSTLU_7124"
                     /db_xref="GeneID:5005013"
     mRNA            complement(join(<106756..107325,107561..>107725))
                     /locus_tag="OSTLU_7124"
                     /product="predicted protein"
                     /transcript_id="XM_001421018.1"
                     /db_xref="GeneID:5005013"
     CDS             complement(join(<106756..107325,107561..107725))
                     /locus_tag="OSTLU_7124"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421055.1"
                     /db_xref="GeneID:5005013"
                     /db_xref="InterPro:IPR000652"
                     /db_xref="JGIDB:Ost9901_3_7124"
                     /translation="MAGNWKLNPKTLDEARTLAALVGAAARDGGIGTNKSKTEVFVCP
                     PAPFAAEVARTLEGSGVAVGAQNIYFEASGAFTGEMSAEMAKSVGCTHVLIGHSERRE
                     LFGETDEMTRLKTRKTLDCGMTAVLCIGETKEEYERGEAKKVCNRQLSAALSGVEADE
                     MSKVIIAYEPVWAIGTGLTATPAIAQSVHAGIRQWFRTNYGESVAAKIQIQYGGSVKP
                     ETVDELMQAPDVDGCLVGGASLNAEQF"
     gene            <108076..>110136
                     /locus_tag="OSTLU_93578"
                     /db_xref="GeneID:5005014"
     mRNA            <108076..>110136
                     /locus_tag="OSTLU_93578"
                     /product="predicted protein"
                     /transcript_id="XM_001420869.1"
                     /db_xref="GeneID:5005014"
     CDS             108076..110136
                     /locus_tag="OSTLU_93578"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420906.1"
                     /db_xref="GeneID:5005014"
                     /db_xref="InterPro:IPR003409"
                     /db_xref="JGIDB:Ost9901_3_93578"
                     /translation="MRAARARTGAIGARATRRASSTRARRDAARIGASAASKSSSPSS
                     ERDDIGADGAGVAVVGVGARGCALVDALVDARALPRAEMWAMHADEDALERSRAANRW
                     RLPPANVEATTTAIEGNAASAARAVMAMGAPRVMVVVCAGGEAVESATAFTRWATREK
                     NARAKKKRFFGFKGANRAPEGEIMIAGVIEPFTFEGRRKQRGCDEFLRACAEPGACDA
                     ALTVSQSELLKNGEDGMSVQDATSIADASLLYAVLSAVESLRSSCWSSGGERDASDVD
                     AWTPQIEKGGRLRAKVNDVMSSHGGGCGVAHVGRGVADVPTYGSADEAIAAAARAAIA
                     TAARQSPFLAPGRFDTARLVICTVKHGNAFGPLARATISQALSELTSAEQFISIANPD
                     KRGSTEVEVTLLTVTDAETAAAPAPESKTVPVVSEDPLHKSNPMLFVPGYVAGEEQTK
                     RKTTKLSRDDLKNFGNDDTQAIVATEERAVIFTSDQLATTAVIAPEVTGAERSSRSAA
                     LPLPRDFATKQVTVRVSEPRMDESGNVIGYKTLQGEEPDKKSSPVKTLFGWRPDKPKK
                     QEKSELSRRALGMLEQDGKRRGAAVRMEFANTSVYEGEWADGKREGVGRQVFADGDWY
                     EGNWFADLPDGKGKLSFKTGENSFFEGMFNAGVPDGPGKLVRTSGDELVGMWRDGAYV
                     DEEN"
     gene            complement(110179..111414)
                     /locus_tag="OSTLU_25387"
                     /db_xref="GeneID:5005113"
     mRNA            complement(110179..111414)
                     /locus_tag="OSTLU_25387"
                     /product="predicted protein"
                     /transcript_id="XM_001421019.1"
                     /db_xref="GeneID:5005113"
     CDS             complement(110182..111393)
                     /locus_tag="OSTLU_25387"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421056.1"
                     /db_xref="GeneID:5005113"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="JGIDB:Ost9901_3_25387"
                     /translation="MRADAAIALDDALDGDDALALDRRRAVRDRAREAATKTAIHGAA
                     FDGDARARATTTTRRDDDDDARRRETSMDAQRAVLETLTAMQETQIRMNGKLAWISRS
                     VPKIYDAVVNDVTTAIDDQSAKIEALTVRLARGASAGTTAVVGKGTRETREEAAADDD
                     EGRRAREKRLSAPPSRSESPTARRQQTHARAPAATVNYGEIANEENEFAASLPRLGRV
                     GPEVEASTAANTVSKFEKKKTLSPSSSMGKAEDPRKWSRQKWLSHLRATAPKLFGTLD
                     DLSIGDMLDGSKCCFVRRGARVVRQGERGTSMFVVVLGKMHVVVTDAAKNRGEPLQVA
                     TMLAGDFFGEIALMTGEERRATVMAPYEGDGNVWVLEFSKSDVGSVILARPNVLRTLT
                     DVCADRRLEKF"
     gene            <111551..>112241
                     /locus_tag="OSTLU_17769"
                     /db_xref="GeneID:5005015"
     mRNA            join(<111551..111734,111910..>112241)
                     /locus_tag="OSTLU_17769"
                     /product="predicted protein"
                     /transcript_id="XM_001420870.1"
                     /db_xref="GeneID:5005015"
     CDS             join(111551..111734,111910..112241)
                     /locus_tag="OSTLU_17769"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420907.1"
                     /db_xref="GeneID:5005015"
                     /db_xref="InterPro:IPR004038"
                     /db_xref="JGIDB:Ost9901_3_17769"
                     /translation="MGKEKTPKKDKKEKTPKKDKSASPGGDSEDEGDGALRPTAPIAT
                     PLADLKTTKKILKVVKKAAKAKQVRRGVKEVVKALKKETKGVCVIAGDISPIDVITHV
                     PILCEEAGVPYVYVHSKEELGAAGMTKRPTSVMLVMPEGVKGSVKMSSSDKKEFDDMY
                     EKILAKVKSMK"
     gene            complement(112361..>113186)
                     /locus_tag="OSTLU_27043"
                     /db_xref="GeneID:5005114"
     mRNA            complement(112361..>113186)
                     /locus_tag="OSTLU_27043"
                     /product="predicted protein"
                     /transcript_id="XM_001421020.1"
                     /db_xref="GeneID:5005114"
     CDS             complement(112410..113186)
                     /locus_tag="OSTLU_27043"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421057.1"
                     /db_xref="GeneID:5005114"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="JGIDB:Ost9901_3_27043"
                     /translation="MTARCARDEDDDAFRERVRRRIEDAAAADDDAATPTPTPLERER
                     ASTLEDDESVVAFVLEKHAAKDYFACLNVRRPDCDDLGRAVWDVGDAELNRAFRKASL
                     RVHPDKNRAADARKAFDAIGETQKMFKDPVRRAEVLRAAAERAFKEKCKRDPEAMRAR
                     AKAQEKVDAETYADEMRKQREDAAKKRAAEAKARSAQANRRKRRAESDEEEDALTAMA
                     KSLEAEEEAKKTQNVVGGNGDDDDFAGVVRRKSSKKRFMF"
     gene            <113309..>115540
                     /locus_tag="OSTLU_27044"
                     /db_xref="GeneID:5005016"
     mRNA            <113309..>115540
                     /locus_tag="OSTLU_27044"
                     /product="predicted protein"
                     /transcript_id="XM_001420871.1"
                     /db_xref="GeneID:5005016"
     CDS             113309..115540
                     /locus_tag="OSTLU_27044"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420908.1"
                     /db_xref="GeneID:5005016"
                     /db_xref="JGIDB:Ost9901_3_27044"
                     /translation="MPARPWRPAEHTRQRAIFHDLGNAPYRRRESFDAEKLADELANL
                     RRANRHRSDDDGGDDGGGDDGLKRERALMTNERVRALETRARDASEVARRETEKREMQ
                     ERALERANANARRGEVSERLKRHAEREVLELTRELETVRMKADEERDALERCVEEMKA
                     THESSLAKAQTAEAQAAGEAKELLEVKARLEEERDATTKKNAALEGELASVGTCLKET
                     EASLKAVSEAKASADDELSEAREEMARLRDELERTAESNRSNERELRESRRKAEAFAA
                     AVHSARGNDSAARAMMRDSVLTFARLEDAANSREIQILKEHHAAIVERMQEEFAVALA
                     DVKANTGAVAHSTVDESQRVKRTMKGMEEDAREAVCNARRREEEANAVAAKLREELVM
                     TKARLNSMIEAGEGKLNHASIRDAQASRLAAAQAQAICRDLQAELEAEHESAEAARHE
                     ASETAHKYFALRDKYEQREALVNHQKETISALKRDNERSGGEIDELKARCKELKLCLR
                     DNEMTYLNRQDLTEEVEHLNRIIADANVRDRERAIELQREQERADNYAERLERCEAKL
                     NEETNRRIQIERTACDADSTKVRADSDALRAEAMTASAVLLEAEVLRLARINEQAETR
                     VAELEGRVEQLIEQADALASSQNPNQSIRYLEKLRDEREMAEKDAEEAGKAVQNMKAA
                     LQFVVCARRETRDKVVQYAREARKTGRIYTEAPGLPQGVSADIWARVVETVARLNLDA
                     VEC"
     gene            complement(<115565..>115942)
                     /locus_tag="OSTLU_27045"
                     /db_xref="GeneID:5005115"
     mRNA            complement(<115565..>115942)
                     /locus_tag="OSTLU_27045"
                     /product="predicted protein"
                     /transcript_id="XM_001421021.1"
                     /db_xref="GeneID:5005115"
     CDS             complement(115565..115942)
                     /locus_tag="OSTLU_27045"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421058.1"
                     /db_xref="GeneID:5005115"
                     /db_xref="JGIDB:Ost9901_3_27045"
                     /translation="MRRHRASRRRFGIALCAVVVARSARVGRASESLDAFDGERDGAV
                     DALPTRGDDDDVVTRIRFGEKVAVDDLIGPVVINHDCTTKYIENWREMTEREREATRR
                     RLGARNRERHAACKQKLGNENEL"
     gene            complement(<116055..>117065)
                     /locus_tag="OSTLU_88913"
                     /db_xref="GeneID:5005017"
     mRNA            complement(<116055..>117065)
                     /locus_tag="OSTLU_88913"
                     /product="predicted protein"
                     /transcript_id="XM_001421022.1"
                     /db_xref="GeneID:5005017"
     CDS             complement(116055..117065)
                     /locus_tag="OSTLU_88913"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421059.1"
                     /db_xref="GeneID:5005017"
                     /db_xref="InterPro:IPR002893"
                     /db_xref="InterPro:IPR005307"
                     /db_xref="JGIDB:Ost9901_3_88913"
                     /translation="MSLVTAPAHYQERVDAKEECQNCGAADRALAVCARCRSAWFCSV
                     KCQRAYWPFHKQWCRRNDFADAVERHEPKFARWMRKHGKQAVLKDGGRRTRARTRARC
                     DERRRARERRTDGRRDATRLLNDDADEVDRLDRNVVTQDDLYGRANPKPSPPDFDAED
                     MRKMRAAEEARMLAAREDTEDVAWLDIKVPDNLGLELERYKWRQNQSFVEVFVKLPRG
                     TKKHDLEVFLSSTRLDVRVRDEVVVQGNLTAVIKAELSTWVIVDGVLEISMLKKNRRG
                     HYDNGCSNADTFWPKLLADAEASLPLPAPSEYFSTEYEIEKDLGNNARKSSSAPMISQ
                     RR"
     gene            <117629..>118228
                     /locus_tag="OSTLU_27047"
                     /db_xref="GeneID:5005018"
     mRNA            <117629..>118228
                     /locus_tag="OSTLU_27047"
                     /product="predicted protein"
                     /transcript_id="XM_001420872.1"
                     /db_xref="GeneID:5005018"
     CDS             117629..118228
                     /locus_tag="OSTLU_27047"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420909.1"
                     /db_xref="GeneID:5005018"
                     /db_xref="JGIDB:Ost9901_3_27047"
                     /translation="MRDYENAEIAPALPLVEVLEPETNRRLLCTLRRRFTLASGSERC
                     LVLPVDTPIDVLRGEGLDESEDLSDIGDDELLQILPDMNRALAMRGFLLQRSAFCMTV
                     RGPVRMNEDDALEMDTGGDEPNEGVEVCTFTSGTSRYLVYAPLNPVLLITNEDPETRL
                     HEVCFDDADVDEATLQANLDAEYEMLSEPEDELFADVAD"
     gene            <118372..>119700
                     /locus_tag="OSTLU_88914"
                     /db_xref="GeneID:5005116"
     mRNA            <118372..>119700
                     /locus_tag="OSTLU_88914"
                     /product="DMT family transporter"
                     /transcript_id="XM_001420873.1"
                     /db_xref="GeneID:5005116"
     CDS             118372..119700
                     /locus_tag="OSTLU_88914"
                     /codon_start=1
                     /product="DMT family transporter"
                     /protein_id="XP_001420910.1"
                     /db_xref="GeneID:5005116"
                     /db_xref="JGIDB:Ost9901_3_88914"
                     /translation="MPSPAPPAPKSPKRTNATIALARAPRACSGAALGYFFIALVCVI
                     WIAASFLVARLEAHGLSPVLLSFICGSGFIILVPLRLGTIARGCAAMVESARGARAGQ
                     RDARRGAGRANADDEAERGHSSSARAGAAKKRTPGEGHANAVELVPLATAGGEGETRD
                     AERGKANETAASRAKRRGEAGMYSFEYHLKAAFVVAPIWVMAQLAFDYSLLMTTVTAN
                     SMLSSSSAVFTFVVSVYMGLDKFSWMKVAAIVAYVIGTVLVTLADRDPRGVNFDEASA
                     EDMANNALGQNIQSPALGNVLALAAAGLYALYTATMKLYLKDDDKTDMTLFFALMGIF
                     NFVGYGAVLIVTRALNGLPNLFFAFTERVFWLACAKAFFDNVLSDYLWARAVLLTSPT
                     VASIGLSLQIPLAATVEVFIGQPAWASHFQNAALMASGTLFVIAGFLGVA"
     gene            <119913..>120479
                     /locus_tag="OSTLU_27049"
                     /db_xref="GeneID:5005117"
     mRNA            <119913..>120479
                     /locus_tag="OSTLU_27049"
                     /product="predicted protein"
                     /transcript_id="XM_001420874.1"
                     /db_xref="GeneID:5005117"
     CDS             119913..120479
                     /locus_tag="OSTLU_27049"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420911.1"
                     /db_xref="GeneID:5005117"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="JGIDB:Ost9901_3_27049"
                     /translation="MATAKYKWTRAEEDALRDGVRKHGPGKWRTIQKDPELGDILRAR
                     SNVDLKDKWRNMRESGALDAADATGGAEEEREASDREHAEGGGKRRRRDGDEAETSNA
                     KGKENAMDAVTNALFNETQRVKREASAAEAEASAAEAHAARCEREAWEAEKLARELID
                     EAQRQKVGIPVEGTVDVADVAADLLEEE"
     gene            complement(<121351..>121845)
                     /locus_tag="OSTLU_27050"
                     /db_xref="GeneID:5005118"
     mRNA            complement(<121351..>121845)
                     /locus_tag="OSTLU_27050"
                     /product="predicted protein"
                     /transcript_id="XM_001421023.1"
                     /db_xref="GeneID:5005118"
     CDS             complement(121351..121845)
                     /locus_tag="OSTLU_27050"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421060.1"
                     /db_xref="GeneID:5005118"
                     /db_xref="InterPro:IPR000100"
                     /db_xref="JGIDB:Ost9901_3_27050"
                     /translation="MSGRKPARAARTESIEGEVFRPRERLKTNADFDRVKREGRTYNG
                     AHLRIRAVDNANHEPATCTRIGIVVPKKQVKRAVDRNLIKRRIRHAFRTNKDAWPARV
                     DFIVFVNASALEGGFEGVRDDMFAWSREYAARGEQSRATKSFKDAKRRRAEKFRASSD
                     AVNA"
     gene            <122366..128520
                     /locus_tag="OSTLU_25388"
                     /db_xref="GeneID:5005019"
     mRNA            join(<122366..125325,126004..128520)
                     /locus_tag="OSTLU_25388"
                     /product="predicted protein"
                     /transcript_id="XM_001420875.1"
                     /db_xref="GeneID:5005019"
     CDS             join(122366..125325,126004..128479)
                     /locus_tag="OSTLU_25388"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420912.1"
                     /db_xref="GeneID:5005019"
                     /db_xref="JGIDB:Ost9901_3_25388"
                     /translation="MSRARETGVSARARDEDDENDGRADSNASAHSASRSDATRARAP
                     STPRGYDHDGSFHDVGTPATAATAGGERGTSNSVARRIAALERSGDDANANARRASSS
                     DASRGDGWRSGSSSVKSAAALERVAEDVRSVRMKLFAASTSAARATDEYGDALREAGE
                     GLDWRPVVTRAVGVIEDADVDARARAARVAKRVREELDARERERGARLEALAERRSEA
                     AAASNRASKASEKKNLPVFLTGVASSSSKHANFVRGGKALDEGAAKATKRLAFEILRG
                     AAGRSRALRRAANDMGMIRRAPILKRAFDALRAHAVICAPRTRAMREACETFVVVTDR
                     RMRRSAFKSWREGVREQTLGKTCAAIHNVRIAQAALHHWELFAARAFWKRKANELAHS
                     YATGRLRTLAFCGWLLHARRVKERRIAVRARMFGMSVPEAQRAIHEKVKYTAHDAHLM
                     MKSELKYLFEKRCSESALRSQVSSSLKLIRTLENMRRFTADGEDVAWASSDSAMFRGI
                     GAAKRHLHVGFSTRGRTDSPRRKTLSLNRDDVAASRTAAAIEKVATTIDFIPDNSMNV
                     DALSADAYELSQEHQRALTSARDATQKCVAARKAAHDTSLRASRLVANADSRANAAVQ
                     GAQDAMNESIKAEFLAIEAEESANLAERRAEELSESGAGDEKVIAHALQRAAEAAACA
                     VNLSSAHVAAARVAERAIDIAEEHKEAARMLKAQAEEDVEKAQTRVLEAEAVVMATAK
                     LERELNAKAVNAMKRLQRATGDSVVFHDGSLFDRDSNENAVFSPTKARSAEEKKIMRR
                     RVTWDSFGEGIDDDDDDIVESMQNISLAPGKWYTLAECATQAYAKRLARKVLAGFAKN
                     IAWRRQQRDAAQLSFITNIFTSWANVAHINQTRRRLVESVVDEVVSEDRERRLRAYVS
                     CLQKHAKWRKARCEELKISLRRVVAPTITRPAFDHWRKKVANIYLVRRVVNRAIVAWR
                     ERIAKPSHSNAFYAIKRFVTSIFGSPSTLNAELAQARDTVKHSRRETLRAPLSLSNGD
                     IFGLTLRFLSDMEFTTHATAVNFYSKCFTGRSFVVWAMEQTFREQTFRDEADAMFLAN
                     ELLVRGIIAPVARGKIDSEKKAGFLPGLPGMGASMGIVGVGKSWKVFQGNDWTYHVKT
                     HARSALIAACFGNGTEKEKNDIRECVGRMRTLKSLIDGVDDAKSDDEAEEHQEDNEKE
                     RKATISLAKDALSATGGILTAPFRRAHVVLQGVGVMIDDFFSTLGPHIVVALGSLLFM
                     VWLQNFAFACVLTAAFTRHLLWVSEIQRDALLVRCRADQLKKFQMIRGDPKLNRTGAE
                     SSDWWSAIFQHMWDGWMAMWMNRLLREQLEWCFESLDLPFVSKVELSEFRFGTNAPAI
                     KTSRTFAGSDGEMIVEWDLDWTMEDSVVLVSAMFGRGTMVPIPIRIRLADIRISGNLR
                     LMFTWMRAKGGPYVRSLRISFVGLPAYSFSLKTFGAVNLNEIGVIHTALKRVVDDYFK
                     SSLCEPEGYFWDVKEWWLSADNEEIIDQKELITQPLMRDIERIWKRRKDEITVELRVM
                     PLFVELDPNARNSSLKAKYLNGKRCRMAVAIEYARRRVVSKMHIMKKHVEAEHDIEHP
                     TWDSGAFARLDTTDEVVDGQLAMFLMSESMDSNAAKATATKLLRISRKISAVGKIDNI
                     FKLRAGDIHSVEVTLLDPKTLKSVGILHCRIRINILQPNIVVDEGKSSEISLGKRVAV
                     LYESMSSAALHIPRGAADAASSTSRAALKRTATCFGCFRATAADVDDGEDDFGIASLT
                     ALTSIERTRAMGAENVSDFGTDDEDAS"
     gene            complement(<128543..>128761)
                     /locus_tag="OSTLU_27053"
                     /db_xref="GeneID:5005119"
     mRNA            complement(<128543..>128761)
                     /locus_tag="OSTLU_27053"
                     /product="predicted protein"
                     /transcript_id="XM_001421024.1"
                     /db_xref="GeneID:5005119"
     CDS             complement(128543..128761)
                     /locus_tag="OSTLU_27053"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421061.1"
                     /db_xref="GeneID:5005119"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="JGIDB:Ost9901_3_27053"
                     /translation="MDKKLRLRLNGNRNVVGTLRGFDQFLNVVLDDATNDTTSEKTPM
                     GMIVVRGNSVVSMEALEHIAPAVRRQGA"
     gene            complement(<129124..>132159)
                     /locus_tag="OSTLU_41641"
                     /db_xref="GeneID:5005020"
     mRNA            complement(join(<129124..130139,130206..130296,
                     130456..>132159))
                     /locus_tag="OSTLU_41641"
                     /product="predicted protein"
                     /transcript_id="XM_001421025.1"
                     /db_xref="GeneID:5005020"
     CDS             complement(join(129124..130139,130206..130296,
                     130456..132159))
                     /locus_tag="OSTLU_41641"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421062.1"
                     /db_xref="GeneID:5005020"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="JGIDB:Ost9901_3_41641"
                     /translation="MATRVATTDARAPVARRARGARRDVARRATGDDARREALRKARA
                     KLPIDAVVDACLDALEVRRRRAKARRGTDEANDWVRCEQRATRAVMQAPPGAGKTTVM
                     PLAAALAAASAGGDGRAGKVIVLEPRRLAAKAAAMRMAEMLGERAGETVGYQVRFERR
                     ASAATRVEVVTEGVLTRRLRNDPELRDVGLVVFDEFHERNLDADVALALCREVQQTIR
                     PDLRLLVMSATLGEMGARVAALLRDENGPEVPVIVSEGRSYPVETIYLGAPGAGWGEL
                     ERATTNAVKDAVRACPDGDVLCFLPGAAEINRVVRDLQRELPNGVVALPLYGALSQEE
                     QAAALAPSKPGTRRVVVSTPIAESSLTINGVKVVVDSGLCKTPKFDARKGMTRLETTR
                     VSRASADQRRGRAGRIAPGTCYRLWSEASNAKLQPDTTPEILQADLTPVALDLAAWGV
                     GDGADMAWLDPPPEGPLIAARRLLRELGALEEGKLVPSDVGSIMSELPVHPRLARMLL
                     FGASRGAESARLACQLAAVIGDRDLISGRDAPLDVRCRLRALWGQDPLASAGDLDEEK
                     PERAVREAKQVAEQLLGNLRRLASSHPDFCAPAGLLLAVAYPDRVAARKNRGGAFQLS
                     GGGAASVGSEHKDDALLRSGDKANETLVVVELAGDGAGNAGSRNDRVRLAAPIDRACL
                     ESGGALYEALSKESDDVFWASASKSVFARRRLTVGSLVLREIPFSVKDNPEATVSAML
                     DGIREMGLASAFGLNKATTSWLKRAEYVHRSGVDATFPNLSEENLLSSAGEWLAPWIA
                     GAQSKSDLAKVDVASLVKAHFCTYDHLKLVDDACPVAVRLPSGSNAKVDYDGDVPVVA
                     ARIQEFFGTTETPRVGGVNCELHLLSPAGRTQAVTRDLASFWRNAYRTDVRKELAGRY
                     PKHFWPDDPESAAATSKTKKYM"
     gene            <132198..>133773
                     /locus_tag="OSTLU_41712"
                     /db_xref="GeneID:5005021"
     mRNA            join(<132198..132317,132499..132918,132979..>133773)
                     /locus_tag="OSTLU_41712"
                     /product="predicted protein"
                     /transcript_id="XM_001420876.1"
                     /db_xref="GeneID:5005021"
     CDS             join(132198..132317,132499..132918,132979..133773)
                     /locus_tag="OSTLU_41712"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420913.1"
                     /db_xref="GeneID:5005021"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="JGIDB:Ost9901_3_41712"
                     /translation="MPREVTRVGAYALKHALGRGAFGWVKLAVQDETGAKAAIKILDR
                     ENLQRLDEQDQVKAEVKAMADLTHPCIVDLKEVLSDEQSVFMVMQYCPGGEVYDRVRA
                     KGSFGEAEARRHFQRLIQGVDFCHKKRIYHRDLKPENLFFDERGELCIGDFGLAALRA
                     DAEDTNLRTICGTPHFAAPETRSDGYDGGPADVWSCGCILYFMLTAKYPFDGKNFVQL
                     QLMVQKTEPYFPSGSMSRSCEKLIKGMLVKDPTKRMTLDQVMKNSWFKVDFVPVKVEH
                     NANTNRFFDEEDPTLAQFMTPDDKLVVKKSSMMSTNESKLRPIKQLNAFELINIAAFD
                     VANIFDEDENTVSNATRFVSKVEIDRVQAAIIERATALGSVAHRQTQARVVFECQSTG
                     QVVTMRTYQVIPGVCVYDFSRDEGGREHFHTWFANLRDENHEVGKLILSEAD"
     gene            complement(<133816..>134640)
                     /locus_tag="OSTLU_27056"
                     /db_xref="GeneID:5005120"
     mRNA            complement(<133816..>134640)
                     /locus_tag="OSTLU_27056"
                     /product="predicted protein"
                     /transcript_id="XM_001421026.1"
                     /db_xref="GeneID:5005120"
     CDS             complement(133816..134640)
                     /locus_tag="OSTLU_27056"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421063.1"
                     /db_xref="GeneID:5005120"
                     /db_xref="JGIDB:Ost9901_3_27056"
                     /translation="MATFASSETAPRVIFALDFDGVVCDSVGESSLSAWKHGEELWPD
                     VFDADATRAEKERVLDGLRAVRPVVETGYENTTLARALLERLPGYSIEEILNDWDGLS
                     GALMDKWSLDRATMVEAFGRIRDDWILNDFDGWLAPNALYPGVAEAVLAAQKRSDAAV
                     KIVTTKQGRFALAILERMGKISIADDDMYSTTVSGIPKTDVLRTLGVDGNPRKIFVED
                     KLSTLEKVCKADDLDEWELFLVDWGYNTESERARAAANDRITVIDISTFISLLREG"
     gene            complement(<134821..>136758)
                     /locus_tag="OSTLU_13171"
                     /db_xref="GeneID:5005022"
     mRNA            complement(<134821..>136758)
                     /locus_tag="OSTLU_13171"
                     /product="ABC(ABCB) family transporter: mitochondrial
                     ATM1-like protein (ABCB)"
                     /transcript_id="XM_001421027.1"
                     /db_xref="GeneID:5005022"
     CDS             complement(134821..136758)
                     /locus_tag="OSTLU_13171"
                     /GO_component="membrane; integral to membrane"
                     /GO_function="ATP binding"
                     /GO_process="transport"
                     /codon_start=1
                     /product="ABC(ABCB) family transporter: mitochondrial
                     ATM1-like protein (ABCB)"
                     /protein_id="XP_001421064.1"
                     /db_xref="GeneID:5005022"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="JGIDB:Ost9901_3_13171"
                     /translation="MGGYLWSDENPAGKRRVAGAMALLAASKAANVSVPFAFKYAIDG
                     LSAQAGMATSGVEAMTHLPMTAIAATPAVMLVGYGALRASASLANELRNATFAKVSQG
                     AIRAIARRVFAHLHELDLKYHLDRQTGALNRTIDRGTRGISFLLNSMVFNVFPTAFEI
                     ALVSGILSVKCGPEFAMLTGGTIATYTAFTIACTQWRTKFRRQMNALENEGNTRAIDS
                     LLNFETVKYFNNEEHEVKRYDESLKGVEQANLKIASSLGMLNFGQNAIFSASLSAAML
                     LAAQGVAQGNLTVGDLVMVQGLLFQLSVPLNFLGSVYREARQSLIDMTSMFHLLEEKS
                     AVRELENAPALVVPDEGLSVEFRNVSFGYDNGRKIIDGLSVTVPAGGSLALVGASGSG
                     KSTLLRLLFRLYDAQKNGDGETSGIFLGGQNAQSVSLRSLRESVAVVPQDTVLFNDTI
                     HYNIHYGKMSASDAEVREAARLAAIDGPILRMPKAYDTIVGERGLKLSGGEKQRVAIA
                     RALLKGSPLVLMDEATSALDTNTEKDILKMLEVLMKGKTTIVVAHRLSTARNCDNIAV
                     LEDGKVVEYGSHDQLLRRGAKYHAMWTQQNGAGDDRAQRPAHDPTTSLDELLARERAR
                     QDADAKKKAQAQAALDRKRCC"
     gene            <138823..>140436
                     /locus_tag="OSTLU_582"
                     /db_xref="GeneID:5005023"
     mRNA            <138823..>140436
                     /locus_tag="OSTLU_582"
                     /product="predicted protein"
                     /transcript_id="XM_001420877.1"
                     /db_xref="GeneID:5005023"
     CDS             <138823..>140436
                     /locus_tag="OSTLU_582"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420914.1"
                     /db_xref="GeneID:5005023"
                     /db_xref="InterPro:IPR001900"
                     /db_xref="JGIDB:Ost9901_3_582"
                     /translation="VPLDPKLPKGRVSEFSVPKSLQKTLASGAEDVEDVFVAVRLRKW
                     SKGMSMPMMDIIEVVGKGSMGDDLDFMTKVIVAEHGIESGDFSADATACLPKVKVGDH
                     WKIPPEEMKRRVNFREKLVFSIDPPTARDLDDALSVQVLPDGCLNVGVHIADVSHFVK
                     PDTPLDAEARERGTTTYLVHTIFPMLPRLLCENLCSLNPGVERLTFSVEWKMTRGGVV
                     KNVSFKRGVIKSAAKLSYIHVQNVIDAGSDVNKAKEALDDVKFSGAYTAEDVIESISI
                     LNAAAKAMRKKRFEAGAVRLDQPKVGFELNDDYEPVGAAPYVIRDSNRLVEEYMLLAN
                     MYVAEFIAEIFPSHAMLRCHPPPNERKLMELSTFASEHDIDIDISSSKRLHDSLRAIA
                     RDSQDLFDIVQLLATKPMQLAKYFCTGSVDEEQWRHYALAVPYYTHFTSPIRRYPDII
                     VHRLLAAALEHAERQGKSSERDVVEKHSLMTPEICSDVADHCNERKLAAKYAQERSQH
                     LFLCKYLQKNPVIARAIVRQLGQQYVVAYL"
     gene            complement(<143552..145369)
                     /gene="EF1A1"
                     /locus_tag="OSTLU_27060"
                     /db_xref="GeneID:5005121"
     mRNA            complement(join(<143552..144957,145351..145369))
                     /gene="EF1A1"
                     /locus_tag="OSTLU_27060"
                     /product="Eukaryotic elongation factor 1 alpha"
                     /transcript_id="XM_001421028.1"
                     /db_xref="GeneID:5005121"
     CDS             complement(143552..144955)
                     /gene="EF1A1"
                     /locus_tag="OSTLU_27060"
                     /codon_start=1
                     /product="Eukaryotic elongation factor 1 alpha"
                     /protein_id="XP_001421065.1"
                     /db_xref="GeneID:5005121"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="JGIDB:Ost9901_3_27060"
                     /translation="MSEGKEHLSIVICGHVDSGKSTTTGRLLFELGGIPERELEKLRA
                     EADALGKSSFAFAFYMDRQKEERERGVTISCTTKEFFTDKWHYTIIDAPGHRDFIKNM
                     ISGAAQADVALLMVPADGNFTVAIQKGNHKAGEVQGQTRQHARLLNLLGVKQLICGIN
                     KMDCDMAGYKQERYEEIRNEMKNMLIKVGWKKDYVEKSVPVLPISGWNGDNLLSKSAK
                     MPWWNGVDVEDYMGGGKKFHIDCLLNVLNDMVDKPDRNTEAAMRLPISGVYKIKGVGD
                     VLAGRVEQGLVKPGEDVVFLPTHTSSNPCGGKVFTVEMHHKRVEAAAPGDNVGMNIKG
                     LDKLNMPRTGDVMIYKKDTSLAPCKEFTAQIQTLDIPGELKAGYSPIGFVRCGRSACK
                     LTALNFKVGKETGGKKLESPMSLKSNEVAECVFEPVHPLVVDSFKKCEGLSRIAFLDG
                     NTAVMLGKITKVEYKAI"
     gene            complement(<145543..>145926)
                     /locus_tag="OSTLU_17783"
                     /db_xref="GeneID:5005024"
     mRNA            complement(<145543..>145926)
                     /locus_tag="OSTLU_17783"
                     /product="predicted protein"
                     /transcript_id="XM_001421029.1"
                     /db_xref="GeneID:5005024"
     CDS             complement(145543..145926)
                     /locus_tag="OSTLU_17783"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421066.1"
                     /db_xref="GeneID:5005024"
                     /db_xref="JGIDB:Ost9901_3_17783"
                     /translation="MYITKLKDAALSVQFLALSAFTVLAYTIVAATNYELFAKIMPTL
                     VNAGMTASNWPIFKAWIITAQLGWFAGKITAVRGGASQVKKFCALNVFPMLYLVATAF
                     GVGAWDAPVWAVFTAAYAYFGYVEK"
     gene            complement(<146406..>146840)
                     /locus_tag="OSTLU_27062"
                     /db_xref="GeneID:5005025"
     mRNA            complement(<146406..>146840)
                     /locus_tag="OSTLU_27062"
                     /product="predicted protein"
                     /transcript_id="XM_001421030.1"
                     /db_xref="GeneID:5005025"
     CDS             complement(146406..146840)
                     /locus_tag="OSTLU_27062"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421067.1"
                     /db_xref="GeneID:5005025"
                     /db_xref="JGIDB:Ost9901_3_27062"
                     /translation="MFVPAGAFGGVSPERRASELMNAMLTYVSAWIVISQLENVAPRR
                     SVAGEDAGEDGEGEARRVTTSHEFLLDYLEANPVRDGEQWLIALTRVNPTLAERIMAV
                     RRAYAEEDFEWHNVAKLTSESIAAGNERAMREWLKSAVPQSA"
     gene            complement(147117..>149569)
                     /gene="SDG3517"
                     /locus_tag="OSTLU_27063"
                     /db_xref="GeneID:5005026"
     mRNA            complement(147117..>149569)
                     /gene="SDG3517"
                     /locus_tag="OSTLU_27063"
                     /product="predicted protein"
                     /transcript_id="XM_001421031.1"
                     /db_xref="GeneID:5005026"
     CDS             complement(147128..149569)
                     /gene="SDG3517"
                     /locus_tag="OSTLU_27063"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421068.1"
                     /db_xref="GeneID:5005026"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="JGIDB:Ost9901_3_27063"
                     /translation="MARDDATLARRVEAHDFADTGRGQRALRDCARGEVLLEIPLERG
                     FTLAAALEDDAVKRVASCCARHDDVVALHVCAERFRGEKATRAAHVATLPRSFDTAFF
                     WSEEELRELTGTTCLRETMNLREETKNDYETLTKKMEAIGEGGWMREHEVDYERYAWA
                     RSNLWSRQCDLLMPDGKRTRAMVPTFDIFNHSAKAPLGKTHKLNAEKNCVTVYAADDY
                     KAGEQAFISYGSGEAANSKLLTWYGFCIDDNPYEELDVTLTITVDKLRKTVLETALRA
                     SAVAYLQDIDARWRESGDYAEPYLPMLYQQLYTPSAEELEVEESTAEFIVKHTVPERE
                     PLPPPLRMMARVQQLGDEELADPEVRKAIMASANDKTGNTYISKANEMAALASLKLIF
                     QDVCEGFTVGDAESDATELAKPFADVPYKRRLALLVRSGERRIATKAFAESSVRLDAV
                     VRDVTRTAVTRKEGLCEDPKCVTCKSHGCRWLHELRKRRPKVEAMLPTVARYARQIED
                     ALPVAAHIQTINLAYLWLMGHTEDDVANRAATNAQTWPFDTIPTCDASAYADLERMAD
                     LEIDGSAGEEHPHNGKEGEMLLPGVYTCKVKQWGAWLLSQWATCGILDITDLNSIGAE
                     AAALKRRHACSVPTSIALDFLAECAPLVEVGAGGGLWARRLAERGVDIIAYDTPTFDE
                     EYQDGGAAKIGASKLTEVNWFDGIRKGGPESAAKHADRALLLSWIDIAGEGDYATATL
                     DNYTGDTIITIGEWRDHTFGDYAPGTTATGMSFSREFQRELEAAFDRDETLPCANWPM
                     FDSVLIRWRRRAPPS"
     gene            <149720..>150529
                     /locus_tag="OSTLU_41622"
                     /db_xref="GeneID:5005027"
     mRNA            <149720..>150529
                     /locus_tag="OSTLU_41622"
                     /product="predicted protein"
                     /transcript_id="XM_001420878.1"
                     /db_xref="GeneID:5005027"
     CDS             149720..150529
                     /locus_tag="OSTLU_41622"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420915.1"
                     /db_xref="GeneID:5005027"
                     /db_xref="JGIDB:Ost9901_3_41622"
                     /translation="MRATARATATALAHADADAGGTYAFERETTVTRVATRDDGGHEM
                     TLASTIAHPAGGGQPSDSGRVVGANGRAWAFDAATRRRETGEVAHAGRTKPPFEVGDA
                     CRVTIDGAKRVLHARIHSAGHALDVAMIRAGLPPTTLTPTKGVHEPALAYVEYKGKVD
                     PEHELADANALMARLNAEMAKLIAEDGASAAAEMTYDEAKAACGGELPAFIAPDMTPR
                     IVTIVPDTPGCPCGGTHVARMSEIQDFKMTGVRVKKGVTRLSYAIPGMATW"
     gene            complement(150578..151933)
                     /locus_tag="OSTLU_27065"
                     /db_xref="GeneID:5005122"
     mRNA            complement(150578..151933)
                     /locus_tag="OSTLU_27065"
                     /product="predicted protein"
                     /transcript_id="XM_001421032.1"
                     /db_xref="GeneID:5005122"
     CDS             complement(150584..151534)
                     /locus_tag="OSTLU_27065"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421069.1"
                     /db_xref="GeneID:5005122"
                     /db_xref="JGIDB:Ost9901_3_27065"
                     /translation="MPVMDVRRETEESPTLAEGELVMPMFPLGSHVYLPDTEHVLNIF
                     EPRYRSMYNEILFNGSRRFVVPMCAPNEPGKFASVAAVFYLDDLKEVSEQTNDQVKFV
                     CSHTVIERVRVVRSLNDRVWGDRSSFLKVVTEKFEDCDLDDDFTNKETALEERFRALI
                     DMQEKVDEPIRFTKDVELAAPISAKRGKMGFWRLVNLWQSLLQSRVTHRENELQAGIQ
                     KMLRKFLEDSGVDLSDGRQLQLSFESIPDDIRAEIQRMNEQYGEERVELLNSAIYPFQ
                     YLVQMDSHAERLDYFGELVSEEEKRLAAKNTLRAMFESTE"
     gene            <152473..>154683
                     /locus_tag="OSTLU_377"
                     /db_xref="GeneID:5005028"
     mRNA            <152473..>154683
                     /locus_tag="OSTLU_377"
                     /product="predicted protein"
                     /transcript_id="XM_001420879.1"
                     /db_xref="GeneID:5005028"
     CDS             <152473..>154683
                     /locus_tag="OSTLU_377"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420916.1"
                     /db_xref="GeneID:5005028"
                     /db_xref="JGIDB:Ost9901_3_377"
                     /translation="VEARLAELENTATGANAQTHRISQQEYVTRLHRLNEDIANAWLA
                     EDRVNALKLCVKVAKLLGDTKVGKFYPVLFVLVTEVIETVGRLVYDRILRKSEESTSE
                     GGTKALPEDFKASRVRTVAKNTCRNWFYKIATIRDIVPRIYMELALFKCYRFIQDEPP
                     TVQIRRLMKMSRGVADPLAAAYVRMYIAKCALAYGCETEDSAMTLEILKEFMPSYVNV
                     LDETADEDPATAYIFRLGLRRTEYSELMDPAMEWLIECCATNPNPSLLHKVLYMGGET
                     PPVPFLRAVFRSLSPTVVRENALKLIALVGATSTDEDSLEHRDAMADCYRTLVDKFDV
                     IAPNEGDRLAILGDVWRVVQKWTHVEPYLRVAERFLLYVIKYLAQGELETLMKDVARH
                     VHAHLAQAKEREPTKSAELPAEAMRCVERALRVVTDQFRDVDYLVSLKWYVYLGEILG
                     GEAKVKFSAALLKCGSSAGSISDPMCLHTLLEAARTVHDDIDGMSSEESRAEAESLVV
                     DFINNVSFAGDFEAHLNFLVTARSAFANLDMAQEILVYHAISLMTSVYERVGVEHTNK
                     TKAFVNACTAYCQITIPSVRGVNVRLQLFMLTAQAAIVHGLIQQVDGLIRSAVTDAQE
                     SGGETAVGGWIDLPTDRAGAEMLDFVRRCSALLVVQPGNLEKGAFLVFRGLMKVVEDF
                     DWEPSSADEVRAYVSLIPMITAMAQETIPFKIDGLQSNDVLFAGEEAYVEEATEL"
     gene            <155136..>156140
                     /locus_tag="OSTLU_27067"
                     /db_xref="GeneID:5005123"
     mRNA            <155136..>156140
                     /locus_tag="OSTLU_27067"
                     /product="predicted protein"
                     /transcript_id="XM_001420880.1"
                     /db_xref="GeneID:5005123"
     CDS             155136..156140
                     /locus_tag="OSTLU_27067"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420917.1"
                     /db_xref="GeneID:5005123"
                     /db_xref="JGIDB:Ost9901_3_27067"
                     /translation="MNATRDRALGALTLPGSHDSATQYLSPKLQPGRAGQLPRWVDDA
                     VRLAESIGVPADQLVRRWARAQSARVGAQLRLGARYVDLRSGWDGDEGVWRAHHALEG
                     QAVDEILEEVKVFLVEQPSEVVIVELSHFYGDPSESAVERLATAATEIFGDMLAPYPG
                     DARAALYDAQLGKDYVDVNHRAIVVFEDANVGKRFKLWPRETLTNTYADSDDARAMAA
                     FNRDVVAAFNEKSFRDDALLKLSWTLTPQASTVVRSLNIFEKNPKSLLELASSRANPP
                     LRDFAADAALHACSLAHIVVVDDFDHSSVVDIVLASNVHGMFPKGACAWSAAALASER
                     "
     gene            <156417..>157448
                     /locus_tag="OSTLU_27068"
                     /db_xref="GeneID:5005124"
     mRNA            <156417..>157448
                     /locus_tag="OSTLU_27068"
                     /product="predicted protein"
                     /transcript_id="XM_001420881.1"
                     /db_xref="GeneID:5005124"
     CDS             156417..157448
                     /locus_tag="OSTLU_27068"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420918.1"
                     /db_xref="GeneID:5005124"
                     /db_xref="JGIDB:Ost9901_3_27068"
                     /translation="MNESTPLVRARALDGDAEDAQTADQHAVDRTARRTRASVRAPIT
                     LALSWVLLLVVAATYYHSDGFDSVKRATRTVKGVRVFDDDGDRLQSARVCESAFANVE
                     RVDDAHISVNVALASGLERIYERTREEATTCESAEATRDKVLCVNATEVWRCAERAGV
                     LLPNKSIKDRYLIATVIKHAQESDVSKFAFVDGRAEVEGALAPTDQRALGVLIDSDKW
                     NAVRLTYDATIAVSGADAAEDACPHQCRCKFSEGKLCELRSSECQLNEDSFFVLRHDA
                     YGDVLKSLPHAVDGSSALKNVFPQWLVVPPFKSKTTATGVEATRPPALGLPLSCVEKD
                     DAPTNATSP"
     gene            <157812..>159938
                     /locus_tag="OSTLU_27069"
                     /db_xref="GeneID:5005125"
     mRNA            <157812..>159938
                     /locus_tag="OSTLU_27069"
                     /product="predicted protein"
                     /transcript_id="XM_001420882.1"
                     /db_xref="GeneID:5005125"
     CDS             157812..159938
                     /locus_tag="OSTLU_27069"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420919.1"
                     /db_xref="GeneID:5005125"
                     /db_xref="JGIDB:Ost9901_3_27069"
                     /translation="MSVMLSAMMMSAAVTFVRKAASMATTTVRTRRVGVAPRAREVLS
                     DEALRAFPWLVEETTATIWGGGVDVDDVGALGRRAHARARVELEDPLEAELERNAHAL
                     DRARTVEDFVAMSVQVDDAHAVGRKPLREWAHRPGWYEDLQARGSAMGTNLEFGDEAF
                     TVCLYNLHRWSRPIGTSTWAEDLSAVLDAKRGVRAAARENLKGRCVKEVLHTNSRSEE
                     RCMEADVVIFRGDTMLKPSSSLGVKRRLAKSSARSAGSSDKADGNATASARSLLRERL
                     RKAPEAARRASNGAVASTHAHAKLGDPGEDIFVTHLPQKSRRDQVYMYVSTAAPAAEQ
                     TGQDLRDQMLLSQVDYLATSNSALESVWRSPLPTAKFMISSFDAFLRPFRMRVPLIGF
                     GDSAAACKHGRSVGAHILRRISQKYPVESFGTCMKNYDASWFVPNLGVSASSAETIRT
                     QLQLSKYLFYYVAEEVDCPGHVTEKLWLPLLRGSIPVYFGTKTVDDYLPCPKKDCVLR
                     VKDFDSVDALVRRMREIADDQKLYESLTAWRHEVPSNWPERFRTGVARASLDIQAVVC
                     DVMRDGDDARRRGSQSNFAAAAPQSAPWLIQSYPNKHMDMDAVIELEKSGARDDSYCV
                     RQERVSALGEVFADRVVVERPVSNVAVDALVAANASTNASTNAAEVEDEDEDELRLAD
                     PSRLYTKVCDYEAAACGRLLPDPTIS"
     gene            <160349..>160546
                     /locus_tag="OSTLU_9914"
                     /db_xref="GeneID:5005126"
     mRNA            <160349..>160546
                     /locus_tag="OSTLU_9914"
                     /product="predicted protein"
                     /transcript_id="XM_001420883.2"
                     /db_xref="GeneID:5005126"
     CDS             <160349..160546
                     /locus_tag="OSTLU_9914"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420920.1"
                     /db_xref="GeneID:5005126"
                     /db_xref="JGIDB:Ost9901_3_9914"
                     /translation="LFAPIVRVARDVIGVKRFNQIRGKAIALHSQVIGDFCEEFGCDT
                     KVKQNLIRTAKKNGGKLGFLA"
     gene            complement(<160790..>161692)
                     /locus_tag="OSTLU_5458"
                     /db_xref="GeneID:5005127"
