GenomeNet

Database: RefSeq
Entry: NC_009374
LinkDB: NC_009374
Original site: NC_009374 
LOCUS       NC_009374             549133 bp    DNA     linear   CON 23-JUN-2017
DEFINITION  Ostreococcus lucimarinus CCE9901 chromosome 20, complete sequence.
ACCESSION   NC_009374
VERSION     NC_009374.1
DBLINK      BioProject: PRJNA19407
            BioSample: SAMN03081420
            Assembly: GCF_000092065.1
KEYWORDS    RefSeq.
SOURCE      Ostreococcus lucimarinus CCE9901
  ORGANISM  Ostreococcus lucimarinus CCE9901
            Eukaryota; Viridiplantae; Chlorophyta; prasinophytes;
            Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus.
REFERENCE   1  (bases 1 to 549133)
  AUTHORS   Palenik,B., Grimwood,J., Aerts,A., Rouze,P., Salamov,A., Putnam,N.,
            Dupont,C., Jorgensen,R., Derelle,E., Rombauts,S., Zhou,K.,
            Otillar,R., Merchant,S.S., Podell,S., Gaasterland,T., Napoli,C.,
            Gendler,K., Manuell,A., Tai,V., Vallon,O., Piganeau,G., Jancek,S.,
            Heijde,M., Jabbari,K., Bowler,C., Lohr,M., Robbens,S., Werner,G.,
            Dubchak,I., Pazour,G.J., Ren,Q., Paulsen,I., Delwiche,C.,
            Schmutz,J., Rokhsar,