     mRNA            complement(<160790..>161692)
                     /locus_tag="OSTLU_5458"
                     /product="predicted protein"
                     /transcript_id="XM_001421033.1"
                     /db_xref="GeneID:5005127"
     CDS             complement(<160790..>161692)
                     /locus_tag="OSTLU_5458"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421070.1"
                     /db_xref="GeneID:5005127"
                     /db_xref="InterPro:IPR000649"
                     /db_xref="JGIDB:Ost9901_3_5458"
                     /translation="EIIASVRAIGGSLAVLKREHLLVGNVARRVLRVIRDEGATSERG
                     DGGGGGESGGGGGGAATKKLKKDVIDTAHEVIEEMETVSTNIASQSSDFVTNGCVVMT
                     MGSNASAGTGLAEAFLRDANKKRSASEGGGGFSVVVAESAPRYDGHAMAKSLAERGVR
                     DVSLICDSAVYATMPSVKLCVLSARGVLADGSALVDSGAYNIALAAKAHSVPVLMLAG
                     SYAISPKTQKEAGFDRVYGFGSPSTALGYGERGADPDAVVINPSFEFVPAELISVFVT
                     DHGAHCPGFINVLLSEMYSPLDSAL"
     gene            <162318..>163727
                     /locus_tag="OSTLU_88925"
                     /db_xref="GeneID:5005029"
     mRNA            <162318..>163727
                     /locus_tag="OSTLU_88925"
                     /transcript_id="XM_001420884.1"
                     /db_xref="GeneID:5005029"
     CDS             162318..163727
                     /locus_tag="OSTLU_88925"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_001420921.1"
                     /db_xref="GeneID:5005029"
                     /db_xref="JGIDB:Ost9901_3_88925"
                     /translation="MNKHAKTPKITGYLLAGVAFGRHGLGALSAAGSRRLWLVDNGCL
                     ACIGVAAGSEVVLSEVRKTLRVTMVTIASVACCCWCATFGAFDAIFAQRVEFLQGLTE
                     RHVAAVGSLLGTLSLARSPASAMAVINECEASGPYCAHILSTTVLKDVLVVALFAINV
                     ELVALSGLDFHNIISDAATMALGGEIASNTTRDVGASAAARRLLVNLKPATQWETSHP
                     ITKLLQPIVRVIGAAIAGIIAGVLLGRLLKPTSLAARWKNIRVGCIVCGAAAIFVSSE
                     HLGLEPLLVCVAAGLTAANRKHTNGAHEREELHAAIAIVTPAVNLLFFTLAGASLRLE
                     NVYNSIVIAVGLVIVRLLGLYCATAISARILKAPAVSDITGERRKNIEWMGHVTQAGV
                     ALGLSRTVAARFPYWGPAFSTLAVSVIVINLFIGPVLFRASIELMNESHSTLNAALER
                     IVATPKRAVEAPATGSPSL"
     STS             162967..164075
                     /standard_name="ha2604"
                     /db_xref="UniSTS:515572"
     gene            complement(<163839..>164341)
                     /locus_tag="OSTLU_27073"
                     /db_xref="GeneID:5005128"
     mRNA            complement(join(<163839..163893,164034..164122,
                     164309..>164341))
                     /locus_tag="OSTLU_27073"
                     /product="predicted protein"
                     /transcript_id="XM_001421034.1"
                     /db_xref="GeneID:5005128"
     CDS             complement(join(163839..163893,164034..164122,
                     164309..164341))
                     /locus_tag="OSTLU_27073"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421071.1"
                     /db_xref="GeneID:5005128"
                     /db_xref="InterPro:IPR008027"
                     /db_xref="JGIDB:Ost9901_3_27073"
                     /translation="MFGAFYKTFMSNSAVYVGVIVAGALAGEKALNYGFDRAWESSNK
                     GKLWKDVEKRLELE"
     gene            <164663..>166813
                     /locus_tag="OSTLU_27074"
                     /db_xref="GeneID:5005030"
     mRNA            join(<164663..164797,164969..>166813)
                     /locus_tag="OSTLU_27074"
                     /product="predicted protein"
                     /transcript_id="XM_001420885.1"
                     /db_xref="GeneID:5005030"
     CDS             join(164663..164797,164969..166813)
                     /locus_tag="OSTLU_27074"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420922.1"
                     /db_xref="GeneID:5005030"
                     /db_xref="InterPro:IPR011417"
                     /db_xref="JGIDB:Ost9901_3_27074"
                     /translation="MPLRLQKKASRVVRAVAEEVQVARGVGTRTDKRGNAKTALWERG
                     KAKLAATAVEKEFAETQLAFSKATNFDDVPPKEKHVLALVRTCGGAGGGSSRDRAFVL
                     ETLARQVRKCAPWRTMLKTHVLLHRLMRECEGGGFKDDFFRFLEFLSRKTYGPKEQTL
                     FNIRYWKDETNKDAYELSGWTRAYAAYLEELCALNEFIPSLVGNVSGAVTTTTNGEAR
                     AVVANPLKDCDFATLIKVLPLVQTLVRRITDCAPTSTTLQKNAVSRYAVGLVAKDSFL
                     VYRVMNEGIINLVDKYFETSKVEAEKGLVIFKKYLTQIEDLQRFYDTCEACAAVENAV
                     VKLEAPPATFLKSMEEYFESAPREGLPLRERRLGATSSTTANNARANAVGSTMLAIDV
                     PANNADFISTTAALPPVEPLNALDALSQLDLGTPSPTSKDDVFSSNALPAPTQPPALA
                     PVAPAASSSTSALDSFSESIAPAVPTEPSAVAYNPFGANPYGGAPQMVPAAPQTAPAP
                     QAKSPRSTNPFGNNPFGTPQPQSLDKSALNDLYAQAPASPRSGHGMSSMAPPQHINPS
                     FMQAPPNSALQRQQVGAPQLALPMAGVQYPQQYPQMAFPQHHQQMGYPQQHPQMGYPQ
                     RPAAEPPLHPAFANPHQGGSPSSSAPSPQNSGSLI"
     gene            <167175..>168368
                     /locus_tag="OSTLU_27075"
                     /db_xref="GeneID:5005129"
     mRNA            <167175..>168368
                     /locus_tag="OSTLU_27075"
                     /product="MFS family transporter: phosphate"
                     /transcript_id="XM_001420886.1"
                     /db_xref="GeneID:5005129"
     CDS             167175..168368
                     /locus_tag="OSTLU_27075"
                     /codon_start=1
                     /product="MFS family transporter: phosphate"
                     /protein_id="XP_001420923.1"
                     /db_xref="GeneID:5005129"
                     /db_xref="JGIDB:Ost9901_3_27075"
                     /translation="MLLASADRTIFAAAALSLKAELGMSMKDLALAQSAFLWGYGVTQ
                     LAAGASSDRFGGAKVLLGGLCVWSIAVAVTPLSSMTTAPVLAVVAARFLFGAASGCAL
                     PASAAAVAAHVPAERRSGALSTIFALFNIGSAFGLAAAGSLITQFGWRAIFYGFGAFG
                     AAWAVAAYAAMPQSVKTFVPRVPKVSELKDENGEQMTELSSEVATQLVALLWCHVVVN
                     WGFMILQSWLPVYLANDLGMSIASSGILGALPWVFTAFMSFSSGQVADKLISRGMERW
                     KVRRLAMNVATIGPALGLFALKYTTTASVALACIVATLGLQAVAVAGYHSYLQDVAPS
                     RAGAILGFTNTVGVVGSIVANMVTGASVEATGSFQATFLYTAAMYASSCFVWNAFLKG
                     EQLFP"
     gene            complement(<168842..>170359)
                     /locus_tag="OSTLU_27076"
                     /db_xref="GeneID:5005130"
     mRNA            complement(<168842..>170359)
                     /locus_tag="OSTLU_27076"
                     /product="predicted protein"
                     /transcript_id="XM_001421035.1"
                     /db_xref="GeneID:5005130"
     CDS             complement(168842..170359)
                     /locus_tag="OSTLU_27076"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421072.1"
                     /db_xref="GeneID:5005130"
                     /db_xref="JGIDB:Ost9901_3_27076"
                     /translation="MSCVRLLTLLALVGTARASAVDNQACATSSTPSGTDFFPAAARL
                     SPGNLTSGSASAFVDGGEGFNVTYAETFKVVRTKALPGVEALTYVLYQCGTTQPTQDV
                     DGSAFPAGARFFSVPVKRVATGMSVAVGYLEQLGLRDKLKLIDPAYVHAPCVQKAEED
                     GTLAASHVIYLGASKYNYTLWHNSISTNNVEMVITDEWDTGYSNSDKDVVFTPSHTNL
                     GMLERLSFIKFISLFFNKETQASGYYADQYERWNYMAGQVAAAQARGGIPTGYKCAWV
                     TAAYEITWDDYKRDICTAAGLSIHIPSAATSSAGYYKYPSKAAFLTDMANVAVVIDES
                     WFTTPSTDATKTAVITNLAFNEAPGLPSLSPSTGMILRLDKHVSDGDPLYSHSTFWPT
                     ESLTWFEDSYVHPAVVVQDLVRLSWLNGVAGVTTLQEGCPRFFRDINSNDVVVKTTAN
                     ECTLWDNARVNGLCLAQLSAQRVAVAALLGASPAARIGANLVTVTFVAIATMILV"
     gene            complement(<170652..>171851)
                     /locus_tag="OSTLU_3430"
                     /db_xref="GeneID:5005031"
     mRNA            complement(<170652..>171851)
                     /locus_tag="OSTLU_3430"
                     /product="predicted protein"
                     /transcript_id="XM_001421036.1"
                     /db_xref="GeneID:5005031"
     CDS             complement(<170652..>171851)
                     /locus_tag="OSTLU_3430"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421073.1"
                     /db_xref="GeneID:5005031"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="JGIDB:Ost9901_3_3430"
                     /translation="ERRYVTIEGVEYDVTDFKHPGGSVIYYMLSNTGADATEAFKEFH
                     YRSKKARKALAALPHKPVDAATREPIEDEAMLKDFAQWRKELEREGFFKPSPAHVAYR
                     FAELAAMFALGTALMHARWHVASVIVYSCFFGARCGWVQHEGGHNSLTGNIWWDKRIQ
                     AFAAGFGLASSGDMWNNMHNKHHATPQKVRHDMDLDTTPTVAFFNSAVEENRPRGFSK
                     LWLRLQAWTFVPVTSGMVLFFWMFVLHPRNALRRKSFEEAAWMFSAHVIRTAVIKAVT
                     GYSWIASYGLFAATMWASGCYLFAHFSTSHTHLDVVPSDKHLSWVRYAVDHTIDINPN
                     NSVVNWLMGYLNCQVIHHLFPDMPQFRQPEVSRRFVPFAKKWNLNYKVLTYYGAWKAT
                     FGNLNDVG"
     gene            complement(<172437..>173252)
                     /locus_tag="OSTLU_93591"
                     /db_xref="GeneID:5005032"
     mRNA            complement(<172437..>173252)
                     /locus_tag="OSTLU_93591"
                     /product="predicted protein"
                     /transcript_id="XM_001421037.1"
                     /db_xref="GeneID:5005032"
     CDS             complement(172437..>173252)
                     /locus_tag="OSTLU_93591"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421074.1"
                     /db_xref="GeneID:5005032"
                     /db_xref="JGIDB:Ost9901_3_93591"
                     /translation="LRESEAALEERADELRRSREKENALSVALSDAEAQLVESRKNVD
                     LIVARADKASQIFTENAAALRLADARAATAELEVNVAEERVKTLEENLDAIAAERDEL
                     QRELDAQKQQQHQLRPISPVVASSPSAAVSASPSKPAASIDVIEALEHERRARALFQS
                     DARYWRERYEAIAATSSAVLTPLSAFAPQTARRPNTPGNALALAAGLPPSPVVLDADA
                     DADPDVEDIDEERPDAENTENEPIPRAKAKPMTSIDSPAPPTRARRSLTAYFQ"
     gene            173579..175705
                     /locus_tag="OSTLU_47343"
                     /db_xref="GeneID:5005033"
     mRNA            join(173579..173634,174553..175705)
                     /locus_tag="OSTLU_47343"
                     /product="predicted protein"
                     /transcript_id="XM_001420887.1"
                     /db_xref="GeneID:5005033"
     CDS             174566..175657
                     /locus_tag="OSTLU_47343"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420924.1"
                     /db_xref="GeneID:5005033"
                     /db_xref="InterPro:IPR002860"
                     /db_xref="JGIDB:Ost9901_3_47343"
                     /translation="MPRRALAVKTATLVAALSALPMDKRALAEGSIESSYWEQVELPL
                     EPGVILLDIAFSSNDPKHGFLLGTRQTVLETKDGGKTWDVRDLSGLLDDDVNYRFNSV
                     SFCGDEGWIIGKPAVLLHTTDGGANWERVGLSPRLPGAPVLITAVQDNGTAEMVTDEG
                     AIYFTKDAARNWKAAVEETVSATLNRTVSSGITGASYYTGTFSTISRNDNGEYLGLSS
                     RGNFYMSWAPGQAYWQPHNRTSARRVQSMGWRPDGGIWELTRGGGIFFSAETGLPEED
                     SEFNEGRIGSRGFGLLDLGYTPSGKTFWTVGGSGSVFYSTDAGKSWKRDRGTDNVAAN
                     LYNVKFQSEDQGFILGNDGILLRFTGAKL"
     gene            complement(<175839..>176855)
                     /locus_tag="OSTLU_13176"
                     /db_xref="GeneID:5005131"
     mRNA            complement(<175839..>176855)
                     /locus_tag="OSTLU_13176"
                     /product="predicted protein"
                     /transcript_id="XM_001421038.1"
                     /db_xref="GeneID:5005131"
     CDS             complement(175839..176855)
                     /locus_tag="OSTLU_13176"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421075.1"
                     /db_xref="GeneID:5005131"
                     /db_xref="InterPro:IPR007130"
                     /db_xref="JGIDB:Ost9901_3_13176"
                     /translation="MIYAWILSAIFVYPAYCVFGPSMWLKNFFLGYIAWYATLDRKTA
                     SSGKRFARWSRRLPFWRILAEYFPVRLHVSAKLDPSGNYLFGYHPHGVIGVGALLTFA
                     TEATGFYEAFPGLDLRLLTLSMNFKFPFTREVLMGLGINSVTKSSVETNLTRAPGASV
                     AIVIGGASEALDARPGWATLTLARRKGFVKMALRTGASLVPVFAFGENDIFEQVENPE
                     GGRLRNFQMYIKQLIGITPPAFYGRSLSRGMWRRIFGRKGVLPKREPIEVVVGNPIAV
                     PKVVDPSNEIIDKYHALYTESLKELYELHRRQFHRLNRGGSSDDLLSDLLTRQGKLQN
                     MQFK"
     gene            <177636..>178384
                     /locus_tag="OSTLU_17797"
                     /db_xref="GeneID:5005034"
     mRNA            <177636..>178384
                     /locus_tag="OSTLU_17797"
                     /product="predicted protein"
                     /transcript_id="XM_001420888.1"
                     /db_xref="GeneID:5005034"
     CDS             177636..>178384
                     /locus_tag="OSTLU_17797"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420925.1"
                     /db_xref="GeneID:5005034"
                     /db_xref="JGIDB:Ost9901_3_17797"
                     /translation="MARRRVPGLKSFLRALLRLTNGALLAGGLATALFAFHLWLGFNK
                     RRVGLDGLDWDDGPDARTPATVDVSENATAIEQTKARVHNFFETEPWFVYFIGGSGAF
                     CAATAWLGLAGAENGNACCLGMYAHQVMWMVILQAGLAAYVSSGKAYASAPTDVTGAY
                     ANAWSFMEEHENAVTSLVLVVFFVQILSIILAIALRRAATESGGVDSDDEEDSYYEDT
                     YGDRERAPLVGSSRVEMERAGDSAWRIRMRE"
     gene            complement(<178560..>179819)
                     /locus_tag="OSTLU_17798"
                     /db_xref="GeneID:5005132"
     mRNA            complement(<178560..>179819)
                     /locus_tag="OSTLU_17798"
                     /product="predicted protein"
                     /transcript_id="XM_001421039.1"
                     /db_xref="GeneID:5005132"
     CDS             complement(178560..179819)
                     /locus_tag="OSTLU_17798"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421076.1"
                     /db_xref="GeneID:5005132"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="JGIDB:Ost9901_3_17798"
                     /translation="MQIAEEGLRLGTIGVQRVGSVLQEVWEDGRAFHELDDRLDRLTE
                     SRKLAEEKRKQVKKKLPPPGSAEMDTTAHAEYVLSEEVHKARMAIIRKEEEALKSERE
                     SLEREKAAHIRALKRVRDEDGSRFNKHPVLGDRYVLMNLLGRGGFSEVYKAWDSVEMR
                     EVACKLHQLNPQWSEERKRTYVRHAARECDIHKSLDHPHVVRLIDVFEVDSDSFCTVL
                     ELCTGDDLDARLKAQGSISEREARAILAQVFNGLAYMSTGPKRIIHYDLKPGNILFDE
                     AGRVKITDFGLSKIMEERSVGFGADSGMELTSQGAGTYWYLPPECFETGPAPPKISSK
                     VDTWSCGVILFQMIYGKRPFGHDMSQEQILHAGTIRNAKEVEFPSRPSISLEGKAFIS
                     RCLAYKQSQRPDVLEASKDPYMTFLTK"
     gene            complement(<179959..>180635)
                     /locus_tag="OSTLU_17799"
                     /db_xref="GeneID:5005035"
     mRNA            complement(<179959..>180635)
                     /locus_tag="OSTLU_17799"
                     /product="predicted protein"
                     /transcript_id="XM_001421040.1"
                     /db_xref="GeneID:5005035"
     CDS             complement(<179959..180635)
                     /locus_tag="OSTLU_17799"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421077.1"
                     /db_xref="GeneID:5005035"
                     /db_xref="JGIDB:Ost9901_3_17799"
                     /translation="MSSTPRATEASAALEMFHARELSREARAKIELLERRLTTSERAT
                     PPSASRETGRSARARAGAERCAMEDSASDSSEDEGGGTRAYGVVDARANASEGKASTV
                     RAEGVGTGASGNGGKKTTKRRRRESATASDLENENPERGGASGGLARSRRHPGGKTAS
                     ARTPEANVSLLDRFENTGSGFKTSSPLVEAMTTPGKGTAGGEREAAATKIRALEEKLA
                     ATEKERE"
     gene            <181131..>182252
                     /gene="FBP53"
                     /locus_tag="OSTLU_27083"
                     /db_xref="GeneID:5005036"
     mRNA            <181131..>182252
                     /gene="FBP53"
                     /locus_tag="OSTLU_27083"
                     /product="peptidyl-prolyl cis-trans isomerase, FKBP-type"
                     /transcript_id="XM_001420889.1"
                     /db_xref="GeneID:5005036"
     CDS             181131..182252
                     /gene="FBP53"
                     /locus_tag="OSTLU_27083"
                     /note="FKBP-type peptidyl-prolyl isomerase; probably
                     targetted to nucleus; N-termonal domain rich in acidic
                     residues, like Chlamydomonas orthologue"
                     /codon_start=1
                     /product="peptidyl-prolyl cis-trans isomerase, FKBP-type"
                     /protein_id="XP_001420926.1"
                     /db_xref="GeneID:5005036"
                     /db_xref="InterPro:IPR001179"
                     /db_xref="JGIDB:Ost9901_3_27083"
                     /translation="MFWGARLEPGVWTPYVPPPDVDVRLHVSQATAASDALEDGARVV
                     IKMRCETDDAVLRAAAGADDDDDDDDSSTDDSFEREEYRVCALIGGRVETCGLDLVLD
                     EYAEFTVEGACGAHLTGYYMPEYGEGDELDEDDVYGDEGDSDSDEEEEMMTTGDDDES
                     DSEDDDSEDDDSEDDDSEDDDSEDDDSEDDDSESESESESEPEGVTRKGGVKIVEMTE
                     DESARSAKKREAETKPAKTPEPKKRAVGAKPESASKKPETPKRVHKNGMEIINTFATK
                     NTSAKVAAGGKKVAMKYIGKLPSGKIFDQTKGSATFKFRLGVGEVIKGWDVGVEGMRE
                     GDKRTLIIPSAMGYGKKGIKGVIPGGSALHFDVELVKVF"
     gene            <183043..>184161
                     /locus_tag="OSTLU_41877"
                     /db_xref="GeneID:5005133"
     mRNA            <183043..>184161
                     /locus_tag="OSTLU_41877"
                     /product="predicted protein"
                     /transcript_id="XM_001420890.1"
                     /db_xref="GeneID:5005133"
     CDS             183043..184161
                     /locus_tag="OSTLU_41877"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420927.1"
                     /db_xref="GeneID:5005133"
                     /db_xref="InterPro:IPR002164"
                     /db_xref="JGIDB:Ost9901_3_41877"
                     /translation="MAALQQLHGNSGLIGALQQKLDGLVGLRSGFLEELHPRVRARVK
                     ALEKLQEAHDGVHEAYLEEKKALEAKYAALYAPMYKARSEIVTGAKEAAVPDDDEELK
                     AEIEAAAKDAVEAPKGVPEFWMIALKNNEELAQMITERDEGALKHLIDITTSALEGED
                     EDGDELCGFKIDFHFEENEYFEDSVLTKTYHMDDEEDNLLRYIESSEINWKSGKNLTV
                     KVLRKKPKPGAKNKKPITKTEPAESFFQFFYPPEVPDEEEQQNMSEDDAEQLQDAMEQ
                     DYELGMMIANNLIPDAVNWFTGDAFADDEEDEFDEDDDEDEFDDEDDEDDEDDEDDED
                     EDEDEEEEFVGGKKSFAAPPAMGGAAKEGEQPPECKQQ"
     gene            complement(<184229..>185272)
                     /locus_tag="OSTLU_41532"
                     /db_xref="GeneID:5005134"
     mRNA            complement(<184229..>185272)
                     /locus_tag="OSTLU_41532"
                     /product="predicted protein"
                     /transcript_id="XM_001421041.1"
                     /db_xref="GeneID:5005134"
     CDS             complement(184229..185272)
                     /locus_tag="OSTLU_41532"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421078.1"
                     /db_xref="GeneID:5005134"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="JGIDB:Ost9901_3_41532"
                     /translation="MASIDVAPEICVRSSKDVVFVKEIGGGMLGAVFVAKTLSTLTTC
                     CVKVMHKWKVAHLDQEKNVSRELELMKRFDSPFLTRALGAFQDARALYLLMDYLPGGD
                     LFQLLVSGPFRGGQFPVDIAQFYAAEVLVALEYIHANEYVYRDLKPENVLIDADGHIK
                     LTDFGFCRRLLRGERAYTTCGTADYMAPEVMLAQGYDQLADYWSFGVLLYEMLVGYAP
                     FASANDGARHRRIVTSDLKFSTAYFPLTAKSLISRLCVVDVSRRLGSSARGVWDLKSH
                     NFFTVDWADVTMRRLAPPHVPARRELDFTENSVSRHKSREIIKALERRGERERAECGA
                     PAHRSQGDEFRGF"
     gene            <187058..>187807
                     /locus_tag="OSTLU_17803"
                     /db_xref="GeneID:5005037"
     mRNA            <187058..>187807
                     /locus_tag="OSTLU_17803"
                     /product="predicted protein"
                     /transcript_id="XM_001420891.1"
                     /db_xref="GeneID:5005037"
     CDS             187058..187807
                     /locus_tag="OSTLU_17803"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420928.1"
                     /db_xref="GeneID:5005037"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="JGIDB:Ost9901_3_17803"
                     /translation="MTRRRPQDGSSEGKTYANVSAPPTMKPLTVKMLKRAIDARQTPD
                     ETLVVNGVPVHNLTVVGKIVGVESKSSYVLYKVDDSTGVCDVKVWSDQDGDQTAEPIE
                     VGAYVRVYGSVKTLANEHMIAAHTQQAVRKITDHNEVTFHMLEVVYASGHAEKTKVSG
                     GAAPANAYTVPQQAPNVAANGDLGSEEIDVSIMGVLKQFAEGEQGMTVDEIASKQNGK
                     FTRDAIKAALEEMSNGGEVFTTIDEDHYAAV"
     gene            complement(<187892..>188863)
                     /locus_tag="OSTLU_41728"
                     /db_xref="GeneID:5005135"
     mRNA            complement(<187892..>188863)
                     /locus_tag="OSTLU_41728"
                     /product="predicted protein"
                     /transcript_id="XM_001421042.1"
                     /db_xref="GeneID:5005135"
     CDS             complement(187892..188863)
                     /locus_tag="OSTLU_41728"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421079.1"
                     /db_xref="GeneID:5005135"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="JGIDB:Ost9901_3_41728"
                     /translation="MCHTSLAPTKPRRWTKGDNLGEGSYGSVWLALNGDTGELFALKE
                     VRVGSSDKHRDESIEQLEQEVDVLSRLVHPNIVRYIGITRQETALYIFLEYVPGGSIA
                     SLVQRFGKFEENVIRVYTRQILIGLAYLHSQRVVHRDIKGANILVEKSGRIKLADFGM
                     AKVLERVSIGKSFKGSACWMAPEVIRQQNIGFEADIWSVGCTVYEMSTGSPPWSECST
                     QVQIIFKIASSNEIPDIPEDLSPEGQDFLRLCLQRDAEMRPEAVALLDEPFVLDAHRS
                     SDHTQNIPGLQYDTWASSSAVDDGSILSSEADPSSRVNSSRHVAWEN"
     gene            <190126..>191916
                     /locus_tag="OSTLU_17805"
                     /db_xref="GeneID:5005038"
     mRNA            <190126..>191916
                     /locus_tag="OSTLU_17805"
                     /product="predicted protein"
                     /transcript_id="XM_001420892.1"
                     /db_xref="GeneID:5005038"
     CDS             190126..191916
                     /locus_tag="OSTLU_17805"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420929.1"
                     /db_xref="GeneID:5005038"
                     /db_xref="InterPro:IPR003961"
                     /db_xref="JGIDB:Ost9901_3_17805"
                     /translation="MPPGAAPGAPDDAGGGYDYAAQLEREPARARDARAAFKHALPLL
                     ALTLVALAALALDAASVARDRARGFSKFFSSIDDDRDGELTLGELAEYLGTARLGVAG
                     SDAATTARRLDSPDDDDTTVSLRELRRGAGLMKSVRETAEWVRWGVGAPECANAFAEN
                     GVSSMDFPSLLAKDGERLRRMGVVRDHEKLTRAMTRQLLHVGRAPSSPRAVKASVERG
                     DGEPRVRVTWRAPKDLGSPRAHEYVVQSGVGVGGRVLKWTHVANVDSETFTVDVDELS
                     RAPGVRHKFRVIAWGEYGRSKSTKAMSNWVTIADESDAKWVGTIVSLALTLRFVIAAR
                     GLIIRGLVLMAALVKFTVALAKGEKKSVKEFLEPALRMKEPSTPPSVGISINRKLFTP
                     TKVLESQSSMSESDPYFVAVGDACMSMESRKQLARKHLDEREFAAGAGGSDGFSPVHQ
                     SIVSRHAREAMTLAPNDSLNGRRREPGVKVLACSDPGCQVNLKKARTVRHFCGLCQAW
                     FCAEHTRVSPHGNRGRCKPESRCICTDCYEILSKEEQRELDEDNAYSIASRTTKKKTL
                     SRAVTMMMTRRRGAKASEISNNLFKDAMSA"
     gene            complement(<192132..>192991)
                     /locus_tag="OSTLU_41856"
                     /db_xref="GeneID:5005136"
     mRNA            complement(join(<192132..192727,192925..>192991))
                     /locus_tag="OSTLU_41856"
                     /product="predicted protein"
                     /transcript_id="XM_001421043.1"
                     /db_xref="GeneID:5005136"
     CDS             complement(join(192132..192727,192925..192991))
                     /locus_tag="OSTLU_41856"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421080.1"
                     /db_xref="GeneID:5005136"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="JGIDB:Ost9901_3_41856"
                     /translation="MSAPPQGQVPTFKLILVGDGGTGKTTFVKRHLTGEFEKKYLPTV
                     GVSVHPLDFHTNCGPIRFDCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTSRTTYKNV
                     PTWHRDITRVCEDIPIVLCGNKVDVRNRQVRAKSITFHRKKNLQYYELSAKSNYNFEK
                     PFLYLARKLSGNAALQFTESPALAPPTVQVDLAEVAAYEKELADAAAQPLPDEDDELL
                     DA"
     gene            <193769..>195346
                     /locus_tag="OSTLU_41777"
                     /db_xref="GeneID:5005039"
     mRNA            <193769..>195346
                     /locus_tag="OSTLU_41777"
                     /product="predicted protein"
                     /transcript_id="XM_001420893.1"
                     /db_xref="GeneID:5005039"
     CDS             193769..195346
                     /locus_tag="OSTLU_41777"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420930.1"
                     /db_xref="GeneID:5005039"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="JGIDB:Ost9901_3_41777"
                     /translation="MQIVFVSSEVAPWSKTGGLADVCGSLPQALVARGHRVMVIAPKY
                     QNGSKSDVLYEGAFDTCVKAKLGCFGGEQEVGYFHQMKNGVDYVFVDHPSFHRKGGLY
                     GDSYGVYGDNQFRFTLLSHAACEAPLQLPFAECGGYYGQDVVFVANDWHAGLVPTLVA
                     SKYRPHGVYKDARTICAIHNILHQGAEPSTTFPNLGVPNEWYGALEYQYPEHMRAHEL
                     DEGRVVNILKGAIATSDRVLTVSQGYAYEITTPEGGQGMEGLLLSRQNRLDGIANGID
                     MDEWNPEADADCAAAFTVTDMSGKLECKRALQKELGLPQRDDVPLMGFIGRLDWQKGP
                     DLLQNALHDMMREDVQVVMLGSGLPELEDFMRWAESTYPDKFRGWVGFSVPMAHRITA
                     GCDILLMPSRFEPCGLNQLYAMRYGTLPIAHATGGLKDTITAYNAFGDADKVLAGTAD
                     YNQGEGVGTGWLFKDMNADALMWAVRSACDVYRSEPKMWRAMQTQAMTQDLSWDNAAT
                     KWEKVFEWSKIDPPHCG"
     gene            complement(<195404..>196024)
                     /locus_tag="OSTLU_93596"
                     /db_xref="GeneID:5005137"
     mRNA            complement(<195404..>196024)
                     /locus_tag="OSTLU_93596"
                     /product="predicted protein"
                     /transcript_id="XM_001421044.1"
                     /db_xref="GeneID:5005137"
     CDS             complement(195404..196024)
                     /locus_tag="OSTLU_93596"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421081.1"
                     /db_xref="GeneID:5005137"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="JGIDB:Ost9901_3_93596"
                     /translation="MRGSDRAAVLVPLAARGDDGWDVTLTTRATSMRSHAGEIALPGG
                     KRDARDACDAGTAAREAREEIGMRTPRDVEVVGRLPVVMSRHRVSVRPVVGVVREGFR
                     VREEEISREEVAEVFTAPLEMFLSADRHRYDDWARPNGARPAVRVHYFEYEGRTIWGL
                     TAMILIEVARRVYGREPEFAVAADDGVAVWDARCRDGEAAVIKSAL"
     gene            <196535..>199390
                     /locus_tag="OSTLU_41853"
                     /db_xref="GeneID:5005040"
     mRNA            <196535..>199390
                     /locus_tag="OSTLU_41853"
                     /product="predicted protein"
                     /transcript_id="XM_001420894.1"
                     /db_xref="GeneID:5005040"
     CDS             196535..199390
                     /locus_tag="OSTLU_41853"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420931.1"
                     /db_xref="GeneID:5005040"
                     /db_xref="InterPro:IPR009756"
                     /db_xref="JGIDB:Ost9901_3_41853"
                     /translation="MARTATRAVRTTTTGGGRRRGSAVRRRGGTRGRASANAADETTA
                     RADAAAAVRDLAKTQLNGADGPRVFTVPAVPVAGAPVRVFADVERADALRSASERTLV
                     GGYNQWKIGSFEKAMERVEGTSWVYVDVDVDERAYEMSFVFRGDGQAYEKDEGQDFVA
                     AVDFGPTPEEFVEILKVVAMEDAARADANAIVDAEMAFARDGVAGVGATFEKYGRLIC
                     KTSTGDAGVAGSTERVFWNKALNPIGGDDAEKLIMHVGFNGWMRGVEEKLTLVRATGE
                     TRDENNDWWVADVPIRPSASVLDFVISDEDEMAWDNNENADYRLAMDVTSDESTWEVL
                     RELTFEEKRAEALRALVEEKQRVARRAEEAAAAKAKAIEVGLKQQAFIIHTEPKVPEV
                     GKPLKVFYNKNNTHLNWSEEIYLTGGFNRWAHETAVAPMKMTPPTEGEEFFSATVPSV
                     PSDAWMVDFVFSSGVGEGAQYDNKGGRDYHIPTRGSAAKKPPLHVVHVAVEMAPIAKV
                     GGLADVVTAIGRAIQDNGHLVEVILPKYQFFNNSVLLGAREYETHFDWAGTTIRVEKC
                     KVEGLQCFFIEPQNGMFQTDSVYGRNDDAERFNFFCNAALEFLLRTARQPDILHCHDW
                     SSAEVARAYWDHYHHNGLTKPKVAFTIHNMNYGQAKLGEAVHHSQMTTTVSPSYAGEV
                     SGSPVIGGNGGKFTGIRNGIDPDIWDPETDAFVPVKYNAENAEKGKAAARAELRSRLG
                     MTGWDDKPIVGVVSRLTAQKGVHLIKHAAHHTISRGGQFVLLGSAPDPKIQGDFNGLA
                     NQLAGDNSGFFFAFDEPLSHLMYAGCDIILVPSMFEPCGLTQMISMRYGAVPVVRATG
                     GLRDTVFDVDNEKERAAWEIAGSTDWEKDGDMTNGFSFEGTDEGSLNYALDRCLDAFY
                     NDRVWFRSLQKRCMLQDWSWNKPALEYEELYFKMLGQ"
     gene            <199740..>200291
                     /locus_tag="OSTLU_27093"
                     /db_xref="GeneID:5005138"
     mRNA            <199740..>200291
                     /locus_tag="OSTLU_27093"
                     /product="predicted protein"
                     /transcript_id="XM_001420895.1"
                     /db_xref="GeneID:5005138"
     CDS             199740..200291
                     /locus_tag="OSTLU_27093"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420932.1"
                     /db_xref="GeneID:5005138"
                     /db_xref="JGIDB:Ost9901_3_27093"
                     /translation="MTLQDEHERHTFESYLSDGERVIGVTFPDGRRREKLDETTWRVR
                     LLPFEFLGQRVTVYATLTLTPLEEGLTIGAKELEFVGLPKEMDLQGKVKLTMEGALRP
                     PRGDKTVNGDVTLTLDAAVNDFVAMTPGLDFVVNGINDTVLANLQGSIEDNLLADYAR
                     WWKQCQRLAAVRASRAAAAAATE"
     gene            <200756..>201424
                     /locus_tag="OSTLU_8186"
                     /db_xref="GeneID:5005139"
     mRNA            join(<200756..200964,201301..>201424)
                     /locus_tag="OSTLU_8186"
                     /product="predicted protein"
                     /transcript_id="XM_001420896.1"
                     /db_xref="GeneID:5005139"
     CDS             join(<200756..200964,201301..>201424)
                     /locus_tag="OSTLU_8186"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420933.1"
                     /db_xref="GeneID:5005139"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Ost9901_3_8186"
                     /translation="AVCASRDGAYVASGSASGTCAVWEARSGRLLARFKAHFKGVTTM
                     TFTPCGSALVTGGEDGAVHAWRVSALDGMVALVGHSKKLVSVRCSSDGNSIISASEDG
                     TARVWDVAS"
     gene            <202833..>204314
                     /locus_tag="OSTLU_41563"
                     /db_xref="GeneID:5005140"
     mRNA            join(<202833..203088,203143..203513,203760..>204314)
                     /locus_tag="OSTLU_41563"
                     /product="predicted protein"
                     /transcript_id="XM_001420897.1"
                     /db_xref="GeneID:5005140"
     CDS             join(202833..203088,203143..203513,203760..>204314)
                     /locus_tag="OSTLU_41563"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420934.1"
                     /db_xref="GeneID:5005140"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="JGIDB:Ost9901_3_41563"
                     /translation="MSAVVDGVDLDRGCDVSAWFEFDLHPLIMRAIQDCGFTTPTPIQ
                     RECLLPATKGRCDIIGAAQTGSGKTLAFALPILQRLLSQGIDVLRALIVAPTRELALQ
                     VCAMMRAVAVYTKIDVCPVVGGMSKEKQERLLNRKPAVIVATPGRMWDTMQSGHEHLT
                     ELSALSFFVLDEADRMVERGHFSELTSIIQNIPQPPRIKRPGGAAKLTSAVPFYGRVK
                     MVDLTTKERKGGAVAKSIAESALECTEDDRDSLLYYLLSAHPGMTIVFVNAISCLRRV
                     VALLKILRVPVEGLHAGMQQRARLKALDRFKAAAAAADKGDRHAHSVLVATDVAARGL
                     DVKGVELVIHYQIPLSADTYIHRSGRTGRADKLGAAVSLVTPKDRARYYSLLKSLNRD
                     GP"
     gene            complement(<204886..>205476)
                     /locus_tag="OSTLU_93598"
                     /db_xref="GeneID:5005141"
     mRNA            complement(<204886..>205476)
                     /locus_tag="OSTLU_93598"
                     /product="predicted protein"
                     /transcript_id="XM_001421045.1"
                     /db_xref="GeneID:5005141"
     CDS             complement(204886..>205476)
                     /locus_tag="OSTLU_93598"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421082.1"
                     /db_xref="GeneID:5005141"
                     /db_xref="JGIDB:Ost9901_3_93598"
                     /translation="VETHDRTHPRTRPDTPLCTQTFYRRLASRTSSDNTASSPRVPRT
                     RPRTPTHRHFSHSRNRSPTVRSTSSRNRSPISRARVRRLVSLRSNWSVGRSFVIGPRP
                     SRTSPYARRIAESTPPLTFAHLFAVAHALTASRVFASYRPSARAPRFKNFSRTRSLCR
                     QCTSAPIDPGARSRGRWQKSSIDRDGMRSGARRGEV"
     gene            complement(<205673..>206090)
                     /locus_tag="OSTLU_27097"
                     /db_xref="GeneID:5005041"
     mRNA            complement(join(<205673..205717,205770..>206090))
                     /locus_tag="OSTLU_27097"
                     /product="predicted protein"
                     /transcript_id="XM_001421046.1"
                     /db_xref="GeneID:5005041"
     CDS             complement(join(205673..205717,205770..206090))
                     /locus_tag="OSTLU_27097"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421083.1"
                     /db_xref="GeneID:5005041"
                     /db_xref="JGIDB:Ost9901_3_27097"
                     /translation="MSAAKEVTWEDQQRICAFSRMNARAHEINSEIKHKEKQIDDLDE
                     ASTELAVNDEDDACVLMGECFVKMDNEQAEAKVEAMLTRERAALEALKGERKVLREGM
                     EELKKKLYERLGNSINLEE"
     gene            complement(<206523..>208412)
                     /locus_tag="OSTLU_27098"
                     /db_xref="GeneID:5005042"
     mRNA            complement(<206523..>208412)
                     /locus_tag="OSTLU_27098"
                     /product="predicted protein"
                     /transcript_id="XM_001421047.1"
                     /db_xref="GeneID:5005042"
     CDS             complement(206523..208412)
                     /locus_tag="OSTLU_27098"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421084.1"
                     /db_xref="GeneID:5005042"
                     /db_xref="JGIDB:Ost9901_3_27098"
                     /translation="MERANRERGVWVDVIWFAPNAAAVGDFKRGAAWTTGMVAAYGVF
                     RRAKACFGTFARCRVVLCGEGGGSEMARAVADAAGASISNVGDDETVDLGERWRGTLA
                     FASSSGKDRVEIHGLRATRLQPRASADDGEEETMDATATTSSAPRPPAPAPPRASALR
                     VVEIVRARDIPSVYLSSTLSLCVRMDDVPESRDVREALFSSWSAAFADAPTPGDVPAM
                     VVKTQWMSGTAARRQYRDVSSDGQLDATPMLLYPVRRGADGLEFHLRAFATVPELLRR
                     LSASAGASGLNKVNVAMDNMSTLARQNALDEADHALGLLSARQSVKLKDIVEDADVVE
                     DVNEDVYKDAEPNLVPLDEAISPEIGAVKSSQIFSAVAAASRGTRSSEGDAYAAYARR
                     WDRGGEATRVGIRVDPGATKATNTAASHAYALRFDDIADRLMDVNESSVSNPTSRRVG
                     EQDALVEGFLIETFSKSIDVAMSQFDQNAAAATILPRIGRSNVVEDAEAREKSFRQLI
                     SETDEDARAQRRAERKRQIEERREKTFLALGIRKPSTATTTSSSIIERDAIARPRAAA
                     AAQQSQRHQALAFDAVAADARDPLKENHVAKSSSISCPACACALNHPVGAVALKFCYE
                     CGAKL"
     gene            <208944..>209390
                     /locus_tag="OSTLU_27099"
                     /db_xref="GeneID:5005043"
     mRNA            <208944..>209390
                     /locus_tag="OSTLU_27099"
                     /product="predicted protein"
                     /transcript_id="XM_001420898.1"
                     /db_xref="GeneID:5005043"
     CDS             208944..209390
                     /locus_tag="OSTLU_27099"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420935.1"
                     /db_xref="GeneID:5005043"
                     /db_xref="JGIDB:Ost9901_3_27099"
                     /translation="MTPTPGKHRRSLSTPVDVLASSALQRALDRARDRHGGDDAPSRS
                     DSLFGDEDAMAHAMAIDLDDAPLDVRELAMQDPKRAKRILANRLSAARSKERKTRYVK
                     GLEKKLNELEECERTLILERERMATAVATLAAENSALQMMMGTPAR"
     gene            complement(<209527..>210366)
                     /locus_tag="OSTLU_88941"
                     /db_xref="GeneID:5005142"
     mRNA            complement(<209527..>210366)
                     /locus_tag="OSTLU_88941"
                     /product="predicted protein"
                     /transcript_id="XM_001421048.1"
                     /db_xref="GeneID:5005142"
     CDS             complement(209527..210366)
                     /locus_tag="OSTLU_88941"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421085.1"
                     /db_xref="GeneID:5005142"
                     /db_xref="InterPro:IPR008507"
                     /db_xref="JGIDB:Ost9901_3_88941"
                     /translation="MANIEAFVASSAPVFSSRAESSRDFALSELWDAFTEPSAFGAEV
                     PLRLQDGQPCVSQYYVPFLSGMQLFVRGDGEDGEDGEDGARRRRVGTGTRLIYEFFEK
                     ASPYSRAPFREIIDLILDERAELRTMTSADLAPSSWMSVAWYPIYRIPQGTMLHDVQG
                     CFLTYHALYAGELCDGDIACPLPPEMTMLSEDLLALRAARAKERASASDDAGAGGGST
                     AAPHAHILRPFGLSMYKMQGDVWAANDDVTDWMNKLMDGAYTWLRMRKTVHPDYEFFS
                     HFG"
     gene            complement(210557..211539)
                     /locus_tag="OSTLU_27101"
                     /db_xref="GeneID:5005044"
     mRNA            complement(210557..211539)
                     /locus_tag="OSTLU_27101"
                     /product="predicted protein"
                     /transcript_id="XM_001421049.1"
                     /db_xref="GeneID:5005044"
     CDS             complement(210581..211306)
                     /locus_tag="OSTLU_27101"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421086.1"
                     /db_xref="GeneID:5005044"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="JGIDB:Ost9901_3_27101"
                     /translation="MSPSGRAAMGRLSRSASARELASAASGTASGTTSGTTSGTTATA
                     AVETSPSVASAKKASEGTCRFCFTGSECGTLIEPCACAGSQAYVHKRCLRRWQRVSYQ
                     TRGARETQCRVCHANYTYESKIWSKEARRGPRFWFSFRARDRLNEYSRAWIQSAANAL
                     LRRKGVSLPRSASSAGNLALLVAHSEVRIWAGREERREGVTSGLPKLLRVASFLVRAA
                     SSYAKVRLLLAPNAAVATAAASS"
     gene            <212003..>212623
                     /locus_tag="OSTLU_27102"
                     /db_xref="GeneID:5005045"
     mRNA            <212003..>212623
                     /locus_tag="OSTLU_27102"
                     /product="predicted protein"
                     /transcript_id="XM_001420899.1"
                     /db_xref="GeneID:5005045"
     CDS             212003..212623
                     /locus_tag="OSTLU_27102"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420936.1"
                     /db_xref="GeneID:5005045"
                     /db_xref="InterPro:IPR001356"
                     /db_xref="JGIDB:Ost9901_3_27102"
                     /translation="MPHNAATVTRPGEGKAPPRGAAVHMTERQLYAFRQQIAAYAHIC
                     QQLLQITTVSATQQTPRQREARYEVPGSAGAHAGANASAQAFAAMAASGTANAQQRKT
                     YEEGQRVGRGEDKGVRGPRWSGTPDQYKILEDLFLAGEQPPVRARLTEITKRLQEHGP
                     IQEHNVYNWFQNRRSREKKRLAEERASNDAALDNQPLASRYGVGER"
     gene            complement(<212715..>213281)
                     /locus_tag="OSTLU_6274"
                     /db_xref="GeneID:5005143"
     mRNA            complement(<212715..>213281)
                     /locus_tag="OSTLU_6274"
                     /product="predicted protein"
                     /transcript_id="XM_001421050.1"
                     /db_xref="GeneID:5005143"
     CDS             complement(<212715..>213281)
                     /locus_tag="OSTLU_6274"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421087.1"
                     /db_xref="GeneID:5005143"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="JGIDB:Ost9901_3_6274"
                     /translation="SASTHVAHARAIAQTAELEGGIQAFYLGTLLAILGGAGFIVVRQ
                     VLIRRELDDQAKKMGERIRAGNASAEDYFEMGSILLRKKVFTQAVRNLQAAEENWDGD
                     EQDLALVHNALGFGYSNTDKIDDAIVEFKKSVALQPGYVTAWNNLGEAYEKKKELKEA
                     IKCYEESLVLSPNNPTASERLEEITLRLR"
     gene            <213564..>214067
                     /locus_tag="OSTLU_17819"
                     /db_xref="GeneID:5005046"
     mRNA            <213564..>214067
                     /locus_tag="OSTLU_17819"
                     /product="predicted protein"
                     /transcript_id="XM_001420900.1"
                     /db_xref="GeneID:5005046"
     CDS             213564..214067
                     /locus_tag="OSTLU_17819"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420937.1"
                     /db_xref="GeneID:5005046"
                     /db_xref="JGIDB:Ost9901_3_17819"
                     /translation="MSLAMTTRARSAPVVGVDARRRRGANADVKARARCVARASEAND
                     DDDGIQLGTAKLPPTCDETALCDALYQWASTLTSSGQNLPFALSQRVDRTNDGFELAF
                     LTAAKNGAPGELAAVGAIAASVEVAGQEKVLMIRGYGNVMNLVDTPVVMGAMPAAIRR
                     AVAMSSA"
     gene            complement(<214211..>214630)
                     /locus_tag="OSTLU_7112"
                     /db_xref="GeneID:5005144"
     mRNA            complement(<214211..>214630)
                     /locus_tag="OSTLU_7112"
                     /product="predicted protein"
                     /transcript_id="XM_001421051.1"
                     /db_xref="GeneID:5005144"
     CDS             complement(<214211..>214630)
                     /locus_tag="OSTLU_7112"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421088.1"
                     /db_xref="GeneID:5005144"
                     /db_xref="InterPro:IPR003323"
                     /db_xref="JGIDB:Ost9901_3_7112"
                     /translation="DHSRLLLRLDFYGVREKIITGDGNCQFRALSDQLFRDGGENHDA
                     VRAAVCDRLVRNPDDYAPYAAPLDFDEYVQKMSNAGEWGDHITLQAAADAYGVDINII
                     TSYSEHGFIEITPKEGADVNSPRSLWLSFFAEVHYNSI"
     gene            complement(<215204..>221644)
                     /locus_tag="OSTLU_93602"
                     /db_xref="GeneID:5005047"
     mRNA            complement(<215204..>221644)
                     /locus_tag="OSTLU_93602"
                     /product="predicted protein"
                     /transcript_id="XM_001421052.1"
                     /db_xref="GeneID:5005047"
     CDS             complement(215204..>221644)
                     /locus_tag="OSTLU_93602"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421089.1"
                     /db_xref="GeneID:5005047"
                     /db_xref="JGIDB:Ost9901_3_93602"
                     /translation="VDDEATNVDFAGVNCEGFGGGALSIDAYAWSHSTPTDSMLRVGV
                     DAPRADDADRGARETYASVLIVNDADREVNLNGVTVQFEFSKLIRLDDAASEFTTLGE
                     FEFTCWGSQIVAPSGARRIVDCGDLSIQMNDVGPRVTFGAIALNAGEFLAGGYSNFLF
                     SFRDRESRVLDAESVRALDPTCDPSAFTTASSIVSVAPTSTFGWNPNAQIMLSACPSL
                     LDVVFSTLESQIEDGVARIRGIVGHRSCSTLDASKVTFAIDLGGDYEQSQLQAACEGL
                     QIVYPISSVPMSDAAATCKAVVTERGVELSFGDDLVLCPGCFIVGGPNNVVLDLSYAD
                     GRGFSSTEISPNGLREPICAGFPRGDGPTDAELVRPCDEEANAEYEGSTLTTGLFLVP
                     SPEACCLACRENPNCNVWTFCTANDGCGRSEFAYSYSSCELKYAAPEIISQDTIPGKR
                     GPNATYISGALRDKEVEPVPFDTSNERKECRAETNANYDGIQISIVNAVSWSACCDAC
                     LADPACAVWNFCDDVSGCDGEFAYQTCVLKLFLVGGDPQKPPAIARGDGVPWVSGSLV
                     DRIPEPVPSIEGCRVEENANYKGHPLNSGSDLVVDSETECCAECKKMKKCNAWVFCAS
                     IDGCGNEYYDYKFGECWLKKLSKEDVETIPVPAWERGENVTWTSGVVGAEVMMPSPPP
                     SPPIVQPSPSPPPPVEVPSPSPPSPSPPVEVPSPSPPPQPPVEVPSPSPPPQPPVEVP
                     SPSPPPQPPVEVPSPSPPPQPPVEVPSPSPPPQPPVEVPSPPPPPPVAVPSPSPPILP
                     TCLRLLQDLQGRCGSIFGIENDEAFDPSCCDIVRGMNVERCFCDTAIIDELGDAIRTV
                     QITAPTLCDSGLELVSGLSCFPSPPPSPPPPSPPPPSPLPSPPPPSPPSPSPPPPSPL
                     PPSPSPPPPSPPSPSPPSPPPPPPVPSPPPPSPPPPSPPPLPPPPPPPSPPPPVDECP
                     TLRLVGGPNAVQNEVLLNSLYVDPGAVATDELDGDISDAIEADTSEVDTSRVGTYRVY
                     YRVRDSGGCDVSAERLVRVIALVPTSEYSQLTSLCVSNIPRVEELCVGFETATISGPN
                     PASFPSCCVALSDLDEAGCFCVPEFIQSFEGIRPSVGELSAFTPLACGFRIKVGDVCE
                     DQQLLTQFLSTPTAVPEFVIPDEKWERIVDDGGALRDDISCADTIDVTRKYCSAIQQN
                     DVGVIPRISDFAPCCGAAARLHNESCLCDDFTLITDDNVMFLREIVGFTPLGCGFNLT
                     EACPALSEELGVQTIVVERPGNDTDPTIPIGTDTPPITRPLEGYGVVVENGQVIPSDT
                     PGRSECDPVRELKNFLVVASRPNSTDYDVLGAIGCCANSTIRVPEVTVVIGYRRREGN
                     MNEFVDALSVPSVECAGLSLISARGEVLDDTLCDRATIEESIAGIKITLANLTIPPDA
                     AITGRVQDGKLFTAKHESEATLDALAPTIRALQCDVGGSWTDVFESPPNDSRRKLLQF
                     FGGIPFFPDQDQFGDANRTDITPSIAPLRPLAGFNLTQYARPSFRDGFDGETSDGGRP
                     VDCLDVLPRVQASLSWFGERVDVGGDFRVAPFNRYDFRGSIGVNNDGGAIRLIDVNIP
                     IVLSSWVNDINGTWREVQNPFDEYAIECLMITVVNGESRTPSLEPCAGLQFRMASYAP
                     DGVFNEASGRPLPKVTLLEVSLSNVTLCAGCKLQGDNETLFRVVSLSGARFDYVGPSV
                     GNPTCRRDIQGQLVEPIAMLPTSPPMTPTPVNGLVCNGEKGLNLKGILLRDGSKFIVD
                     TEEACCQACFRTRDCDTWVYCTGDCKDFAYHSCWLKRAIGGGYTAERGPTEIAAWDRG
                     PDVPWTSGWFPTQRSPPSPSPPPTPSPTPSPTPSPTPSPTPSPTPSPTPTPTPSPTPT
                     PTPTPTPPTESSPTPPAPDSATYFTLQPGVPVQIPASTITVIPGAQLPPGAPPSTPTP
                     APIPVDGLSRTCSPDDATICPTESAPERLRETDARLSLQLLRGEGGSQAVVTGTAINF
                     GRVSDQICLNGVAVMLPFERIVVAANEAPIVAPPEDFIVDCIFVGVRSRDGPPSSDDN
                     GCGVYVEAKVVEAGVELTFRDISLCAECWIVGGPSSALFTVRHIDGLALQLPEQNVTI
                     ANIFTEDAAFCATS"
     gene            <222955..>223251
                     /locus_tag="OSTLU_8728"
                     /db_xref="GeneID:5005048"
     mRNA            <222955..>223251
                     /locus_tag="OSTLU_8728"
                     /product="predicted protein"
                     /transcript_id="XM_001420901.1"
                     /db_xref="GeneID:5005048"
     CDS             <222955..>223251
                     /locus_tag="OSTLU_8728"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420938.1"
                     /db_xref="GeneID:5005048"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="JGIDB:Ost9901_3_8728"
                     /translation="ALSAACKAGDEDAAMKAIEGGADVNERDALGRTPLHWCADGGHS
                     KIAMHLALLKADVNARDRYGQTPLHFSVNLDDTETVNLFLDWGADPSIADEEGET"
     gene            complement(<223609..>224763)
                     /locus_tag="OSTLU_3427"
                     /db_xref="GeneID:5005145"
     mRNA            complement(<223609..>224763)
                     /locus_tag="OSTLU_3427"
                     /product="predicted protein"
                     /transcript_id="XM_001421053.1"
                     /db_xref="GeneID:5005145"
     CDS             complement(<223609..>224763)
                     /locus_tag="OSTLU_3427"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421090.1"
                     /db_xref="GeneID:5005145"
                     /db_xref="InterPro:IPR004147"
                     /db_xref="JGIDB:Ost9901_3_3427"
                     /translation="GGIYVKAGQHLAAQPIAPKPFQIVLRALMDDAARRPFEEDRKTF
                     AEETGLEIEEAFAEFDETPVASASLAQVYRAKTFGGEDVAVKIQQRPVARFLESDLFT
                     IEGYYSLMEWLVPSLRFGWLAKETRRHMGEEMDFTREAANALKASKMLADEFDESELK
                     IPRVHRHLSGKRVLTMEFVPGVRIDDVEALKGKGIDLADVAARIQKIFAQMTFVHGFV
                     HADPHPGNILITDKGGIVLLDHGVYRTLDDDLRKKWANVWLSIIRSDDNALREATGSL
                     GIDPDMSQFFKLILAVVPTRVVEEPLAGSIKRNDDSSSDSFTVAEKRSVMKQIMGVKL
                     EDQTKLFETLPRDLLLVLKANNLLRYVNEQLGSPVNRYKIIWKSASEGLAK"
     gene            <226123..>227110
                     /locus_tag="OSTLU_17826"
                     /db_xref="GeneID:5005049"
     mRNA            join(<226123..226140,226736..>227110)
                     /locus_tag="OSTLU_17826"
                     /product="predicted protein"
                     /transcript_id="XM_001420902.1"
                     /db_xref="GeneID:5005049"
     CDS             join(226123..226140,226736..227110)
                     /locus_tag="OSTLU_17826"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420939.1"
                     /db_xref="GeneID:5005049"
                     /db_xref="InterPro:IPR002579"
                     /db_xref="JGIDB:Ost9901_3_17826"
                     /translation="MLNPITDEWKNKLEPFSYKVLRKEATERPFSSELNSEKRTGRFV
                     CAGCGTPLFDSKAKYDSGTGWPSFYEPLAGAVMEVPDYSIMFLPRSEVRCTACQGHLG
                     HVFEDGPPPTGLRYCMNGAAMKFEPASA"
     gene            complement(<227129..>228529)
                     /locus_tag="OSTLU_41525"
                     /db_xref="GeneID:5005146"
     mRNA            complement(<227129..>228529)
                     /locus_tag="OSTLU_41525"
                     /product="predicted protein"
                     /transcript_id="XM_001421054.1"
                     /db_xref="GeneID:5005146"
     CDS             complement(227129..228529)
                     /locus_tag="OSTLU_41525"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421091.1"
                     /db_xref="GeneID:5005146"
                     /db_xref="JGIDB:Ost9901_3_41525"
                     /translation="MALKEVREPLNPSQRVAVKSALSSSLAVWQGPPGTGKTRTLIAY
                     IGAAVHLASIQKRRGRGPIVLASAASNVAVDNILEGLAKESFIVDGRPLRVVRVGAPA
                     KVQPWLQQLTLDAQIALHPLGRQAAAMREAIRGQSGPAFARQRKQATQLELTAAKSIL
                     KSVDVVCTTCVGAGDELLEDFTFPVAVVDEATQCTEPGALISLTKALSAVLVGDSKQL
                     PPTVVSRDAVDAGLQVSIFERMERLGVKVSLLDMQYRMHPQIAEFPSLAFYKGKVGSV
                     PTPQDRPLVPGIAWPSPNVPVAFVEISAPESRAPDGNSLYNVGEAKMAIGVVRKLLAA
                     GDLAGPGDIGVISPYAAQVRRLQEEYGVGGSPKRNYLDYTEEDKIEELEIRSVDGFQG
                     REKEVIVLCTVRSNPSGDIGFVADPRRLNVGITRAKRGLIVLGNRKTLSNNEMWRSWF
                     KWIDEQNCAVSDTTNF"
     gene            <230308..>231066
                     /locus_tag="OSTLU_27115"
                     /db_xref="GeneID:5004948"
     mRNA            <230308..>231066
                     /locus_tag="OSTLU_27115"
                     /product="predicted protein"
                     /transcript_id="XM_001420903.1"
                     /db_xref="GeneID:5004948"
     CDS             230308..231066
                     /locus_tag="OSTLU_27115"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420940.1"
                     /db_xref="GeneID:5004948"
                     /db_xref="InterPro:IPR000252"
                     /db_xref="JGIDB:Ost9901_3_27115"
                     /translation="MVACAVAVTAMVMPESALAAKAAAVASSSEGLLAKALSWVMHLD
                     KHLAELFVSQGMFAYGILFAIIFAETGFVVTPFLPGDSLLFATGALGALGVVNFPLTC
                     ALLFAAATLGDTVNYSIGSYVGANFMETHPKIFPPEYIAKTRKFYDQYGGKTVVLARF
                     FVIVRTFAPFVAGVANMNYSKFITYNVVGAALWIASFMGLGYFFGAIPAVQENFALAV
                     AGIVVLSLVPVIVEIIQHATGSKGDESETAPAAT"
     gene            <231293..>231877
                     /locus_tag="OSTLU_27116"
                     /db_xref="GeneID:5005147"
     mRNA            <231293..>231877
                     /locus_tag="OSTLU_27116"
                     /product="predicted protein"
                     /transcript_id="XM_001420904.1"
                     /db_xref="GeneID:5005147"
     CDS             231293..231877
                     /locus_tag="OSTLU_27116"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420941.1"
                     /db_xref="GeneID:5005147"
                     /db_xref="JGIDB:Ost9901_3_27116"
                     /translation="MASAEEILMQVIDRREFKPTSEECPFCREARVKENGSKCLGICR
                     NPQNVPGPLVYPHAMQTWEDAVDCILWAMRDISTPRTDHGVQVMWEYAVEHGNMERSR
                     FFGFSSDMYHFDHFIGKALNTYDAFVRNTGHEITQVSTMEDGRTRVDVRVKDRVGEET
                     EWIFIMVRRTFGKYEGCIQAHRIVRADFPHLGDI"
     gene            complement(<231899..>232954)
                     /locus_tag="OSTLU_17829"
                     /db_xref="GeneID:5005148"
     mRNA            complement(<231899..>232954)
                     /locus_tag="OSTLU_17829"
                     /product="BASS family transporter: sodium ion/bile acid"
                     /transcript_id="XM_001421055.1"
                     /db_xref="GeneID:5005148"
     CDS             complement(231899..232954)
                     /locus_tag="OSTLU_17829"
                     /codon_start=1
                     /product="BASS family transporter: sodium ion/bile acid"
                     /protein_id="XP_001421092.1"
                     /db_xref="GeneID:5005148"
                     /db_xref="InterPro:IPR002657"
                     /db_xref="JGIDB:Ost9901_3_17829"
                     /translation="MAVSGGLGSWAAIVGNVLLFALVLGLAVTVEFEAFKKSLRSRGL
                     VIGVFSQFVFLPLFGFTMARTLLWDQPALGIPLIITTSSPGGSYSNWWTSLFNADLSL
                     SVAMTTVSSILSVGFLPLNLYMYTEGAYPNGTNVRMKWGGLFLSISMVISGIVLGLFV
                     GRRAPKARAPLNFVGNVCGVLLVLLGFFFSSNSSAPIWDREWKFYVALIVPCVAGLVV
                     SLGFAKLTRLDMPQALAVAIEVCYQNTAISLAVILSSFEDDPSCASSAGSACNVVGVA
                     SGVPTFYQFVQVFSLGILCLLAWKSGWTYAPKGTPLLTAISKSFQPTHRDPGAFREVD
                     LDRSEEMSEMPREVENV"
     gene            <233294..>234169
                     /locus_tag="OSTLU_17830"
                     /db_xref="GeneID:5004949"
     mRNA            <233294..>234169
                     /locus_tag="OSTLU_17830"
                     /product="predicted protein"
                     /transcript_id="XM_001420905.1"
                     /db_xref="GeneID:5004949"
     CDS             233294..234169
                     /locus_tag="OSTLU_17830"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420942.1"
                     /db_xref="GeneID:5004949"
                     /db_xref="JGIDB:Ost9901_3_17830"
                     /translation="MARDPRGLDLLLRAARTATEARARDRDETVKKSTTVRFQTADAT
                     GRVEAKTRRQGKARADGAMRDRTNDFERGGTAGKGKRGRGRATMTMKAKANAPPPDVD
                     DSAEATTVREETLAIGAETLAREHADVVIERVRQWLDVMMSDARGRLTALERSQTRTH
                     RALEKYDSEEAQDDVGIEMLVEFDKTLEIERSILEETMKNLEAMRTKVEFESANLALR
                     WLRRSNCGGDDDGQASEEDQATDGRKYFYSSSAYAFLQTAIGAFMNDTTPAKSAKSAD
                     AHSPSGVLDAARLFT"
     gene            <234346..>235446
                     /locus_tag="OSTLU_41587"
                     /db_xref="GeneID:5005149"
     mRNA            join(<234346..235020,235102..>235446)
                     /locus_tag="OSTLU_41587"
                     /product="predicted protein"
                     /transcript_id="XM_001420906.1"
                     /db_xref="GeneID:5005149"
     CDS             join(234346..235020,235102..235446)
                     /locus_tag="OSTLU_41587"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420943.1"
                     /db_xref="GeneID:5005149"
                     /db_xref="InterPro:IPR003495"
                     /db_xref="JGIDB:Ost9901_3_41587"
                     /translation="MPVGVCVITGFLGSGKTTLVNYILKADHGYRIAVILNDFGAELG
                     VEKMLVQQDGVDGDNASRTLVEDWVELNNGCVCCTVKGSLVQTIEGLLEKRKEMGEKF
                     DFILLETTGLADPGPVARELWVDDELVEEDGAVLDSIVTLVDASNIEKQIEENKEATL
                     QVAYADTILLNKADLVKAEDLERVKARIAAINAEAEIVVTTRSSVDLGIVLNQGTVAG
                     GGCGRKPYAPASSVHNSDIRTVCIATSGFLDGESFQNWLEDLLWERRNAEGGADILRA
                     KGLVYTAGSDKRRVLQAVREVYEITDGPVEENSDEVMNKLVFIGRNLDEDALAVGLKS
                     CVARD"
     gene            complement(<235573..>236202)
                     /locus_tag="OSTLU_7246"
                     /db_xref="GeneID:5005150"
     mRNA            complement(<235573..>236202)
                     /locus_tag="OSTLU_7246"
                     /product="predicted protein"
                     /transcript_id="XM_001421056.1"
                     /db_xref="GeneID:5005150"
     CDS             complement(<235573..>236202)
                     /locus_tag="OSTLU_7246"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421093.1"
                     /db_xref="GeneID:5005150"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="JGIDB:Ost9901_3_7246"
                     /translation="ASAGDAAWFSALDDDALERAMTRRDDDGRTSFHRACAAGARGRD
                     VTRLARERMKGEAMARVVTTADDGGWTPLHTSAALGERETCGTLLARGADCEARTPGG
                     QTPGHYAASKGRVGTLETLVSGGRGWLTMEDDVGATPLHRAAARGELRAIDFLVDALA
                     NGTTEVPKMALEARDKRGQTPLLVACEAGQDEAAIRLAKHGANVGAKDGE"
     gene            <236598..>240833
                     /locus_tag="OSTLU_88951"
                     /db_xref="GeneID:5004950"
     mRNA            <236598..>240833
                     /locus_tag="OSTLU_88951"
                     /product="predicted protein"
                     /transcript_id="XM_001420907.1"
                     /db_xref="GeneID:5004950"
     CDS             236598..240833
                     /locus_tag="OSTLU_88951"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420944.1"
                     /db_xref="GeneID:5004950"
                     /db_xref="JGIDB:Ost9901_3_88951"
                     /translation="MTTRESGETRPRRAETTMEGEGGCAATATRTTNAQGVHTVSIAL
                     KTLPKGVANAREVTFHWGVMREKTGKTWQVLPSELHPPNTEYYKGDKAMRSAFPVWGP
                     VNLVLDPQAKSVAFALYVEKTGEWINAVGGGNFEIDLAAETPSTAVKAAASAVEAPAP
                     TPKEEILKTAPKVTVKATATEMTSALTDPIELLIADMARVEWEAVGRPGLDAQTRDDM
                     LRRAADQIKSKLAEGMSFEQIAAGDASVKSVPKVVATEAPKVVAKTIETPIATKKFSL
                     EDFQAVAQDRATDDTNVKWNKLYEEGGTTIFVEAREVNGSGIQLHVLADSKDDLIIHW
                     GATTTTDGSWKPPPHGFSTQPSRSWASSGSSWETELERISPNLRAVTLDVPLDVKARE
                     GIIFVLRTTSNKWIKNGRDDFFASLEGSVLERPAKTEKKSERRKDSQQDRSRKESRSE
                     PVVVKVAKKEKPAPIKRDRWDVDDIALDQGVFQNLGGFVAQDMVDRICGEESGATRSL
                     MHRYNAGADMLGAMHGAGEPGLTALFCWFRFMALRQLVWNNDYNIKPREISAAQARMT
                     EGLSAIYRQDPEYRDIVRLIMATIGRGGDGDVGQRIRDEILAVQQKNNCKGGMMEEWH
                     QKLHNNTSPDDVPICEALLKFIAADCDISVYWAHLHANGIDAARMKAYDRQICSEPSF
                     SRDQYEGLTADLTEYLRTLKAVHSGADLDSAAEACLGYHQDACKGKEINIPPIREVAS
                     ERLEELLCAARELRSEDPLLALEAMIEARRYLWTWTRPGGKSNDRIKDVIYLDLALEG
                     AARSVIEGSLESLPTRAPYEVLRIMSLVLENLCMSASGNHELRICLKEWQNVLEAARR
                     QGDWALQAKAVCDRLQNSLGEISQRYIDALQPTAQSMGNKLGVDGHVLDLFSEEIIRG
                     TAAAPLSQMLRVLDPVIRNVANMGSWQIVSNAECSGVIVSVASLADVQNVKYSQPTVI
                     IADRVGGEEDIPVGVVAIVTPDMPDVLSHCAVRARNEKVLFATLFDVNVLEQMKAMTG
                     KSVQLKPSAQGDDLQFDVVDGIIGTDAEVIATSSSDSVSSDISIIKRPFQGKFVATSS
                     EFTPELVGGKSRNLQLLRGRVSNLIKLPPSVAMPFGTFDAVLDVPENAGAKRQIAELV
                     KQLEAYDSTDGVGFKALIAEVKACIATLKPTADLSKSLKVAFEAESLGWPGDLVTSAQ
                     GQKAWKTILGVWASKYNERAVLSCKKAGLNHADLSMAVLCQPVVRARYAFVLHTVNPQ
                     NNDKSEIYGELVCGLGEALVGNFSGRALSFKTSKSNLDNPTVVGFPSKSKGLFMEQDS
                     LIFRSDSNGEDLEGFAGAGLYDSITMEEATLKNVDYSTDSLITDETKRQKLLATISKV
                     ALEIETLCGSPQDIEGAISEDGQLYIVQTRPQV"
     gene            complement(240946..242836)
                     /locus_tag="OSTLU_27122"
                     /db_xref="GeneID:5005151"
     mRNA            complement(240946..242836)
                     /locus_tag="OSTLU_27122"
                     /product="predicted protein"
                     /transcript_id="XM_001421057.1"
                     /db_xref="GeneID:5005151"
     CDS             complement(241046..242809)
                     /locus_tag="OSTLU_27122"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421094.1"
                     /db_xref="GeneID:5005151"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="JGIDB:Ost9901_3_27122"
                     /translation="MADQVIVIGGGLAGLSAAHTVIEHGARVVLLDKCSFLGGNSTKA
                     TSGINGALTKTQARLNIPDSADKFEDDIIKGAAGVGHTEAPAHTVPLAKVLAQGSGSS
                     VDWLMEKFNLDLSLVAQLGGHSFPRTHRGKERFPGFTITYALMEGLEKIMEETNGEIA
                     RIVTKAEAKRLLKDGSGTVIGVEYEKGGALHQEYGPVVIATGGFGADYQSDSLLKKYR
                     PDLQALPTTNGDHCTGDGIKMALAVGADTIDMESVQVHPTGLVNPSEPDSKVKFLAAE
                     ALRGVGGILLDADGNRFADELGRRDYVSGEMNRNKGPFRLILNGKASKEIEWHCKHYV
                     GRGIMKRHDTGAEVAKEMGISPQKLADTFAKYNEAARTKKCPFGKKFFTNAPFEMNDF
                     FHSAIVCTVVHYTMGGLAINTDSQIVGSSGPIPGLYGAGEVVGGIHGRNRLGGNSLLD
                     CVVFGRVAGASVSRHLMATAIKALRSGQSVALNRVANLNDKINPSMSTASAAPVSSGG
                     GARAITMDEIAKHNSEGDLWVIIEGAVYDLTTFLPDHPGGKKAIMLFAGKDATEEFNM
                     LHPPNVLKKYLSPDAKIGTVA"
     gene            complement(<243094..>245475)
                     /locus_tag="OSTLU_591"
                     /db_xref="GeneID:5004951"
     mRNA            complement(join(<243094..243821,243870..>245475))
                     /locus_tag="OSTLU_591"
                     /product="predicted protein"
                     /transcript_id="XM_001421058.1"
                     /db_xref="GeneID:5004951"
     CDS             complement(join(<243094..243821,243870..>245475))
                     /locus_tag="OSTLU_591"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421095.1"
                     /db_xref="GeneID:5004951"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="JGIDB:Ost9901_3_591"
                     /translation="AARDVELTCAAFAVWGANTAVGKTLVSGGLARAARSAEAGTLFV
                     KPVQTGFPEDSDAAFVARVSGGVESMGEHAAVAAGETARKGLEGDRGAWAHTEFAWRR
                     PAGPHVSAAEEGRGVLDDDIVRATSRYLREFAEKMRANESGQQRALALVETAGGVASP
                     GPSGTLQCELLRGLRLPAILVGDGRLGGISATTAAYESLHARGYDIVAIVMADDDGLA
                     NHKAMAKILPSETRVWALPPLPPEGQADAWLEDSKHTFDDLLKYITKWHDDRIKTLQS
                     LPDEALTKIWWPFTQHAMVERDAVTVIDGRYGEDFAIYAQNTHSSKDGSIVLRFDGSA
                     SWWTQGLSPELQQELVRTATHAAGRFGHAMFPENVHQPAVDATTALLEGPGKGWAARA
                     FYSDNGSTATEVGLKMAFRKFYVDAGFVSKDGNQRAKDLVNKGADDLPPLRIIALDGS
                     YHGDTLGAMDMQSPSVFTGPMQTPWYQPRGLFLQPPSLAIREGRWNVALPRDGLLNDG
                     DRLFREGKDVDENTSWTSKEAAFNIAALLERAAKDAKDNNMGHVGALIMEPVLHGAGG
                     MVLIDPLFQNILMKSCRERKIPVVLDEVFAGIWRLGTEGAWEIIGEKPDISCYAKLLT
                     GGLIPMSATLATADVFDAFYGPGKAQGLLHGHSYTAYPMGCAVAAKALSMYKDPAKNR
                     NVIVSKSSSTGEPTSVLRELWDEDALKKISTLSNVRRVIGQGCVLAVELEVEGEGGYS
                     SNAARDVVMRLLPHSIQARPLGNVVYLMCAPTTSKDAC"
     gene            <245929..>246564
                     /locus_tag="OSTLU_27124"
                     /db_xref="GeneID:5004952"
     mRNA            <245929..>246564
                     /locus_tag="OSTLU_27124"
                     /product="predicted protein"
                     /transcript_id="XM_001420908.1"
                     /db_xref="GeneID:5004952"
     CDS             245929..246564
                     /locus_tag="OSTLU_27124"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420945.1"
                     /db_xref="GeneID:5004952"
                     /db_xref="JGIDB:Ost9901_3_27124"
                     /translation="MRVTKILHAMERTEGFECAAEVRAMVEIFAHGTLREYRARAANE
                     KLPTLTTREEAKLKRLSTCALCAEGGTIAYVRLMRELEFTSERAMEKFIVDECLGEIV
                     WGRLDPKNKVLRVRRAKARDARASALDGVIADVSRWHAITETMLASLNEQIAYVSSEK
                     AESLAREDELNAAIEETKKQLKAAEPDVAERVDEDEDMDEDGPSTGVKRRR"
     gene            complement(246661..>247986)
                     /gene="RACK1A"
                     /locus_tag="OSTLU_19794"
                     /db_xref="GeneID:5005152"
     mRNA            complement(join(246661..247640,247949..>247986))
                     /gene="RACK1A"
                     /locus_tag="OSTLU_19794"
                     /product="Receptor of activated protein kinase C 1A,
                     component of 40S small ribosomal subunit"
                     /note="Has EST support. CTZ14_E06.x1d_t"
                     /transcript_id="XM_001421059.1"
                     /db_xref="GeneID:5005152"
     CDS             complement(join(246713..247640,247949..247986))
                     /gene="RACK1A"
                     /locus_tag="OSTLU_19794"
                     /note="Recepter of activated protein kinase C 1A; Also
                     cytosolic 40S small ribosomal subunit protein RACK1A;
                     protein is identical in sequence to RACK1B"
                     /codon_start=1
                     /product="Receptor of activated protein kinase C 1A,
                     component of 40S small ribosomal subunit"
                     /protein_id="XP_001421096.1"
                     /db_xref="GeneID:5005152"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Ost9901_3_19794"
                     /translation="MATQMQLRGVLKGHENWVTSIATPLDNSDILLSSSRDKTVILWN
                     LTREEENYGYPRRSLHGHSHFVQDVVISSDGQFALSGSWDGTLRLWDLNTGTTTRRFV
                     GHTKDVLSVAFSVDNRQIVSGSRDKTIKLWNTLGECKYTIQDADAHSEWVSCVRFSPV
                     TSNPIIVSGGWDKLVKVWNLTNCKIRTNLVGHTGYINAVTVSPDGSLCASGGKDGVAM
                     LWDLGEGKRLYSLDAGDIIYGLCFSPNRYWLCAATESCVKIWDLESKSIVDELRPEFP
                     PVGKKSQQPYCTSLQWSADGSTLYTGYTDNVIRVWSVGSVGTGMM"
     gene            248139..>249954
                     /gene="HXA3501"
                     /locus_tag="OSTLU_51202"
                     /db_xref="GeneID:5004953"
     mRNA            join(248139..249410,249510..>249954)
                     /gene="HXA3501"
                     /locus_tag="OSTLU_51202"
                     /product="predicted protein"
                     /transcript_id="XM_001420909.1"
                     /db_xref="GeneID:5004953"
     CDS             join(248308..249410,249510..249954)
                     /gene="HXA3501"
                     /locus_tag="OSTLU_51202"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420946.1"
                     /db_xref="GeneID:5004953"
                     /db_xref="InterPro:IPR000433"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="JGIDB:Ost9901_3_51202"
                     /translation="MASALVPKRRRVATENAMTKLSGNGESCALFNCNYCQKDISNVV
                     RVRCAECANVDLCTECFAVGVEPHPHKAYHQYHVIDNMSFPLFTRDWGADEELLLLEA
                     VEMFGLGNWTEVSEHVGTKTRAQCHAHYFEVYVKSPCAPLPDMSKILGKGVARMTSDE
                     LKAEAEQKANENKDVEEEEKLLESLANPNAVKTEGNVQELTGYNIKRNEFDPEYDMDA
                     ELPLAEMEFRENDTEEDVQMKLRMIEIYNSRLQERARRKQFILERNLLNVKKQQNVEK
                     KRSQYERDLHGTMRIFARFLTSTEYDVLLEGLAAEHRIRTRITELKEYRRNGIHTIAE
                     GEDYDLEKRRRETEFARLHAIEHPTSKNIARANNLGPRRRMYLSLDLADLPGVDLLND
                     DEKELCRSCRLLPVQYLSMKVELMREGLKSEKPLNRNHVRNMFKVDPLKAIRVYELLL
                     QHGWVLEDGFVNPGEDEDSEPAPKKSASADEEEDEEDDEVDYETDDNDEDEDEEDDEE
                     EDSEEDD"
     gene            complement(250005..251438)
                     /locus_tag="OSTLU_25402"
                     /db_xref="GeneID:5005153"
     mRNA            complement(join(250005..250146,250198..250369,
                     250445..250876,250946..251007,251060..251438))
                     /locus_tag="OSTLU_25402"
                     /product="predicted protein"
                     /transcript_id="XM_001421060.1"
                     /db_xref="GeneID:5005153"
     CDS             complement(join(250073..250146,250198..250369,
                     250445..250876,250946..251007,251060..251156))
                     /locus_tag="OSTLU_25402"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421097.1"
                     /db_xref="GeneID:5005153"
                     /db_xref="JGIDB:Ost9901_3_25402"
                     /translation="MNSMALDIGAKERCARVVRVAGDVADEKIWQNGEILEGSKMALY
                     AGVMMYLAKNSNRTDNISESVQVVEKSTKINTQDVEPVLEFFNSPMASVCVSVLQDVV
                     LNIADSVACAYVTCARESGLQAPVNGGVARTEDTGAVVRIPPFRDALSVRLKSTRSLE
                     KFRNETSLRTWLARNYYDVVAMYEDWHKLWGMNANGELVTRKIHVCRQPELAKVKGFR
                     LAVSMIIELADVSLPLFRSALNNCSRVASWLLVTLIGRSLGLVYRGIKESMDPQNRVK
                     FT"
     gene            <252278..>253312
                     /locus_tag="OSTLU_27128"
                     /db_xref="GeneID:5004954"
     mRNA            <252278..>253312
                     /locus_tag="OSTLU_27128"
                     /product="predicted protein"
                     /transcript_id="XM_001420910.1"
                     /db_xref="GeneID:5004954"
     CDS             252278..253312
                     /locus_tag="OSTLU_27128"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420947.1"
                     /db_xref="GeneID:5004954"
                     /db_xref="JGIDB:Ost9901_3_27128"
                     /translation="MHVTNVGGSLTTAVCLSLIAWSVRVLRSAKHRDRARQRTTSSSQ
                     PTVKLNKQTYGVLSAKAFWMLVQTKPVKYLLLDVRPKSEDGGATAVTKLSDRLAVTHI
                     LPEELANLLRNRNTLWKKRFPNIPVPSLRTTMIFVSTHGHSSSHAAALATSLGFTRCS
                     IVDGGLAAAVPLAHFDEPAVFSSGKDRALSFDAVLLLLETVRDDGNALGLVILDIRRF
                     DERALYGTLEGSTHVPVDHLPKAVHMNDEEWVRMFRFHKPTSDNLILLHSRSSSSAAW
                     AKQLLSDAGLHNCHSYVDGAYAGPDGTLRSYEAYEEGGAPPEPVSIGQSVTFNRTSAE
                     RELLNLRIRV"
     gene            complement(<253432..>254832)
                     /locus_tag="OSTLU_17840"
                     /db_xref="GeneID:5005154"
     mRNA            complement(<253432..>254832)
                     /locus_tag="OSTLU_17840"
                     /product="predicted protein"
                     /transcript_id="XM_001421061.1"
                     /db_xref="GeneID:5005154"
     CDS             complement(253432..254832)
                     /locus_tag="OSTLU_17840"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421098.1"
                     /db_xref="GeneID:5005154"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="JGIDB:Ost9901_3_17840"
                     /translation="MMSLEARREALRLPRPDVAAPGMEDPWNDEKWQKVKWTVFRDVA
                     YDLGPFFEKHPGGNWLLNLAIGRDCTALMESYHLRPEVATARFRMLPKLEGFPVDAVA
                     KSPRPNDSPLYNNIRNRVREELFPEEGKNKHRMGGDHATITILSFAAFAYGVYATIPG
                     FLSGCLLGLAGAWIGLTIQHCANHGAMSPSPAVNGVLGLTNDLIGGSSLMWRYHHQVS
                     HHIHCNDNAMDQDVYTAMPLLRFDARRPKAWYHRFQHWYMFLAFPLLQVAFQVGDIVG
                     LFTRDTEGAKLHGATTWELATVVIGKFVHFGLLAAPLMSHAASAVVAGIVGFMACQGV
                     VLACTFAVSHNVPEAKLPEDTGGEAWERDWGVQQLVTSADWGGKIGNFFTGGLNLQVE
                     HHLFPAICFVHYPAIAKIVAEEAAKMGIPYSSYRTLPGIFVAFWKFVRDMGTAEQIDD
                     VLLPKFANPQLSPAIN"
     gene            <255536..>256507
                     /locus_tag="OSTLU_27130"
                     /db_xref="GeneID:5004955"
     mRNA            join(<255536..255673,255866..>256507)
                     /locus_tag="OSTLU_27130"
                     /product="predicted protein"
                     /transcript_id="XM_001420911.1"
                     /db_xref="GeneID:5004955"
     CDS             join(255536..255673,255866..256507)
                     /locus_tag="OSTLU_27130"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420948.1"
                     /db_xref="GeneID:5004955"
                     /db_xref="JGIDB:Ost9901_3_27130"
                     /translation="MALDRALATRARASGASTSTSTRDASGRRPGPGARGRPAKGRGR
                     GKTTTNAVFDALKFDPDRVSVAFDASSTRVEPESLLQRRYTLTHNDVTRNLTLTVGDA
                     FNDDQTSIWYTRLLRDEVLAEWREDGLHVFCQVSAKEAWWIRWAAPLRSVVFRQKLPL
                     VLDTLRYAERELLATYPELFDSPVYVNFGSADGPGDKEYWGDFRTAGSEETRSSRVTC
                     ADGAGLDPRIADNVRNTIITGRGSRVEVGGVILENSPAPPR"
     gene            <256938..>258215
                     /locus_tag="OSTLU_13191"
                     /db_xref="GeneID:5005155"
     mRNA            <256938..>258215
                     /locus_tag="OSTLU_13191"
                     /product="predicted protein"
                     /transcript_id="XM_001420912.1"
                     /db_xref="GeneID:5005155"
     CDS             256938..258215
                     /locus_tag="OSTLU_13191"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420949.1"
                     /db_xref="GeneID:5005155"
                     /db_xref="InterPro:IPR004101"
                     /db_xref="JGIDB:Ost9901_3_13191"
                     /translation="MHRLLRDFDDPHRAYNTIHVSGTKGKGTTVSVLASVLRAAGLRI
                     GTYKSPHVYTVAERIRSSESDASAQVLDVLRDLEREIKSAQQREGGQLSYFEVLTALA
                     FAYFKKANVDLALVEVGLGGSRDATNVLAAENLEAAVITHIGEEHLEALGGSIETIVD
                     AKAGIAHKGRPVFCAPNVDERITTMLKTALRARGANVIDNVCVDTRLVRYHVEDSIAS
                     QDVDIDIKVDGKIASTLSNVRIPLAGPHQRENISLALRVLWWLRAQNKIDASLEDIRR
                     GLETTRSPGNFEVFETSGGPTMIADGAHTKGSARVLVNTIREVYPDRKLLFVVAMADD
                     KDHGGFIEELYRADPVGVVCTQMQVAGASSRTTPAKTLAKAYIGPAHGPTPTSEDDFE
                     KALKGALSRGDDEIVVVVTGSLYTFKALSKALL"
     gene            complement(258262..>259970)
                     /locus_tag="OSTLU_51201"
                     /db_xref="GeneID:5005156"
     mRNA            complement(join(258262..259164,259345..>259970))
                     /locus_tag="OSTLU_51201"
                     /product="predicted protein"
                     /transcript_id="XM_001421062.1"
                     /db_xref="GeneID:5005156"
     CDS             complement(join(258279..259164,259345..259970))
                     /locus_tag="OSTLU_51201"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421099.1"
                     /db_xref="GeneID:5005156"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="JGIDB:Ost9901_3_51201"
                     /translation="MRARATPGAIKHARSARAVATRATYGRPERIARVKGNDGGASRV
                     GEALELRGWARSVRTQKGMAFIDLNDGSAISGMQAVVNEGSAAWDALDAGGVSTGAAL
                     RVKGKLVASPGGKQAAELAVEEIDVIGTADPETYPLQKKRHTLEYLRSIAHLRPRTNT
                     IGAVARVRNQLAYATHTFFQEHGFLYANTPIITASDCEGAGEQFQVTTLVEALKNNRP
                     SSDLPKNKDGSIDYSQDFFGKPSYLTVSGQLNGEIMACAVNDIYTFGPTFRAENSNTS
                     RHLAEFWMVEPELAFADLNDDMDCAEAYLKYCLNHVLEHCDEDLEFFEKNISKDNLRE
                     RLRNVASQEFARITYTEAVEHVLNAKKKFEFPIEWGSDLQSEHERYISEEVFKDRPVI
                     VRDYPKDIKAFYMRLNDDNKTVAAMDVLVPRVGELMGGSQREERLDVLERRIEEVGLE
                     KESYWWYLDLRRYGSQPHAGFGLGFERLVQYVTGVENIRDAIPFPRYPGSAEF"
     gene            <260718..>261380
                     /locus_tag="OSTLU_4459"
                     /db_xref="GeneID:5004956"
     mRNA            <260718..>261380
                     /locus_tag="OSTLU_4459"
                     /product="predicted protein"
                     /transcript_id="XM_001420913.1"
                     /db_xref="GeneID:5004956"
     CDS             <260718..>261380
                     /locus_tag="OSTLU_4459"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420950.1"
                     /db_xref="GeneID:5004956"
                     /db_xref="InterPro:IPR007261"
                     /db_xref="JGIDB:Ost9901_3_4459"
                     /translation="GVGGAVNRQLERAEATNKTMDEAFTDLRALMAKAGEMVTLAERL
                     AESMDGKGESSELQRLVLSLGITSPVTRANAGAEFHRELGKQLADWITPVVQKSNGII
                     TVTDAFCLFNRARGTELVSPQDMLRASESWESLGVDLHLRKFESGVMVIHTVERTDEE
                     ACARLLARLPSYEHSIDSYEAAQILATTPEIALEYLYMAESRGVLCRDDGPAQMRFYA
                     NMF"
     gene            complement(<261470..>261898)
                     /locus_tag="OSTLU_13193"
                     /db_xref="GeneID:5005157"
     mRNA            complement(<261470..>261898)
                     /locus_tag="OSTLU_13193"
                     /product="predicted protein"
                     /transcript_id="XM_001421063.1"
                     /db_xref="GeneID:5005157"
     CDS             complement(261470..261898)
                     /locus_tag="OSTLU_13193"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421100.1"
                     /db_xref="GeneID:5005157"
                     /db_xref="InterPro:IPR001253"
                     /db_xref="JGIDB:Ost9901_3_13193"
                     /translation="MPKSNSKGKGGKNRRRGKGGGEDEKRELIFKEDGQEYAQVLRML
                     GNGRLEAQCIDGVKRLCHIRGKMRKKVWVNTGDIILLGLRDFQDEKADVILKYLADEA
                     RSLKAYGELPDTFRVNDTDTFEEERDENDDFFDFDDINDI"
     gene            complement(<262338..>265304)
                     /locus_tag="OSTLU_17845"
                     /db_xref="GeneID:5004957"
     mRNA            complement(<262338..>265304)
                     /locus_tag="OSTLU_17845"
                     /product="predicted protein"
                     /transcript_id="XM_001421064.1"
                     /db_xref="GeneID:5004957"
     CDS             complement(262338..265304)
                     /locus_tag="OSTLU_17845"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421101.1"
                     /db_xref="GeneID:5004957"
                     /db_xref="JGIDB:Ost9901_3_17845"
                     /translation="MGNGEGALGAIWTTATAALGTLLTRGSWRTSATVGTSCALLAVN
                     GVNLFLFCSWCTLQFRWIHESHAGAAATCERLIFALCPPTTTTILTWAFASASAGAER
                     AAFYGSVVSLITHRMFLFPCASACAAVTKTNGPPSDKRSALTESDAEYATVATLGLPV
                     ALYLWTNLDTLFKSLDHVFACGALVTVPVLYLIAAGTEKSLWWRARGVDVASKRMETA
                     VLLFALTGFAVSVEGGIIFSEFAEYIEIMAPLNYIMVTVSVHSALAVFAACYANAVGD
                     GVPTGAVKATLALSTSTAICALGAPLWMIPIPIAGSSSFVKYYYEDREPKDYGVFAAS
                     CVGCFSWFLSKNFWSLDVRVGAFDVKQLCVAILLLAVAALALPAVLNTKSARAPTVGV
                     LVVCYVSALATIEQILSQATHDDDSLIYPPYLVIVTSISGFLASRGLVISGRISREFG
                     WVMQSVCGAKLSMLFVRGLKEMFSVLVVVLAITAPHAMSRRMTQLSPGASVGYCVALV
                     FSLVFARFAMFDVIFELSGHRPTDATLFGGLLLITGASLASVVTRQSYGDDMFSKRLM
                     MLLSFCGVFLITFRPPMPWKGEVGMWYDAEHVPDSEEDEARMYGVRENAHHGWPSWLL
                     MLAALTAIFAVSSPRQQTKSTSTIRIALSAVCGGSVGLYMALEFFVQQVALTALLFVA
                     CALVGVFLSFTYSPSPKSSRWLPYVYLSFVSVLGLAYVTQMGGSDETVDDHQARMEGK
                     FGVVGVFAGTSLQIAFALKLRIKTSLESVQHRRRQGGTSPFLPATGRSRPEYFRGVAS
                     RNEHRELKAKAIAWMPIIGNIATLTSFLACVVLSDELADGSAFSVFVLAPILLLLHQD
                     SVIFPILEDSQRYAPPLAMIVGKMCWDAVAAILAGPNRVHVLAATASKLPWMTLNALS
                     LLLASVNSINLVHYLATSVRTDGMTLILTAPLAVVAPFLSKIPSVRALAFTSLIAVVT
                     QHTLQRRAKIVGLKYL"
     gene            <265817..>266221
                     /locus_tag="OSTLU_27136"
                     /db_xref="GeneID:5004958"
     mRNA            <265817..>266221
                     /locus_tag="OSTLU_27136"
                     /product="predicted protein"
                     /transcript_id="XM_001420914.1"
                     /db_xref="GeneID:5004958"
     CDS             265817..266221
                     /locus_tag="OSTLU_27136"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420951.1"
                     /db_xref="GeneID:5004958"
                     /db_xref="JGIDB:Ost9901_3_27136"
                     /translation="MTRSRALVATRVTTRRGTATTRRARATRPKIESLGGFGPNIDAK
                     EIQRRMAEKQRKIDENKRKARGAKEASTAFGARREFQRTISSARPSRAGRTMPGGGVA
                     AGTTSSKTKTTSGKGGKGGKEEAPKKKLFGLF"
     gene            <266707..>267378
                     /locus_tag="OSTLU_93609"
                     /db_xref="GeneID:5005158"
     mRNA            <266707..>267378
                     /locus_tag="OSTLU_93609"
                     /product="predicted protein"
                     /transcript_id="XM_001420915.1"
                     /db_xref="GeneID:5005158"
     CDS             <266707..267378
                     /locus_tag="OSTLU_93609"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420952.1"
                     /db_xref="GeneID:5005158"
                     /db_xref="InterPro:IPR007705"
                     /db_xref="JGIDB:Ost9901_3_93609"
                     /translation="VSSGHLKKLTNKMAESKKLIKEFERRALSEGAMDANALAAAKKE
                     YVSRLNKFVQMKKEAQIAIAEKQEERKSEVGSQGGEASTSGGVTTSTTATSTAFTLPA
                     FRPKPKGEIVEDEQLQLMEAGDLIDHGRNVMDQTDKSIMRSEAVVEETIQIGTQTAEA
                     LRGQTKQLEKIVDDLDEIHFSLKKSFGVLKDITRGLATDKCIMLLLFLVVVGVVVVII
                     TRFVK"
     gene            complement(267456..269594)
                     /locus_tag="OSTLU_27138"
                     /db_xref="GeneID:5005159"
     mRNA            complement(267456..269594)
                     /locus_tag="OSTLU_27138"
                     /product="predicted protein"
                     /transcript_id="XM_001421065.1"
                     /db_xref="GeneID:5005159"
     CDS             complement(267609..269252)
                     /locus_tag="OSTLU_27138"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421102.1"
                     /db_xref="GeneID:5005159"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Ost9901_3_27138"
                     /translation="MDEDGAGGFARRSRNIFADAQRRQWCRERQIGERRGGAASAKTG
                     ATALRCSNKRFVEELRLRETLEKHGGCVNCVSWNDDASLLISGSDDMTVCVWGCGAKM
                     PLKGSAFTGHTHNVFASEFVPQSNSAYCVTTSADGDVRLVDLERGFRGPAPAHYGYRL
                     RGANQPNSECSRSLWHGRGAGMGFGMTFVPNEPNTFLSCHQDGRVRLFDLRQSHGGFE
                     GNSHEIVVDLSACGPTSEIVFDPTAPTTFAACSDDPHVRVFDLRHVKSNRREAARECP
                     AAPSPSTSPTGQPMFLRSPRPSMNHDIPCVMMLSPLELGRGVRSPGFEGISGLAYSSK
                     GELAINCKGDDVYLLDTRRAAANINSEERIFKSFSVPWEMPITHQAAKRYVGRRNVKT
                     FLKGVAFMCDDEYVTTGGDDGNVYVWHKDTCELVCKMQADSQVVNTVLPHPHLPTIVC
                     CGIDNHVRVFEAGDGGVHLGTPPMRDEHDAWGFDEEDDEEEEDTDEDDEDEASTDSDD
                     DHRGENLARWSRALVDAADAPEEDDDDDADFEPDSMREN"
     gene            <269923..>272199
                     /locus_tag="OSTLU_41529"
                     /db_xref="GeneID:5004959"
     mRNA            join(<269923..271091,271638..>272199)
                     /locus_tag="OSTLU_41529"
                     /product="predicted protein"
                     /transcript_id="XM_001420916.1"
                     /db_xref="GeneID:5004959"
     CDS             join(269923..271091,271638..272199)
                     /locus_tag="OSTLU_41529"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420953.1"
                     /db_xref="GeneID:5004959"
                     /db_xref="InterPro:IPR000812"
                     /db_xref="JGIDB:Ost9901_3_41529"
                     /translation="MVHRWCETCGKRVAAETNEANGFTCCTTCGKILDERAAFSADAT
                     FVKNAQGASVPDGHYVPESGVAHGVIRATRGGRLYGVQLDSHERTLYRGKLEIKQLAD
                     RLGIRPREDVVDAAHRLYKLAVQRNFTRGRRISQVAGACMYIICRQESRPYMLIDFAD
                     ILQTNVYVLGGVFLQLCRLLRLEQHPLMQKPIDPSLFIHRFADKLNLGRRMHTVANTA
                     LRLVASMKRDWMQTGRRPNGICGAALWVAAQIHGFSPSKRDVVAVVHVGESTLKKRLS
                     EFENTPSAALSIEEFDTQARTFEAEEEANKNTKSLASSPMSVLSCVHKDNENIPHFAH
                     GMCRACYVDYVRISGGSVGGADPPAFMRAEAKRKIDAKQKLLLPALSSGELGDEDADG
                     LVAKEDNEVIDTLSDVDDDEIDSYIHNENEVNLRRLVWSEMNKEYLEFQALKEQAASR
                     TSAPTKKKHRKAPDTLPAETPAEAARQVLAKKKGSSKINYEALENLFKVSDGSQPPPN
                     SKATSDVENDASPTKSPRTRRARPAGLPSSAPMSTKSTAKRRGSSVSTHAPSSARPSG
                     LAKKPSAKKK"
     gene            <272477..>272899
                     /locus_tag="OSTLU_93610"
                     /db_xref="GeneID:5005160"
     mRNA            <272477..>272899
                     /locus_tag="OSTLU_93610"
                     /product="predicted protein"
                     /transcript_id="XM_001420917.1"
                     /db_xref="GeneID:5005160"
     CDS             272477..272899
                     /locus_tag="OSTLU_93610"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420954.1"
                     /db_xref="GeneID:5005160"
                     /db_xref="JGIDB:Ost9901_3_93610"
                     /translation="MSSAKVQFMITNAMRAILVDDLDYLDAEVDVMRPEIAAQLIETR
                     TKRPFGDRPMPEAWKRGGNMPQRRGGGALSNNLVKLFLAGVCCLGAAVMSGRVSVGTL
                     LGGAPLGRKPLKKLSSEMKSTKKRKSSSKKRRKKTAAA"
     gene            complement(<273223..>276780)
                     /locus_tag="OSTLU_516"
                     /db_xref="GeneID:5005161"
     mRNA            complement(join(<273223..273498,273568..274115,
                     274323..>276780))
                     /locus_tag="OSTLU_516"
                     /product="P-ATPase family transporter: cation"
                     /transcript_id="XM_001421066.1"
                     /db_xref="GeneID:5005161"
     CDS             complement(join(<273223..273498,273568..274115,
                     274323..>276780))
                     /locus_tag="OSTLU_516"
                     /codon_start=1
                     /product="P-ATPase family transporter: cation"
                     /protein_id="XP_001421103.1"
                     /db_xref="GeneID:5005161"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="JGIDB:Ost9901_3_516"
                     /translation="VLAFASIATAHALLLFAQHWSVRIRCFVQYKPINRVTEGSYFII
                     TPHAHQGKPEIVPVSRLRVFDADGSLRTMLWCVFQRQRYEYVEIEWDEARGKGQGELR
                     EIETPKDLPLSHYVKSRGLSGEEVHHSHERYGDNALQVNIPTFWNLYKEQLTGPVTVF
                     QIFTVLLWLMDEYWKYALFSALSLLIFEGTTAFSRQRNIATLRGMGQKAGRILVRRGG
                     VWEDHSTEELYPGDIISIKRNGGEEVPVPCDCVLLAGSAVVNEASLTGESVPQMKEHI
                     NPEVSKDERLDMNGLHKVHILYSGTTLMQHTSKTESESSALQVTTPDGGCLCYVLQTG
                     FASTQGKLMRMMEFSSEQVTGDTKETLVLLFILLIFALAASYNVYVKGIADGKRSQYE
                     LILRCIMIVTSVVPPDLPMQTAMAVNTALIALVKASVYCTEPFRVPVAGKVDCCLFDK
                     TGTITSDRLVAEGVLSDLTKGAPLKQPVEADKNVSIVIGGCHALLEIDGKTFGDPLEK
                     AALLGIKWKYDPATHLGTPKLDDKITRSWTGAENTSVKILVRNHFASALQRMSVIADV
                     SSNSTVSRWSLVKGSPEMIKSLLKNVPQGYDAAYRGLAEQGMRVIALAHKELSAEESA
                     RVGSQSTPLTRDEAESDLVFDGFFAFACKVRADSAEIIHALQASSNNVMMATGDATLT
                     ALHVGNEVGIARGGLDGALILARDQLDKLEWQSARVDEHMKPMKVFPYEETSIRELAK
                     EYSLCVTGKSLNVALTASGTLWDNLDQISIYARMSPDDKERVLKRLKTQGKHTLMCGD
                     GANDVGALKQAHVGVALLSGFEAGEKWAQLNAMKVATQRLVQEAKRRQAARSKVAGTG
                     QSLQQVFAELEETDGEVPKVKLGDASMAAPFTSRAPSIKATADIIRQGRCTLVSAIQM
                     QQVLMLSCLISAYSLSVLYLDGVRNSESQMMAAGTALTVAGLAFSYATPVHTLSEVRP
                     LRSIFHPANFLSLFGQLVIHLAAMVYAVHLVKKAANETQRSFWEQGPPFEPCLLNTVV
                     FLVDTVQRVCVMLVNYKGRPFMLGAMENKSLMGSMASMVIGAFVCAFEVIPWLNKKLQ
                     LVSMPD"
     gene            <277493..>278926
                     /locus_tag="OSTLU_41733"
                     /db_xref="GeneID:5004960"
     mRNA            <277493..>278926
                     /locus_tag="OSTLU_41733"
                     /product="predicted protein"
                     /transcript_id="XM_001420918.1"
                     /db_xref="GeneID:5004960"
     CDS             277493..278926
                     /locus_tag="OSTLU_41733"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420955.1"
                     /db_xref="GeneID:5004960"
                     /db_xref="InterPro:IPR005101"
                     /db_xref="InterPro:IPR006050"
                     /db_xref="JGIDB:Ost9901_3_41733"
                     /translation="MNDAAKAALDASARARASASASASAGPVVYWCDRDRRCANNDAL
                     GRAMELANERRVPLVVAMHVGTDLSGSGIGGARRAVFALKGLKELDEDLRARGVSTRT
                     TTGSDVAGGIVETCETLNASAVVCDFSPLREGRAAREAVARVVEVPVIEVDAHNVVPA
                     WVTSDKQEYAARTIRPKIHRNLGDFLTAPQALDDLIAAPDALTPSETDWDALIDTARV
                     KGAHVPEVDWIKPGERAALAALLDPNVDSFLPQRLTLYGERNKPTSPRAVSRLSPYLN
                     HGQLSPRRAAWEAAQLRGIVDDEAIDSYLEELIVRRELSDNYCLFNPYYDSLQGASQW
                     AQDSLSLHARDVREYVYDYKTLERGNTHDELWNAAQKELYHLGRMHGFMRMYWAKKIL
                     EWTPSPEVALQTAIQLNDAYALDGLDPNGYVGCMWSIAGVHDQGWKERAVFGKVRYMN
                     YAGCKRKFQIQDYVAAVDAEISGIGRK"
     gene            complement(<279012..>280691)
                     /locus_tag="OSTLU_27143"
                     /db_xref="GeneID:5005162"
     mRNA            complement(join(<279012..280405,280670..>280691))
                     /locus_tag="OSTLU_27143"
                     /product="predicted protein"
                     /transcript_id="XM_001421067.1"
                     /db_xref="GeneID:5005162"
     CDS             complement(join(279012..280405,280670..280691))
                     /locus_tag="OSTLU_27143"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421104.1"
                     /db_xref="GeneID:5005162"
                     /db_xref="InterPro:IPR001732"
                     /db_xref="JGIDB:Ost9901_3_27143"
                     /translation="MTRPITTICCIGAGYVGGPTMAMIAKKCPQISVTVVDISQPRID
                     AWNSSELPIYEPGLDEIVFECRGKNLFFSTDVEGAIRDCEMIFVSVNTPTKKTGLGKG
                     KAADLTYWELAARTIAACSESDKIIVEKSTVPVRTAEAIEKVLQRNCPHDGVRFDILS
                     NPEFLAEGTAIVDLDAPDRVLIGGKIENAKGQAAVDALVGVYSNWVPKENILTANLWS
                     AELSKLAANAFLAQRISSINAMSALCEATGADVQQVSHAIGTDTRIGSKFLNASVGFG
                     GSCFQKDILNLAYICECHGLPEVAEYWHSVVGMNDYQKSRFVKRMISAMFNTISGKKI
                     SMLGYAFKKDTGDTRESPAIDVGHGLIEDGAKLNIYDPKVAAAQIALDMGEEAMKSIT
                     CCKTHTESLTGAHAVCIMTEWDEFKTYDWEAIYGVMQKPAFVFDGRLILDHQKLKDIG
                     FIVYALGKPLDPFLCSAEGAP"
     gene            <281039..>282190
                     /locus_tag="OSTLU_17852"
                     /db_xref="GeneID:5004961"
     mRNA            <281039..>282190
                     /locus_tag="OSTLU_17852"
                     /product="predicted protein"
                     /transcript_id="XM_001420919.1"
                     /db_xref="GeneID:5004961"
     CDS             281039..282190
                     /locus_tag="OSTLU_17852"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420956.1"
                     /db_xref="GeneID:5004961"
                     /db_xref="InterPro:IPR010918"
                     /db_xref="JGIDB:Ost9901_3_17852"
                     /translation="MRGVSASKEDVHAAIKKVDKGLFPKAFCKIVEDIAGDEAYCTCM
                     HADGAGTKTSLAYAYWRETGDLGVWRGIAQDSIVMNTDDLLCVGCVDNIFVSSTIGRN
                     KALIPGEVLSALINGTEEVLETLRECGVGVKSTGGETADLGDLVRTVVVDTTVTARMR
                     RDAVVSNDNIRAGDVVVGLASFGQATYESEYNGGMGSNGLTSARHDVFAKNLAEKYPE
                     TFDPNVPESLVYSGKYQLTDVEPETGVTVGKLVLSPTRTYAPVVKAVLDAMDVRDIHG
                     MVHCSGGAQSKVGHFLLDGLRVVKDNMFPIPPLFRLIQECSNTEWSEMYKVFNCGHRL
                     EFYCSPEHAQKIIDISQSFNIDARVVGRVEAKDGKSEVVVKSEYGEFTY"
     gene            complement(<282333..>282737)
                     /locus_tag="OSTLU_9315"
                     /db_xref="GeneID:5005163"
     mRNA            complement(<282333..>282737)
                     /locus_tag="OSTLU_9315"
                     /product="predicted protein"
                     /transcript_id="XM_001421068.1"
                     /db_xref="GeneID:5005163"
     CDS             complement(<282333..>282737)
                     /locus_tag="OSTLU_9315"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421105.1"
                     /db_xref="GeneID:5005163"
                     /db_xref="JGIDB:Ost9901_3_9315"
                     /translation="LSNEVLLSIVRSELADEEVNRLVWNALGYRSRVELDAETLTANE
                     VWTPDEVFPNWAKSYPEPPDVIGVTRKYDPKIDAPVKVACAALTRSVPEEHKQGIKTT
                     LTPLGWKGFKMEGLTPNMTRRAQVANWLLFYRR"
     gene            <283063..>285150
                     /locus_tag="OSTLU_88968"
                     /db_xref="GeneID:5004962"
     mRNA            <283063..>285150
                     /locus_tag="OSTLU_88968"
                     /product="predicted protein"
                     /transcript_id="XM_001420920.1"
                     /db_xref="GeneID:5004962"
     CDS             283063..285150
                     /locus_tag="OSTLU_88968"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420957.1"
                     /db_xref="GeneID:5004962"
                     /db_xref="InterPro:IPR006876"
                     /db_xref="JGIDB:Ost9901_3_88968"
                     /translation="MEWTTRDVAADPRATRARWTRSAAETSSGSGADDGFFASWSTPV
                     FVVAACVAALAVARFADRRVGAAVRAHCFVAWTLALIMVGIVPTDVTATLRAGEAPRG
                     LDATWDVAYWSTYALTWIVLPLHQCYVDAADFSSVGRLKRAARENAMFLGIAATAMFV
                     GAAALLATESLSLDAMRAYGIVVANVWGISTGVLLMGFGLVDVPRAIWRRAAFNNRLT
                     RSYKRVAGVSRALGNAHARLARQVVAVTTTSRVMPRRHSLRWAMSVIENETPEFSEMH
                     RGSLDEALDATEEDVLDYDYDELNDLVALRRAVRRSLRQYDRTKAQYVIAVKDAFEAE
                     AAEQSRASSTRRLHRPPNSVSRSGSLGKCMDDVQYTWSIVIVPVLLRVIATGLAFFSV
                     SIIIAESSIWIGKLWEEADQISLLSVMLENAEDSTSGLTSMHVVVAFPLAYMCLCTFH
                     SLHKLGMFSFYTLVPRHTDAFSLLVNASLVCRYSAPLSFNFLMLLPIIRASGKMTTFS
                     RKMANNVPELAGELNIIVPTFLGLYCVAIALGWFDRIARVLNVEGFKFDSDKDVNEST
                     ETGKSIVDRERAEVMDGAEIGSSHESFVSETAPREQRLPPIASNSNEWNDVEHDARGG
                     LLSTYPDPESASARWETQKARLAQATQASAARAVPRGSPLSRTGRDKVSELDFMFSNL
                     GRRSSGGESFSDE"
     gene            complement(<285209..>285616)
                     /locus_tag="OSTLU_27147"
                     /db_xref="GeneID:5005164"
     mRNA            complement(<285209..>285616)
                     /locus_tag="OSTLU_27147"
                     /product="predicted protein"
                     /transcript_id="XM_001421069.1"
                     /db_xref="GeneID:5005164"
     CDS             complement(285209..285616)
                     /locus_tag="OSTLU_27147"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421106.1"
                     /db_xref="GeneID:5005164"
                     /db_xref="InterPro:IPR002539"
                     /db_xref="InterPro:IPR006683"
                     /db_xref="JGIDB:Ost9901_3_27147"
                     /translation="MSATSSTRADALRERRTFTADDCAAFARLTGDENPIHFDDGAVG
                     DGENRLRGRAVHGMLAASAFGALLARARPGTVYASQELKFREPVRVDEELEIELKLVK
                     RSGTRARYETVVRKVKCGTVCVDGHALALLPEE"
     gene            <286141..>286737
                     /locus_tag="OSTLU_10386"
                     /db_xref="GeneID:5004963"
     mRNA            <286141..>286737
                     /locus_tag="OSTLU_10386"
                     /product="predicted protein"
                     /transcript_id="XM_001420921.2"
                     /db_xref="GeneID:5004963"
     CDS             <286141..286737
                     /locus_tag="OSTLU_10386"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420958.1"
                     /db_xref="GeneID:5004963"
                     /db_xref="JGIDB:Ost9901_3_10386"
                     /translation="VLVLTQRDYERVLPIAATGEQYGYFWGDNDTAFQRVGLSLLTTV
                     LTANAAPALAVPASTFFLWAPVALAARRNSKVRSAKYAGLWRARVISVEPVETRGTSS
                     VDWMFNLVVGDRSGARVPLKVPLKAEYADINVGDDVELIVTSDDPYFYTFQAVREAYF
                     PFLNVWVGEYPFLDRRGMVSVSDRLAGEEEARRARARG"
     gene            complement(<286779..>287286)
                     /locus_tag="OSTLU_27150"
                     /db_xref="GeneID:5005165"
     mRNA            complement(join(<286779..286865,286975..>287286))
                     /locus_tag="OSTLU_27150"
                     /product="predicted protein"
                     /transcript_id="XM_001421070.1"
                     /db_xref="GeneID:5005165"
     CDS             complement(join(286779..286865,286975..287286))
                     /locus_tag="OSTLU_27150"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421107.1"
                     /db_xref="GeneID:5005165"
                     /db_xref="JGIDB:Ost9901_3_27150"
                     /translation="MTTTRRLESPRVGKTTRTRATPADDEGDVPFGYTRADVMLIGTG
                     VTGAGFAAYYGLQSFAGMDSTKAGNAVQLTFVLGLTLAWVGSYVMRVFNKDMTYAKQL
                     KDYENAVMQKRLEEMPASELEKMMDELDEK"
     gene            <288030..>288989
                     /locus_tag="OSTLU_27151"
                     /db_xref="GeneID:5004964"
     mRNA            <288030..>288989
                     /locus_tag="OSTLU_27151"
                     /product="ENT family transporter: nucleoside"
                     /transcript_id="XM_001420922.1"
                     /db_xref="GeneID:5004964"
     CDS             288030..288989
                     /locus_tag="OSTLU_27151"
                     /codon_start=1
                     /product="ENT family transporter: nucleoside"
                     /protein_id="XP_001420959.1"
                     /db_xref="GeneID:5004964"
                     /db_xref="InterPro:IPR002259"
                     /db_xref="JGIDB:Ost9901_3_27151"
                     /translation="MDVVFAQTLGVIVVVGLATAVAQSGGFALASRLPPEFAQGAMSG
                     QAVSGVVVSLVALATTAYGGGSVSSSSSAKGAQAYFYVAAAVVLGCAATAARLDKTPA
                     FEELTGVERHRDGRRSEMNALLRDDDVDEYDSDVEGAPLRASTGVEDFGDESRDYRLA
                     VALTFIASLCAFPAITSSIESSHGAMGAFWSPVLFLLFNLGDFLGRHLAGMYPKTPPR
                     GASLRRAATLRFAFIPFLAACNVTTPNWRVPTVFASDFFPFLFISALAVTNGWLASVA
                     MMHGASRAPLSKRQAEGVVLSFALVAGIFLGTALSLFIVFILS"
     gene            <289236..>291338
                     /locus_tag="OSTLU_27152"
                     /db_xref="GeneID:5005166"
     mRNA            <289236..>291338
                     /locus_tag="OSTLU_27152"
                     /product="predicted protein"
                     /transcript_id="XM_001420923.1"
                     /db_xref="GeneID:5005166"
     CDS             289236..291338
                     /locus_tag="OSTLU_27152"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420960.1"
                     /db_xref="GeneID:5005166"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="JGIDB:Ost9901_3_27152"
                     /translation="MDARGERGNAHDGYHDIQKTNKAFETYYKAQNIVPESEWETFLD
                     CMRSPLPMTFRINGSGKFATDMRDQLEGTLFAELLKEELKDEEQNELPPPKPLAWYPE
                     RLAWQCSYTRAQLRRLPALQGIFDFIKNANELGSISRQEAVSMIPPFFLDAQPHHRIL
                     DMCASPGSKTFQILERMHGDFDGNTKLPTGIVVANDVDLKRCNLLTHQTKRANSPTLL
                     VTNHEAQNYPIIKGPKGELFDFDAILCDVPCSGDATMRKAPDIWNRWTPGNGNGLHTL
                     QLRIAARGAQLLKVGGRLVYSTCSLNPIENEAVVAALLKECDGALELLDVSDELPDLK
                     RSPGLRDWQVWDKFGYHPSFRGEEQMFKLCETMFSDEETKKLPLERCLRLLPHHQDTG
                     GFFVAVFQKVKPMEIKEDVNAKKQTVKERVRLSLNVNAKNEIEMSHEVITLARKGQTA
                     SIPPEVDDKGEYLLPHRGATGPNGGSRWLGIDPVLPVNDPKVINSIYSVYGIESDDIA
                     LHKNCVTRTADTSRPKRVYTITDSLRQYLACDVNESLRVTSCGLKAFERQEIKDEVKE
                     QEETSGAMCDFRLTQDGIPMMFPFVRKRIIRPTFDDFKAILERRTLAFEYSAEAPQRA
                     VISCAETKKALLDLTLGCCILVPRDEDLAAINVSKADLAIACWRGRTSCNLLVSKAET
                     IHFIDKIKVNAAVKMDTS"
     gene            291454..>292572
                     /locus_tag="OSTLU_25406"
                     /db_xref="GeneID:5005167"
     mRNA            join(291454..292432,292466..292535,292555..>292572)
                     /locus_tag="OSTLU_25406"
                     /product="predicted protein"
                     /transcript_id="XM_001420924.1"
                     /db_xref="GeneID:5005167"
     CDS             join(291502..292432,292466..292535,292555..>292570)
                     /locus_tag="OSTLU_25406"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420961.1"
                     /db_xref="GeneID:5005167"
                     /db_xref="JGIDB:Ost9901_3_25406"
                     /translation="MRVSTRARVDERARAGVDEREGVDELKGRRNDSRARVSQDVDQG
                     GQVSHARGVGNVIYRARGGNDGPVGAGRRDGADERWRRDSGAGPRVDRRRAHAGDGVR
                     VEWTTTFKEPRLAENRAQRAIDRVSVRVDVGVRSLRGRRRSRAQSPRIGHPLVGVVAI
                     RVANDDVGIHRPVHEGRQARRARGVARHARFRSSNFPGAARPRRRLRRRARSRETRSP
                     HDMGSRHVWFDLAPELVHVRRLTSRARRRLVGRRLRPRLFDASQRVLVRLIRPRPRRR
                     ASVRVDRRLSRLRPRLRRRRRPRLERVSPPSRPGPPSARRYFQRDASLREIPFAYPST
                     YHTSA"
     gene            <292854..>294590
                     /locus_tag="OSTLU_41670"
                     /db_xref="GeneID:5005168"
     mRNA            <292854..>294590
                     /locus_tag="OSTLU_41670"
                     /product="predicted protein"
                     /transcript_id="XM_001420925.1"
                     /db_xref="GeneID:5005168"
     CDS             292854..294590
                     /locus_tag="OSTLU_41670"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420962.1"
                     /db_xref="GeneID:5005168"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR010402"
                     /db_xref="JGIDB:Ost9901_3_41670"
                     /translation="MGATRLADALADAVEDASARNAGGGGGRAGRARAKTNGKSARPR
                     LNDAGAHLRVLLATDDAHTRKMVESMLRELGVEVVAATNGNEVLDVLRGAPKSAREDT
                     SVDMILLDVLMPELDGEVELVEACKANETLRGVPIVIMSTVDERKACKTRFENSGAAG
                     FLTKPVNRIELKESLAHTRALKSHESGSVEGEGSGSGNCMDPNDNVGGSAKSSLTKLT
                     SREKVAGGSGGGQNDSGSDNQYNEKPLTRRAEAEAIDRWASREGGSGDCGSGGSGQGT
                     GSGSGSHEGSGSGQRDPNDGEKFRGLSVQLIKAHGGATTMLELSLPEHASEHVVVRRS
                     NSRSAFKGFQNYLKNENKDTAVQMMSVDLTQQHHSFYEASSMMPPSDFAKFYGPIMPK
                     MEMPVPPPMPPYADMNQFSAAAAAAAAVAASSVDASVMDQSYMANPFFNVLQTAADHT
                     QQTSSSQAAEHRAAAIRRFLKKRKERNFEKKVLYPSRQKLSESRPRVRGQFTRNNDET
                     TTTTTTTENVSNGSDNKPKSNETNASEANKVGEVEGKGVDEYGHGSNEGSNEGSKEGS
                     RSSSGAEGEGSK"
     gene            complement(<294738..>295814)
                     /locus_tag="OSTLU_93613"
                     /db_xref="GeneID:5005169"
     mRNA            complement(<294738..>295814)
                     /locus_tag="OSTLU_93613"
                     /product="predicted protein"
                     /transcript_id="XM_001421071.1"
                     /db_xref="GeneID:5005169"
     CDS             complement(294738..295814)
                     /locus_tag="OSTLU_93613"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421108.1"
                     /db_xref="GeneID:5005169"
                     /db_xref="JGIDB:Ost9901_3_93613"
                     /translation="MARRAQWRSFAHAKCDVDDALATTFALAKSVEVAVPRGRRDDED
                     AIARALDDDANAIVGTHFEAEMSIADALDPHFVHEHVRRWTAAKTKTRDAGATFGLTT
                     IDAEVDSDDCFCVTPKGRFVASLMADAKESLGMQTTEDARGKALASVNLTREEFKVGN
                     WFHDRIGACARAFEQRTGKSKVLCAYMVSGAHEEVKFPRTVTAARRAESVKTSSQVRV
                     NLVSQSAVLLASASPPMRGEEKDIDVDDLDRILEFCGRISLGDAYMEGAEDDRGDIVE
                     TRRWRGLMLYPDTRRVIDIARRIVNDGLAPWAVVTVWAFAHMPSELTGEPRKKIERDS
                     CAPKMGAVFTIVLYPDDKYLKFVA"
     gene            <295915..>297397
                     /locus_tag="OSTLU_41633"
                     /db_xref="GeneID:5004965"
     mRNA            join(<295915..295959,296153..>297397)
                     /locus_tag="OSTLU_41633"
                     /product="predicted protein"
                     /transcript_id="XM_001420926.1"
                     /db_xref="GeneID:5004965"
     CDS             join(295915..295959,296153..297397)
                     /locus_tag="OSTLU_41633"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420963.1"
                     /db_xref="GeneID:5004965"
                     /db_xref="InterPro:IPR006090"
                     /db_xref="InterPro:IPR006091"
                     /db_xref="JGIDB:Ost9901_3_41633"
                     /translation="MTTREPFGEGVPFGDPSWYTTFNSPYYTMSHAKFRDKVRAFVER
                     DIAPYVHEWDETKTIPPEVYRATYAAGILPAVVGKPWPKDLVPECEEPEHFDYFHELI
                     VFDEFARCGSGGVLWGLLEGIHIGLPPVLNFGSEDLRRRVGAPCLRGEGIICLAITEP
                     YAGSDVANIRCEAKLDPSGKFYRVTGEKKWITNGIWADYFTVAVRTGGPGMGGISLLV
                     IERSMPGVDCRRMDCMGVWASGTTFITFEDVKVPVENLIGKENEGFKYIMHNFNHERW
                     GFVIQANRFARVCYEESFKYAHRRRTFGKKLIEHPVIRHKLAEMIRQVEATHYLLETI
                     TYQMNTMTKEESSKALAGITALAKVQSTKVFEFCAREAAQVFGGASYVRGGQGEKIER
                     LYRDVRAYAIPGGSEEIMLDLGVRQAMKQWQVAQSRL"
     gene            complement(<297445..>298341)
                     /locus_tag="OSTLU_41684"
                     /db_xref="GeneID:5005170"
     mRNA            complement(<297445..>298341)
                     /locus_tag="OSTLU_41684"
                     /product="predicted protein"
                     /transcript_id="XM_001421072.1"
                     /db_xref="GeneID:5005170"
     CDS             complement(297445..298341)
                     /locus_tag="OSTLU_41684"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421109.1"
                     /db_xref="GeneID:5005170"
                     /db_xref="JGIDB:Ost9901_3_41684"
                     /translation="MATELKKLRAHLLALEDEEDEVAEEQEREIDEAREEERREYERR
                     LSDLKKNMSGNDAEVTRLREVIKARDEEVENLQKALGAYYAEIESADAQRIESANLRQ
                     KLAALTSQATADRAACMEAKEKAKEAEERLTKFEAHLKIAKEECIKATSDASKLRKAL
                     HHALQKSSDMMVESEKLLDKRIVSDLFIAYLERERAEDVLDLLAKMLGFTDKQKARME
                     ALKRRQKKRGVLGTIARAPVSIAAGAIGVALEVTGATGENKPVPVADLWISFLEQNAA
                     NDEEVENKIPSSSELISAAREL"
     gene            complement(<298902..>299474)
                     /locus_tag="OSTLU_93614"
                     /db_xref="GeneID:5004966"
     mRNA            complement(<298902..>299474)
                     /locus_tag="OSTLU_93614"
                     /product="predicted protein"
                     /transcript_id="XM_001421073.1"
                     /db_xref="GeneID:5004966"
     CDS             complement(298902..299474)
                     /locus_tag="OSTLU_93614"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421110.1"
                     /db_xref="GeneID:5004966"
                     /db_xref="JGIDB:Ost9901_3_93614"
                     /translation="MLATRRRGTSADAEDDLRAKLSADKALVLVNDWERVVDAGEARA
                     REREKRFAEARRAMMSKTRLKREGLYGLRPEQCTWSAFSKLRGLWEKYARALVKDAKR
                     GEAEARLTRGLDLHGCVLKVVRHARAPDLVGREGVVAFISSRCLWLVARKREKPIKVL
                     IDGGTFEFVLDERVVRLSSEDVLASAPRPS"
     gene            <299866..>300933
                     /locus_tag="OSTLU_41900"
                     /db_xref="GeneID:5004967"
     mRNA            <299866..>300933
                     /locus_tag="OSTLU_41900"
                     /product="predicted protein"
                     /transcript_id="XM_001420927.1"
                     /db_xref="GeneID:5004967"
     CDS             299866..>300933
                     /locus_tag="OSTLU_41900"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420964.1"
                     /db_xref="GeneID:5004967"
                     /db_xref="InterPro:IPR002173"
                     /db_xref="JGIDB:Ost9901_3_41900"
                     /translation="MRRARRARRLALGAALTALARVALARADRASIAVVGSVNADVIA
                     RVGTSVPRRGETRAATAARVERACGGKGANQAVAASRLTCERGGKAAFVGRFGEDEAG
                     TTLRRALRRETDVSGSVTMARGSGIETGMGFVMLTDDGSPSAVVVGGANALGWNADDE
                     ALASEFREALRGAKTVMLQREVPERVNVIAATVAREIGVRTIVLDAGGSFHAADEALL
                     ALVDYVAPNESELAGMAGMRVEEVSSGDEAVVKAARIVAGTSRVAVLCTLGSRGSLLV
                     RGEDVTRVESMELPAGAKEVDATAAGDAFRAAFAVAMAENKNERDAMKFASAAGALAV
                     TKLGAMPSLPFRSDVDEFLGVS"
     gene            <302656..>303477
                     /locus_tag="OSTLU_6232"
                     /db_xref="GeneID:5005171"
     mRNA            <302656..>303477
                     /locus_tag="OSTLU_6232"
                     /product="predicted protein"
                     /transcript_id="XM_001420928.1"
                     /db_xref="GeneID:5005171"
     CDS             <302656..>303477
                     /locus_tag="OSTLU_6232"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420965.1"
                     /db_xref="GeneID:5005171"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="JGIDB:Ost9901_3_6232"
                     /translation="RFRLEDFQLVNVIGRGRYSVVYKAFYRRMNFEVALKCYIKAKLK
                     LHVYEQIAHEIAVHHSMEHSAIVGFFGSFIDTSTGNYYLIHELHNRGDVFNALARVGG
                     KFSESRAVTGVMKWVIKAVAHMHAMNVIHRDIKPENVVLTDDGRAKLTDFGFALHLEW
                     FKPLGRLGTTDYMAPEVVRCDKEFRERYLRLNRAGYGKAVDLWAIGALAFELVVGFPP
                     FQSTSRQQAYDMILQGSFKIPAFVSEHGADFIRKCLVLDPSARLKPEEMLEHPWIV"
     gene            complement(<304300..>304941)
                     /locus_tag="OSTLU_27160"
                     /db_xref="GeneID:5005172"
     mRNA            complement(<304300..>304941)
                     /locus_tag="OSTLU_27160"
                     /product="predicted protein"
                     /transcript_id="XM_001421074.1"
                     /db_xref="GeneID:5005172"
     CDS             complement(304300..304941)
                     /locus_tag="OSTLU_27160"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421111.1"
                     /db_xref="GeneID:5005172"
                     /db_xref="InterPro:IPR006145"
                     /db_xref="JGIDB:Ost9901_3_27160"
                     /translation="MVKPDDCVSVGKGSDPMKWSAERLCATALTPTPEGVEGALSRPR
                     PVHRLDELTGGLLVCAKTRMAMTALSAAFEKREVRKRYRAVLRGRVESKKGVVDVPLG
                     GLEALTEYSVVREYESEEYGGILTLIDFFPKTGRTHQLRRHAKALCAPILGDVKYDYA
                     SRAHEDGLFLWATGIVLPPSATPWRGEDCGELIVDIEEGEKFARVLARCQELA"
     gene            <305742..>307577
                     /locus_tag="OSTLU_27161"
                     /db_xref="GeneID:5004968"
     mRNA            <305742..>307577
                     /locus_tag="OSTLU_27161"
                     /product="predicted protein"
                     /transcript_id="XM_001420929.1"
                     /db_xref="GeneID:5004968"
     CDS             305742..307577
                     /locus_tag="OSTLU_27161"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420966.1"
                     /db_xref="GeneID:5004968"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="JGIDB:Ost9901_3_27161"
                     /translation="MLTVWSKRTRDKDYVRRVLISRRRRKDADASPSLTWLESVRAKK
                     ELETNEQDQIHFKDEFKTLFNTYSPKWTEDASFNRVHWLNRVIDAAWPNIDTGVSKTV
                     KESVEPILRDMLPESVTWIGFEKFTLGPRAPTLCGIRSHSSHMENSILDIELTWASSC
                     EIIVTLYAFGIRFPVSLRQLQLKCLVQVTFDPLVDIIPCLGAIEACLMGMPEILDFGL
                     FLPGGIDLMALPFMHGFVKRTVKSSIEKMLLYPYKLHIPIMEASGIEESSTGMMRIRF
                     LKGNAFYKRRNYSRLSRKKGKASSLMRNMLKSDNYFIKYWTREQRQLSTPPRLGDAPS
                     WDGVEDSFVLCDRETPLTFRLLKQGAERISNYGEASITCGEIADRGPGPIVLELPFID
                     PTYYKKECPLEYFAAADGYTHEQIMTRSNEITEWHKKSEEEADEARMKYFYRCIEEQN
                     KTKTPGGKKFMHPTMTVELEYIDTGAPDEFDEDYEQGLLTVELLEGRNLLRVKDLPPN
                     PMAHVSCAKQTYTSARKLKTSQPKFNERFVFYNVIPDVDPLRIEIRGFEVSLGFVEID
                     VSLVRQNVIMKDVFKLQGVAKGEIELLLQYAPMSTKNAVHRIPVL"
     gene            <307650..>308693
                     /locus_tag="OSTLU_93616"
                     /db_xref="GeneID:5005173"
     mRNA            <307650..>308693
                     /locus_tag="OSTLU_93616"
                     /product="predicted protein"
                     /transcript_id="XM_001420930.1"
                     /db_xref="GeneID:5005173"
     CDS             307650..308693
                     /locus_tag="OSTLU_93616"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420967.1"
                     /db_xref="GeneID:5005173"
                     /db_xref="JGIDB:Ost9901_3_93616"
                     /translation="MPPTMRFEHSSPTARLFHSPATVKPSTWSTGERTLDDSSSTAVD
                     ELDAASYARVLERRIAELEEIVEKTRNTTGDGKYAAMEAKCAALRAENARLKATTSTA
                     APLRDVTNGSRARESTPMRALKSRLSESTAAMAVENELRVELAKAKSTAAAESARAEK
                     RFNKALETASENEEWLASALRAKCDEVEKSEAKRRGMDARMGELQDALRVSESRLREA
                     LNNLDEYRAEVKSSIKREKKHAKIMHDKYKACKRERAQLEAEVDALRELASTPPPDAT
                     PGSVSYTRAAESAVKIASFAMEFAMEYPSPFAAFAVALFHALSWLFLRRGPSSVLAPP
                     ERFDVSGFLTVFP"
     gene            <309215..>309784
                     /locus_tag="OSTLU_6879"
                     /db_xref="GeneID:5005174"
     mRNA            <309215..>309784
                     /locus_tag="OSTLU_6879"
                     /product="predicted protein"
                     /transcript_id="XM_001420931.1"
                     /db_xref="GeneID:5005174"
     CDS             <309215..>309784
                     /locus_tag="OSTLU_6879"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420968.1"
                     /db_xref="GeneID:5005174"
                     /db_xref="JGIDB:Ost9901_3_6879"
                     /translation="EAALLSTTSFGTIGLSVGLPLLLYGFCAYFSFLPGADISALMLI
                     YGFPISLIGFALKYAELEPLKLVTYEDALKVREEQTTPILTQVRGDVTRYRYGDEQHL
                     EEALKIIFRFNRPGGLRRNQAPELVGLSEQIINDRYALCLEFDSPKMDFTEWTDRVSK
                     ITTFFGPGVIAAATRIDGDEHKVEIALITT"
     gene            <309945..311620
                     /locus_tag="OSTLU_27164"
                     /db_xref="GeneID:5005175"
     mRNA            <309945..311620
                     /locus_tag="OSTLU_27164"
                     /product="predicted protein"
                     /transcript_id="XM_001420932.1"
                     /db_xref="GeneID:5005175"
     CDS             309945..311546
                     /locus_tag="OSTLU_27164"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420969.1"
                     /db_xref="GeneID:5005175"
                     /db_xref="JGIDB:Ost9901_3_27164"
                     /translation="MTAPDLSRFDEGSSDEDDFIARVRARELAEGADDASAAADASPP
                     TTSGGGGDDKTDADARVSANRASKLERAREKKRKAKQARAKRRKLEEGRPRGTDETEG
                     GGDAANADDEDKVFHGTFNVEGVVMNDELVLVDKKSKAVYSSTERTANGEHVRIGTWD
                     DATQSYTYWKPAEKKKDERKEKGAVLNERGETIPAIFKGNAKLAEEFKAPAEVEHPFE
                     TDADDHCETSPEAHENVANFLKAACGRLNKTPADLVIYDPYYCAGGTRRNLALIGFTN
                     VINRNEDFYKVIEEGRVPEHDVFLTNPPYSADHIEKCVTFAAENLAAHGRPYMLLLPS
                     YVIHKDYYLPALLTGGSRGKEKAKSLELQRKDEENNEDDVEENDDGIKRHGGGAARAQ
                     ILPFYIAPKKRYYYWTPKAMVKARAAKGQSEESAKARRKRTHIGALGERTSPFLSFWY
                     CCFGSMQRDVLAWHKKLPRSEVWGYVVARHPNDLPLAVLDEWDPRRIAAMEKAKADGV
                     EIPQLSSYAGFTGAAQSPAKKKFYK"
     gene            complement(<311702..>312454)
                     /locus_tag="OSTLU_93617"
                     /db_xref="GeneID:5005176"
     mRNA            complement(<311702..>312454)
                     /locus_tag="OSTLU_93617"
                     /product="predicted protein"
                     /transcript_id="XM_001421075.1"
                     /db_xref="GeneID:5005176"
     CDS             complement(311702..312454)
                     /locus_tag="OSTLU_93617"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421112.1"
                     /db_xref="GeneID:5005176"
                     /db_xref="JGIDB:Ost9901_3_93617"
                     /translation="MREDELRAAIDEAREILAEAARMANEQARAELARTFDAGDGRGA
                     AFECVRVEEFLKGKGARTLDAERAARELYIGDAYFQDVEKLMVQFDRLERALGGVPGM
                     NVGALVGRCTEVATCDIARATANLLTLRGAFKVGKISAMVMDCPKLLMCDDLEDRIRR
                     TQACITRIWASESDEDTIYAISEEPNLLFTLCDLPIFAEDISVDISELPMSVQGACVV
                     VARARVRRRTAFVSNHSSRVEALVFATRRFKA"
     gene            <312717..>313908
                     /locus_tag="OSTLU_2417"
                     /db_xref="GeneID:5004969"
     mRNA            join(<312717..312794,312925..>313908)
                     /locus_tag="OSTLU_2417"
                     /product="predicted protein"
                     /transcript_id="XM_001420933.1"
                     /db_xref="GeneID:5004969"
     CDS             join(<312717..312794,312925..>313908)
                     /locus_tag="OSTLU_2417"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420970.1"
                     /db_xref="GeneID:5004969"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="JGIDB:Ost9901_3_2417"
                     /translation="GAPSAYPTNASAYELLEEIGHGVSATVWRARCATNDEVVAVKVL
                     DLEEHEPEHLDEIRREAQTMSMLSHPNLVKYYSSFVNEASLWVVMPYLAGGSALNLMK
                     WSHPGGFEEPVIACIVKAALKALDYFHRNGNIHRDIKAGNILVDENGAVKLADFGVSA
                     SCWGSGGRPRSHQTFVGTPCWMAPEVMEQENGYDFHADIWSLGITVLELCHGHAPFSK
                     FPPMKVLLMTLQNPAPTLEEQPEDGRHFSRALREFVSLCLQKDPSKRPPASKLLEHKF
                     LKEAKKADWLAKTLLENIPSLGDRTRMLAEREAKRRAESNAVGEAQAEAASNEAYKHG
                     VSNWNFDVDELKAQAAAMDD"
     gene            <315323..>316741
                     /locus_tag="OSTLU_27168"
                     /db_xref="GeneID:5005177"
     mRNA            <315323..>316741
                     /locus_tag="OSTLU_27168"
                     /product="predicted protein"
                     /transcript_id="XM_001420934.1"
                     /db_xref="GeneID:5005177"
     CDS             315323..316741
                     /locus_tag="OSTLU_27168"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420971.1"
                     /db_xref="GeneID:5005177"
                     /db_xref="InterPro:IPR010554"
                     /db_xref="JGIDB:Ost9901_3_27168"
                     /translation="MKPKTQSLSFVNGYAIPRDSDGEVDVFDANAFADAPARGEAKAY
                     APEYVKLHGLVLRFNAYFDETVENGQKESARCRKCVIYFFLEDGSIKITEPRVENSGM
                     PQGAFLKRHVVRGVTLGDLNVGKAVTIYGFEFKIYRCDGFTRDYLGRVGVDVPNDERE
                     PDGVGPSWEEVRLARRAARSTKKDARGKFLTHDKQVLRFYCVWDDRSKFGDRRRFVLT
                     FFLIDDTVAITEVEANKSGRGSGMSSTLLHRSRLPLRDEDANARGLANDDFDYVTAED
                     LHVGDTIRVYKRDFFIYDCDEFTKSWYLTKFPGELTEAAFEPHDVTEPEDTVPAHRIP
                     EHTGLAIGSEEDSLQNCISLIPKPPRKDVAKDDEIVLQFRAEMVPISDADEVCEFDAS
                     RRFVVSFHVGDKTLSIFEQASKDSCSSKFLERARVRKRDETGAFYDLRDMRVGSVLEI
                     HSRAFKLGESDEFTRKYLENAV"
     gene            complement(<316785..>317576)
                     /locus_tag="OSTLU_41697"
                     /db_xref="GeneID:5005178"
     mRNA            complement(<316785..>317576)
                     /locus_tag="OSTLU_41697"
                     /product="predicted protein"
                     /transcript_id="XM_001421076.1"
                     /db_xref="GeneID:5005178"
     CDS             complement(316785..317576)
                     /locus_tag="OSTLU_41697"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421113.1"
                     /db_xref="GeneID:5005178"
                     /db_xref="JGIDB:Ost9901_3_41697"
                     /translation="MRADGFAVLLNTFERPDLLKTALRHYGKCRGVEEIRVVWSEKRD
                     APREGTAEDGYFVKKKPGLVRYDAHAESTSIQNRFEPLDDLRTRAVFNVDEDVRIPCE
                     TLYRGFKAWQKHPDALVGYYARNYAPAKKPSDGCSWRYVANEFQLWWSGKYSIILTKA
                     AFMDQKYLKLYKEHLPDGVREYIDKGGGNCEDIAMQFLISSITREAPVYVPASLMYYT
                     KAKLGGVGVAGISSGAGHHLKRGDCITDFQTMFGAEHIPLVETYQ"
     gene            <318497..>318676
                     /locus_tag="OSTLU_27170"
                     /db_xref="GeneID:5004970"
     mRNA            <318497..>318676
                     /locus_tag="OSTLU_27170"
                     /product="predicted protein"
                     /transcript_id="XM_001420935.1"
                     /db_xref="GeneID:5004970"
     CDS             318497..318676
                     /locus_tag="OSTLU_27170"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420972.1"
                     /db_xref="GeneID:5004970"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="JGIDB:Ost9901_3_27170"
                     /translation="MKCSICFDCYATDEVVVAMPCSASHVFHERCVKEWLARDDSCPL
                     CRSSLPVWLGRPQYS"
     gene            complement(<318749..>319630)
                     /locus_tag="OSTLU_93618"
                     /db_xref="GeneID:5005179"
     mRNA            complement(<318749..>319630)
                     /locus_tag="OSTLU_93618"
                     /product="predicted protein"
                     /transcript_id="XM_001421077.1"
                     /db_xref="GeneID:5005179"
     CDS             complement(318749..319630)
                     /locus_tag="OSTLU_93618"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421114.1"
                     /db_xref="GeneID:5005179"
                     /db_xref="InterPro:IPR001471"
                     /db_xref="JGIDB:Ost9901_3_93618"
                     /translation="MPTALRASRARTPTSESAHAVDGLPGTQPRAKKTKEVSGESLGK
                     YRGVYKWKNGKYRAMINSEGKTYGLGVFSDVEAAAMAFDRASIVLGRQPKNFATSNRY
                     EFELDELSKLNGNIQALRRMTSDRAPDKSKSMSVYRGVHRCSRTGRYRSEIEHNGKKF
                     SLGVHAKEEDAARTYDQAAIVCLGGLAVTNFDRQEYQLAHLDHFAGDLDKYRASLHIK
                     IRRQGTSRSRCTSKHEGVRKYEHTWKSGKKTVKWRAEVKVEGKSKQLGYFRSEDEAAQ
                     AVKTFRVGYAATATAGA"
     gene            complement(<319808..>321862)
                     /locus_tag="OSTLU_93619"
                     /db_xref="GeneID:5004971"
     mRNA            complement(<319808..>321862)
                     /locus_tag="OSTLU_93619"
                     /product="predicted protein"
                     /transcript_id="XM_001421078.1"
                     /db_xref="GeneID:5004971"
     CDS             complement(319808..321862)
                     /locus_tag="OSTLU_93619"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421115.1"
                     /db_xref="GeneID:5004971"
                     /db_xref="InterPro:IPR002482"
                     /db_xref="JGIDB:Ost9901_3_93619"
                     /translation="MSSDGDDGDDGRGRDDGDDGDDARRAGASRARADARGTNNHRNH
                     DDGVRNQRRRRSSDDARDGADDETTNARATDGDDERTDARLFPPTRADEEGTKTRTRG
                     DEATRGTNEAKENDDEGRRKANERGKTRGREGDGGVGATGGSIVDAARESATAGLAVC
                     GNVYVRSVENKLPPGVRSVVKGARCEVRTFADVFFATMFASCALTVRVVGAGAGAARR
                     AGERTMSTAGEASARIAREVKMKTMTIAKGGNDRKEARGEASKASEPSSVASLAKEKT
                     KEALRGLDDAKLAALASVKSFFDDRNKPGGDGTKSKKSGEASGSKSKNAKKKSVDVTK
                     TNGDAKPRRKKSVATEDGKLKRRVDPLRSLVSEETSKKVKEKLKGFEDAVGSWPMVQA
                     VKPRVDGFVEAFAERQRVVVAKLHSSTEGGVDTIRGARASLVHHAKGLKTRVEDGVTG
                     ARGILAGGIASTSRLVSPLLRHDRSATQKSRLKTFLNPGSSGRAIMRDDEYSAAQIER
                     HHELSKQVERAAKLSREADGELLAKPLRVVVQPEDNLFDIASIAGISVMDLARYNNLR
                     PHPESHFLKIDPGQVLYVPSRSLLDRLPAIDRAREPKYELSVRVTDVPRAAPPPTASS
                     RLVHPSRHSRHKSVRESDDALESSNFAASLGVSLALCAAALALRSVREAMNSDDEDVN
                     DA"
     gene            321931..323419
                     /locus_tag="OSTLU_27173"
                     /db_xref="GeneID:5004972"
     mRNA            321931..323419
                     /locus_tag="OSTLU_27173"
                     /product="predicted protein"
                     /transcript_id="XM_001420936.1"
                     /db_xref="GeneID:5004972"
     CDS             321937..323361
                     /locus_tag="OSTLU_27173"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420973.1"
                     /db_xref="GeneID:5004972"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="JGIDB:Ost9901_3_27173"
                     /translation="MAPARSNARDVESQESCAATHCAGNGHPAVAALVAPFVLAWNAI
                     DAYLTPCLGAYARLGARGAMGSLCCCLLECFRYEDKVWAGDAALGVDCEFRGCDWARV
                     DDLSAGSEDKPMVLYQGIIEPRDCVQGQLGDCWLVSALACLAEHPGAIKRLILNGEKS
                     LRGKYRVRFYDGKEKRWVTVTVDDLIPCYKGTKNPIFMQPHNNEFWPLIVEKAMAKFM
                     GSYAALDGGFGTWATHALTGDNVFLLKKRMDVERTWRRHNMKFIGKPGDGGKKDRIYH
                     EEVEENIVRDKLFNILTQYDSIKSLIAVSRMTKNGESKDETTGLVSGHLFSVISVRWA
                     GRSWGVGGKRFIKLRNPWSTFEWKGAWADGSKEWDKHPAIAKELAYVNDHHDGVFWME
                     FDDFCEYFNQIAVCDRTTKRDFSLRYDHDNKYCGPLMGCVSGCACFWCGCQGPYKLYC
                     GHQSTTETRQATKCCGTMKVANDA"
     gene            complement(323599..>325572)
                     /locus_tag="OSTLU_51241"
                     /db_xref="GeneID:5005180"
     mRNA            complement(323599..>325572)
                     /locus_tag="OSTLU_51241"
                     /product="predicted protein"
                     /transcript_id="XM_001421079.1"
                     /db_xref="GeneID:5005180"
     CDS             complement(323692..325572)
                     /locus_tag="OSTLU_51241"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421116.1"
                     /db_xref="GeneID:5005180"
                     /db_xref="JGIDB:Ost9901_3_51241"
                     /translation="MDDARASATAVVDAHVARGALTTDDARTLRETIALGQAHLIADW
                     PAPGVDDERKRAFVEEVRRADRGYPGGVAKYVSNARELLRASKEGKNPFEGWTPSVPT
                     GKTVEYGSAAHEILEKIGMRETAETCFVLVAGGLGERLGYSGIKVALPVERATNACYL
                     ELYVKNILAMEKRAEGAEGATNAGGCGCFGGGGAKAKSSTKIPLAIMTSEDTHALTLD
                     LLERNDYFGASRDQITLMKQEKVPCLMDNDARLAVKDDDPYKLALKPHGHGDVHSLLH
                     TSGLLSKWMSQGKKWVVFFQDTNSLVFRVIPGALGVSKTMNLEFNSLCVPRKAKEAVG
                     AISLLTHEDGRKMTINVEYNQLDPLLRATTNPEGDVNDATGFSPFPGNINQLIVSLPE
                     YAKQLKKTGGAIEEFVNPKYKDETKTAFKSPTRLECMMQDYPKSLGSKAKVGFTVFAN
                     WIGYSPVKNSPADGLAKFKSNGPTHTATSGEFEFYESCANLLRLAGADVPAAAVDAEF
                     NGMKLPMGPRVVLGPDVATSFDELKSKVGAVKLGAKSALVVEGSGVNLKNVEVDGALV
                     IKACEGAEVIVDGLKVTNKGWQWKPTGKGAPEVDALAGFVVKKNETAEYVFDKPGKYT
                     LP"
     gene            <326052..>327248
                     /locus_tag="OSTLU_41816"
                     /db_xref="GeneID:5004973"
     mRNA            <326052..>327248
                     /locus_tag="OSTLU_41816"
                     /product="predicted protein"
                     /transcript_id="XM_001420937.1"
                     /db_xref="GeneID:5004973"
     CDS             326052..327248
                     /locus_tag="OSTLU_41816"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420974.1"
                     /db_xref="GeneID:5004973"
                     /db_xref="InterPro:IPR002755"
                     /db_xref="JGIDB:Ost9901_3_41816"
                     /translation="MYRYYKQFYPADLLFKWLAHGNDERHARAEKTYPSRREFCFVLD
                     KEQEEGGGEIFARYQSFVDAKDFKTNVERKKPARIEFGPICNRRPSDRHTVELKPEER
                     ELVFDIDMTDYDDVRTCCKEAGICGKCWPLMTVALKVLDVGLREDFGFKHLLWVYSGR
                     RGIHCWISDERARKLSDEARSAVAEYFAVVKGEGQGRRVLSSTPMHPSVKRAYDGVLK
                     QYWIESYLPTQRILEDKTKLEQLLNLIPDENIREDLASEFATSSLNSVDRWGVIERRV
                     QDSLKKNNYKLTGALEKIILWHIYPRVDIEVSRHMNHLLKGPFCVHPKTGRVCVPMDP
                     ATADSFNPELVPTVVDLDSGAQTLDGAIKTFNDTFWNACARENIERLTAKTRQAKAEQ
                     QSGMEF"
     gene            complement(327293..>328445)
                     /locus_tag="OSTLU_51183"
                     /db_xref="GeneID:5005181"
     mRNA            complement(join(327293..327809,327879..>328445))
                     /locus_tag="OSTLU_51183"
                     /product="predicted protein"
                     /transcript_id="XM_001421080.1"
                     /db_xref="GeneID:5005181"
     CDS             complement(join(327309..327809,327879..328445))
                     /locus_tag="OSTLU_51183"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421117.1"
                     /db_xref="GeneID:5005181"
                     /db_xref="JGIDB:Ost9901_3_51183"
                     /translation="MTIASLRRASPRAAATRRERATTTTTRSRGARSTRAIDARARRG
                     RVCGGDAPRGDVRTRAKPPQRDTGIAKEDEAFEDADDEDDGAAGASEDGARGGNRETS
                     TSVEEKGGMKTTRKRGFDRGEGGYQSRWWTTKRDCPDGRSGSSETRWAKCDFSGYKEL
                     GFEKSGFNDTGETWWETWREIYCRDDFTGWWERYYANGAVERGVEKSGREVRQAWWEK
                     WGEQYDGEGATLKWTDKWAENGMGMRWGDKWEERRSKIGSGRKSGETWRVGEDGERFS
                     RTWGEVLSPDGSVRKFGNSTTGESWDTTVVENVYFDKSKPPTWQEVLSSSERLMSIEL
                     TPVSQDDDDDDDKWSLARNAP"
     gene            complement(<328640..>330907)
                     /locus_tag="OSTLU_41606"
                     /db_xref="GeneID:5004974"
     mRNA            complement(<328640..>330907)
                     /locus_tag="OSTLU_41606"
                     /product="predicted protein"
                     /transcript_id="XM_001421081.1"
                     /db_xref="GeneID:5004974"
     CDS             complement(328640..330907)
                     /locus_tag="OSTLU_41606"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421118.1"
                     /db_xref="GeneID:5004974"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="JGIDB:Ost9901_3_41606"
                     /translation="MTSVDEKIARARGRGRRGSASAGGSEDEYGSDSEDAPLPGEDDG
                     ETDDDASVSGDSESGEESESGDDDDDESESEREREREREEEEEDGTSEGEEEREAREE
                     DAAKDEKAKTPTATATSSESDSESEDGFQERAVVKGAKGDTTFDAKAFDELHLSRPLT
                     RACEALGYKKPTPIQAAVIPIAMTGRDVCGRAVTGSGKTAAFMLPQLERMLHRGPRPA
                     AATHVLVLVPTRELAVQVHQMTESLAQFTTIRAVLVVGGLSANVQAAALRTRPEIVVA
                     TPGRVIDHVRNTHSFGLEDLATLILDEADRLLEMGFLEEIKEIVRQCPKKRQTLLFSA
                     TLTAGVEALASLSMKNPARLSADTLGTTPKRLVEEVLKLKPNQSAQKEAFLMAIVSRS
                     YDKSTIIFSQTKQEAHRLKIIMGLSDIKAGELHGDMTQTQRLAALDEFRTGTVTHLIA
                     TDVAARGLDIPSVDAVISFDAPKTLASYLHRVGRTARAGKKGTALTFMEESDRKLVKT
                     IAKRGANLKARIVPGNIVAEWHKKIEDMEEQIVQINYEERTERQLQKAEMEANKASNI
                     LEHAAEIKSRPAKTWFQSERDKRNAQKDALKAMETAEMDLMDRKSHRKGAKRRQEAAG
                     PDRLPDSKRARRKLAQQALYKKERGDDDTPRGGFRVTKGVKSVKAIEREARLTGGVAT
                     KVVRMVKNARDPKAKAKRAARADVHDDDDARVQSSGRGADFRGGFRGASPGAPAKPFK
                     TARGKFKSASKYRRK"
     gene            <331210..>332331
                     /locus_tag="OSTLU_93620"
                     /db_xref="GeneID:5004975"
     mRNA            <331210..>332331
                     /locus_tag="OSTLU_93620"
                     /product="predicted protein"
                     /transcript_id="XM_001420938.1"
                     /db_xref="GeneID:5004975"
     CDS             331210..332331
                     /locus_tag="OSTLU_93620"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420975.1"
                     /db_xref="GeneID:5004975"
                     /db_xref="JGIDB:Ost9901_3_93620"
                     /translation="MARDAPKSAIPAMCAHVAFGVCYFLTAQRVLDARLVSPEAQPLT
                     GMIYASDAASASAGVLMARLRARRDGRVTATARRAGKFPRAALLLPVFDLFGLTCAFE
                     AMRALGGPLYQTISGLLIPLSALLSKVVLKRTFTKGQIGAIAVVICGLAVKAKDVADE
                     AARRGTAIDARGILIANAATVSYGFRGLVMEYLSASKSSLSGNAQTMLMGTCGLAAFA
                     IYTLARTARDMDGMVWAYYNASPRDVSSILKVHLGNMLSRAFMVKMMMAVVARAGATQ
                     LALSNAIRSVGVIAFSHVLFCSDDARQCLSYNGAISAVMVVTGGLAYAMSGKPKTAAA
                     AAPKTARARKTTVAVARADAKPTASPSSTVRRRSARRGS"
     gene            <332509..>333033
                     /locus_tag="OSTLU_93621"
                     /db_xref="GeneID:5005182"
     mRNA            <332509..>333033
                     /locus_tag="OSTLU_93621"
                     /product="predicted protein"
                     /transcript_id="XM_001420939.1"
                     /db_xref="GeneID:5005182"
     CDS             332509..333033
                     /locus_tag="OSTLU_93621"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420976.1"
                     /db_xref="GeneID:5005182"
                     /db_xref="JGIDB:Ost9901_3_93621"
                     /translation="MPPNRDFATRTARRAPRASRTTHLLAFAFALASSRRGAARAEDG
                     LGWREGGTATWYGGPNGPGPDGMSIYTGSCKYGSNIPSHYVAALNTDGTLNTDAAAWN
                     FNSENINCAGGYDHGLTDECGACYEVMCVAGRQRGLADSALGPWAGCANGDGEKSITV
                     LITDSCPCGHPNPR"
     gene            <333691..>335133
                     /locus_tag="OSTLU_2735"
                     /db_xref="GeneID:5005183"
     mRNA            <333691..>335133
                     /locus_tag="OSTLU_2735"
                     /product="predicted protein"
                     /transcript_id="XM_001420940.1"
                     /db_xref="GeneID:5005183"
     CDS             <333691..>335133
                     /locus_tag="OSTLU_2735"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420977.1"
                     /db_xref="GeneID:5005183"
                     /db_xref="JGIDB:Ost9901_3_2735"
                     /translation="SAAGPSPRRFAVVGSGPAGMYAVLALTKTFDGAKVDVFERYPAP
                     FGLVRYGVAPDHAETKLVTNKFHETLTTRDDVAFYGNVQLGRDVSLGELYDSYHGVVL
                     ACGTSGDRRLEVPGEGEHRGVLGAREFVAWFNGDPEHGPQSATHAAVVEALRSRDGDA
                     HVAVIGVGNVAIDCARVLLRDADALAGTDICEHALEVLRAHPVRAVSVIGRRGVAQAS
                     FSPKELRELLNLRNVRVVISDENLTLEPEDEAELAENRPRRRAHEAFVKRKTAGECAS
                     EDGCTKILNVRFLASPLAFGGENGVLSWMKLGRNELVGAAGARKSIASGETEMVPTAL
                     ALRSVGYRAEPIQMTVKDESLTQLRLPFDEKNRVVPNAYGAVAVSADSADTIPRLYVT
                     GWLKRGPTGIIGTNLTCADETIAKMAADFAVAPPPDPVEDGVDRLLEKRGVRVVRAAD
                     WIQIDRLERERGAARGKPREKFVSTADALKA"
     gene            <335590..>336147
                     /locus_tag="OSTLU_93622"
                     /db_xref="GeneID:5005184"
     mRNA            <335590..>336147
                     /locus_tag="OSTLU_93622"
                     /product="predicted protein"
                     /transcript_id="XM_001420941.1"
                     /db_xref="GeneID:5005184"
     CDS             <335590..336147
                     /locus_tag="OSTLU_93622"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420978.1"
                     /db_xref="GeneID:5005184"
                     /db_xref="JGIDB:Ost9901_3_93622"
                     /translation="VEALAKNTAKELPETLQAMEESAREVEALAAETREALSKLDATE
                     YVESLVNDFTAKMKDPTKDFRDLGDDATEYVRRLSLELGLVMQSVGIYLDDGAFDEDA
                     KNLSAAEKARRKNALTEAISAAKETTESAAKLSTQLQGAANGESKGRDLAEIVGKIAL
                     ASKQVSTAMTRVVESTSESFRSTDE"
     gene            complement(<336191..>341333)
                     /locus_tag="OSTLU_17874"
                     /db_xref="GeneID:5005185"
     mRNA            complement(join(<336191..338806,339519..>341333))
                     /locus_tag="OSTLU_17874"
                     /product="predicted protein"
                     /transcript_id="XM_001421082.1"
                     /db_xref="GeneID:5005185"
     CDS             complement(join(336191..338806,339519..341333))
                     /locus_tag="OSTLU_17874"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421119.1"
                     /db_xref="GeneID:5005185"
                     /db_xref="JGIDB:Ost9901_3_17874"
                     /translation="MDAPELAIALDELAILPPASLAHVPTLRAAHAALRSSQCPGVAA
                     APARDVADAPEQLDVDRLHDVFDACARAGCASVIAHYVDEVCLSDDGRFSSDDGAEAY
                     ARDGACASAWARRATRRASERVHASAGRPREARVAAVEDAMRTLEAARRTVEALGGWR
                     EDGDEANAEREALRATADEVVTRQLQAEALLWAAREGLSDAVGARYGGPAAWAGAVQR
                     RRSAAANGDARFGGANATTFLDDLLAGVGEHQPAYPFKTVTDAAKCVFVDGSASPAAL
                     VAKKCLFLYFLLDSGLPHDGSPMEYARQARIHPRLFQETRAAVLLDDSENEASLDEAC
                     ALLPRVAHPLLPVKFIASLARRGRATTALMVARARAPSSSDTEAIGLDVSIRLACGLI
                     AEAFIAVRDAFKTFPELRGDSKSGAYLVSLLLDHGVEKLCLDKVLELPFYGEMEKLLL
                     DLLWARRSEVPVETGILYLLNRGRALEASELFSKARSEGRLEDEHAAKLVKRMQESLS
                     RLPVPQKVLVAEAARQRGDDDALLARSLVVRDASEDALATTASALLIDEVKEFEAVLK
                     SEDAAVGILPFLKPPIELARERREPSIDSATAALATTMLRSFWDVVGAAVVSADDDDA
                     SREDSNAPLRAGSCVAMYALGAREGRGMYAARDGGGRSTRANDAPAATEGKRALEFSC
                     ATLRRDGVSTSTSASGGGADIDSLMLTARDASTQLVVLRFGEFYGFRSHAAGGKLLQA
                     RRKAASELCFYNYNFGVCEQWELVSVDHERATYGRAMLFRNRRFEHVTINAAVVEVPK
                     EFLPKYALDDMSLYDDDLAYVEYGTSYYGSDTESESSVLNLKPLAAPPSPSAAANASP
                     SKPKSKQKRVEQQPVLIEPPKPAESAPSWLSAAIVEKWTRIFKDEIEIRRGVERELEG
                     LREELKIVEKSWMNSVQTVQLEFESINNEALKTMRKTMQQKMRKRVQAVQVKAIERMT
                     RTSARAFRDETFKRWRAFADKERRKRVGVVRFLLRADRRGLGAAFDAWKNYANTRKLK
                     RERDALLSARRRESLARQFFDRWKSCASESNQTRRIAARAHRRALTDKSRELKQKVFV
                     SWYLYAKRGKHVAKIQRLAVHKMRERLMFDAFECWKNRAEERKSFTQRLMRTFARWDN
                     RTACAAFLKWKEVVDDSRHAKKTYNGVLLCWNKDSRKTLTKLHFFAWRTTARFVRVHR
                     EKMYAVTRERMKNNTTRIVFHNWKMLSARRQREEQHQRGVVHAMASLRFKYIRANFDA
                     WRSQTIKSAFRKHTVSKFMNKLRRYELLRAFQGWRYRTHTLRTQRRSVAATLTRWRQR
                     VLLSSWNQWKFATQEHSKLIAVSALAIFNRQRQSRLRRSFAIWRGMWRAQMVALVKMR
                     ASHQFATRNHYFTRWRNAIRQREEMQRMVVSKRVTHNLFLDWYWETFGEQFTRLIEGN
                     DTDEYQTLVRVDDPEVELFHTPLRTPEKVFWSPPKPRRIL"
     gene            complement(<341437..343067)
                     /locus_tag="OSTLU_27184"
                     /db_xref="GeneID:5004976"
     mRNA            complement(<341437..343067)
                     /locus_tag="OSTLU_27184"
                     /product="predicted protein"
                     /transcript_id="XM_001421083.1"
                     /db_xref="GeneID:5004976"
     CDS             complement(341437..342948)
                     /locus_tag="OSTLU_27184"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421120.1"
                     /db_xref="GeneID:5004976"
                     /db_xref="JGIDB:Ost9901_3_27184"
                     /translation="MAAVTLGTFLVLGRAGAFRGASARRAPLQAMDAGAGSAGGTASR
                     PARRWMTHLLRDHPEMRCTQIPSKPVIVGGDGGGAGKPLMEFLRDSNAVTFGPTDKDG
                     NSDAERLSGLDDMVVDVMAFSKRLLYEPDDLPMDLQADLAKHLCDMFARQEKWLHPGL
                     TMNGIQHDQEVGRWGWKDPLAMYLVPIWRDVYGPSVTYVHLVRDPRTLPLGNLHDKER
                     DLQKAYFGQERWEQLTAKFESEWAHLSQHQSMTSVKKDDVIDLLRTTAYWTSINFELG
                     ALIKGPLKNYATVLRAEDLVQPDMDHFRRDATGKKPEKYQAAQKVMQELTTLLKLPAK
                     LSNTLGSHEHMKQNLRRFTIHREKFVYRTDSPIIEVQTRIAEKTLELFGYSADAALFV
                     SRHPSSSEPHGHRLTPEGEYMHEEHRYTPDDFEPTIEPASEGDLPGITNHVLGAQLKY
                     TDRVELERAKTRAPDTEQSRAVEAQLMEAKKKTFLLETTKIDGKSLKDVIDHL"
     gene            <343476..>344123
                     /locus_tag="OSTLU_5165"
                     /db_xref="GeneID:5004977"
     mRNA            <343476..>344123
                     /locus_tag="OSTLU_5165"
                     /product="predicted protein"
                     /transcript_id="XM_001420942.1"
                     /db_xref="GeneID:5004977"
     CDS             <343476..>344123
                     /locus_tag="OSTLU_5165"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420979.1"
                     /db_xref="GeneID:5004977"
                     /db_xref="InterPro:IPR001537"
                     /db_xref="JGIDB:Ost9901_3_5165"
                     /translation="FPYGDGFAFARATCETETMVALATAMVGEERRMRLENVLEHRSF
                     SLLPILEGVYDVGNILAVCRTTEALGIGCASIVSSKGLSFKASGRTSGGALKWQHVEQ
                     FETSERALRVAKAKGYRVLTTEFDGAQPLSHYDWTVPTAVVFGNEREGVSDEARALRD
                     GAVYIPMFGFTESLNISVAAALVMSHAVTDRINRRGFHGDLTEEEKRILRGVYMSR"
     gene            complement(<344382..>346211)
                     /locus_tag="OSTLU_93625"
                     /db_xref="GeneID:5005186"
     mRNA            complement(<344382..>346211)
                     /locus_tag="OSTLU_93625"
                     /product="predicted protein"
                     /transcript_id="XM_001421084.1"
                     /db_xref="GeneID:5005186"
     CDS             complement(344382..346211)
                     /locus_tag="OSTLU_93625"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421121.1"
                     /db_xref="GeneID:5005186"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="JGIDB:Ost9901_3_93625"
                     /translation="MVGCDDCGDWYHLKCINVTPTMAKTMHNYICPPCIAKSGKASAL
                     SLDTYRSVHRTNRPNVMLLRELLGEAQRFPGEVPEEAVLNQVINTHDAWRLEVRKTLH
                     RKSMKEAHDNAISQASKIAQEAAMRESEERTRRIAEASLAATAENPNPPASLTPLQQV
                     MLMGQAVTFAATQRTHALNISPCSQEISDVVTKQLGQLQQLAMQLAMCQAQIHMAPVR
                     SRPHILHVLMMQQQHLKMTNEHEEELANVGASNWLMEATLQLSGMSGMMPPPTAQDTG
                     KEPSTSTGHGSPSDMSAQLKTNEPMMVPQQFMLQPAMPSLVGDASGMPKQEMDYTYDI
                     PRKDNVDPALQVYAGMKGALAMELEPVEETLALMREVCGPAWREQATRLMTGAPFPRL
                     IKLHELKESAMAAGLCPGAGIDPLADRAHALEVAGQIWLERAAAVVQDKTIPIEAAQL
                     LLQEGRSLPLYLKEELEELGERCELYCVCRSAYDALRPMICCDRCDGWFHYECIGMQS
                     PAPGEEDENAENVKFACPECCAAQGIPYVPFRPAPKDTDKAPERAAPPPAEEAPEPPK
                     TEEEAKPPAKPEPEVADNKKKRKTVEPTPPANKSTSSRSRRRK"
     gene            complement(<346245..>351087)
                     /locus_tag="OSTLU_17878"
                     /db_xref="GeneID:5004978"
     mRNA            complement(join(<346245..349911,350120..>351087))
                     /locus_tag="OSTLU_17878"
                     /product="predicted protein"
                     /transcript_id="XM_001421085.1"
                     /db_xref="GeneID:5004978"
     CDS             complement(join(346245..349911,350120..351087))
                     /locus_tag="OSTLU_17878"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421122.1"
                     /db_xref="GeneID:5004978"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR003347"
                     /db_xref="InterPro:IPR004198"
                     /db_xref="JGIDB:Ost9901_3_17878"
                     /translation="MRAPSRAPCASARPEAGVVDALDDLAAVDARACGIGKLTIAHDD
                     DDDDARGLRHRDRGAFALDLRAWSFTARTQPVRALGACARDASVDMRVPFRDEYERHR
                     ASRPDERAPRGASWRIHRVRGWRFDLRALYEEVKRRGGADAIDGNQGWREVAEAIGAH
                     GRGCAAGHAARALHGAWLEAFARDAKRREDAVKSAQFDAVKGEIEQDDALAIDALCGL
                     EFGASGAPERRVKVENVRNSCHIFFARDRDDGESHAFAARATRARDDGRRDDVRLTFT
                     ARVFATQGLDLVASQLADAPEGDADCDVCGASGNEDAMILCDGCDRGSHMYCLTPKMT
                     EVPSGEWFCGRCEEIDAEVERLSADEGTQFTLGDFNEACIEFDTAFFGEDAKRTGIDM
                     QVIEECFWRMVEDASSVDDVCEVKCGTAIDTTKYGSGFPRHGEALQVKIDGVSPESIK
                     RWSESKWNLNNVARASGEKSSLLGALKDDVAGVTTPFLEVGSTFSSTTWRREEHNMYS
                     ITYNHWGAAKLWYCVPASAADKLEECFQKVMPDVYEAHVNDLGSVFTMLSPSFLMSAG
                     VPVHTLEQFPGEYVVTYPGAYYASFNCGLNCTESVNFVPADWLPEGSASVERNRSYAK
                     RSLFSHDELVCRVANNPSSSIAPHLWPEIARLYAEEANGRAELFASGVTRSAQMTSAD
                     DDDDDDGCEKPRKVRSRFDDASNSGSDECVVCRHILYSSGVGCSCDETRKACLRHVND
                     LCKCAMSKKTMFYRETVADLESLVKKTEKALSQKELASLKSKHSDLDSVTVNKNLVKK
                     AQAWVKRVGEELVKPPLPPLDKMRNLLAAGEEFIWGGADMKAAREAYTRVTNAVAWQT
                     SLVALKQRLGSSAGAEAAHDDAGEARLRLNRLKELLDNPPVPMPKADTQPFRDLLAAG
                     LKLEERIKAALAEVPNPSPRACTTLQTEANKFGVEVPSYKKLKDVIVRAGAWSTKVRG
                     ALPGRRQLPPREELANAREIEALYEEAHGLPVQQSELLTLRKSLEELNFWRAKSESLF
                     VAKVDVEEAEALLKEGMALSTKLDEVDRLADQIKAVKVWADHARASDYPGARVTDLHM
                     LLVEGEKFSVRVDEVEWLRNRIVVRELAEKLKDMVSSKKYPLAEVEAAVRAGNEFLDS
                     EDKEVAPDEEALLAQCESHINAAKKWNERAAVMLKSLDSKDRPSLEDAASLIREGSSI
                     PIFLNGFDVLSEAVNVAKSWLDRAQPCLKGKQLTRRGVSNPIPPLSEAQELMKESSNL
                     KLFVKEVEALEERVEAAEEWDVDAKDAIERWREDGAEVTLTELELSHEDFGLELPAME
                     TVRIRLKSLKWEERVAKIIAPKAKLVEDTVLDELREEIDVLQDLKEDLVAEIMKRYTI
                     VDEWRKKADRLLDPPLLEDGRLAPSASPEEIDALIAEGKALPADVSKVEDLEASLADH
                     AQWVDTVRKCLNSVAEGRSRPSIDELYDLLAEVEDLTFKCSERQALTNACNAATAWTE
                     RLNALLWANDQGEVKQEKTLIEMLSNVLDSIKAGVEDITGTGEPPETEEG"
     gene            <351487..>352491
                     /locus_tag="OSTLU_13201"
                     /db_xref="GeneID:5004979"
     mRNA            join(<351487..351958,351995..>352491)
                     /locus_tag="OSTLU_13201"
                     /product="predicted protein"
                     /transcript_id="XM_001420943.1"
                     /db_xref="GeneID:5004979"
     CDS             join(351487..351958,351995..352491)
                     /locus_tag="OSTLU_13201"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420980.1"
                     /db_xref="GeneID:5004979"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Ost9901_3_13201"
                     /translation="MARRLTLLVTSWDGTARRYACRAREIGDVKSLNSIDLGAPALCG
                     TFVGTDEDAACVGCLDGSVRLVDFKTGAFRVVGAHDDGAVSAVEYDDATKKLFTFGWD
                     RTIRAWDLTKDERGRAVSTTKTAGKCYAADLRDGKIFVATSDGQVLAYETRDLVRAPP
                     RPLINRRSSMRFQTRAIAANIRGDGFVAASVEGRVAVEFIRDEENDKRKYAFKCHRKT
                     DDASVGEIVYPVHAVAFHPVHGTFATGGGDGYVNFWDGDAKKRLFQSPRYPTSISALA
                     FSPCGSLLAIASSYAHEERENNKPEDRVFLRETRAEEVTPKSAKTS"
     gene            <352669..354877
                     /locus_tag="OSTLU_51294"
                     /db_xref="GeneID:5005187"
     mRNA            join(<352669..353636,353694..354195,354268..354877)
                     /locus_tag="OSTLU_51294"
                     /product="predicted protein"
                     /transcript_id="XM_001420944.1"
                     /db_xref="GeneID:5005187"
     CDS             join(352669..353636,353694..354195,354268..354702)
                     /locus_tag="OSTLU_51294"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420981.1"
                     /db_xref="GeneID:5005187"
                     /db_xref="InterPro:IPR008532"
                     /db_xref="InterPro:IPR008616"
                     /db_xref="JGIDB:Ost9901_3_51294"
                     /translation="MYRASRIPARARWRIASLASPRRAPSPRHRRSLVVVRAARATPA
                     TFDYTALVASVREINALSTPVKIDACAQVDAHSMTLDARAADGRRSVRVSWHPVTAHV
                     AMSARGAKVEKGMNLSFGESANALLKGKVLLDARVGTAWERACRLRFGDRPGGEAEYE
                     LLCEVMGRYSNAFLLDSKNNDEVLACGYQVGEKQTSVRRLAIGYAYEPPPSAPGIDPT
                     TGVEGGVDGWTAVLRDVARGRSGDMGEARLDECMVRAFRGVSPALAKALIRGAGVADG
                     ERVETASASDWVAVYDEFMRWIASVSSDADSAGTLANATWCEEFGQFVAGGPIGALFG
                     AVYGEAGETDVFERERSRILQAVRARLKKLASKDVGFRKQLEAASGHEEIQLLADALM
                     AYSYNYKPGSSELEGQDFTTGETVMFKVDPEKGPVGTAEALYKKTRKLRRTADAVEPL
                     IEQNASEIEYLEGVEFSILEVSEFKSRDDLLFIEEIGAELKGGGAKPKTGKQARKQEM
                     MNAIRIYTAPSGKEVYCGRNSRGNEAVSLFFGQDQDVWFHVRGAPGAHVILRQQPGET
                     ASDDDIQFAANVASFHSKVRTGGKVNVSYTSPKYVKKPKGARLGMVTIDREDVIVGRP
                     DDVADVCDGR"
     gene            355075..355898
                     /gene="ELIP/CBR13a"
                     /locus_tag="OSTLU_27189"
                     /db_xref="GeneID:5005188"
     mRNA            355075..355898
                     /gene="ELIP/CBR13a"
                     /locus_tag="OSTLU_27189"
                     /product="possible early light inducible or carotene
                     biosynthesis related protein"
                     /transcript_id="XM_001420945.1"
                     /db_xref="GeneID:5005188"
     CDS             355086..355742
                     /gene="ELIP/CBR13a"
                     /locus_tag="OSTLU_27189"
                     /codon_start=1
                     /product="possible early light inducible or carotene
                     biosynthesis related protein"
                     /protein_id="XP_001420982.1"
                     /db_xref="GeneID:5005188"
                     /db_xref="InterPro:IPR001344"
                     /db_xref="JGIDB:Ost9901_3_27189"
                     /translation="MFAVTTRPQLAARAVVKTQRAHRRASVAVRAENDVSKAVEEANS
                     EWKDADAASKQPTMRVDAIDPADGSIAEAAPLGNDNSMLDSVMLAFKDSRAVETINGR
                     AAMIGWTAALYVELTSNTSFMHQLFNERTFTLADGITRTSTYPAAGFFLVPACVILTL
                     ASSLAPALKKSSPNGLDEAPEAFGPFRAEAEMTNGRGAMIGLVALPIVEKIMGGSALF
                     "
     gene            complement(<355964..>356608)
                     /locus_tag="OSTLU_27190"
                     /db_xref="GeneID:5005189"
     mRNA            complement(<355964..>356608)
                     /locus_tag="OSTLU_27190"
                     /product="predicted protein"
                     /transcript_id="XM_001421086.1"
                     /db_xref="GeneID:5005189"
     CDS             complement(355964..356608)
                     /locus_tag="OSTLU_27190"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421123.1"
                     /db_xref="GeneID:5005189"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="JGIDB:Ost9901_3_27190"
                     /translation="MPAPTRPPTRHHHFETGTYKPSGLFLPDDEYGRALDALVKGCVD
                     CLLTNEKGEVLLGLRKHEPAKGTWWYIGGRMRTGETVEETARRHAKRDIGIEIDTERF
                     RFVTTSTMNWEFRVQEPAGNGTCDINVVLAATLTEEEIARKTMCADEYLDQKFWSVED
                     ILAVTDEKVILPPIHISAKKMVWSEREDAMYAAVARGADDAEIARLARRAYEFA"
     gene            <356719..>357810
                     /locus_tag="OSTLU_88990"
                     /db_xref="GeneID:5004980"
     mRNA            <356719..>357810
                     /locus_tag="OSTLU_88990"
                     /product="predicted protein"
                     /transcript_id="XM_001420946.1"
                     /db_xref="GeneID:5004980"
     CDS             <356719..357810
                     /locus_tag="OSTLU_88990"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420983.1"
                     /db_xref="GeneID:5004980"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Ost9901_3_88990"
                     /translation="VSRAKWIKSSLRRDVASRARSRPTVVDVVQRSAMGIRAACAVDM
                     RGKIAVVTGANTGIGLQTARLLADAGARVVMACRSIDRARAALEYASNGGANDVAVMA
                     LDLSDAASVRAFAEKFGKEYEKLDVLVNNAGLNGASGYSGPKTTKQGYDICMGVNYLG
                     HFMLTSLLLPQLMKSDGARVVALSSVTTWFGSNKYQYYYKGASKTKGNYGSSKLACLA
                     MTVELQRRLDAAYPDNKIVCAAADPGFVASNIWRDYNPVLRKIMSILALTPAQGAMTS
                     VNAASLPSITKATLYMPFKIKMSKLFKMHKSATYMFGMPLLSKAFAGFGADAMAPRAK
                     NAESNAKLWDLSIEFCKENGVKSCEAYNL"
     gene            complement(<357859..359013)
                     /locus_tag="OSTLU_27192"
                     /db_xref="GeneID:5005191"
     mRNA            complement(<357859..359013)
                     /locus_tag="OSTLU_27192"
                     /product="predicted protein"
                     /transcript_id="XM_001421087.1"
                     /db_xref="GeneID:5005191"
     CDS             complement(357859..359007)
                     /locus_tag="OSTLU_27192"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421124.1"
                     /db_xref="GeneID:5005191"
                     /db_xref="InterPro:IPR006680"
                     /db_xref="JGIDB:Ost9901_3_27192"
                     /translation="MPRLLSPRALASSRLSLEATVLPGRRARASPRARVAVARASSLT
                     IARPDDWHLHVRDASKLADVVPFTSKTFKRALVMPNLTPPVRTASEAEKYRELIAKAA
                     PASDGFEPHMTLYLTDNTTVEQVEEAHACGFVRGYKLYPAGATTNSEFGVTDVANVAK
                     ATKRMAELGLTLQVHGEVTHASVDVFDREARFIQDVLMPLLDRSPDLRVVMEHITTRD
                     AAEFVAAAGPNVAASVTPQHVLFNRNALFKGGLRPHFYCLPILKREEHREAVLAAATS
                     GSGKFFLGTDSAPHPKGAKEAACGCAGIFSAHAALPLYAMAFESVDALDKLEAFASHN
                     GADFYRVPRNTETVTLEKKAWKVPDEYKFGDTTVVPFYAGEEIPWSVV"
     gene            complement(<359167..>360102)
                     /locus_tag="OSTLU_17885"
                     /db_xref="GeneID:5004981"
     mRNA            complement(<359167..>360102)
                     /locus_tag="OSTLU_17885"
                     /product="predicted protein"
                     /transcript_id="XM_001421088.1"
                     /db_xref="GeneID:5004981"
     CDS             complement(359167..360102)
                     /locus_tag="OSTLU_17885"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421125.1"
                     /db_xref="GeneID:5004981"
                     /db_xref="JGIDB:Ost9901_3_17885"
                     /translation="MPPRPRADASVDLARARASADDVSHRLSDTRARTVQAVELTERA
                     LREFRDADARDASKPRSTLVSPYDGEEDEEGGDNELTALVRQLESFAEKRTGTGQAPR
                     GANGTSGTTRGERERERERGGDKWSVKSGDSGDGRSMNDENSLVGYSMMYGSTVDDDG
                     SAADADELASEFSVDFSLPSERVAGGATARNDKKSELGSVSGRINAVSDSLTTSKSRL
                     HESIASLELEAGLTENGAEMDFEQYKDDMPVVGNTKTGQVVIDLAARGVNSLSRSSSQ
                     FMGEGKGGRGGDGAELSPLVRMFNSVCGGCCALRK"
     gene            <360423..>361088
                     /locus_tag="OSTLU_6312"
                     /db_xref="GeneID:5004982"
     mRNA            <360423..>361088
                     /locus_tag="OSTLU_6312"
                     /product="predicted protein"
                     /transcript_id="XM_001420947.2"
                     /db_xref="GeneID:5004982"
     CDS             <360423..361088
                     /locus_tag="OSTLU_6312"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420984.1"
                     /db_xref="GeneID:5004982"
                     /db_xref="JGIDB:Ost9901_3_6312"
                     /translation="LREACAGTYRGALATRDDAAEIMAAAGALERLTTSETIEWDALD
                     GKWRLAYTNAADVLGLLMASQRLGVPEVGDIFQSFGCANGTNTGITNEIRLSVPFLLS
                     EAKVGAPGGVGLRVQASFKDVGRRRIALTFQEAQVSEISISPLAETLLAPAILPRSSL
                     NHQVLMFIKELELKFPLRGALTSMGGGEAGAAVGTYHLTFCDEDMLIGRAAAGGIYIF
                     TRA"
     gene            complement(361119..>362950)
                     /locus_tag="OSTLU_19801"
                     /db_xref="GeneID:5005192"
     mRNA            complement(join(361119..362633,362797..>362950))
                     /locus_tag="OSTLU_19801"
                     /product="predicted protein"
                     /transcript_id="XM_001421089.1"
                     /db_xref="GeneID:5005192"
     CDS             complement(join(361183..362633,362797..362950))
                     /locus_tag="OSTLU_19801"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421126.1"
                     /db_xref="GeneID:5005192"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="JGIDB:Ost9901_3_19801"
                     /translation="MSLKSINPNAELMNADAALFMNINAAKGLQDVMKTNLGPKGTIK
                     MLVDGAGGLKLTKDGNVLLREMQIQNPTAIMIARTAVAQDDITGDGTTTTVLVIGELL
                     KQAERYLNEGLHPRVIVEGFDVAKRESLKFLETFKRAAPGVEAPDREMLLCVARTALR
                     TKLREELADKLTTIVVDAVLCIAKPEESIDLHMVEIMTMKHQTDDETKLIQGLVLDHG
                     ARHPDMKRYVEDAFVLTCNISLEYERSEVNSTFMYTDAEQREKMVAAERAYTDETVRK
                     VIALKKQVCDGNDKGFVVITQKGIDPISLDMLCKEGIMGLRRAKRRNMERLVLACGGQ
                     CINSVEELSPEILGHAGEVYEYVLGEEKYTFVEKVVNPTSCTVLLKGSNDHTIAQLKD
                     AVRDGLRAVKNVLTDKAVVPGAGAFEMALNKHLKENVTKMVEGRAKRGVEAFAEAMLV
                     VPKTLAENSGYDPQDAIIDMQEEHDRGNVVGFDISIGEPFDPTMSGIYDNFLVKQQIL
                     HSAPIIATQLLCTDEVLRAGVNMRKR"
     gene            complement(363138..364476)
                     /locus_tag="OSTLU_27196"
                     /db_xref="GeneID:5004983"
     mRNA            complement(363138..364476)
                     /locus_tag="OSTLU_27196"
                     /product="predicted protein"
                     /transcript_id="XM_001421090.1"
                     /db_xref="GeneID:5004983"
     CDS             complement(363209..364411)
                     /locus_tag="OSTLU_27196"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421127.1"
                     /db_xref="GeneID:5004983"
                     /db_xref="InterPro:IPR006034"
                     /db_xref="JGIDB:Ost9901_3_27196"
                     /translation="MPFAPGAIPRSESYDAFVASVPDSRASPVKSLARARDASASATT
                     GDDERPRVMLLHCGGTLGMGVESFELREADVVPRAGGKYRPLGASKYLLDVQEVIPEL
                     RDFARLDVEVLMNKDSSEMDGKDWVTLARALHERREEYSAFVVAHGTDTMAYAASALS
                     LMLVGFGKPIVLTGSQLPLSFARSDARQNLIDALTCCCASRSCGGTVDFAEVAICFGG
                     KLLRGNRASKTSATVYAAFSSPSYPALARLGVGVDWNHARLLRPAPEYAPQFELNSNV
                     IRVPVIPGLDIEKAYGDLYGRGVRGIILEAFGVGNFPQSLVPWLTSQASRGLQIYLST
                     QCQSGELRPELYAAGLGALAVGAKSGPVMTSECAVVKMMLHIANPELELHVSYSGEAG
                     DVDFCDIK"
     gene            complement(<364584..>365522)
                     /locus_tag="OSTLU_5879"
                     /db_xref="GeneID:5004984"
     mRNA            complement(<364584..>365522)
                     /locus_tag="OSTLU_5879"
                     /product="MC family transporter: folate"
                     /transcript_id="XM_001421091.1"
                     /db_xref="GeneID:5004984"
     CDS             complement(<364584..>365522)
                     /locus_tag="OSTLU_5879"
                     /codon_start=1
                     /product="MC family transporter: folate"
                     /protein_id="XP_001421128.1"
                     /db_xref="GeneID:5004984"
                     /db_xref="InterPro:IPR001993"
                     /db_xref="JGIDB:Ost9901_3_5879"
                     /translation="WRAFVAGVAGGASSTLALHPLDVVKTRLQVQDDPDARRARYAGA
                     WRGARRIVAEEGARGIYAGAAPAIVGSAVSWGAYFAWYDGARARYADALGRERNGALP
                     AGANMMAATEAGVVTTVLTNPIWVVKTRLQLQRGGGLGDAASEAAKSGEKRYAGFVDA
                     LATIARKEGLRGLYKGLVPSIWLVSHGSIQLTAYEWLKEIAASGRARRARGGAADVAP
                     VEAGALGLASKFIAVTATYPIQVVRARIQQRSDVGRPADAPTYARFGEAVSRTFAREG
                     VRGFYKGFAPNVVRVLPSSAITFAAYEGVLGVLNDDP"
     gene            366154..367597
                     /gene="EF1A3"
                     /locus_tag="OSTLU_27198"
                     /db_xref="GeneID:5004985"
     mRNA            366154..367597
                     /gene="EF1A3"
                     /locus_tag="OSTLU_27198"
                     /product="Eukaryotic translation elongation factor 1
                     alpha"
                     /transcript_id="XM_001420948.1"
                     /db_xref="GeneID:5004985"
     CDS             366182..367585
                     /gene="EF1A3"
                     /locus_tag="OSTLU_27198"
                     /codon_start=1
                     /product="Eukaryotic translation elongation factor 1
                     alpha"
                     /protein_id="XP_001420985.1"
                     /db_xref="GeneID:5004985"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="JGIDB:Ost9901_3_27198"
                     /translation="MSEGKEHLSIVICGHVDSGKSTTTGRLLFELGGIPERELEKLRA
                     EADALGKSSFAFAFYMDRQKEERERGVTISCTTKEFFTDKWHYTIIDAPGHRDFIKNM
                     ISGAAQADVALLMVPADGNFTVAIQKGNHKAGEVQGQTRQHARLLNLLGVKQLICGIN
                     KMDCDMAGYKQERYEEIRNEMKNMLIKVGWKKDYVEKSVPVLPISGWNGDNLLSKSAK
                     MPWWNGVDVEDYMGGGKKFHIDCLLNVLNDMVDKPDRNTEAAMRLPISGVYKIKGVGD
                     VLAGRVEQGLVKPGEDVVFLPTHTSSNPCGGKVFTVEMHHKRVEAAAPGDNVGMNIKG
                     LDKLNMPRTGDVMIYKKDTSLAPCKEFTAQIQTLDIPGELKAGYSPIGFVRCGRSACK
                     LTALNFKVGKETGGKKLESPMSLKSNEVAECVFEPVHPLVVDSFKKCEGLSRIAFLDG
                     NTAVMLGKITKVEYKAI"
     gene            complement(<367767..>369751)
                     /locus_tag="OSTLU_41838"
                     /db_xref="GeneID:5005193"
     mRNA            complement(join(<367767..369533,369638..>369751))
                     /locus_tag="OSTLU_41838"
                     /product="predicted protein"
                     /transcript_id="XM_001421092.1"
                     /db_xref="GeneID:5005193"
     CDS             complement(join(367767..369533,369638..369751))
                     /locus_tag="OSTLU_41838"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421129.1"
                     /db_xref="GeneID:5005193"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="JGIDB:Ost9901_3_41838"
                     /translation="MTTGERSNASKLAAVREAMAKRGVRAVVVPSQDPHFRRYVAACF
                     ERRRWLSDFTGSAGTVVVTDAAALLWTDGRYFVQAEDELSEDWTLMRSGVKDVPDVKK
                     WLCAEEAGLAFTGAKVGIDPNVHSVSEARGLREALSACGIELMSVEENLVDLVWSDRP
                     PFPKTPLRVHPMEYAGKSVAEKLENLREKMKENDAQKLVVSSLDDVMWLCNVRGGDAP
                     CNPVTLSYVLVGENDASFYVDTDKATPEVVAHLAEANVTIKPYEDMAKDVYAAAQRGE
                     RLWMDVDKVSIAMLEQAEAGAAEAPKDAKKVKTESAPSAIKEGTCPVPIAKAVKNEAE
                     MAGMVEAHLMDGAAMAEFWCAIERDVAEGRAIDEYEAGERVLACRAKQNGFFEESFPT
                     IAGEGPHGAVVHYRASKKSARAIGKDSLLLCDSGGQYACGTTDVTRTVHFGTPTAHQK
                     ECYTRVLQGHIALDQMVFPVGTKGFVLDAFARSHLWANGLDYRHGTGHGVGAALNVHE
                     GPQGISPRFGNMTPLMPGMILSNEPGYYEDGAFGIRIETLLQVKEAKTAHNFGDTGFL
                     CFDVLTLIPIQTKLMDLSIMSEKEIAWVNAYHEKVWQQISPRVSGETKTWLERACAKI
                     SK"
     gene            complement(<370104..>372402)
                     /locus_tag="OSTLU_51248"
                     /db_xref="GeneID:5004986"
     mRNA            complement(join(<370104..372176,372307..>372402))
                     /locus_tag="OSTLU_51248"
                     /product="predicted protein"
                     /transcript_id="XM_001421093.1"
                     /db_xref="GeneID:5004986"
     CDS             complement(join(370104..372176,372307..372402))
                     /locus_tag="OSTLU_51248"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421130.1"
                     /db_xref="GeneID:5004986"
                     /db_xref="InterPro:IPR002099"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="JGIDB:Ost9901_3_51248"
                     /translation="MTRGDGARDGASTPRAIGRLPSDVVNRVAAGEVIHRPSNALKEL
                     VENSLDAGAKSIAVTTREGGNKLLRVQDDGHGVRIEDLPLLCERHATSKIEKFEDLAR
                     CESFGFRGEALASMSYVAHVSATTMAAGATHATRATYTDGKMDAEGAKPIAGVLGTTI
                     SVENLFYNVVTRRKALKSASEEYSKVLEVLQRYAALRTDVAFTCRKHGESRATLHTPV
                     AQSRVERLQAIYGPTVARDLKKLDFDSELSKKKFDFKLQVDGLVSGGNYHSKKTTFIL
                     FINSRLVECAPLKRACESVYAAILPKAEKPFVFMHLRLPFEDVDVNVHPTKQEVHFLH
                     QEAIVELIQSKLEKILLATNSSRTFTVQTLLPGAEKLAKKDDENDAERSGDKENSEKA
                     DEPPASQAKTMRTQRERAGGDHKLVRTDANLAAGSLDAYLQRAMNSEGREHEKIEEVR
                     RAVRERRGQRTEPEDTYVCELTSIRQLNTEIANRAHKELGDVIKNHTLVGAVDARKGV
                     WLLQHQTKLFMVDAVKLTEEMFHQMALKNFANFGYQSLQDPASLAELALCALEDKFVD
                     DEEWDASDGSKEEVAEKIAEMLVEKADMLKEYLGVVIDKERRQITGVPSMLPGYAPEI
                     GKLPEFVLALAEDVDWTSEKECFETCARVIGAFFAMDCSFHDPKAEEGDAESDARRVA
                     RLCVFPAMKRRLAPPRRFADDGTVIQIACLEQLYKIFERC"
     gene            <372714..>373454
                     /locus_tag="OSTLU_27201"
                     /db_xref="GeneID:5004987"
     mRNA            <372714..>373454
                     /locus_tag="OSTLU_27201"
                     /product="predicted protein"
                     /transcript_id="XM_001420949.1"
                     /db_xref="GeneID:5004987"
     CDS             372714..373454
                     /locus_tag="OSTLU_27201"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420986.1"
                     /db_xref="GeneID:5004987"
                     /db_xref="JGIDB:Ost9901_3_27201"
                     /translation="MTAMCYVGAIRRRRATRGETACVAKICERWSARVGGRLGRVRAS
                     LEAEDGSAAARAVAREVGKCEAEATALARRFAHEAIEATEAFETREAADDATTSEARG
                     DGDGDGDGDGVNGIPEKWRMACGNVNGYLEYAGATLTFEEWARVREAFDAVVTEVDGD
                     DASARYVRDDGNWNAMKAMMDDSVVRPRRLSQVENNARYANAKAELDEAKKAWKEANE
                     IYKDARRRIKQARHEVHKTRKAVRIEYR"
     gene            complement(<373511..>374251)
                     /locus_tag="OSTLU_41621"
                     /db_xref="GeneID:5005194"
     mRNA            complement(<373511..>374251)
                     /locus_tag="OSTLU_41621"
                     /product="predicted protein"
                     /transcript_id="XM_001421094.1"
                     /db_xref="GeneID:5005194"
     CDS             complement(373511..374251)
                     /locus_tag="OSTLU_41621"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421131.1"
                     /db_xref="GeneID:5005194"
                     /db_xref="JGIDB:Ost9901_3_41621"
                     /translation="MPEVEREHVQKVYDIVAQQWHGTRYRAWTGVEAFVRKQPPGLLA
                     ADVGCGNGKNIPEIVKGGGFALGSDFSRGLIEICRDSGYEVMVADAVILPYRSDVFDY
                     ALNIAVLHHISSPERRVELVKETMRIVKVGGVALFYAWALEQEQGGVSGHQFEGQDVL
                     VPFHNKIKVKGVAPEDERERQSRVSGAPTHGEADREKRSVVYQRYCHVYTEGELPKLF
                     ENLPWCEVTAAYYDHGNWCVEVLKTSRP"
     gene            376411..377479
                     /locus_tag="OSTLU_51192"
                     /db_xref="GeneID:5004988"
     mRNA            376411..377479
                     /locus_tag="OSTLU_51192"
                     /product="predicted protein"
                     /transcript_id="XM_001420950.1"
                     /db_xref="GeneID:5004988"
     CDS             376430..377380
                     /locus_tag="OSTLU_51192"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420987.1"
                     /db_xref="GeneID:5004988"
                     /db_xref="InterPro:IPR004142"
                     /db_xref="JGIDB:Ost9901_3_51192"
                     /translation="MSLPEDGLDLLPAASFDVSGVAHVVPTRHGPVTVTAQGADRSRP
                     ALVTYHDVGLNHRTCFQPLFVCAGPRSDLVSRFCAYHIDAPGCQDGARGRDRGGDGDA
                     ATTATTLDAHAEIVEDVVKHFGLRDVTCLGVGAGATVMALYAGRHSSACRAGIFVSPS
                     CGRARTMEHALGAVCKFNLKRHGWTPWTLKHLLKRMFSYRGLGGSNGMYESDLAQTAR
                     REMREMNPEATLAYYDAALHRLDNEHVYASLDIDAMILAGTSSPWYKDTIVMNSLMKA
                     SKTSWIEIEGCGTVATMEDPQQLLSPINLFIQRLKSQGLA"
     gene            complement(<377445..379141)
                     /locus_tag="OSTLU_27204"
                     /db_xref="GeneID:5005195"
     mRNA            complement(<377445..379141)
                     /locus_tag="OSTLU_27204"
                     /product="predicted protein"
                     /transcript_id="XM_001421095.1"
                     /db_xref="GeneID:5005195"
     CDS             complement(377445..379106)
                     /locus_tag="OSTLU_27204"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421132.1"
                     /db_xref="GeneID:5005195"
                     /db_xref="JGIDB:Ost9901_3_27204"
                     /translation="MAHACFVRPRVAFAHQIVGAKRATHIKFSDSDEDDDERVDGKSG
                     VEGDDESSCDEREGEYVLPLNASQRRALRRFFARDGHFDQLQMVQGPPGCGKTHFIVS
                     LLAVLAAKKQRVLVCAPSNKAVCVVMELYLRTCGEDAAPCVLTGAEDTLREASSVDGG
                     AMDYFIFERCNVIASSFRRSFVSGGDGIRESAKAARRALESIAPSFCKGVVAEGLSAV
                     AAMDDEASMRARGEEIAREIEKGSGRGERSDEFAREALNRASLVFCTLASAGQSIMSS
                     LEQPDALVVDEAAQALEPEIAIPFLRYPRKALLVGDPAQLPATLISEIARRHGHATSL
                     MERLMSANAERASLLDTQYRMHPSIASWPAAQFYGGRLANADHVLTRNLPQGLSSSVP
                     SYAFVDVASVESGGVGKSKWNQREADVACALIRALKTKSPTLFVVCITFYSAQVRAIA
                     RALQRAGVRDVAVHSVDSFQGSEADVVVCSAVRSNAKANVGFLSDKRRLNVALTRAKY
                     SSIVLGSRDTLSRCGVDALRSLVEDAAARDVIVSEHDIVRRIIRN"
     gene            379956..381928
                     /locus_tag="OSTLU_27205"
                     /db_xref="GeneID:5004989"
     mRNA            379956..381928
                     /locus_tag="OSTLU_27205"
                     /product="predicted protein"
                     /transcript_id="XM_001420951.1"
                     /db_xref="GeneID:5004989"
     CDS             380354..381910
                     /locus_tag="OSTLU_27205"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420988.1"
                     /db_xref="GeneID:5004989"
                     /db_xref="InterPro:IPR001194"
                     /db_xref="JGIDB:Ost9901_3_27205"
                     /translation="MEALDATARGTTRELARGDALWEYLDRTIGTRAPTAGTTADVGL
                     PWTEFAGVATQSVRLRAPDLRKEFNGGIKFTALLDCGHVEAVLALFAALVTERRVVLT
                     SGRLEAVSAAVHAANAALYPLSWQHIFLPVVPEAFLDYLTAPMPFLVGLHSSLSEDAK
                     RLPCDDVFTLNLDDGSFTYFEEDFEAIPSGPFTLLRVGLLREIERTRGEDSQAVARVF
                     RTFFSSVLGPYKQHIKGVVAHPPPRDAIIADSLWLDQRGLELGNLKHAGILAAMRGTQ
                     MYEVFVRQRLRMCAQVARKTGFVPMGDEIVDFDLEEGELTLSDLMMRGQALSEQFASA
                     SSHAFSVGSSALRETMRKAKKAYSTSKTIQGMREAFASKRSQLAHSIGKLREKSSEDL
                     QAKWAEWTDEGTAKNLSFAEASTAEAPVPAPPQTQSPVVEREAVEVNEPVAMSEPIVD
                     SLASAPTPAPTLASAPPPRVESVSGAANMMANLMSFDDAGDTLAPVTPSKRTGATMAD
                     VDELPNLIDM"
     gene            complement(<382014..>382631)
                     /locus_tag="OSTLU_93629"
                     /db_xref="GeneID:5005196"
     mRNA            complement(<382014..>382631)
                     /locus_tag="OSTLU_93629"
                     /product="predicted protein"
                     /transcript_id="XM_001421096.1"
                     /db_xref="GeneID:5005196"
     CDS             complement(382014..382631)
                     /locus_tag="OSTLU_93629"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421133.1"
                     /db_xref="GeneID:5005196"
                     /db_xref="JGIDB:Ost9901_3_93629"
                     /translation="MSHSPWHRLNATLTLAVAIFAVLVACASVTDVFHACAPTSSMPF
                     MSRSPIVRVVDYERFARVADSRDEAVVRLEVDYDLSSCASWNTKMVFAHVTVSWETET
                     RGVNEATIWDDAVKFDRWESAESKAKKLRKQGVIRAKYKLRSVDERLSGRGMEVKLRW
                     AVTPRAGRIWRGETSTSNATFPVEYLNVGGDGQRARAAPRTPGMP"
     gene            complement(<382844..>383338)
                     /locus_tag="OSTLU_7370"
                     /db_xref="GeneID:5004990"
     mRNA            complement(<382844..>383338)
                     /locus_tag="OSTLU_7370"
                     /product="predicted protein"
                     /transcript_id="XM_001421097.1"
                     /db_xref="GeneID:5004990"
     CDS             complement(<382844..>383338)
                     /locus_tag="OSTLU_7370"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421134.1"
                     /db_xref="GeneID:5004990"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="JGIDB:Ost9901_3_7370"
                     /translation="DRANAQGLLTVCNHVSTFDDPGMLSALIPWSVFVGEPRRGGVRW
                     TLCTDEICAKTKLRESFFLCGKALAIKRGGGVEQPAMRTAANLLLRGDWVHLFPEGRV
                     SRDGELGTMRRGVAKLLCDVEIAGGTPPMVLPFWHSGMSDVKPYGRWEIGVGKRVHVT
                     VGEPL"
     gene            complement(<383838..>384530)
                     /locus_tag="OSTLU_13210"
                     /db_xref="GeneID:5004991"
     mRNA            complement(<383838..>384530)
                     /locus_tag="OSTLU_13210"
                     /product="predicted protein"
                     /transcript_id="XM_001421098.1"
                     /db_xref="GeneID:5004991"
     CDS             complement(383838..384530)
                     /locus_tag="OSTLU_13210"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421135.1"
                     /db_xref="GeneID:5004991"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Ost9901_3_13210"
                     /translation="MLGHRSRAGTLAWNSHTLSSGSRDRAILNRDIRSPSDYSSKLLG
                     HKSEVCGLKWSYDDQQLASGGNDNQLFVWNSHSTSPILRCSEHTAAVKAIAWSPHQHG
                     LLASGGGTADRCIRFWNTVTNTPLQCVDTGSQVCNLVWSKNVNEIVSTHGYSQNQIVV
                     WRYPSMSKLTTLTGHTLRVLFLAISPDGQTIVTGAGDETLRFWNVFPGMKSPVSGAGD
                     NTVSTLARTSIR"
     gene            complement(<384672..>385571)
                     /locus_tag="OSTLU_17898"
                     /db_xref="GeneID:5004992"
     mRNA            complement(<384672..>385571)
                     /locus_tag="OSTLU_17898"
                     /product="predicted protein"
                     /transcript_id="XM_001421099.1"
                     /db_xref="GeneID:5004992"
     CDS             complement(<384672..385571)
                     /locus_tag="OSTLU_17898"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421136.1"
                     /db_xref="GeneID:5004992"
                     /db_xref="JGIDB:Ost9901_3_17898"
                     /translation="MANGGHRGVDVARRLIFEDSTRRGTGARDGSAPGTPEREGRASA
                     GRGASAGRANAGYSDRYVPSRSASAGFRGDFSMLEACASVGVGATGGGRGEEIGGASG
                     GGGGRIGRDGRGDADRGREGDANRDADSAGAHRGDGGSARAHEREDTSAAYGALLRSE
                     LLGDVCPPEAYGVTPPATPSAARYRPRTPATPIDGSSYSYSTPGRNLFKFRDDGSFGT
                     IARGESPYALNPVGDGDGPLGMTLLSPRRRAPRKIARSPFKVLDAPALQDDFYLNLVD
                     WSSSNVLAVGLGTCVYLWSACTSK"
     gene            <387133..>387681
                     /locus_tag="OSTLU_7923"
                     /db_xref="GeneID:5004993"
     mRNA            <387133..>387681
                     /locus_tag="OSTLU_7923"
                     /product="predicted protein"
                     /transcript_id="XM_001420952.1"
                     /db_xref="GeneID:5004993"
     CDS             <387133..>387681
                     /locus_tag="OSTLU_7923"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420989.1"
                     /db_xref="GeneID:5004993"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="JGIDB:Ost9901_3_7923"
                     /translation="EKAVPYTVFVKDVPASVSERELADVFASCGRIIDCRMCGDANTH
                     KFSYAFVAFECAEAVDRALLLDKTPLHGKNIMVKKSDTAVIPVNPLLLPQNEREVESC
                     ARTIYVANVDKTVDSHALKLLFEDRAGPVNRLHLQVKNNAVANVAFVEFVDLESVGTA
                     LHLTGEQLGNRMIRVSASKTPLR"
     gene            complement(<388602..>393227)
                     /locus_tag="OSTLU_17900"
                     /db_xref="GeneID:5005197"
     mRNA            complement(join(<388602..389895,390181..>393227))
                     /locus_tag="OSTLU_17900"
                     /product="predicted protein"
                     /transcript_id="XM_001421100.1"
                     /db_xref="GeneID:5005197"
     CDS             complement(join(388602..389895,390181..393227))
                     /locus_tag="OSTLU_17900"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421137.1"
                     /db_xref="GeneID:5005197"
                     /db_xref="JGIDB:Ost9901_3_17900"
                     /translation="MDSTRCATCRAVVRGGAATCAECGAPQGYDSDSDATIRVDDDDD
                     DDDSSHYARDARDSSASDADSSTSASSTTRRRREVESREREMEESPEALKLLYMLSLY
                     TDASQKQSKSKSAVSNNNNNKRSPWIRELPLLVLVYEGIVRNAVFDYDYAPKSEKIFG
                     ACPRYLNVSEEGRDDLDDLRELGFITALKVTSETYDHSTLLKISKKGSEFLQRMTASG
                     RFTSAMRQSVDSLVHEAGHLLEVRYDRESSDFFLTVPSIGVRIRSTITDVEDVPYVSS
                     PYIPPHMLSSDAFTPNALNGHKKAKRVLGGAVQSSRDIRDPRLSESILLDSVKIIVTE
                     YVPMGSNEMVSFCRKLGTGDRVAGGMFTAEASATQDEFNMVVGINADNKTELKVLDVD
                     ETRFVNVEADLLATGAPKSNLVQQQIEVFGINFRENGAITYGIVVNGIADRIRNDISV
                     DLLARLLSDVHEDTSSLVGNLFSERQRSMLNITYKGEPDNRDKFTCIIAERATPKLKA
                     AAYMDGEDNENELKQVIGATFYAYDLNEQEVIVFGSRGVVVFGPRTERHHKLLATYSA
                     FQARSLFIKSVFSSCFALNDELKKTRALIETYQIDPTNVTRIRSRLADHTTTVTILSA
                     TQQFVLESLENVDTSREKLSADMSDGASQVLYDLFQLEPSWKRLQRRAVDLEKVIAAC
                     VNDLESLREMNAVIGSRRKLRINEAIEGTTKNLEDAFRAQARNSTTLEVTQVILSGTL
                     AFDILDRFTGQYLSFTEIRWAVEAVQPYIVNVPAVWFILNMLAWSALGGGIVYLMRYL
                     AYMHCSVETKKLTLNKPIHLSRWRRFIATRNVESTAFKEENNRRVVKYGWTEPIDVKK
                     WKGTPPKINVTIDERYGFILQAMIIINKRTCTLSGDAVWRQFWSDVFVARNVHDQSRE
                     LFDTDTGDRLQTAEYSSEEEDETRRDVTAKIIGIDNRKSTLKWRDGRQILAQDDTDDD
                     IDSDEEAIAKTGDLTFEGFVASRSLKLAREEEKAKKKRAARMENLKLDVSRPSRATQC
                     EFYVVGTSHASAAAAADVRRVIRRAKPQAVVLELDQERADALVASFVERARVIDDSEY
                     GSDLLTGIIESEREDALTVYGDVRARGIGEALAARAFGTNPFAIERWKTVLAYVKNAW
                     DGGSVGVSSDGALAAADVARALMDEPRNLTPLAGPAAAFVAATLASLAMPNGAENGLV
                     DAVGVFLALLLFCPLVETLWMERDEVLCANALNAVDVCSGIARGRVRRVRFGFSTDPS
                     ATKKSMQTFTPSDAGAVPCFTLKRPLKRGETRRLNLWEPRWLALMDSLAEANGGSLVG
                     AELGCLLGRARHYVSSSCFEILGDAARRTGTVAVEDSMRRARVTRVVEGERPTTKARK
                     LEVWIEGMDECDVHALETHPAGYLLASASVEASQAPRIDEDDDEVVTCVIVTGLAHAN
                     GIVRGIAEAQ"
     gene            complement(<393841..>394338)
                     /locus_tag="OSTLU_27212"
                     /db_xref="GeneID:5004994"
     mRNA            complement(<393841..>394338)
                     /locus_tag="OSTLU_27212"
                     /product="predicted protein"
                     /transcript_id="XM_001421101.1"
                     /db_xref="GeneID:5004994"
     CDS             complement(393841..394338)
                     /locus_tag="OSTLU_27212"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421138.1"
                     /db_xref="GeneID:5004994"
                     /db_xref="JGIDB:Ost9901_3_27212"
                     /translation="MPSGCVYEMFSDNAKCNKTYIGSTTGSLRARLASHKYARHPIFT
                     FGDADVRVLEKDIPAGELHQRKGAYMREKRDGLFNSRAAGRSQKHACRENVDESPAYS
                     RAQYTPKRDGGDGNYRQLNYYKQHAKGILRKTCLKNARARGTLPSKRSLDKYQFTVDE
                     LRGLA"
     gene            <394583..>394948
                     /locus_tag="OSTLU_93633"
                     /db_xref="GeneID:5004995"
     mRNA            <394583..>394948
                     /locus_tag="OSTLU_93633"
                     /product="predicted protein"
                     /transcript_id="XM_001420953.1"
                     /db_xref="GeneID:5004995"
     CDS             <394583..394948
                     /locus_tag="OSTLU_93633"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420990.1"
                     /db_xref="GeneID:5004995"
                     /db_xref="JGIDB:Ost9901_3_93633"
                     /translation="VCTNDENDEMLKYFNVYFYFRSMTSNSVDLYENSSSFVISSGSK
                     PWSFWCLVESSYCKCTNYKISMSTRRPPARAPSPLCTHCPSATRSTRRGEFPNRRPSR
                     LYLASGGPLPLGPCGPFPS"
     gene            complement(<395284..>396777)
                     /locus_tag="OSTLU_10119"
                     /db_xref="GeneID:5005198"
     mRNA            complement(join(<395284..395706,395833..395905,
                     396029..>396777))
                     /locus_tag="OSTLU_10119"
                     /product="predicted protein"
                     /transcript_id="XM_001421102.1"
                     /db_xref="GeneID:5005198"
     CDS             complement(join(<395284..395706,395833..395905,
                     396029..>396777))
                     /locus_tag="OSTLU_10119"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421139.1"
                     /db_xref="GeneID:5005198"
                     /db_xref="InterPro:IPR003495"
                     /db_xref="JGIDB:Ost9901_3_10119"
                     /translation="RLPVTTLCGFLGAGKTTTLKRVLEAKRDANGKFRCAVVVNDVAE
                     LNIDKKLIDDSALLQSDEVVAMQNGCVCCSLSGDFVKQIGDMAKSGNFDYMIVEASGV
                     SEPAEIAKLFANCEDDHDHEAAHVDEHEHLSTLARLDTCVTVIAAGDFLDMIDSFRAS
                     AVNRQSYSQLLAEQIEYANVVVLNKVDTVDDEQLAEIKAQIQLLNSRADILEAVNGAI
                     DVTRIVNTKLYKENDFAGFITWEQEIEATSVNRFGITSFIYRARRPFHPKRFLGSFRR
                     KREGEIGVLLRSKGVTWLSDAHDLIIVFSQAGNIYSLEGSSRWTALNKNAWVGSQGIK
                     QELRKDWEGPYGDRRQELVFIGKDLKYDEIQSTLDSCLLTDEEFEMGSDGWRAVMGDV
                     FLDEDDEDEDDEVDDEDDEEIDE"
     gene            <397369..398900
                     /locus_tag="OSTLU_25431"
                     /db_xref="GeneID:5004996"
     mRNA            <397369..398900
                     /locus_tag="OSTLU_25431"
                     /product="ZIP family transporter: zinc ion"
                     /transcript_id="XM_001420954.1"
                     /db_xref="GeneID:5004996"
     CDS             397369..398802
                     /locus_tag="OSTLU_25431"
                     /codon_start=1
                     /product="ZIP family transporter: zinc ion"
                     /protein_id="XP_001420991.1"
                     /db_xref="GeneID:5004996"
                     /db_xref="InterPro:IPR003689"
                     /db_xref="JGIDB:Ost9901_3_25431"
                     /translation="MRCASALGGGIAIVASALAQRGAHASGAHAFEWAGIFETPENEY
                     VWQAQKVADKYAADTMKMVIYDEIAAGHDELEAREDSGDTAIGGACTTAKIRDSVLTP
                     DSGCVNLEFDNTWHTTPFKINTTGIDAISIFAEHVPTEFERDAHYLKDLHGDDVVPKA
                     SLPEASTVSESKSKPWANAIGAAIIVNIVTLSGVVFLIPSIAKKQKAYPETVSCTINS
                     FAAGALLSAAFYLMFYEATHLIKPAGSDEAEQTAWWASASIFGFLMAYFIDFGISVVF
                     PTLGNTAKTTDAELAVKGAQDDCDTCTCNSHKYRVRSGIILGDFMHNLVDGIFIGFGF
                     LNCDSTMGWSITAATVYHEIAQELADYLVLVDPFQGDLAPLPTLTLNFVSGLSVILGV
                     LISVGSGNNNDFWHGLLLAFGAGVYLQIAAAECMPRVSVSATSPRLRATSILTFIVGV
                     VAISLVLLNHKHCTGGGGGGDSHAHAH"
     gene            complement(<399771..>400943)
                     /locus_tag="OSTLU_93634"
                     /db_xref="GeneID:5005199"
     mRNA            complement(<399771..>400943)
                     /locus_tag="OSTLU_93634"
                     /product="predicted protein"
                     /transcript_id="XM_001421103.1"
                     /db_xref="GeneID:5005199"
     CDS             complement(399771..400943)
                     /locus_tag="OSTLU_93634"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421140.1"
                     /db_xref="GeneID:5005199"
                     /db_xref="InterPro:IPR003347"
                     /db_xref="JGIDB:Ost9901_3_93634"
                     /translation="MTLFDEEIARLDVERADLAARAARETDDGRRAYVDAIVARVERA
                     RATLAAAAAADSGVEKPTTTGRDVARVHARDLTPRRFRLEYVATDTPVVIEGLGSALT
                     EDGADGETCAWLTRRAGNKKVAVTRKDGHRRATLSCEVTDVLDLKDFFAEVVDDRGAG
                     SYLYDTSIPLKLPSLSESVRVPAYVAHDYMQRTMRLTAFSRSWPSLFVAAKNTRSSLH
                     VDQWQGHFFMAVVRGTKRWTVFSRESLAFLRPSWSRGTLDPAMPPLEEQEEMGMLPLP
                     REFGARRWDVDLGPGEVLFVPGGSPHAVRNLDCTVAFAGNFVDDVNLDRVLEDLKLMA
                     AKDPALMESYRALDEVDFDDEGAALAAGDDDVHAGAFDANARVVRVADYLAGGRLV"
     gene            complement(<401110..>401961)
                     /locus_tag="OSTLU_5140"
                     /db_xref="GeneID:5004997"
     mRNA            complement(<401110..>401961)
                     /locus_tag="OSTLU_5140"
                     /product="MC family transporter: deoxynucleotide"
                     /transcript_id="XM_001421104.1"
                     /db_xref="GeneID:5004997"
     CDS             complement(<401110..>401961)
                     /locus_tag="OSTLU_5140"
                     /codon_start=1
                     /product="MC family transporter: deoxynucleotide"
                     /protein_id="XP_001421141.1"
                     /db_xref="GeneID:5004997"
                     /db_xref="InterPro:IPR001993"
                     /db_xref="JGIDB:Ost9901_3_5140"
                     /translation="VTTTAGALAGATARVCVAPLDVIKIRLQVQVERGASGKYRGLAD
                     ATRTILREEGGRAMWAGTVPALLLWVPYTAIQFTVLNKFKEAARERERAKPGSTAGLP
                     VSFIGGAAAGSVATVATYPFDVIRTLLASQGHPKVYNNVFDAALGVVRERGVAKGLYA
                     GVSVTLAEIVPASAVQFGSYAALKSNLPEVFGENDFACGFAAGTIARLVIHPLDVVKK
                     RFQVAGFSRSLAYGQRVDAGAYKSFFAAVRTIARSEGVGGFYKGLMPSLIKSAPASAI
                     TFSVFEAA"
     gene            403083..>404570
                     /locus_tag="OSTLU_47300"
                     /db_xref="GeneID:5004998"
     mRNA            403083..>404570
                     /locus_tag="OSTLU_47300"
                     /product="predicted protein"
                     /transcript_id="XM_001420955.1"
                     /db_xref="GeneID:5004998"
     CDS             403086..>404570
                     /locus_tag="OSTLU_47300"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420992.1"
                     /db_xref="GeneID:5004998"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Ost9901_3_47300"
                     /translation="MPVASGDIREIAGQPVFVPLYKLFLAYGEMFVLAIGPKKFVVVS
                     DNAVAKEMLLTQAKSFSKGLLSEILDFVMGQGLIPANGEVWKIRRKVIVPSLHKKYVT
                     SMVDMFGDCGLKGMSQLARAEKANESVEMENFYSRFALDIIGKAVFNYDFDSLSTDDP
                     VIKAVYTVLREAEYRSVTFIPYWKVPPLRWLVPRQRQCQEALQVVNDTLDDLINRCKA
                     VVEEEDEEFVEEYMNTDDPSILHFLIASGDDVTSKQLRDDLMTLLIAGHETTAAVLTW
                     TTFLLAKHPEVKAKVFEEVDRVVGDRNPTVADMRALVYTTRVINESMRLYPQPPVLIR
                     RALEPVTLGGYNIDAGTDFFISVWNLHRNPRIWDEPDAFKPERFPIDAPMPNEYTEEY
                     AYLPFGGGQRKCVGDQFAIFESIVSLAMLMRRFDFELDESKHPDGECGMTTGATIHTT
                     NGLHVKLKRRDGRGGREMDGTYVTGMALSNLEDVDVVRGSIDAPT"
     gene            complement(<404846..>406000)
                     /locus_tag="OSTLU_27219"
                     /db_xref="GeneID:5005200"
     mRNA            complement(<404846..>406000)
                     /locus_tag="OSTLU_27219"
                     /product="predicted protein"
                     /transcript_id="XM_001421105.1"
                     /db_xref="GeneID:5005200"
     CDS             complement(404846..406000)
                     /locus_tag="OSTLU_27219"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421142.1"
                     /db_xref="GeneID:5005200"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="JGIDB:Ost9901_3_27219"
                     /translation="MDATRREVASERAYALSARFAARVAWCCQEGCYPHKDHHVNQDA
                     CATWEGREMAHEEAVIDGEGNDAVARRETGRVLVGVFDGHGKHGEECAQIARATFAET
                     LARETRGGAALRDGYARTFEAVNAVVCKEMGENASFSGSTAITALFDDEGVVRVGNVG
                     DSRCVVGVERAAGVAVGNRHTRRWEVRDLTHDQTCFRADERARMKAEATSPMTFATIG
                     MVLGETEAHEDFGDGEPGSDEEYCDDPPRVFMAGYRFPGCAFTRSIGDTVGKSLGVSA
                     TPEMSEFDLNAEPSTRCVVVASDGVFEFMSSAETMAIAEKFYEENMPGAAERAAHAIV
                     RAAFSRWQEHDERADDITAVVTFIYPLDSDTSTATVVVNDMDDALNKLLL"
     gene            <406481..>408018
                     /locus_tag="OSTLU_27220"
                     /db_xref="GeneID:5004999"
     mRNA            join(<406481..406501,406777..>408018)
                     /locus_tag="OSTLU_27220"
                     /product="predicted protein"
                     /transcript_id="XM_001420956.1"
                     /db_xref="GeneID:5004999"
     CDS             join(406481..406501,406777..408018)
                     /locus_tag="OSTLU_27220"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420993.1"
                     /db_xref="GeneID:5004999"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="JGIDB:Ost9901_3_27220"
                     /translation="MRDLTSTIAARLDAHLTLPLLEFALAEGTHDAKSLREAKLATLV
                     KTKMCDWAEEARAEASGSGSAAEAKARRDATVEAHAALGKAAARAVKFASDGALIKNL
                     RRDKAANAKFAEDNHGVTSADVDALYKFAKFEYECGDYENASEHLGAVQLLSADNERC
                     ESALWGKFAADILLRNWGGALDDMNRLRDALESNASTSNLVKMKQRAWLLHYALFVFF
                     NHPNGRNLIIDVLFQERYMQAVQQEAPHLLRYLAVAIVANKKRRNMLKDLVKIIQSDV
                     YDDPALDFVVAAFVDYDFSKTQEMLKKCDAMIEKDFFLIGCKDAFDENARQYVIENYC
                     KVNKRIDIANLAQMLGMPAADVEATIATLIRGSKLNARIDSEAGFVHVHVEKKSVNEQ
                     IIEKTKALLSKTTALTQAVLANTQAQAY"
     gene            <408098..>408475
                     /locus_tag="OSTLU_27221"
                     /db_xref="GeneID:5005201"
     mRNA            <408098..>408475
                     /locus_tag="OSTLU_27221"
                     /product="predicted protein"
                     /transcript_id="XM_001420957.1"
                     /db_xref="GeneID:5005201"
     CDS             408098..408475
                     /locus_tag="OSTLU_27221"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420994.1"
                     /db_xref="GeneID:5005201"
                     /db_xref="JGIDB:Ost9901_3_27221"
                     /translation="MSPPLRRLARLVPRVADARAFASGAGKDVVRRDSSDVASSSSSS
                     DANPWRPVVDRETRRVYFWNPRTGETSAVGAPRPATEFLADDPGASAREGIGTQIGSA
                     FAMGAGASLGFAAVAVAARIAFG"
     gene            complement(409083..>410016)
                     /locus_tag="OSTLU_27222"
                     /db_xref="GeneID:5005202"
     mRNA            complement(409083..>410016)
                     /locus_tag="OSTLU_27222"
                     /product="predicted protein"
                     /transcript_id="XM_001421106.1"
                     /db_xref="GeneID:5005202"
     CDS             complement(409579..410016)
                     /locus_tag="OSTLU_27222"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421143.1"
                     /db_xref="GeneID:5005202"
                     /db_xref="JGIDB:Ost9901_3_27222"
                     /translation="MRVARADVATTSEDAATTATTSIDAAKPPSTATRRRELDKAEKK
                     ARRMAEIDAFLRAREVAAAREDASRDDADGDASNGAARRRENEKKKKPTAAADGVAAA
                     ADGARVSREWFAAFAVVAFFAVVGGAYSLYSFVARVASRAFAS"
     gene            <410488..>411348
                     /locus_tag="OSTLU_5777"
                     /db_xref="GeneID:5005000"
     mRNA            <410488..>411348
                     /locus_tag="OSTLU_5777"
                     /product="predicted protein"
                     /transcript_id="XM_001420958.1"
                     /db_xref="GeneID:5005000"
     CDS             <410488..>411348
                     /locus_tag="OSTLU_5777"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420995.1"
                     /db_xref="GeneID:5005000"
                     /db_xref="InterPro:IPR004044"
                     /db_xref="JGIDB:Ost9901_3_5777"
                     /translation="VGVLGAPNAGKSALACALVGDAVSAVSRKTNTTRTRALGVRTVG
                     DAQVVFVDAPGIVGREHYRNAAHARKVEDATALASECDALVFVVDAARQLERRDLRVL
                     EAVRKTRAALGEMRAPPEAVLVLNKVDKIPKERRAGLTKMVDDFRAAGDFEFARVFPV
                     SALTGAGTRALMDHIVAGAREAPWEFDATSTSDMTPAQRALEIVRESVYDGVHEDLPY
                     GIDIAHVSWEDFRNGDARIEQNILVDTASQRKIVVGKSGEVVGRIGINARAMLERALN
                     RKVHLILNVRL"
     gene            complement(<411543..>412484)
                     /locus_tag="OSTLU_89011"
                     /db_xref="GeneID:5005203"
     mRNA            complement(<411543..>412484)
                     /locus_tag="OSTLU_89011"
                     /product="MC family transporter"
                     /transcript_id="XM_001421107.1"
                     /db_xref="GeneID:5005203"
     CDS             complement(411543..412484)
                     /locus_tag="OSTLU_89011"
                     /codon_start=1
                     /product="MC family transporter"
                     /protein_id="XP_001421144.1"
                     /db_xref="GeneID:5005203"
                     /db_xref="InterPro:IPR001993"
                     /db_xref="JGIDB:Ost9901_3_89011"
                     /translation="MPPPSRVPADADRARARRETRRDASSSATDRPPSFARSLRVGIA
                     SGACAGIACQLVLFPLNTLKTRAQAGGRLTADRLYGGVAAELLGAAPGTALFMSAYEC
                     AKSTLGLDPSIAAMLGALASSAVLAPMELIARRMQVSRLSLATAARLSARRGELFAGF
                     GSFLARELPFDTIQMSAFEAMKRATLAIEGAAADESGKKTKKKRALGKRQTAIIGGVA
                     GGLTGLVTTPFDVSRTAHVCASSMGIDLKTHPKGLAGLKRLKERFGMSFFFRGAAPRA
                     LEIGLGGVIYFTVIETTRRYFESSSRETKDAKVLKTV"
     gene            complement(412655..>415317)
                     /locus_tag="OSTLU_19807"
                     /db_xref="GeneID:5005001"
     mRNA            complement(join(412655..414137,414184..>415317))
                     /locus_tag="OSTLU_19807"
                     /product="predicted protein"
                     /transcript_id="XM_001421108.1"
                     /db_xref="GeneID:5005001"
     CDS             complement(join(412662..414137,414184..415317))
                     /locus_tag="OSTLU_19807"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421145.1"
                     /db_xref="GeneID:5005001"
                     /db_xref="InterPro:IPR001930"
                     /db_xref="JGIDB:Ost9901_3_19807"
                     /translation="MTTATETPTEAPKTIYLKDYERPAYAFERVNLDFELGEATTTVT
                     STIRVRPANDANGKSLFLNGDESVELAAIEVDGAKFTTYERTGKGITLRALPTEAFDL
                     RVTTTIKPQENTALEGLYKSSGNFCTQCEAEGFRRITFYQDRPDVMSIFTTRITADKT
                     KYPVLLGNGNLVDSGDLEGGKHFTVWEDPWAKPCYLFALVAGDLGMVEDKFKTMTGKE
                     VTLRIFTETHNLDKCAHAMTSLIKSMKWDEDTYGLEYDLELFNIVAVDDFNMGAMENK
                     SLNIFNSRLVLATPQSATDADYAAIEGVVAHEYFHNYTGNRVTCRDWFQLSLKEGLTV
                     YRDQEFSADMNSRGVKRIGDVSRLRMAQFAQDAGPMAHRIRPGIGAEVVRMYETLLGK
                     DGFRKGMDLYFERHDGQAVTTEDFFAAMCDANGADLSTFKPWYSQAGTPRVTANGSYD
                     AAAKTFTLECSQVVPKTPGQDSKVPVLCPIAVGLVGPDGADMNLTIDGKSHGTTAVLR
                     FDQASATYTFTGVDAKPVPSILRNFSAPVRLTTNLTQDDLLFLMANDSDAFNRWEAGQ
                     TLLRNLCLDLIKGGEQSFKMNDAITAAMRTILSGAKAADADKAFIARAMMVPSEGELS
                     DMLEEGTVDPAAVHAARDFVMKTLATELRAELEATAQANSAAVYSNEPADRAARSLKN
                     ACIGYLSYLDAPEIAAMTYERYVAADNMTDKIAALSALSGKDCDERIKAIDAFYAEWS
                     HDPLVMNKWLSIQAASSLPNNLANVRALAAGSAFDIKNPNKVYSLIGGFCASPTNFHA
                     IDGSGYEFLADIVLELDDLNGQVASRMVSAFTRWRKFEPTRASAMKAQLERIAAKTGL
                     SENVFEIVSKSLE"
     gene            <415789..>417147
                     /locus_tag="OSTLU_27227"
                     /db_xref="GeneID:5005002"
     mRNA            <415789..>417147
                     /locus_tag="OSTLU_27227"
                     /product="predicted protein"
                     /transcript_id="XM_001420959.1"
                     /db_xref="GeneID:5005002"
     CDS             415789..417147
                     /locus_tag="OSTLU_27227"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420996.1"
                     /db_xref="GeneID:5005002"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="JGIDB:Ost9901_3_27227"
                     /translation="MDAVRRAGDADASTSATVRDGEVFSKNLYFEHPSTTARSARATE
                     DAMRARGVRVVRGADVPKIVTTFEEASFPAYVMDDLKERGLATPTPCQCQAWPIALSG
                     RDLIAVAETGSGKTLAYVLPAIVHVNAQPVLEKGEGPIALVLAPTRELASQIELEVAK
                     FAASSEIKHACVTGGVPKGPQIKALKSGGSEICVATPGRLIDFLDGGQTNLRRTSFVV
                     LDEADRMLDMGFEPQIRRIIAQTRCDRQTLLFTATWPVEVREVAREFIRNDPVEMRVG
                     GAGDGLLASKNVEQIVHIVEDAEAKYAKLMDILEEEMDGSSILVFVETKALVDQLTRR
                     LRSEGWPALGLHGDKEQKERDWVLEEFRAARSPIMISTDVASRGLDVVGVKLVVNHDF
                     PKSVEEYVHRIGRTGRAGRKGKSHTFFSILRDGKHARELAHVLRASNQSIPRALEGVV
                     AD"
     gene            <417254..>417937
                     /locus_tag="OSTLU_13214"
                     /db_xref="GeneID:5005204"
     mRNA            <417254..>417937
                     /locus_tag="OSTLU_13214"
                     /product="predicted protein"
                     /transcript_id="XM_001420960.1"
                     /db_xref="GeneID:5005204"
     CDS             417254..417937
                     /locus_tag="OSTLU_13214"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420997.1"
                     /db_xref="GeneID:5005204"
                     /db_xref="InterPro:IPR007482"
                     /db_xref="JGIDB:Ost9901_3_13214"
                     /translation="MSLAKTYLASYNAALVAGWSYVLILAFAALRTAGPSAVYAAVER
                     PLALAQTAAVLEIAHAACGIARSPVLVTAMQVSSRLMVVWGVLHLAPVSRTASLDVVG
                     PLKIGVPSLMLAWGVTEVVRYSFYFFKLVRGDVPRAVTWCRYTLFIVLYPLGVSSELF
                     LAYSGFKYLVKTNPLAYEMPNAVNFAFHLPTAMLMFFAGYAPGFPMLYGYMLGQRKKV
                     LGAAKSKRD"
     gene            complement(<418047..>419078)
                     /locus_tag="OSTLU_27229"
                     /db_xref="GeneID:5005205"
     mRNA            complement(<418047..>419078)
                     /locus_tag="OSTLU_27229"
                     /product="predicted protein"
                     /transcript_id="XM_001421109.1"
                     /db_xref="GeneID:5005205"
     CDS             complement(418047..419078)
                     /locus_tag="OSTLU_27229"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421146.1"
                     /db_xref="GeneID:5005205"
                     /db_xref="JGIDB:Ost9901_3_27229"
                     /translation="MASLVRAMVNGTAVVNATKVQELLNDVDAAMDWKNDPLRYLWAT
                     ASAVSTFMWFGFAGDNLQYYRMNGGLAYAGGATNRSVWAESFGKSGVFLLAYRACATA
                     ACAYYEVREKIAPRLTVNAETEMYGLDMSYFLNLHDWTVHSVTLFFFFATLASLAGMC
                     SRTATHDHYLGHSGRCNTLGHWVMALYTIAFTMSVSFLVIVLFEAAFAPQCVPSSARG
                     KLTTFLDPASRLCYLEPQYMIGYLGNVLLLLIEASLGRLVFPKCYMSQPIFYASTFFI
                     IGQFNVMVLNGDWAYQWTNYWRRETVVYLNAFLCLVMFTHLVLVKFLRANSNSKLAKN
                     VEERVPLFM"
     gene            <419283..>419810
                     /gene="FBP16-2_13"
                     /locus_tag="OSTLU_41512"
                     /db_xref="GeneID:5005003"
     mRNA            <419283..>419810
                     /gene="FBP16-2_13"
                     /locus_tag="OSTLU_41512"
                     /product="peptidyl-prolyl cis-trans isomerase, FKBP-type"
                     /transcript_id="XM_001420961.1"
                     /db_xref="GeneID:5005003"
     CDS             419283..419810
                     /gene="FBP16-2_13"
                     /locus_tag="OSTLU_41512"
                     /note="FKBP-type peptidyl-prolyl isomerase, possibly
                     targetted to thylakoid lumen (TAT pathway)"
                     /codon_start=1
                     /product="peptidyl-prolyl cis-trans isomerase, FKBP-type"
                     /protein_id="XP_001420998.1"
                     /db_xref="GeneID:5005003"
                     /db_xref="InterPro:IPR001179"
                     /db_xref="JGIDB:Ost9901_3_41512"
                     /translation="MFASTLSRAAVVAAARAPDADASIASRRAAVAAGALAVALAPRG
                     ARARGLPTLECANELVVGARGLAFCDAVVGDGATPTASSVIKAHYVGRLESGRAFDSS
                     YERGAPLQFKPSQVIQGWGLGICGDGDAIPAMRVGGKRRLVIPPELGYGARGAGGAIP
                     PNATLYFDVELVAVA"
     gene            420007..>420243
                     /locus_tag="OSTLU_27231"
                     /db_xref="GeneID:5005206"
     mRNA            420007..>420243
                     /locus_tag="OSTLU_27231"
                     /product="predicted protein"
                     /transcript_id="XM_001420962.1"
                     /db_xref="GeneID:5005206"
     CDS             420088..420243
                     /locus_tag="OSTLU_27231"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001420999.1"
                     /db_xref="GeneID:5005206"
                     /db_xref="JGIDB:Ost9901_3_27231"
                     /translation="MYAVGATDKLQGTGVWSFIKAERDSGANKAANKTKRPEQKKKTP
                     QRFPGGK"
     gene            complement(420566..>424031)
                     /locus_tag="OSTLU_27232"
                     /db_xref="GeneID:5005207"
     mRNA            complement(420566..>424031)
                     /locus_tag="OSTLU_27232"
                     /product="predicted protein"
                     /transcript_id="XM_001421110.1"
                     /db_xref="GeneID:5005207"
     CDS             complement(420579..424031)
                     /locus_tag="OSTLU_27232"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421147.1"
                     /db_xref="GeneID:5005207"
                     /db_xref="JGIDB:Ost9901_3_27232"
                     /translation="MDTNWTPATPARARADARIASDKVLSTKAFEDARVKDHRDVERE
                     RGVYLPPSAEEAATHADSAQPRLLSEDGKLEKLKYFDSEVDLGLEFGAGVSGYFFVLR
                     AFACLFFAAFALNLPAMFINYTSTYYASHYEAEPETATAPTADALSGRPTTSFHSWFV
                     DWHWANPMSASLGTVAPDDVPQRAWVLAGTTSGVLRWSSSKIDFIRFSVVMDVVVSLI
                     IILSVPVIMLVLMRTERRVERGTATLKDYTVLVTGLPSDATDEEVRCFFALRFGTVAD
                     VVLVKTECMQINAQRRRRRLLEDYDEAEAALIAAGNRGGDGTKTAIENEILAVDRKLK
                     RRRARTRAKQCSAFITFETEGSKIDCILRNTRSIMSYIFAFPRKERFRGKRKYRVRDA
                     PEPEDVRFENLNLSNRSWRRLVVLFSCSAVVLLCYGFLKMLVDDKEKLWENADMMVTT
                     LADDVGIVVAHGNPVEQFETHKNQFRTACRARLDQCGVAFSKDKTYVGMPWGAPIYAF
                     YDYPNATLLDRRYAQQDAVRDLTNCAQDTNRCPGGPTMQNCHACYCASLKYGLTSEVV
                     RAYNKAIRHSCAKYVNLGPGEYYNWLWVSFCITLMNVLLEWIVPLLVAAERLRTRSAT
                     KVLKTKIIFWVRYLNVAVIYGLLNANFYHIGRYFPLIKQMFGLKGEYADFTSEWFNDV
                     GLVLFFAIMMSVTIRILARVLVDIITHVGRKFSVAYCHTQAKLNKAFEGPSFDTGAKC
                     GDVCFTIMAAMTFSSGMPLIYLVLSMYFVLVYLYDYRLLLKVCKLPERSKSTLPMTAA
                     KVLFISVSIHALIGLWMFSYHWTPDLAKPTKDFEHSSKNNAPPLAYEIGGEILNPPHD
                     NGALTAIVQSTGVATTYFHQYRDATVGALSAGDFVAPPPRVQLRFAERPFSEAGMPFM
                     GMFFALLGVMGLWQIAVAWHNWGKSRRDIARSWKNLPQYHEAIMTGLIVGSETYRPEY
                     QPDYAFLFDKSTVAAAKMKLGSYAGGPVRGDSVNSRDAWSLGQGDDDDIAELIHHRYD
                     NEREYDGGAPWVRKTGSKIYGGDAATAKRGSRGTRQRDGGHYGVPVVDVRALGVGSDY
                     NHVENNAFGHSDAFVADDHEWDSASDADTLDDDASTQRSQSFSDYENDDQRFDGARRP
                     AWLD"
     gene            complement(<424423..426062)
                     /locus_tag="OSTLU_27233"
                     /db_xref="GeneID:5005004"
     mRNA            complement(<424423..426062)
                     /locus_tag="OSTLU_27233"
                     /product="predicted protein"
                     /transcript_id="XM_001421111.1"
                     /db_xref="GeneID:5005004"
     CDS             complement(424423..426033)
                     /locus_tag="OSTLU_27233"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421148.1"
                     /db_xref="GeneID:5005004"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="InterPro:IPR006652"
                     /db_xref="InterPro:IPR011498"
                     /db_xref="JGIDB:Ost9901_3_27233"
                     /translation="MGGGRDKRKKVAKKLGKVSADKRTGATKTALKREKNAEKNHRRL
                     ERGLVEDDIDAILAAMAIEDARRAEVEVEKDCPRPQARGHASLTATVVGRGNELILYG
                     GERVTPGDEKCVVYGDLYRYDVDRDRWTKVSNAKGPHPRSGHQALAYGGYVYVFGGEF
                     TSPNQERFLHHRDCWRFDLESNIWEAMPAKGGPSARSGHRMAIWGKKAILFGGFYDTG
                     REVRYYNDAWEYDFEKSEWKCRCAGGEGALGPSPRSACHVGVHDDAFIVYGGYCKNVD
                     NDGDADEDRSERGTTFSDAWKLDLKTWRWEKLKRQGLAPSARAGASSAMHALKKRLVL
                     FGGVVDHEVKRGDVIVSEFFTDAYNLNMEAKKWFPVTLYGEDKTKTHKAGSLEEAERV
                     AAGDVVNENFNIRSEAHRAAIKIQAHFRGYQVRKAYKLYKVGGVVSELLYSPGSGEAP
                     PKSLPKPRGRINAAIAIKANSMYLFGGVVELGDVEVSLDDVWKLDLGNRPKWTCITPL
                     SDEVSAQLAGGGAESDSDSDDGSGSDSA"
     gene            <426133..>427000
                     /locus_tag="OSTLU_27234"
                     /db_xref="GeneID:5005005"
     mRNA            join(<426133..426231,426356..>427000)
                     /locus_tag="OSTLU_27234"
                     /product="predicted protein"
                     /transcript_id="XM_001420963.1"
                     /db_xref="GeneID:5005005"
     CDS             join(426133..426231,426356..427000)
                     /locus_tag="OSTLU_27234"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421000.1"
                     /db_xref="GeneID:5005005"
                     /db_xref="InterPro:IPR007599"
                     /db_xref="JGIDB:Ost9901_3_27234"
                     /translation="MANTLEEWYASVPTVTRMYLTLTFAVTVGCALELISPLNVYFNS
                     KLIFQEYELWRLVTNFFFFGSLGVDFVFHMFFLSRYCRMLEEGSFQGRSCDFFYMLLF
                     GGTLLTAFAPFVNVQFLGTSLTFMMVYVWGRRNAATQMSFLGLFNFTAPYLPWVLLIF
                     STLIGSQPITDALGMIAGHAYYFLKDVYPEMTGREPLKTPAIVCALFGTRQRLVDTDG
                     VQTRAARRARRDAGAAVEGAAGAPRDLNE"
     gene            complement(<427138..>430304)
                     /locus_tag="OSTLU_278"
                     /db_xref="GeneID:5005208"
     mRNA            complement(join(<427138..428109,428209..430095,
                     430251..>430304))
                     /locus_tag="OSTLU_278"
                     /product="predicted protein"
                     /transcript_id="XM_001421112.1"
                     /db_xref="GeneID:5005208"
     CDS             complement(join(<427138..428109,428209..430095,
                     430251..>430304))
                     /locus_tag="OSTLU_278"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421149.1"
                     /db_xref="GeneID:5005208"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR008152"
                     /db_xref="JGIDB:Ost9901_3_278"
                     /translation="GMRGLTVFVQDVRNCSNKEQERARVEKELANIRRKFNKTHRALT
                     AYERKKYVLKLLYIYMLGYNVDFGHTEALKLISASSYAEKQVGYMTTSVILNERNEFL
                     RMAINSIRTDVISSNETNQCLGLSCIANVGGREFADSLAGDVETIVMTPTIRPVVRKK
                     AALCLLRLFRKNPEILLAETFASKMTDLLDAERDLGVLMGVLGLLLGLVQHDYRGYEA
                     CVPKVIALLERLTRNKDIPPEYLYYGIPSPWLQVKCMKILQYFPTPDDQALLDSQLIA
                     MRNILTKTDTVKNFNKNNALHAILFEAINLVTSMDYAHELLDPCVEILGNFLDMKEPN
                     IRYLALNTLNALAAMADLREAIKVYQEQVVAALHDADISIRRRALTLLFSMCDASNVH
                     SVIEELIKYFVTADFDIREELALKTAILAERYSVNDRMWFIEIAMQMIDKAGDFINDD
                     LWHRMVQIATNDASLHGRTAQLMFVKLRDEGASNELMLRAMSYCIGEFGYLLPIPASQ
                     YVDLLVPLFQDTDEVTQGIMLTAFVKVAMHKNCDQASMGKIVKVFTDMSSSFDVELQQ
                     RANEYLKLLRLGPNMRPILEPMPEYPERSSVLEKHIQVENVASDVAAGVRKLAMSGVV
                     TAREQPRAQARSAPALPAAAAPPLLGNAPPALPAVEERLALPSSTSPPAGPVTTTSSA
                     DALDDLLGLGALAATQPPPATHGDALDAFGALGAPAPAAPAPTQPVAPVQSLTSSDGI
                     QPTVNVQDCAKRFLIADNGLLYEDANVQIGVKSQWQGSQGRVMFYVGNKSASADLQNF
                     RMVIPSIEGLRHSLQPFPASIGPKRQVQLMLQVAITSAFASAPKLEFSYTSTAVAAAC
                     ARSLELPVRVTKFLSPMTIASPQEFIAKWHQMASAGQQQKIMDVSQQYATSIESVSNA
                     FSGMRLVVHKGLDPNPANLIAGSRFVGERCGEVFVGVRVESDANVRGRYRFTVASMD"
     gene            <430543..>433110
                     /locus_tag="OSTLU_17916"
                     /db_xref="GeneID:5005006"
     mRNA            <430543..>433110
                     /locus_tag="OSTLU_17916"
                     /product="predicted protein"
                     /transcript_id="XM_001420964.1"
                     /db_xref="GeneID:5005006"
     CDS             430543..433110
                     /locus_tag="OSTLU_17916"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421001.1"
                     /db_xref="GeneID:5005006"
                     /db_xref="JGIDB:Ost9901_3_17916"
                     /translation="MPRSSRAKRRRGVAATALARALIAASWSCVVALRPGASMSIDCV
                     TPEVGPAVGGTLVTLAGEGYGGSADAACAFDDAVVAPTSKGTQSGHATMVCLSPRHAD
                     DRGGFVSVGLTLRRANRAATTAPMNENGETFNFAKQMSVTNAYPTDAPEIGGEVFYLQ
                     GKHLHEAVSVRWTKPVTHVGVDVVSSALIRCETPPLTSGEISSMVIATFTASQSEYDA
                     NALAATTANQTVSIPPRSRGVLGFVLETNDFSLTSATSSVNVTGGTPVLVTGNGFSTV
                     GGEDDGDFLSCFFGTIGPIDARVTASKTATCYSPARAAAASVPLRLGIGNGRFVLTTT
                     VNVAFTETTRQTTDPLEPAEEAQSLVVMNPTLDVASGATPFDVVLGGNFFVRGSGFSF
                     DYDDGCVCTYPDASTSRLVYVSSAIARCLDTPTWTSGEVKISCSADANAVVRSVYVAP
                     VAVPTITSVDVLTITHQGGVALQVTGTSYPDEGESRAYSGCHFGAVGPVHARYMSGTV
                     AECVTPALKPSQSALMLGFGATESVDLVQYGLTIPVTAETTSAYVAPPLWLTPATTYL
                     AAATAKIIVGDHQQLGTLSVGTLKCVFGSGNLNATVGTYVAPSVHCPTPALLSPGFVV
                     VRLARDAAAASLDPPAILLVKEDHAVTGAHPRQTWGPVDVISITGSNLISTHVEGTID
                     SAKSLCVFGGGAGVSGGVVVSSALIMCESPLAESTGVVERWVTPCFEECDSTKALPTG
                     STASASHTRVALTSMAQSYMSAVDAASGWTFGGTPVRATLSIAVASEMLTCHFGSTRV
                     QARPAGVAVVETVASAQGENIEIDCVSPARERGSVTVYATLAQSRAPLLSGVAFLYK"
     gene            <433324..>433955
                     /locus_tag="OSTLU_27237"
                     /db_xref="GeneID:5005209"
     mRNA            join(<433324..433433,433541..>433955)
                     /locus_tag="OSTLU_27237"
                     /product="predicted protein"
                     /transcript_id="XM_001420965.1"
                     /db_xref="GeneID:5005209"
     CDS             join(433324..433433,433541..433955)
                     /locus_tag="OSTLU_27237"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421002.1"
                     /db_xref="GeneID:5005209"
                     /db_xref="JGIDB:Ost9901_3_27237"
                     /translation="MPASSKFQLLTEPEPTAAELVDVIDAFYDALPPIASSGESDPGV
                     VFAGYGEPLLRHDVLCDALREIRARRHGIATRVATNGLVDVAVCDALRDAGLRSVTVN
                     FASADPDEYARIMAPRDGRTQGDALAFIERCSELGMEVEATTTRTPGVDIARARELTM
                     ALGASAFREREYFP"
     gene            complement(<434008..>436857)
                     /locus_tag="OSTLU_27238"
                     /db_xref="GeneID:5005210"
     mRNA            complement(<434008..>436857)
                     /locus_tag="OSTLU_27238"
                     /product="predicted protein"
                     /transcript_id="XM_001421113.1"
                     /db_xref="GeneID:5005210"
     CDS             complement(434008..436857)
                     /locus_tag="OSTLU_27238"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421150.1"
                     /db_xref="GeneID:5005210"
                     /db_xref="JGIDB:Ost9901_3_27238"
                     /translation="MRVDAAHTARPRRVHFLVDARATRERASATQSASTSGADFKSST
                     WKTFARRALERAVDGRAGEDVEFTVRACDGSVPPHAFDARAREATGRRGDEFGKFRRC
                     DKNAVEDAFRTCETTCGEYLETFTSGGDVAASDEDGRGAIESWLVNATRNVGAATNDF
                     AAAGGGFAATFADDDDEGEKYSALFIITALPELSEAEAAKVDAKHVAKLFKGIEEKFK
                     RDRVRAHLLYVGDGPTGAFADVLQETFHKLNGAVISLDVASRLASWLPLYSTLSALSR
                     GDEASASTTTVESTSTVDIIVETRDSQSAHRLGEAHQARYHGRGDGSIAIVGFIDRAE
                     APSAAALAVETQTILCFDDSPIRALMAMLVLKDAVAVVRRDAGRHEQIAILEPLTCSS
                     FIVTSLKTTPGELCPRASAAKASARSEIVKLASRRDCLASLENVHVLLAKIREDVREK
                     IVSPPATQDSLALTQQVLSMDAATQSSSAPLMPVDVNTLEEAFIADQRIGVQQDASRL
                     EAWYGSRDLVPKTREMLRRVEDKATKSSDTAGELLNNLDERFKDMLKRHNGIVSPPRK
                     SRARRSLASTLTVFAMDADVPPWTGDVEQAALEEYESFVATFSALEGGDGLNEPNLHD
                     FAAKIIYRFRLSVGSNEDDNLVERLERAIAKNSKELKAKYVGVHSSKAAKRLEFILQM
                     HVALQLASLKVTQVRDENGADACEAVEERAISKKEQKKLVKSVQKLVDEIHFLLQPCG
                     VEGVRSLMAAELTPHYSGFIPDTLRVLQRDLGLTMEPDAGGDASAVALTPFSPVPALR
                     RSPRKPKAPERLAPAEPAPKLKIKAKPHEGWHHLARGRNNTKEVKVSVKDLKKPTFAH
                     PRPQTFRGVTRHSALQGGATPAPSGNRALSTPAIVKCTPMGGTTPAPMRGGPRAIVAA
                     TPVGGAMSTPLANRAPVRKLADDFTPAKRSRLHNT"
     gene            complement(<437026..>438156)
                     /locus_tag="OSTLU_41776"
                     /db_xref="GeneID:5005007"
     mRNA            complement(<437026..>438156)
                     /locus_tag="OSTLU_41776"
                     /product="predicted protein"
                     /transcript_id="XM_001421114.1"
                     /db_xref="GeneID:5005007"
     CDS             complement(437026..438156)
                     /locus_tag="OSTLU_41776"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421151.1"
                     /db_xref="GeneID:5005007"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="JGIDB:Ost9901_3_41776"
                     /translation="MGAVGYATIRVRRGHLLEDGIAGLSDKLTETLGGIIRVQFINQQ
                     GLEEAGVDGGGLFKDFLNDLIAEAFDPKFGLFVETPERTLYPNPASELHAGERHLQYF
                     YFLGAILGKACYDGILLDVPLADFFLASLKGRHVEFNDLTTLDPELYRNLVSLKRYQG
                     DVEDLCLYFTAIDRSGMEETVIELIPNGSSVPVTRANVPRYLHCMSIYLLRAQIYRQL
                     SSMKAGFSIAVRKRWLDMFTPAELRLLISGNRTGSMDIDDMAANCEYSGGYEASHPTI
                     RALWRVMRTISPDDQRLVLKFITSCSNTPLLGFSHLEPKLCVHRSGTAGTDAPDATAD
                     LTRLPTAATCMNLLKLPPYSSDDALREKLMYAVKSGSGFDLS"
     gene            complement(<438467..>440124)
                     /locus_tag="OSTLU_17919"
                     /db_xref="GeneID:5005008"
     mRNA            complement(<438467..>440124)
                     /locus_tag="OSTLU_17919"
                     /product="predicted protein"
                     /transcript_id="XM_001421115.1"
                     /db_xref="GeneID:5005008"
     CDS             complement(<438467..440124)
                     /locus_tag="OSTLU_17919"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421152.1"
                     /db_xref="GeneID:5005008"
                     /db_xref="JGIDB:Ost9901_3_17919"
                     /translation="MAPVFDGSTTKKRHISLGGRRKDEPSTQRALIESAREARERRAA
                     QRATATATATAQRFRRGAREVRRAKAAVREAYANASEGVMVDDASCRALVYFGDGWRD
                     WAACAAACERLYAAATTTTSVAPSEAFVERWDDAMRASGVERARWVIRMRKMVRLIVG
                     SLRATTRLEETTGRDVAETHLASALLALMARDDARWKDTGVQLCATLCSNDGLEDVRE
                     ILLDILRNQSRRDDVVRAAMLRTCENIARCSGDDASGALASMLATIPGVWDTFGPEIH
                     SRDLWSFVVDAFKSDRHVDSVATVALETPLSGVDAALGNVLQLTKTFIGTMDFSQSQN
                     VVVAVTKLMESSVLSGALFATTPNAMEDEDDDEGGADDDDDDDDSVKIDLLNLRAVRA
                     EARKIRRVPPDVDMEAVRATRTWMQTREFFGDNACVARLVTTIMPANDAQRCLVGIEG
                     FTHFACACDMVLRGAERASFTRVLTFGTDCIAQLWPALEHWRQTSGGGQERSFRRALG
                     VFAKLYNTYTAISDDEEFYRLGKPLGLEATTRLVAFLRDTLWTLL"
     gene            <440803..>444141
                     /locus_tag="OSTLU_25439"
                     /db_xref="GeneID:5005009"
     mRNA            <440803..>444141
                     /locus_tag="OSTLU_25439"
                     /product="predicted protein"
                     /transcript_id="XM_001420966.1"
                     /db_xref="GeneID:5005009"
     CDS             440803..444141
                     /locus_tag="OSTLU_25439"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421003.1"
                     /db_xref="GeneID:5005009"
                     /db_xref="InterPro:IPR001930"
                     /db_xref="JGIDB:Ost9901_3_25439"
                     /translation="MDGIRRAPGVECRATKTKTSKPTIGTKTAPSDALSLAKDVRTYL
                     ESESNLDGEEHSREVVIAPVSGEKIEARARGAANGESTSATTEKEIVIEIEYETDESA
                     MGIAADESYFLCPGASRRPACWFPCVERGDVLTTFDFSVSAPRDLQVITSAHWDRVER
                     CNDIDEDEDGFRLRHHFTGMYPTFAHEMRLICGRFKAVSSPIKGVTLFAPKDGDYAER
                     LEIAAAGVSKAIVAYEEYLGHPYPISCLNIVFMPDEYVGARDSLGACMNIHSAKWLID
                     PTLNTALLDARVHIATAIARQWFGGVVVPADTTDCWVVEGLAQYLAGAYVKKLTGLNE
                     LSFRRMRDMQLTARMDDGESLPPLASRAARIWRAGQYAGPDLAAGGTPKPLSASVERG
                     LQAKAVTIIYMLEKRLGPDVMQKVLKYFAGLHVRRNKKEGGTRAGPSAEVLSSNARWI
                     HTLQLFDHCRATVNLGKGEVNSFLERWVYGAGTPKLCVGYVVKRRKNVMEFAVKLEGS
                     VAAAAADRAALAVARNHRTSVTVRMREENRPDANDHVVSLGHSAWQLMEIPLQPKIKD
                     RRPKTIIESGGDPELIAAMDCPVRYVRVDPEFEWMGNIEQSAKQVGLESMMAQMLEKE
                     KDIVAQTIAVEFLGRRVANGSVSAVLVLDKCLNSEDTFCRVRAEAALALGKSASEKTQ
                     WGGLNALIRHYKKFQCDANTGKPKQNDFRDLAKVIVDEAVITALGYVMDNGITHQDAL
                     EAIVARLKYNDNEGNPQSDDGFVATCIAALGRCVPADGKQLQTVMQTIHYYIRRDDRF
                     PSDDLCVTCAGIRALGLLASTIDSKELRADAEHVAKLGFALGRQSTVLASADTMMYLR
                     FVETKSEIEALKYMLERSAQESAATKAAMLWSACEYLQSVAGADSLKGVSKPILADLR
                     DLVLKGGSEIASAAFSILATLASQDESLSEIRESIAEAIRRAGDQVPVGVDVHAAHAA
                     PTAEDEVKRAEKEAKRARKRERERLRQAARAEVDLKNAEQRRIDAEAAFVEQQAEHVQ
                     DDKTTVSERTATMMGSEGDATPQGGTPVGGLKRARDQNPSVTQFAVEPAAPVATEDAA
                     PAATEDAAPAKKLKLSFKIKKPTT"
     gene            complement(<444195..>444641)
                     /locus_tag="OSTLU_27241"
                     /db_xref="GeneID:5005211"
     mRNA            complement(<444195..>444641)
                     /locus_tag="OSTLU_27241"
                     /product="predicted protein"
                     /transcript_id="XM_001421116.1"
                     /db_xref="GeneID:5005211"
     CDS             complement(444195..444641)
                     /locus_tag="OSTLU_27241"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421153.1"
                     /db_xref="GeneID:5005211"
                     /db_xref="JGIDB:Ost9901_3_27241"
                     /translation="MVAAIARPNAACAALAAACALATRDGKRRADLRRALMRGEGGGE
                     NETEETAPVMEFTAKDATVLMERAAKAAERAASVAEWRSRTVSAATMYAAMALSGVSA
                     FVRADVMMCAIALYATRPARLRVIPDPINACWSRLPSLWKDQSKIQ"
     gene            complement(445068..>450981)
                     /locus_tag="OSTLU_25440"
                     /db_xref="GeneID:5005010"
     mRNA            complement(join(445068..446410,446678..>450981))
                     /locus_tag="OSTLU_25440"
                     /product="predicted protein"
                     /transcript_id="XM_001421117.1"
                     /db_xref="GeneID:5005010"
     CDS             complement(join(445198..446410,446678..450981))
                     /locus_tag="OSTLU_25440"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421154.1"
                     /db_xref="GeneID:5005010"
                     /db_xref="JGIDB:Ost9901_3_25440"
                     /translation="MTTDASAGRREVMRALRRAAASRARAVDGETLRRAFDALTRDDG
                     ERRGARASCEECVEVAKSAMWDEGNAALMSAALAAAAAAANAQPNKPAPACVDFEFLW
                     SVVETWSRAGEGDARRGAKEACDATMRAFVLHPMYARAIPNLVADAASAKKQKTIAST
                     DDARGAGGARSSAPGFICDTIARVARAAESMDVDALRLAPWVLRATCEQDANERKPTA
                     SSSANKSSESVSKDARALFVELFEPIAAAFVAVPTGGKGERRVDEDAASALVDALVGL
                     LDIAVDFTIYSPLEDEGRVESALQAFVTSIATVVKTNEVRDRGWSRVIGALSTLDLRL
                     VEPHVKVMLTLLLVKSRDAREECVAVTQTMIKAFAEMRQLPEFMESVGEVVIEAMANG
                     EKVNDALASEEVLVAFQDAAKTVPLRQTPDLMVICRKAFITAYDGDEKPSGARAPYDS
                     LDKLARVLQSALGTCPIDAGEPLLPEAQACLEGFSEDIAQRLHSHVESSPARTGALLR
                     AYVPVASLRQGLSEVADATARDSYFRSESVDLSAIVRHLVRDSPRANQEHENAESAAI
                     GCAIQRVNNLSRLRYPREDVSPEESAKAGSEIKSLLSACLKLVPDTLTTSYDAPDSKT
                     EAWKVLTSTIDLWYEQATDARILDYYRCRLETDIEGEGALSTEEEDKFSELVATFKPW
                     VRAIASVITRGAVDLTRELKESLSRDDDSSAAGRCDVLEDIIADCVENKRQGEAACDK
                     IKDFWIGPASTPITDGFGKNCTREDSAALKRMRRAVDAAERLHYRAVSETDVHELSIA
                     LQIGDCAMFNAASLGMSSAMDLCTRVRSRSAFLATHDEDSAMIVSGLITRGGHYLNVT
                     NLALRNMLDVELASRLIESTTSAFQASLVGSALKVKAAVYTNAATNVARLLDDRFINE
                     DSIERNVANVGGAFALSLVESLFAAANVVHTEPEREKYGWVDGNPDLDEEDELTDEQG
                     DAIAQFWDAPAVMQVRARIESMILDMKNGLENGEFKPVAESVEVVASCVSAAGFILAV
                     SATTLDYSEAFHRTCDADFVQNAIAVAIKVLLDTSNELSSRGTSRLVNFIGAACDALK
                     QTGPQLTSEAHASLVAVLMFTYTRGTRALVDRDGAKSATPAADLHESLSLTMSELVYG
                     AGKRPLTAMYDACVDAFKTTDAESRRAYLSSDRLDVSLAAPMWCLMNLVKSFHLGKAI
                     RTAAQENVETVMDACMRAMTVAIRVPNANAVVHKLLEITTEFARLGPRCEISTRCVSR
                     MCQLPSVACASDAVFDDGDAMTKIFCQACELIGVLLKSRKDHLRRAVSGITVACSDLL
                     AALRRFKASGASAAVMESCAGKLSFVYESAEASGLDRYCTHLLADAITAITGGGIGVV
                     AESALKPGLFALLDSSGDRELQQLHAALGAGAGGARRVVFAALREEHKHTHKFTGRVA
                     LFFAGTTLLAMGAIVGRSADAARASALGEGAGGTCALSPTGAGANAAANTCAARYMDE
                     LGLWDAADAGDNVEFETKVYECMNEPTGAPVVVPQDGVAKPFATKPGSAYAWIFVHIP
                     KAAGSVFIEMLKQNKNHETVVLHEPAHPDFLVNPWRPLNSLQARHVPTMLRTFKQNRE
                     SKSGTFSKEFMHADYDEGRRMYFTGATGIGMCGTVDAPCAYITVLREPMSRLWSEYTY
                     LCLEANEGHLSWTAEEIAADNHQGCPLNPLEWYNQKRSTAAQLTGLLGARGGHTPCGA
                     EAAKANLASSCVRYIFQDDIENGMKRIREKLPDLAHLGDDGGNKQYISGALLEHHNGS
                     AEKLAPALAARLDAYKADPTIVAGLRALVEHDISVYEFAKAKYDEHWSAPLVSC"
     gene            <451494..>452339
                     /locus_tag="OSTLU_93639"
                     /db_xref="GeneID:5005011"
     mRNA            <451494..>452339
                     /locus_tag="OSTLU_93639"
                     /product="predicted protein"
                     /transcript_id="XM_001420967.1"
                     /db_xref="GeneID:5005011"
     CDS             451494..452339
                     /locus_tag="OSTLU_93639"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421004.1"
                     /db_xref="GeneID:5005011"
                     /db_xref="JGIDB:Ost9901_3_93639"
                     /translation="MASTWRRNRLSFREKFVDACDVDGVVVRQYASSEAFVKATGTTG
                     TTGTTTRDDDDDDDDDDAVPATGFTVWDASVLLGKYVGRERTWRRLTKKAREDARGPT
                     TLELGAGTGLATLLVAAARGSAEGEAGMVCAMTDLKRVVPLTRMNARANKAESGGRIP
                     ASVAMATTTLRWGRAEDVERLPEAIRRPDVVLGADLMYTSDEGVIRALAATTMALVGP
                     GRAAVFAACKEHRPESVELFASIIEANGFEVTRVPASEAHPDYPASNEEFELLECWRP
                     RPRAD"
     gene            complement(<452358..>453734)
                     /locus_tag="OSTLU_27245"
                     /db_xref="GeneID:5005212"
     mRNA            complement(<452358..>453734)
                     /locus_tag="OSTLU_27245"
                     /product="predicted protein"
                     /transcript_id="XM_001421118.1"
                     /db_xref="GeneID:5005212"
     CDS             complement(452358..453734)
                     /locus_tag="OSTLU_27245"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421155.1"
                     /db_xref="GeneID:5005212"
                     /db_xref="InterPro:IPR000407"
                     /db_xref="JGIDB:Ost9901_3_27245"
                     /translation="MRTLGTKEKTRLPLAEMGGRVREELMPAVRAALAKIPDRVERAR
                     TPVYVWATAGFRVLTPAKQQALWREVREAVEAETGTRHGYGHFRTVDGAEEGFYAWLA
                     ANYLSDVDVTAVGRLNDANTPAPAFARVSEDDNPLLKSVGAIDVGGGSVQYVALPREG
                     KGAFVKSMLELRNAVKVESFLGYGANHMETRWRGALAAAKTTRNACAFPGHVVTVDGV
                     ELTGTGEYRQCVVGLRKQIASMQREQKVTLRMPDDFKRVERFLGMSLLFHLTNFITVA
                     LPGALPSMPKATLAEIATAGEKLCAIEWAKLVKDVDGKDPNTPADRLNGRCFDAALVQ
                     ALLGVDFAEDDIAAGEVGLGFSQNDERLNFIERIDDAEVEWTLGAAMSVVHPTAARSN
                     SAWAKTRVPTECARVLHTSFLNALYEWGVIIMPAALVATGYLLYKTLRMTANVATMAR
                     SPSYLEVL"
     gene            <454187..>455089
                     /locus_tag="OSTLU_51291"
                     /db_xref="GeneID:5005012"
     mRNA            <454187..>455089
                     /locus_tag="OSTLU_51291"
                     /product="predicted protein"
                     /transcript_id="XM_001420968.1"
                     /db_xref="GeneID:5005012"
     CDS             454187..455089
                     /locus_tag="OSTLU_51291"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421005.1"
                     /db_xref="GeneID:5005012"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="JGIDB:Ost9901_3_51291"
                     /translation="MTRIPTINLARDGSARGLTDAFASDDFARRGFAFVAHEGALPEP
                     EIVRKCFAESRTFFDSSDETRKRALTGDAPGIGYTAFASEKLDPSSSSVGDSKEGFYV
                     VRERAKNRWPSAAFEDAATTYYESMYALGKRLLPALARACGVNDAYFDAHWSASSHNC
                     VLRFLKYSASRSDEGEGQFACGAHTDYGALTILAVENDGSTGLEIYDRETETWVPVTP
                     PPDHFVLNVGDLLERWSNGRFASTRHRVMTTGERERFSIPFFFEPSYDAVIEPVCVGD
                     GEAAKYAPIRFGDYLQEKYAQTYE"
     gene            complement(455138..>457413)
                     /gene="PPR3_13"
                     /locus_tag="OSTLU_25441"
                     /db_xref="GeneID:5005213"
     mRNA            complement(455138..>457413)
                     /gene="PPR3_13"
                     /locus_tag="OSTLU_25441"
                     /product="pentatrichopeptide repeat (PPR) protein"
                     /note="Has EST support"
                     /transcript_id="XM_001421119.1"
                     /db_xref="GeneID:5005213"
     CDS             complement(455194..457413)
                     /gene="PPR3_13"
                     /locus_tag="OSTLU_25441"
                     /note="PPR protein, possibly chloroplast-located"
                     /codon_start=1
                     /product="pentatrichopeptide repeat (PPR) protein"
                     /protein_id="XP_001421156.1"
                     /db_xref="GeneID:5005213"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="JGIDB:Ost9901_3_25441"
                     /translation="MKTTPNCAPNIRSYNGVISAATRKKHFPGAMWAWEEIETANLQP
                     TMITYGAMLAAGAAADDVDVRWSEDLFAQALESGACGNAGNDHMVTSMLQTYARGVAL
                     EQIERDVAMERGESVVQALIEDAQWDERRAESTPNGRVWSALITLCARCGRAARAIEV
                     LKIMISTRSHRVGHEWLHLTYALTSALEASKEGIEYFARVQREIEQSPAMVRDCTGVR
                     NGLIATHLHFGDFKSAFKVYDDFKNDIFKYRKAHEENWNARARRGLERQLPDTITYNS
                     LIYACADDDVKAMGLYHDMVSNGINPTVRTYVALIVALSRSKRGSKVTEAEKIFKAAI
                     DDGVTPNEFLFTALMDAQVKGNRPLSAFETYARMIEADVNCTTVTFGCALQACCYVED
                     VEESVERAYSVLRDMTERDVQMNDWCSNTFLRVISRAGRIEEMLEEVKKTVRRKGKLE
                     QETLEAIIRALCSAGYVERANRFISMMNSRNLEPREQTFKEFIVASSRDGFVDWAWES
                     YKRFTRLGHKLDAGTRSALVTVLSVASTSPDPDDAELLLARAIGVFEAAFKRADEDNG
                     PQVLDVIDAEARCALIVAMARSEKLDRALDIWRDSPKAQSFSKARKHTSSEGNDYIGD
                     VRAMYECLIEVCCHEDRIDDALEVFDHLKDAGVRVSTVTLAFLESSCRRCRVEEWRMF
                     DVCAQMRAQVEQKNEGRLAKPTKMSHHVRDDGNIASELATDGLGGEQKTSAWRKNVD"
     gene            458516..461070
                     /locus_tag="OSTLU_27248"
                     /db_xref="GeneID:5004928"
     mRNA            458516..461070
                     /locus_tag="OSTLU_27248"
                     /product="predicted protein"
                     /transcript_id="XM_001420969.1"
                     /db_xref="GeneID:5004928"
     CDS             458950..460992
                     /locus_tag="OSTLU_27248"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421006.1"
                     /db_xref="GeneID:5004928"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="JGIDB:Ost9901_3_27248"
                     /translation="MLAKRRRATKSELEPLCEALSQTFTFSELDANVRRRVASEMFFI
                     NVPEGTILMEEDEPGDALYLIAGGEFDVLQNRLGADISVLTRTKGDIIGELALLYSVP
                     RSATVRAKTRSQVWVCTQQVFKREVKHSVEATTLAKNLFLEQVPVLSALPIDTRKSFA
                     DALETVSFDPYTDVITEGEACDGKFYLVNSGRAQVSKLDPDTGEPRTVNHLFRHDFFG
                     ASEIIRGDEPREYTVRCVETPLVCYVVNRDVFLEKLSSVREDLLREKSREVIRNRMRQ
                     LKGEKSWRSARIRLLGSARVGGKKVNISMYGSVNPRSFATDVNRELGSIDLVEKEMLG
                     GGTGGHVYRVIQEGMNVSSPRAFALKRVRKRAVMESPSHIFCEKEVTSEISHFSLMCQ
                     HASFQDRNHLYMLFDIMDGCDLMDMLASAVQVKLIPTQIDGEIRHVPTQIGISEDTAR
                     YYTAMVILAFEYLHGNQIIYRDLKPENVLLALNGKCKLGDFGYAKKLDVGERAFTFCG
                     TPGYVAPEIVLSTGYGYAVDWWALGVLTYVTITGQQPFTISKDPSQKDDPLKVMRRIV
                     DMSYEVQYPTYATDEACNFISQLLQRNSAKRLGNMQGGVSQIKRHPWFAKFDWALLES
                     GEYTPKPLTLSRQFLEIQRERLIEIERESLLATEMDSARGPTDASMNRANEIFKDF"
     gene            complement(<461078..>464414)
                     /gene="CHR3524"
                     /locus_tag="OSTLU_27249"
                     /db_xref="GeneID:5005214"
     mRNA            complement(join(<461078..464185,464262..>464414))
                     /gene="CHR3524"
                     /locus_tag="OSTLU_27249"
                     /product="predicted protein"
                     /transcript_id="XM_001421120.1"
                     /db_xref="GeneID:5005214"
     CDS             complement(join(461078..464185,464262..464414))
                     /gene="CHR3524"
                     /locus_tag="OSTLU_27249"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421157.1"
                     /db_xref="GeneID:5005214"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001510"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="JGIDB:Ost9901_3_27249"
                     /translation="MVELTIVPSWDGKGVTWRPIFDDDEEAFAAYTHACEYAKSGRGK
                     CGKCGEKIAKDAVRIGEPLKYRGGDYGWISKWMHPECYRAEGVTREELETRVHGLDAL
                     KDGDREVLLATVLSPDRPEIENTALDVTSEEFLRRPAVEPMEAPRALTRPLLGFQREG
                     LRWMCDNESGDAKGGILADEMGMGKTIQCISMLLARKEAWMRDRAEVGEMVTDDDRPP
                     PTLVVVPTSALVQWEEEIKSCVEEGSLRVFVYYADRANVVEGDFKGYDVVLTTYPVVE
                     AEWRKIINRHLTACQWCGKKYLPRSMVTHLKYFCGPDAVRTEKLARREVTRDVANEKA
                     MRTLKIKPGSAKDVKKGIPTMANVYKELMAMAGRETLSMYDGAHKARARAASGLAPGG
                     DVVVVKEEVEDGVAEPSEVLKALISQLPVPTIVVENIKEESIEEKEKEVESVNEPALA
                     DASTAAIASTVKKAQKRKSKASGKATSTSSAKKKKKSLREASDGEAESDYKPDSDSED
                     DEIILVDDSESEDRKPKKKQKKKKTPAKTEEADDVKASNIDDIPQTSQGGSQGGSQFE
                     DEDDVDLSDSLLHRTQWHRIVLDEAHKIKARTSNTAKCIYALKSTYKWCLTGTPLQNR
                     IGDLYSLVRFLRMDPYAFYFCSTKGCECKTLTWNFGPQARFCTNCGCGAPRHYSHFNR
                     TVLNPINRYGYIGDGKKAMLTLRNDILLPMQLRRTKAERAEDVRLPDLKIIIQENTFN
                     EVEQDFYESLYMLTRSKFDAFVKKGSVLHNYAHVFELLARLRQACDHPYLVIHSKSAN
                     VKKDAPDAPKVESPADTDVPKHYCGMCQDEIEEEDAALANCKHIFHRECIMQYASCAP
                     ADGKKVTCPVCRTALTIDFSPESLENVKSAISRNFKDALPDKSILNKLDLTQYTSSTK
                     VETLVNALRDMRNQENGHLNKAIVFSQYTAMIEIVEWRLKKAKFTIAKLLGSMPVTQR
                     AANLQAFREDPNVSVILMSLKSGGEGLNLQAANYVYVLEPWWNPAVEMQAVMRAHRIG
                     QLRPVTAVRFSTKGTIEERMMELQEKKQLVFEGCMDGNQAALSQLTAEDLQFLFKR"
     gene            <464522..>466585
                     /locus_tag="OSTLU_93641"
                     /db_xref="GeneID:5004929"
     mRNA            <464522..>466585
                     /locus_tag="OSTLU_93641"
                     /product="predicted protein"
                     /transcript_id="XM_001420970.1"
                     /db_xref="GeneID:5004929"
     CDS             464522..466585
                     /locus_tag="OSTLU_93641"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421007.1"
                     /db_xref="GeneID:5004929"
                     /db_xref="JGIDB:Ost9901_3_93641"
                     /translation="MTAKRKILIRTTKSARFRTRARIDARRAFKTRSIDATPRDRRTR
                     PARPPSRRARARRRSRNTRAREARTRAAPRRTRRTRRRARARPRPKTRGRARAPRTRR
                     DTRRGFERRRRIRETRRRVSPPVPKSRIEPEWPACTPLARSSTSPANLADSCNPASRS
                     SIAREARRRRASRRRRRVRAAAPRVARARARSGPTKTARSPPCARPRPPRAGSRAPRA
                     PARAPARARARAARRVASSMSSSSSGRRARRRRDAASDAPARRGRRARARAPSSRACR
                     PRFVVESTNDARARAFSHAFIRARSNTPRRAFESRAMTASTPASASSSSVADDVERLR
                     RIARDAAEKTHDVSRRLRIAESALDDLRGARANARVATETAIEINVARGSNDASEAMK
                     SDARRTMRATRETRATFGDAGAEGEATVRFASARADYLANEDEYEARVVTLEKVTFAR
                     TVRETANGVRVRARATPFGAEGVDACPGGVGGARRSHRLTGFGALGSNLIERCEQDSM
                     GAVSVEYKDRFAAHLGVFTGNRQPEDNMGKVLAQASAKSSTSTRHVNFAVNASRCQSG
                     EAILGVALTVAKTLPKTTRAVVGNAWGQVAVRQPNAREDLTEWGIAASVPPTKGAGLV
                     KNAGWGIVAGKPANRGGVQAEAFLRIGSDGEEPGSTLIPGVVISTDDRGHRQTTLACR
                     AHLLW"
     gene            complement(<466678..>467523)
                     /locus_tag="OSTLU_27252"
                     /db_xref="GeneID:5005215"
     mRNA            complement(<466678..>467523)
                     /locus_tag="OSTLU_27252"
                     /product="predicted protein"
                     /transcript_id="XM_001421121.1"
                     /db_xref="GeneID:5005215"
     CDS             complement(466678..467523)
                     /locus_tag="OSTLU_27252"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421158.1"
                     /db_xref="GeneID:5005215"
                     /db_xref="JGIDB:Ost9901_3_27252"
                     /translation="MSAYELERLERIEANKRRMAQLGVLEHAKSLARDAQKKRKKTNF
                     SNAFERTSNEENKGSAAPVRASRRVRNEEPEAFDPNDASRDLFEVRYNEEVYEARHAE
                     ALGSAAEPWTLFEDGYDDKGRRIYDPVNGQCCHQCRQKTKGLRTSCAGCEMMRGVYCG
                     DCLYMRQGLNIREVIARGDAWRCPSCLDICNCSFCRTKKGYPPTGTMYRRSLAMGYDS
                     VAHYLVLTGQKDEAARARYEAEAAVKAEAYAKREAEAEALRESDENAPDRKPHWLKEK
                     VIASE"
     gene            <468564..>469256
                     /locus_tag="OSTLU_27253"
                     /db_xref="GeneID:5004930"
     mRNA            <468564..>469256
                     /locus_tag="OSTLU_27253"
                     /product="predicted protein"
                     /transcript_id="XM_001420971.1"
                     /db_xref="GeneID:5004930"
     CDS             468564..469256
                     /locus_tag="OSTLU_27253"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421008.1"
                     /db_xref="GeneID:5004930"
                     /db_xref="JGIDB:Ost9901_3_27253"
                     /translation="MVFDGRRTVSAAAAKAKARDASAASASPSGRLIDTKKARKAFMS
                     AEAGKVLNDDVVRAARERDKDAEDGGEARFGKFSALREEVQAFGARGLAKWDRQALET
                     KRLVELGMKPKKGPRIPPTIGVGLAKANEKRAETARQEAFAAGYKLEKKAAKKSSDAA
                     RDRGLAWGSSTFSTSNGVMKVNKRDMVNHDKLVDTKAMLRGEGRRPQMKSSGKKTKKK
                     GKAVKAGRKSKR"
     gene            complement(<469318..>472413)
                     /locus_tag="OSTLU_41924"
                     /db_xref="GeneID:5005216"
     mRNA            complement(join(<469318..470459,470616..>472413))
                     /locus_tag="OSTLU_41924"
                     /product="predicted protein"
                     /transcript_id="XM_001421122.1"
                     /db_xref="GeneID:5005216"
     CDS             complement(join(469318..470459,470616..472413))
                     /locus_tag="OSTLU_41924"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421159.1"
                     /db_xref="GeneID:5005216"
                     /db_xref="JGIDB:Ost9901_3_41924"
                     /translation="MSASDAEAVRTLACVTVKRRCTPRAFASRLTRGERDEAKRALLD
                     RAMTAESKALRNAVLDVIAKIARWTVPQGEWNELLEFLGQCASSPETAHRALAFKLFE
                     SLTETIVSSLSHHFKTLAGLFANGLVDAHDEVRVSALRAVGALVANASGEPEEVAVIK
                     SLVPHVLEAAKTAVSNEDEESASIVFEVLDALTESRTSALSGHVPAVVGFCIQVATAE
                     RELGTSARRRALDVLAYMARHKPKALTKSKLVEPMLAVLCPLCGEPKEAELAGEDDLE
                     DEDEVHIQTVASQLIDILALKVPAKYVLPTVLSFAAANINNASNDRLRHAAVAVLGVV
                     TEGCAEGVRAHASTIVPSVVGRLSDLNGPVRGAAAFTLGQFAEHLGLTLEDPDMHKQV
                     LPSLFTALPVEQVKSVQERMMYAMDAWLEDVQDEVGVYVKPLLDIVLLALDSGAKRHV
                     REMLLSALASATASSGDKVHPYLGELLPRLDRCLSLTADEELNVRARALEVLGMLISA
                     EGGKEAMGPHVENAMQAGLSGFELDFAELREYAHGLFGEVAEALKEDFDRYLAVCAQK
                     AFASLELDDGIMFDSEDEADREELDSDDDGDGDGMTDYMHEMVRVQAHLALAQTTIAA
                     LSINPEGAKELVNDSLSATIRCVLEDEDRDAVAASVEAAALLVNILKEHRGVDVSQHV
                     IDLTAASLEILEGNTFCQVEDGYDSEEGDEEGDEDEDEDVEAGLVVIEAVAELLPALA
                     MYMGETFATHFVPHFNALMKRTEENHTETERSLCYATLVEVVRAVGAPAAGCAVVALP
                     RCLRDVASLDVGLRRNSIYCIGILAQIGGASAIDFHGAIAEALAPMTRADRESDGGVR
                     DNAVGAIARLLQVIDGGHARENASALLDVVLNALPLRNDLEEGPDVYHWLASTITENP
                     TSLADAAMTRIVGILAEVVTDGALAPIDTSRILGIALSRAEDQRVRATLSSLPAQSQD
                     AIRRAGA"
     gene            <473127..475010
                     /locus_tag="OSTLU_27255"
                     /db_xref="GeneID:5004931"
     mRNA            <473127..475010
                     /locus_tag="OSTLU_27255"
                     /product="predicted protein"
                     /transcript_id="XM_001420972.1"
                     /db_xref="GeneID:5004931"
     CDS             473127..474995
                     /locus_tag="OSTLU_27255"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421009.1"
                     /db_xref="GeneID:5004931"
                     /db_xref="InterPro:IPR001164"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="JGIDB:Ost9901_3_27255"
                     /translation="MREAMEALSSERERLANFTRNALASENVRRATEKDVGELRERRK
                     AVDAAKKEYDGVRQRYMKTTGGEEELRAAKLSFERARRDLLVALQRVNVAKHTRTKRC
                     AVDLIDAQLDYFRRGVEILTRLSPTLDILRKDVAAAEAEGADLEAALNEEMEKLMARC
                     DDEAQSTSDALSMVSDRAREMSAQMASSAAGYGSSQNEALMQGYLLKRSSGKIQDWKR
                     RFFVLDARGSLTYTKSLSSNPRKALGGKLLSLGSMRNKSSNAPSTQTTGGGEVRETVS
                     LLTATIKPDLDDDSNARFAFRIVSPEKTYYLRCESNAERSKWMEAITTAIASLLNSSV
                     NETILAEHEASVNKYGSKHSRTMSSISSVSAYDGPPPLTVLGAVPGNGFCADCDMPEP
                     DWASLNLGIMLCLQCSGVHRQLGVQVSKVRSATLDVRAWEPSVLEFFSRWGNAQSNAR
                     WEYEKAEVEAKKPNKNSSLESRKAFILSKYVAKAFCRREAQPTESQLLTAINSNSLPA
                     VMDLLLKGPHIKMHWVMLTAACDCGDASIAILEALLHHNVDVNARENPYTEDTALHYA
                     ARRGRDAFAKVLLRRGADPRVLNGRGQTAFDVAVDVHGAIRDEDLLIMLSAAQDDD"
     gene            475064..477086
                     /locus_tag="OSTLU_27256"
                     /db_xref="GeneID:5005217"
     mRNA            475064..477086
                     /locus_tag="OSTLU_27256"
                     /product="predicted protein"
                     /transcript_id="XM_001420973.1"
                     /db_xref="GeneID:5005217"
     CDS             475193..477028
                     /locus_tag="OSTLU_27256"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421010.1"
                     /db_xref="GeneID:5005217"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR007209"
                     /db_xref="JGIDB:Ost9901_3_27256"
                     /translation="MGKKNKDEDPNEKLDRIAIVNGERCRPKKCKQECKRSCPVVKVG
                     KLCIEVGPKDKIAFLSEELCIGCGICVKKCPFEALTIINLPKNLERETTHRYGPNTFK
                     LHRLPTPRAGQVLGLVGTNGIGKSTALKILAGKLKPNLGNFTKPPEWSDILAHFRGSE
                     LQNYLTKILEDDMKALIKPQYVDNIPKAVKGEVEQCLNDRNELDNLEFLKDQLDLENV
                     MQRQVAQLSGGELQRFATAIIACQKADIYMFDEPSSYLDVKQRLKASRVIRSLLKNDT
                     YVIVVEHDLSVLDYLSDFICCLYGKPGAYGVVTMPFSVREGINIFLAGFVPTENLRFR
                     DEALTFKVAGADSGMEITDKHFSRYEYPALVKTQGDFKLNVESGEFTDSEIVVLLGEN
                     GTGKTTFIRLIAGLIQPDDEELELPEFNVSYKPQKISPKFPGTVRELLHKKIRDSYMH
                     PQFVSDVMKPMNIDPLMDQAVQNLSGGELQRVALAMCMGTPADIYLIDEPSAYLDSEQ
                     RVWASKVIKRFILHAKKVAFIVEHDFIMATYLADKVVVYSGVPAIEATAHAPQSLLTG
                     MNMFLKALEITFRRDPTNYRPRINKYQSQLDSEQKAANCYYLLDE"
     gene            complement(<477149..>477985)
                     /locus_tag="OSTLU_17931"
                     /db_xref="GeneID:5005218"
     mRNA            complement(<477149..>477985)
                     /locus_tag="OSTLU_17931"
                     /product="predicted protein"
                     /transcript_id="XM_001421123.1"
                     /db_xref="GeneID:5005218"
     CDS             complement(477149..477985)
                     /locus_tag="OSTLU_17931"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421160.1"
                     /db_xref="GeneID:5005218"
                     /db_xref="JGIDB:Ost9901_3_17931"
                     /translation="MLAAERVKVVEAHSAGKIAQDALREQLTKSENETMALRRMMETR
                     STEMANAVRQLNEELAAQHEIVERGMASRVDALRETFDDELARARERANEMIESARKS
                     VKEANERVARMESTATRAENVSRNALMKLKEIAAASADTERECAQLRTNLHAVGEINA
                     KLTRRIIDGEPFVLDEELDVVREPGAEMSVNTPSPASERSRGKPAKFDTRDIQHIHRE
                     LQNELSKLRVEHESIAREIGGSSGAEGEFLAKALEDAQERVESKARQVKLLNKTIRSA
                     TH"
     gene            478727..>479855
                     /locus_tag="OSTLU_27258"
                     /db_xref="GeneID:5004932"
     mRNA            478727..>479855
                     /locus_tag="OSTLU_27258"
                     /product="predicted protein"
                     /transcript_id="XM_001420974.1"
                     /db_xref="GeneID:5004932"
     CDS             479016..479855
                     /locus_tag="OSTLU_27258"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421011.1"
                     /db_xref="GeneID:5004932"
                     /db_xref="JGIDB:Ost9901_3_27258"
                     /translation="MRDEASGYEKRAAESAAAGVEEKRPPRGGDAPAPGSWSWTLNWD
                     HVMFDTRGRVIEEPTKEDMARARVLIGSCPRNAEDVDRLVDEAGVEAIVCLQCSLCHA
                     AMEIDWQSVRRRAIERGVMIVQVNVRDFDRLDQAKMLPEAVRKLAAFQAMGKRTYVHC
                     TAGINRASLTVVGYLTFVKMFDLEAALHAVRTSRPQANPYVVSWEIARARLLAHRLED
                     IYLYSQVDAGGNTIDDGGDWIKRDLERAEKGVIAEVFKRAIDTDLSMYGALIEGDYQQ
                     QRH"
     gene            complement(<480586..>482542)
                     /locus_tag="OSTLU_41554"
                     /db_xref="GeneID:5005219"
     mRNA            complement(join(<480586..482307,482426..>482542))
                     /locus_tag="OSTLU_41554"
                     /product="predicted protein"
                     /transcript_id="XM_001421124.1"
                     /db_xref="GeneID:5005219"
     CDS             complement(join(<480586..482307,482426..482542))
                     /locus_tag="OSTLU_41554"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421161.1"
                     /db_xref="GeneID:5005219"
                     /db_xref="JGIDB:Ost9901_3_41554"
                     /translation="MFGTLGSLFASGPRLKYDLGREFACRAFGVWTHRRGTCQETGEE
                     HSIFTFHADVNRDQQRVRLAKNGARRMKTLRHPNVLLVKDVIEIESGNELTIHVVTEA
                     VTPLEAHLREAPIGGGGNGQRDDYFSLGVREIATAVAFLSNDCKLVHGGVGLSAVVVT
                     ERLDWKLHGFDLCSELESIGHGVNGDAALIRGAYLVPDQYKPEEYRRGDWVIIPEGPP
                     WAIDAWGLGCLIQEVYSGGALRGTDQLREIDQIPKSLLKDYQRLLGSQPARRYNPKKL
                     IENKEAFSNKLVETITFINNLALKDSIEKERFFGHLPRVLEQLAQAPVQKKILPMLCD
                     ALSFNQAPHQAILPMLLAAEEVPRDQYQKLVIPTVMKLYEAPDKMIRLDLLENLTRYA
                     DHVPDAMMDDPLYERLQTGFAHNDSNVREMTLKGALTLVPRLSERVITASLLRHLSKL
                     QIDEDPAIRANTTICLGNIAKYLSQATAKRVLLNAFTRSLKDGFPPARLAGLMALEHT
                     TQYYEPLEVSQRLIPALAPLMTDIEKDVRTRAFTVLELYVQGLKGHSEALELGPEAAA
                     AHVEAQQQKGHANAAKRAANMLSWAVNMAATKIGGPDDAHEPVDLQN"
     gene            <482652..>483638
                     /locus_tag="OSTLU_27261"
                     /db_xref="GeneID:5004933"
     mRNA            <482652..>483638
                     /locus_tag="OSTLU_27261"
                     /product="predicted protein"
                     /transcript_id="XM_001420975.1"
                     /db_xref="GeneID:5004933"
     CDS             482652..483638
                     /locus_tag="OSTLU_27261"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421012.1"
                     /db_xref="GeneID:5004933"
                     /db_xref="JGIDB:Ost9901_3_27261"
                     /translation="MDAATRDDDARRAGATTTAIDGDDDDDGTRATTTTTTTTTTTAA
                     TTAVKTPTGRDDGDDGFCPAWTRRGRGTIASAAWRRPALAACSLEDFTFDLMRFHQER
                     GRDWEQCWANLDRVVGRTGAPLDCLHLYRQVCSLGGFASRTSAKERIKAAEIFRNMFN
                     HYENHTMTDCGNRMLTAYENYFLEYEAAHEEDLTRGTCGNCGGGIQTSIGTVADLLHE
                     CVGCERMFHGRCQPPEVFPPIHGEGKNAGCSTRIVCFECRAGGAYAASTKLLRDERED
                     ADSYQTRLYECVARRGRRYKSSYVRPTRAMDEGAKPPSPTGNDPDDGSKMDD"
     gene            complement(<483684..>485312)
                     /gene="ClpY_13"
                     /locus_tag="OSTLU_41786"
                     /db_xref="GeneID:5005220"
     mRNA            complement(<483684..>485312)
                     /gene="ClpY_13"
                     /locus_tag="OSTLU_41786"
                     /product="ClpYQ (HslUV)-type protease, ATP-dependent
                     subunit ClpY (HslU)"
                     /transcript_id="XM_001421125.1"
                     /db_xref="GeneID:5005220"
     CDS             complement(483684..485312)
                     /gene="ClpY_13"
                     /locus_tag="OSTLU_41786"
                     /note="ClpYQ (HslUV)-type protease, ATP-dependent subunit
                     ClpY (HslU) (AAA+ ATPase superfamily)"
                     /codon_start=1
                     /product="ClpYQ (HslUV)-type protease, ATP-dependent
                     subunit ClpY (HslU)"
                     /protein_id="XP_001421162.1"
                     /db_xref="GeneID:5005220"
                     /db_xref="JGIDB:Ost9901_3_41786"
                     /translation="MSRRAFGALARAWRAARDADVDQRCAATLAARATTTTTTTTTTT
                     TKTHRGERPYGATGPSRVAKPPKPPTKRSTIDVTIDVTPADARDGRDAREEDGRGGLT
                     PERATALLDKHIVGQTEAKRACAVALRNRWRRHRIGKPMRDEIVPKNILMIGPTGCGK
                     TEIARRLAKITDSPFVKVEATKFTEVGFHGRDVDQIIRDLVDNGIAVTKQKMRAKFEK
                     FVEELIENKILDFVCGEGANDETREAFRTLYRDGTLDDRTIEVELPDSGGQNMKIDPS
                     GGPIPIHELVIKVDKLFGNRKSTSKRKMTVAECKPLIEEMEFDNLLSAETIAKEAITA
                     VENDGIVFIDEIDKIVSSSDYRHGADASSEGVQRDLLPIIEGSVVSTKHGNVNTDHIL
                     FIASGAFHSAKPSDMLAELQGRLPIRVELKGLTERDLYRILTEPEMNMIAQQKALMKT
                     EGIDLEFTNEAIEHIASIAAKVNKTVDNIGARRLHTVLERIVEDLSFDAPERYAKFVA
                     AGGKGELQVKIGVKDIDDAIGNMLKQEDLSRFVL"
     gene            <485351..>485686
                     /locus_tag="OSTLU_27263"
                     /db_xref="GeneID:5004934"
     mRNA            <485351..>485686
                     /locus_tag="OSTLU_27263"
                     /product="predicted protein"
                     /transcript_id="XM_001420976.1"
                     /db_xref="GeneID:5004934"
     CDS             485351..485686
                     /locus_tag="OSTLU_27263"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421013.1"
                     /db_xref="GeneID:5004934"
                     /db_xref="JGIDB:Ost9901_3_27263"
                     /translation="MPTSLTRAGARATPSTLGVDPEDVLHPRVRDLLHGDVVRVGAPT
                     PSVMKQRLRNKLWKLVVLAIASVVLWALQGARQAREGAWARGEGVVEPMAVRFARKGA
                     FGGGAKIVH"
     gene            complement(485799..487076)
                     /locus_tag="OSTLU_27264"
                     /db_xref="GeneID:5005221"
     mRNA            complement(485799..487076)
                     /locus_tag="OSTLU_27264"
                     /product="predicted protein"
                     /transcript_id="XM_001421126.1"
                     /db_xref="GeneID:5005221"
     CDS             complement(485803..487035)
                     /locus_tag="OSTLU_27264"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421163.1"
                     /db_xref="GeneID:5005221"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Ost9901_3_27264"
                     /translation="MAPPHTDLPIRVLACDELGYVRAFATDPAAGGDAAEDLTLIGKF
                     GALDRARRAVRARAVCELRGASDASGPRVVCARKGGAVEVMEARSGTRSTATLTLSKE
                     IVDAHAWCEGDERGTSWERMHVVAVHDDGEVGVHGIVNEYGDETWRETGTFRACGDAT
                     SSDLDARLGRLVLGGKGQGNDVVVYDVHEQKRTYKAKPPPPNWLGYRAPPWVSATCFA
                     STSECARFFVGTGEHRFRHYDTRADKRAVLDLDVGKGVITSVASSADGYEAYVANARG
                     MFEIVDLRAGKTRGKFKGNSGSIRQVAVHPDGAHVACAGLDQYVRVYDTATRKCVASA
                     YAKQPLTAIVFDAHTPAFEAASVKKSSKKKKRAPDVDDDDARAEKKAKKKKKKIRECA
                     VAVDDAAPKKKKKKKSKE"
     gene            complement(<487155..>489206)
                     /locus_tag="OSTLU_89032"
                     /db_xref="GeneID:5004935"
     mRNA            complement(<487155..>489206)
                     /locus_tag="OSTLU_89032"
                     /product="predicted protein"
                     /transcript_id="XM_001421127.1"
                     /db_xref="GeneID:5004935"
     CDS             complement(487155..>489206)
                     /locus_tag="OSTLU_89032"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421164.1"
                     /db_xref="GeneID:5004935"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="JGIDB:Ost9901_3_89032"
                     /translation="VRAERDARARASNAARGEAQSRDEDARASTSADAEAARAASLRP
                     ATRANVRREIMTMNDGTEREITVDARFKCAKCARGSSCFAVHRATSAVSGMRAKRRYN
                     ERKKAKKTKSKYASDVEGGGRGSRARADADPVGATLALIRDGHRPTAKTFTAVISTLG
                     AMGRAKEALDDVLPMIEEYGDDVDVAVWNAVAHAFCAGGDPAGAEKIVDRMVGEDGVG
                     VNGATHPEIIYTYAKRGEANRVYRLIRRMSSEHGIIPDERAYNAFLRGLCERDDLEDA
                     EEVLRRWNNEKFDLERQSDRGGRVSKPSAASYGLLIDAWTRRGNMLAARKLLQQMQWE
                     RIAPSLPLFNMLIDGYLKQENMRAAEGLFRELESSGTWDMESLGIKPDNVTYTLFLDY
                     WANQGQVDACERIFNRMHRKEVAPDVTAYGTLVKAYARARDSDGAEAVLDRLAEAKVA
                     PSVAIYSAVVAAHCTIGNMSRARDVLERMFDAGLRPNERTFAHFAWGYGQLEDINGIA
                     EVAKLMLASGLKLKGANRTAIVRACEECGMSMSAVQALLDRINPEMTQRKGVWKRDGG
                     EPKPKSNRAAAAAADEDLEPSTLEPTKTKEIYGGPESTARRVSLSQRVESLDEDDDDG
                     DTGAVDAPPASSDWPRKVSTRAVAIAHRASSRARPIRRTFTRTNARAFAITRALGAAS
                     M"
     gene            489317..491222
                     /locus_tag="OSTLU_27266"
                     /db_xref="GeneID:5004936"
     mRNA            489317..491222
                     /locus_tag="OSTLU_27266"
                     /product="predicted protein"
                     /transcript_id="XM_001420977.1"
                     /db_xref="GeneID:5004936"
     CDS             489686..491170
                     /locus_tag="OSTLU_27266"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421014.1"
                     /db_xref="GeneID:5004936"
                     /db_xref="JGIDB:Ost9901_3_27266"
                     /translation="MEGEDASAVVVDDGANGDAGASEASTSESVDEDAEGREAKKSTA
                     DRGLGQRRALSAETRSRPFVPLKGEVLHIAWYREYDETGKFTREEGLAYRECIEQLLA
                     HYTMPKELVEETLDGIERGWSDVTLNLGSGFNLRMQRHTEFETITLSGPGNMKASLGT
                     RITPWQWLLPHDWLADIPGKVFLVNHAVFRQLSQPSRSEEPTLKELNAIRKALGSTLY
                     EDKVNASMDEEDAVLEWDAGSLVGCGIGDGSRMFANYELDDSGAMTTLVVVPPGDSTF
                     IRAGRQLQRFFALEQYRLMILQRLPMAKSKFPLLAGLNERYETLSRELRRSKATARGH
                     KDQQEFVTQITELEQAITQLVTRTKLVALTTASYLEIIELRLAEASFTRLGYEIRFLP
                     LFVKKRIDPAVSTIYAVAEQAKILSDALERTTSLVQASVEVRLQRINERIATYGLLFT
                     IVSVLVSFTTSIQPNGSLHWLFVLVKAKFFSCVAFGAKLCASGP"
     gene            <491539..>491967
                     /gene="ELIP/CBR13b"
                     /locus_tag="OSTLU_27267"
                     /db_xref="GeneID:5005222"
     mRNA            <491539..>491967
                     /gene="ELIP/CBR13b"
                     /locus_tag="OSTLU_27267"
                     /product="possible early light inducible or carotene
                     biosynthesis related protein"
                     /transcript_id="XM_001420978.1"
                     /db_xref="GeneID:5005222"
     CDS             491539..491967
                     /gene="ELIP/CBR13b"
                     /locus_tag="OSTLU_27267"
                     /codon_start=1
                     /product="possible early light inducible or carotene
                     biosynthesis related protein"
                     /protein_id="XP_001421015.1"
                     /db_xref="GeneID:5005222"
                     /db_xref="InterPro:IPR001344"
                     /db_xref="JGIDB:Ost9901_3_27267"
                     /translation="MVPVSEALERAKATRDARGGRVEGRSAFDALAFSGWAPETVNGR
                     AAQIGIVCGLWRQYTTGTGFVTQAHDHVLLFAAVLAVVAAASAAPSFLGKTYGGDPKS
                     KKDVGIFTARKEMIHGRLAMLAIAYEVYAELSARGVTAPF"
     gene            complement(<492039..>492779)
                     /locus_tag="OSTLU_27268"
                     /db_xref="GeneID:5005223"
     mRNA            complement(<492039..>492779)
                     /locus_tag="OSTLU_27268"
                     /product="predicted protein"
                     /transcript_id="XM_001421128.1"
                     /db_xref="GeneID:5005223"
     CDS             complement(492039..492779)
                     /locus_tag="OSTLU_27268"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421165.1"
                     /db_xref="GeneID:5005223"
                     /db_xref="InterPro:IPR010283"
                     /db_xref="JGIDB:Ost9901_3_27268"
                     /translation="MSIACNAFIMLVSLCFSRRVVGAKRFDAMKPHERTTWHTNLCTF
                     WPAFAVTAYALPAIATFSGKSDSFVSDVSALTSKACGLSIGYMTWDLGVILARWDDQV
                     VAYGGKGALYLFIVHHVFSIVLWPYALMRHLCAYHINYFLVSEVTNFNMSLRWILAAL
                     NMSNTKLYLINGLAWIPLFLGVRVVVIPRLFAAYMNSDWGVLTTPQYYAALLTLPIPS
                     LLNLYWAQQIVVGAAKFLITGEDVLKQD"
     gene            complement(<493163..>494200)
                     /locus_tag="OSTLU_41604"
                     /db_xref="GeneID:5004937"
     mRNA            complement(<493163..>494200)
                     /locus_tag="OSTLU_41604"
                     /product="predicted protein"
                     /transcript_id="XM_001421129.1"
                     /db_xref="GeneID:5004937"
     CDS             complement(493163..494200)
                     /locus_tag="OSTLU_41604"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421166.1"
                     /db_xref="GeneID:5004937"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="JGIDB:Ost9901_3_41604"
                     /translation="MSFATQAAASDGAKKPQEPKAPVKAVELDGGAALKIMKHCADAA
                     PGSATGQLLGLDIGASLDVTACFPFPKVTADDQYDPDGSFAAEEGAAYQLDMMRCLRE
                     INVDSNIVGWYQSTYLGTFYNEELIATFLSYSESLQRCVCVAYDPTYAEQGVCALKAL
                     KLSEKFIEAYKNGNGELTVEQIHEKGLKWNDVVVEVPLTIRNSALATAVMGELMRDKD
                     VTLNDTDYERLDLSTAPFVEENMKLLGECMEDFANEQQRVAYYQRNMQRYQSQHAHWL
                     HKRRQENARRRAAGEDLLPEEDPNYKAPQPPSRLENFLITNQVAEHVTHLENFTKKTS
                     AKLDLVTALGK"
     gene            complement(494453..495674)
                     /locus_tag="OSTLU_47417"
                     /db_xref="GeneID:5004938"
     mRNA            complement(494453..495674)
                     /locus_tag="OSTLU_47417"
                     /product="predicted protein"
                     /transcript_id="XM_001421130.1"
                     /db_xref="GeneID:5004938"
     CDS             complement(494478..495671)
                     /locus_tag="OSTLU_47417"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421167.1"
                     /db_xref="GeneID:5004938"
                     /db_xref="InterPro:IPR001804"
                     /db_xref="JGIDB:Ost9901_3_47417"
                     /translation="MVYVRGEEMTAYVMDLIRAKWIEPRVDTTAWREFDLRAKNRDDT
                     EDQVLRDVIEAGKAVKAIFKEPTVTPTADQVKRLGLRKSWGSPNGAMRRGWNGITISR
                     DTIHIDGVELGYKKPVFFERHAVGGEYAAGYKNVGKGTLVTTFTPSEGPDAGKPVEVD
                     SRTITDNEAAVVTYHNPYDNVHELARFFFGRCLEAKITPYVVTKKTVFKWQEPFWQIM
                     KKVFDEEYKSKFVDAGVMKSGDELVHLLSDAATMKLVQWRQGGFGMAAHNYDGDVLTD
                     ELAQIHKSPGFITSNLVGVDENGTLIKEFEASHGTVADMDEARLRGEETSLNPLGMVE
                     GLIGAMNHAADVHNVDKERTLAFTAKMRAVIHQLFREGKGTRDLSGPSGLTTEQFVDA
                     VAERL"
     gene            <496735..>505789
                     /locus_tag="OSTLU_17941"
                     /db_xref="GeneID:5004939"
     mRNA            <496735..>505789
                     /locus_tag="OSTLU_17941"
                     /product="predicted protein"
                     /transcript_id="XM_001420979.1"
                     /db_xref="GeneID:5004939"
     CDS             496735..>505789
                     /locus_tag="OSTLU_17941"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421016.1"
                     /db_xref="GeneID:5004939"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR010314"
                     /db_xref="JGIDB:Ost9901_3_17941"
                     /translation="MEFMREIVENCGELPSFAHGEATALFLEFFETCESALRLLAAAT
                     RRSVVGRTPRNAYFSSDVFQRRVRFMLSKIHAHMPLSAAHLNDADENESKACEVVAHE
                     LFVAEDREEGSGPLDCTRYEFTVDTTSSGSDEIVFKASGRRGLDPSEMHRPYNRASSL
                     ECLIDDFSRPQMFDPGKEMDSLKDISAAYFGVLAQLWSKSLQRTRAGREKAARLSILA
                     QQINVHLGKGAEPSDFELYVEDAQTTAIKLLDLMQVDLGVTPSLLLRRDATTLLSAYT
                     NERASGFQVCQIMRRPAGRGALSQCVSTMTAALLAPLSSSDAEIDFDVVRDARCLMHL
                     VGILSTTTPGCTAIREAELLPLLMSIFKLERLEAIPVVVDVVHIVESYLEFQPNAVVA
                     FRELNGTDLLLKRMRYESVTAIEELRASGHLDDVADRKRKIDSLSSLEDAETSLAAMK
                     KAPKYVNFYRRVLIKVLMRTLAYTSFAYGGARMRVPGLSDGTLTDILGSVLKYPLKFG
                     PGVSSLTANLVCDVIHNEPTCYATLDEAGIVDAFLKFITETMWPLGRSKGMAKVLCAI
                     PTTLNAICLNEKGQEKVLKSSALVCFRKMFQDSSFPLNADTSRIVGTGINETLRHIPA
                     LKDVSVEVLNDILSDLTIQLRKISDSETNLEHAFVNKAVVEQMPISKTLQNVARFMDG
                     ILQTSHMCAPLVQAGALDSMLNMLTCPLPVEFSTCASYNSISVACKSLINPPDPSNSY
                     AGANTPNLSDDVILACTTVVEKYMASAVDIGVQIEEFYVHELDKTGDDIDKLATYDIY
                     SKTLSEKHKGDKAALDREVRFCRQTKSLCQRMAAHERLCELLATLVQQVPVMSAAIMN
                     KRRDDPHGPMMAESLFNAALAAFNEAVKIEAKLRSLAVEIQADEMPYSPVWWLYTRAD
                     LFVRVTSGLFAAVAKLSTTMRRRKDLGPEAQNFIKLSGEAIIAVAREMTKAFTSRVTA
                     QAELLPPSHASNAKMDFEQRCSHNFLALIYESFFDDKRNSPNGVMINYAARCGLFEQL
                     YTHFQGTVALTQSILETCTGEKAEQGHVAAECYRTLSCFVRIFVSISDVKLMASNNSN
                     KLALGTRLPERVEDDPIYDKMTKYTHISDAFTNSRSAMDWIHCSLNEALKCIWRPETD
                     IFASVAAGHVDSDALVQCLLNIISGTEQAVMSEQRRAASVPRAPPRPPPRQFVPSETM
                     IDSIVEMGFSRGHAHHALAAVNGQSVERALEYMLTRPMEDVPDEAPTAPSEPAPSEST
                     ALEETADAMETAPVAFNHTHAVQGRLPAINELVAALYANFHISAEKGATLLLKVIEKH
                     ELMSGLSRDECIYALTDEVVRTRTPKIGRDEVYAIKHYAFVEALARQGDEVLRRALWI
                     KGSVIDSQVETFIAEVDKICAAQKTASLETFLKDVPLSFVPLANCINAAACLQKHRDS
                     DASARNYSKFGFLNDGHKIALADACVECLIAIVKNSGELASDYESHSVQAVILDLLAN
                     LSRDNVIADRIASNSFADSKDGAAISKRSFAHTLFTCFWNNTNDSVSVILRHMVNDPR
                     TLQFAMELEIVKSITKPPMGRDSKVALKTFCVAMKNIIERDFDCFEAAFANVAEIRTM
                     ADTPLSTPREYVIPTAEVKAMQSLPTVRLTKNLRMVVEVLVAVATEPIHQAPLTKLER
                     QAAAFRLLTELVEVYPSSVKALMDMDDQTDIFRNILRYQLPSSRRSSSSEQTGVWCGC
                     ENAAFFLATLCVNSQKARTKIIEKMLVLLKEPDLTQETASTCADKGDSLVPKHAFVDL
                     LHSLMDYGLARGYQSGERIRNRVVFNLQQGVLKTMYSLKVPERIIELIEETNVVGAAR
                     EKRGNPGFLRVTLAVLEALVVRSTKSKRESRLTRIGNMVRAVNAARVPSGEEVEERRA
                     LTEQMLQNLLEHAAGGNIQVARLEDDLDGMPEIEGVHPVFGGDDGDADGIDANDGHEN
                     SDDDSEMEVDDDHDHDSDEANEEGMHESSDEEQLSESGESGESSGTSDSSEEDSEEEE
                     EEDDEEGEEAMADDFYGSDMDHIDPDPGNDVLEMSDDALYDEDGEEFDYDDGGGSDDD
                     DDDDEEEGDFEEPSSPQSSYTSPSGVRVLPRATHSGSHVERTSNLGSRDHISVSRAQV
                     EAWFATDYSSVMSGADPRVEAQTVGELQIAGGQRAQVSTEDERQQTLSESRSEGQLRG
                     HNREHSPRSSSVNASELFNRRDVPFTSSLREQTQRIARATLGDPSLLARGNPPVHGSP
                     WHTWSQSETGVPPALNHEGINVQRVGTSLNITLSTPMDFSSRSRSLHDVLNSISGEMA
                     RLAVRPSHLEILDPLSSAKAILWLGDGSFQATAPAEFSVRNQTIWSLDGRNARASFWS
                     NAVCMSIGESLATSGTFLSHLDTAELATSSLVSSERDKENVNGNLAEIVDESPEERTA
                     RQRREAAALDISANELSMVTEDLRDGFLNANRLVARAREQAPEAASDLNLIGAEFLSA
                     MPADIQRELIQRTTSGANRLLTRIQHTEASPSVSAPRPRANSPTTTVIDTAPLEIGNM
                     MFGEGWDGRLDRHEQMSWNDIERIRQSSTRDAVAPEDFKPLKVNVELRHQHIRTLLLL
                     FFVQTIDLKDTVNKICVNLCVVDQNRESILRQIIETVIMNTMDRADPRFIESTLSSPN
                     AKGLEPSAAMEVAMARSLCANLSERNGARKEMVTRRLLTLLSQLISRNRHVHGTYRVR
                     GVNLTCVKLFFAKDEDASMVNFLTNQKENGEAVLRSDAGVSTVDIPLLSFLVGLLAHA
                     SQFHDQKNIELCATCTDAYLTKFLAATPKPNIGPKGLSTAATPELLASIASFLKVPYL
                     APSAYEKINTILQKVLGDFFEEGCDAVILNRFHADALQCSVEAIACLSKASSIKYRPN
                     VDEPSARHVEYADSRQSLKTHIPYLRRLTDCFLQVLTYLDGKDSRFQKAFKDKAKEEL
                     IRYHDALRPFWQMMNVYASLMQDITSDESGDASILCERSHASAALTEGITTYLMIGTS
                     LYPYVEGEVSKSRRES"
     gene            <506005..>507225
                     /locus_tag="OSTLU_41898"
                     /db_xref="GeneID:5005224"
     mRNA            <506005..>507225
                     /locus_tag="OSTLU_41898"
                     /product="predicted protein"
                     /transcript_id="XM_001420980.1"
                     /db_xref="GeneID:5005224"
     CDS             506005..507225
                     /locus_tag="OSTLU_41898"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421017.1"
                     /db_xref="GeneID:5005224"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="JGIDB:Ost9901_3_41898"
                     /translation="MLKQRPLLLSGPMKILLSNPRLLDFSVKRAEIRTRIKKLRERLG
                     HNRPEARTLHIRRDRILEDSFRQLNSRSIEEIRGKISIVFVGEEGMDGGGLIKEWFTI
                     LAREVFNPNIALFELSHDKGCYQPNQNSVVHPDYLSYFRFVGRLVGKALFDDILLNAY
                     FTRPIYKHLLGQQLTYEDMEGVDPDYYKSLKWMLENSVEGVMEYTFSDTTSYFGETQV
                     HDLTENGRNIAVTDANKFEYVNLITAHRMTNAVKDQLAALVKGFEEVVPRETISILNA
                     SELELLISGTPDIDVEDLRANTEYTGFTVGSKQIQWFWDVVREMNKEDLARLLMFCTG
                     TSKVPLDGFGALQGMQGPQRFQIHRQHADDSKLPSAHTCFNQLDLHEYSSKQILRDRL
                     LYAIVEGCEGFGFI"
     gene            complement(<507277..>508944)
                     /locus_tag="OSTLU_27272"
                     /db_xref="GeneID:5005225"
     mRNA            complement(<507277..>508944)
                     /locus_tag="OSTLU_27272"
                     /product="ABC(ATP-binding) family transporter"
                     /transcript_id="XM_001421131.1"
                     /db_xref="GeneID:5005225"
     CDS             complement(507277..508944)
                     /locus_tag="OSTLU_27272"
                     /codon_start=1
                     /product="ABC(ATP-binding) family transporter"
                     /protein_id="XP_001421168.1"
                     /db_xref="GeneID:5005225"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="JGIDB:Ost9901_3_27272"
                     /translation="MLTDEALASAKDEPIESAREAAASAAVGAPAFARAALDAAADGI
                     EACVAMVYHAQCLFQSSFWSAPVLIGSALIGQVAQNARTFDGYEAKKEAHRAETATAR
                     LRELLAHARTDGEAIALANGAITEAEEAMATLEAGQEFVYRREVLNARASFPSDVYDA
                     AANLLPVATVLPRLVRGVSVNAWDIQVAMSSFNGIRAALAVLVQNMSTLRTAELHAGH
                     VSNLYDALDVSTVRGLAGDNESGGASVRVDTPEDDMSLVEVDSLSLRGYDGQEIIRGL
                     DFVLCRGDSLAVVGPAGCGKTMLVKALVGLWSYGSGSARVIHRSRVCVLSRKPYFPKG
                     SLLDVCLYPTSSADIGTDTRELLTDAMVALGLGRHIDYLDAIAPWGDNLSPSEQQRFA
                     VCRAVVNRVDLCVLDDATCAMDPKDRAASYDVLKKHVSGILSLGDEVSLPKHHSRTLR
                     VRSDGTLGDFEEMASPVTSSRINVRDVAREAIGEPLVDVASEESDSSASGFNPLQMEA
                     NRRENQFIRRQKKNVARALGVNPQKFGVVPTPTKSTKGKPLAFDPLA"
     gene            complement(509495..>511516)
                     /locus_tag="OSTLU_19811"
                     /db_xref="GeneID:5004940"
     mRNA            complement(join(509495..511004,511339..>511516))
                     /locus_tag="OSTLU_19811"
                     /product="predicted protein"
                     /transcript_id="XM_001421132.1"
                     /db_xref="GeneID:5004940"
     CDS             complement(join(509521..511004,511339..511516))
                     /locus_tag="OSTLU_19811"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421169.1"
                     /db_xref="GeneID:5004940"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="JGIDB:Ost9901_3_19811"
                     /translation="MMQQGGQGQQIMVMNTNAKRETGSIARANNIAAAKAVSDIIRTT
                     LGPRSMLKMILDASGGIVLTNDGNAILREIDVTHPAAKSMIELSRTQDEETGDGTTSV
                     IILAGEILHLSQQFLEKNIHPTVIVRAYMKALDAALKVIDSISFPIDVTNRDEMMKIV
                     KSSVGTKFTARMGELIPNLALDAVMCVARKNADGTNDIDIKKYAKVEKIAGGSIDDCT
                     VLRGVMMNKDVVAPGRMKRRIENPRIMLLDCPLEYKKGENQTNVEITKEEDWAVLLKM
                     EEDWIKETCAKIAAFKPDVVVTEKGCSDLACHYLSKAGITALRRVRKTDNNRIARAAG
                     ATVVSRVDELRESDIGTGAGLFNVEKIGDEYFTFVVDCKEPKACTVVLRGASKDILNE
                     IERNLIDAMGVARNVVQDPRLLPGGGAVEMAVSRAIAEEATKIEGVEQWPFRAIGAAL
                     EVIPRTLAQNCGANVIRTLTKLRAKHAEGEEARTFGIDGDKGTIVDMKELGVWDPYAV
                     KVQSIKTAVESATMLLRIDDIVSGLSQKNSDAAGTGTGVSAGDDD"
     gene            complement(<511754..>512597)
                     /locus_tag="OSTLU_27274"
                     /db_xref="GeneID:5004941"
     mRNA            complement(join(<511754..512451,512561..>512597))
                     /locus_tag="OSTLU_27274"
                     /product="predicted protein"
                     /transcript_id="XM_001421133.1"
                     /db_xref="GeneID:5004941"
     CDS             complement(join(511754..512451,512561..512597))
                     /locus_tag="OSTLU_27274"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421170.1"
                     /db_xref="GeneID:5004941"
                     /db_xref="JGIDB:Ost9901_3_27274"
                     /translation="MGRINKSALKRLAHEKKTMAKTLLALPKSQIATMEELNAEVKAL
                     VAEGKKLKGNHGAAKRHEGALAGALRRMTESEMDALVSKVTAIENGTTGAIDSNVDAL
                     AMSWRARLLSGTEATTASSDDATACLGEIFDALATAEANETSAPLSFTRQELKVALDA
                     ATKESRARALAIAEFNASIDKEMEVLAYGETNEEVLRETRAFIAQKLKSGGGASATPS
                     RSPPRAKSSKRLLGMLRDVAAVVVAA"
     gene            complement(<513027..>514994)
                     /locus_tag="OSTLU_13224"
                     /db_xref="GeneID:5004942"
     mRNA            complement(<513027..>514994)
                     /locus_tag="OSTLU_13224"
                     /product="predicted protein"
                     /transcript_id="XM_001421134.1"
                     /db_xref="GeneID:5004942"
     CDS             complement(513027..514994)
                     /locus_tag="OSTLU_13224"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421171.1"
                     /db_xref="GeneID:5004942"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="JGIDB:Ost9901_3_13224"
                     /translation="MMRSAAATVLTRHATTQTLVRDCVYARSWRRRASTTSSSTRNVA
                     IIAHVDHGKTTLLDQLIRSTSEARVEERAMDNMQLEKERGITIAAKYTAVSYKNATLH
                     IVDTPGHADFGGEVERALELVDGALLVVDPFEGVMTQTKFVVRKALQKGLKPLVVLNK
                     VDRDGVTRALCDAVESDLFDLFAAMGADDAQLDFTVVYASARAGVASTSLEEAQKQIV
                     EGNGSVDAILQGVLDHVPAPRGCTQQPFALLVSMIERDPFFGRLVTGRVFDGALGIGD
                     TLKVLTLGDGVVRETVRVQKIFTSRNLERVAVKEAKAGDIVTIAAGFGDATVADTLCS
                     PERREPLPSTPVDPPTLSMTFGVNTSSLAGKEGNQLTERQIEERLRAEADTDVSLRVS
                     DSSDEDGIPGLQVSGRGELHLGIIIEKLRREGFELSVSPPRVIQGIDDEGRRTEPFES
                     VLLECDANDCGGVIDAVTQRKGDLLDMDTNAGEDGRTRLTFYVPSRGLIGFRQEFINA
                     TRGNGVMQRAFDSYGPSRGAIGKAKKGKLISTTSGVTTTYSLGALEPRGTLFVGPASE
                     VYAGMIIGEHTRENDLEVNPTKEKKLTNMRASGNDETIRLTPPKVIDLESAIGYVGTD
                     ELIEVTPKAIRLRKAELASSMRRRASRQADS"
     gene            <515227..>516356
                     /locus_tag="OSTLU_17947"
                     /db_xref="GeneID:5004943"
     mRNA            join(<515227..516102,516264..>516356)
                     /locus_tag="OSTLU_17947"
                     /product="predicted protein"
                     /transcript_id="XM_001420981.1"
                     /db_xref="GeneID:5004943"
     CDS             join(515227..516102,516264..516356)
                     /locus_tag="OSTLU_17947"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421018.1"
                     /db_xref="GeneID:5004943"
                     /db_xref="JGIDB:Ost9901_3_17947"
                     /translation="MSPPLVPFVVCGTKKGSVPFARVKTKYGKTHTRIDNCSGDVSLL
                     LSTLTRALGCGGSVCDDKKSVVIAFDESFDRIVKVLKSFDPRCVRGVRGAETSVPVSR
                     ASASAPTREPRTKPRHGATGSGKGVSGAAGRAEPIVITKRGAHESAKQSIDGYRLLLS
                     RWPYWDGDVSRMYDMYHRHRRLNDDVVMSFDADSILQSSATDTNAMSDFDRAAQCAST
                     EDALRTLGMLAMPSEFRQSRLERQREAAKRKESVARVSSGPKTSSAVVDIDPFAEYLQ
                     HDRGFAPARVSSKPAGAPRLRRWFQAHGERKVYIWRRGSNADARRI"
     gene            <516541..>516873
                     /locus_tag="OSTLU_27277"
                     /db_xref="GeneID:5005050"
     mRNA            <516541..>516873
                     /locus_tag="OSTLU_27277"
                     /product="predicted protein"
                     /transcript_id="XM_001420982.1"
                     /db_xref="GeneID:5005050"
     CDS             516541..516873
                     /locus_tag="OSTLU_27277"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421019.1"
                     /db_xref="GeneID:5005050"
                     /db_xref="JGIDB:Ost9901_3_27277"
                     /translation="MHIECDELFGDMTEEEIVALVVRMSQEETTSEAALPMPTKTEWV
                     NARLGEIFFPDIERARQVAEIFRATETDRNATIDLLIGAGAAESDAKAFWELFDAVTL
                     TDNDSHVD"
     gene            complement(<516947..>518632)
                     /gene="SDG3506a"
                     /locus_tag="OSTLU_17948"
                     /db_xref="GeneID:5005051"
     mRNA            complement(join(<516947..518416,518591..>518632))
                     /gene="SDG3506a"
                     /locus_tag="OSTLU_17948"
                     /product="predicted protein"
                     /transcript_id="XM_001421135.1"
                     /db_xref="GeneID:5005051"
     CDS             complement(join(516947..518416,518591..518632))
                     /gene="SDG3506a"
                     /locus_tag="OSTLU_17948"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421172.1"
                     /db_xref="GeneID:5005051"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="JGIDB:Ost9901_3_17948"
                     /translation="MTTTKYEREVVWVKYGKGERFWPAHVVGRDAARARVPGAAAVFE
                     KHPGARAFQYFGYGGYYQLEKPNAPAAIAWAEGLARRLDEKGVAKAHKTAVTNARAYV
                     ERGDLTSEVAAGALWWSMPLPAPREEPAKRTHDSAGTLSEKNKKPRRGDAAKDTFDER
                     EEVKDAGADEFEFPRMSKTFVGGERKEYTPTLSVLSLGKPPPFERIHRSVFVSRPPPV
                     KLHKSETAVCDCHPPPSRGDSETIRDGCGQECLNRKLRFSCDSRTCPCGDACSNRPLS
                     QLPAPKTKIIRTENRGWGLTLQEPVRAGTFIVEYAGEILDEHECAERLWYDKQSGEEN
                     FYLMEISANYVIDAKFKGSIARFINSSCHPNCETQRWVDASTNETRVGIFATEDIASG
                     TELTYDYNFAHFGDEKGTSFVCMCGHPKCRGTLDAAKTSKKNLHRRLRVEIMVNGKVV
                     KSRKKKQKVKATVVDYDAAKNRYKVQVEGDEKETFAWVRLDGEGAAKHSWLSK"
     gene            <519303..>519875
                     /locus_tag="OSTLU_41673"
                     /db_xref="GeneID:5004944"
     mRNA            <519303..>519875
                     /locus_tag="OSTLU_41673"
                     /product="predicted protein"
                     /transcript_id="XM_001420983.1"
                     /db_xref="GeneID:5004944"
     CDS             <519303..519875
                     /locus_tag="OSTLU_41673"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421020.1"
                     /db_xref="GeneID:5004944"
                     /db_xref="InterPro:IPR004192"
                     /db_xref="InterPro:IPR005806"
                     /db_xref="JGIDB:Ost9901_3_41673"
                     /translation="AVKTPAHTIDYDVSNHTVARAGDPDKRAFTYFVMTGGRMIYASA
                     LRLAVLKFLLSMSATADVLALASLEVDLSKVELGSTVTVKWRGKPVFIRRRTPAEIAK
                     EESVDVASLRDPQADSERAPNQEWLVAVGVCTHLGCVPIANAGDYNGWFCPCHGSHYD
                     ASGRIRKGPAPENLEIPEYKFLDGDKMLIG"
     gene            complement(<520012..>520338)
                     /locus_tag="OSTLU_27280"
                     /db_xref="GeneID:5005052"
     mRNA            complement(<520012..>520338)
                     /locus_tag="OSTLU_27280"
                     /product="predicted protein"
                     /transcript_id="XM_001421136.1"
                     /db_xref="GeneID:5005052"
     CDS             complement(520012..520338)
                     /locus_tag="OSTLU_27280"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421173.1"
                     /db_xref="GeneID:5005052"
                     /db_xref="JGIDB:Ost9901_3_27280"
                     /translation="MHYRAQRLSERLALVALSTSAIVAFACGWFASDYDLLKRIYFGG
                     VCGTVAIVVPHWEWIYGSKDGMKWRASTGRLKAREGTPEPLAAETKKKPKRRAAQRKA
                     GTKTVI"
     gene            <520512..>521024
                     /locus_tag="OSTLU_93648"
                     /db_xref="GeneID:5004945"
     mRNA            <520512..>521024
                     /locus_tag="OSTLU_93648"
                     /product="predicted protein"
                     /transcript_id="XM_001420984.1"
                     /db_xref="GeneID:5004945"
     CDS             520512..521024
                     /locus_tag="OSTLU_93648"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421021.1"
                     /db_xref="GeneID:5004945"
                     /db_xref="JGIDB:Ost9901_3_93648"
                     /translation="MSTSYAHGATVTKGTTASGESFRGEIFAYDDGAKLLVVRTPGEI
                     SNSYDLKFVNVAGAKDIEIDASTAKDPEALPTVDDPRRERRFEAACRAAKTAGDNIGE
                     NVSALAQDVFDALARTLPCKWNKDVIVVMDEVDVVGPKYDAASGSGQTPGALERVQKV
                     LELERAKLGL"
     gene            complement(<521435..>522001)
                     /locus_tag="OSTLU_6182"
                     /db_xref="GeneID:5005053"
     mRNA            complement(<521435..>522001)
                     /locus_tag="OSTLU_6182"
                     /product="predicted protein"
                     /transcript_id="XM_001421137.1"
                     /db_xref="GeneID:5005053"
     CDS             complement(<521435..>522001)
                     /locus_tag="OSTLU_6182"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421174.1"
                     /db_xref="GeneID:5005053"
                     /db_xref="JGIDB:Ost9901_3_6182"
                     /translation="WFQLRASRLTASAFGNAIGFWREGRNELWEEKLGLREGFAGNEA
                     TEWGSSKEDEAVRVYEAFAGRKVSHLLFNVLSADDAELWIGASPDGLIGTNAADVDGE
                     IGGVLEIKCPFNKGSPTTASPYAKVPWYYVPQVQGLMAVFDRPWCDLVSYTVNGGVAI
                     YRVERDHDYWNLLYECCSEFWWQHVVPGK"
     gene            <522835..>523419
                     /locus_tag="OSTLU_17952"
                     /db_xref="GeneID:5004946"
     mRNA            <522835..>523419
                     /locus_tag="OSTLU_17952"
                     /product="predicted protein"
                     /transcript_id="XM_001420985.1"
                     /db_xref="GeneID:5004946"
     CDS             522835..523419
                     /locus_tag="OSTLU_17952"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421022.1"
                     /db_xref="GeneID:5004946"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="JGIDB:Ost9901_3_17952"
                     /translation="MSRDAVDGVATPVRFASLTDATERDLRALNAVLFPVRYGDAFYD
                     DCRRAGGCTQLAYAMDERGSGSATTTTMTLAGAIACRLEMNAASDGAKLYIMTLGVYA
                     GRRDGKIGSRLLTHALNVASRDAFVKEAYLHVQTNNFQAFEFYERFGFEKGEVVKNYY
                     KRIEPPDAVILRRDLGASWTERELEGVTFDEDAA"
     gene            complement(<523573..>526383)
                     /locus_tag="OSTLU_41620"
                     /db_xref="GeneID:5005054"
     mRNA            complement(<523573..>526383)
                     /locus_tag="OSTLU_41620"
                     /product="predicted protein"
                     /transcript_id="XM_001421138.1"
                     /db_xref="GeneID:5005054"
     CDS             complement(523573..526383)
                     /locus_tag="OSTLU_41620"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421175.1"
                     /db_xref="GeneID:5005054"
                     /db_xref="InterPro:IPR003111"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR008269"
                     /db_xref="JGIDB:Ost9901_3_41620"
                     /translation="MYATRAIARRLERHAARCKGAHVARAVRGARARTTSAPRALLDA
                     LGAGRGDADAFGTRTRRTRNAFVSSVDGDGSTGSTGSSSSSSSSAFGDSASSGGIMVS
                     ASHPSSHPQVLAVPLPRRPLMPGIIMPVKVTDEKLIAELEDMRNRGQAYVGAFLQRTD
                     AASSASKGEGEDVFDALSAMKRTTTSVGLDGEEMVDEDEVDPADHMHDIGTFAQVHNI
                     VRLPTDSTTGEESATLLLLGHRRLRKLGTMKRDPMVVKVEHLKDEKFDANDDIIKATT
                     NEVVATIKDLLKTNPLHKETLQYFAQNFNDFQDPPKLADLGASMCSADDAQLQHVLEL
                     LSVKERLDATLELLKKEVEIGKLQADIGKKVEEKISGDQRRYFLMEQLKSIKKELGME
                     RDDKTALIEKFTKRFEPKRASVPEDTAKVIDEELQKLGGLEPSSSEFNVTRNYLEWLT
                     SLPWGVCGDEKLDISHAQEVLDSDHYGLEDVKDRILEFIAVGQLLGTTQGKIITMVGP
                     PGVGKTSIGQSIAKALGRKFYRFSVGGMSDVAEIKGHRRTYVGAMPGKLIQCLKSTGV
                     CNPVVLIDEIDKLGRGYQGDPASALLELLDPEQNGTFLDHYLDVPVDLSKVLFVCTAN
                     VLDTIPGPLLDRMEVVRLSGYITDEKVQIARTYLEKAAREKSGLSDVDASITDAAMGK
                     LIGDYCREAGVRNLQKHLEKVYRKIALKVARAKSADEKLDSIVVDVDDLVDYVGQPPF
                     ATDRIYDVTPPGVVTGLAWTAMGGSTLYIECTAIDSGDGKGALKTTGQLGDVMKESST
                     IAHTFTRGFLELKDPGNKYLADTSLHVHVPAGATPKDGPSAGITITTSLLSLAMNKPV
                     KPNLAMTGELTLTGRVLPIGGVKEKTIAARRSGVKTIIFPEGNKKDYDELSEDIREGL
                     DAHFVSTYDEVYRQALDWEASS"
     gene            <526820..>527731
                     /locus_tag="OSTLU_41926"
                     /db_xref="GeneID:5004947"
     mRNA            join(<526820..527477,527535..>527731)
                     /locus_tag="OSTLU_41926"
                     /product="predicted protein"
                     /transcript_id="XM_001420986.1"
                     /db_xref="GeneID:5004947"
     CDS             join(526820..527477,527535..527731)
                     /locus_tag="OSTLU_41926"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001421023.1"
                     /db_xref="GeneID:5004947"
                     /db_xref="InterPro:IPR006845"
                     /db_xref="JGIDB:Ost9901_3_41926"
                     /translation="MEATSACGRATTTTTTTTTRASKANEMRLLLDCAMFACTTGVNR
                     PTPGMELMNLRLRDERGDHGAATTTMKTGVEGPGLSIAQRIAYGLATCVVGYGWGLWQ
                     RKMLRERYDEDDEDDEGGGGWKYRAWKLSQTVENCYTMANFVNFCVFLRNGRYPTLLE
                     RALRARLVYQRPTMARVVDFEYLNQQLAWRELSELVLFTLPYLYSTRVRSTLGALTSR
                     VVAVQAYRCVACGCREPIHPFVAEPCGHPYCYYCLRARLVEQPTSCACVKCGKRVAEM
                     RRLATTTS"
CONTIG      join(CP000593.1:1..528469)
//
DBGET integrated database retrieval system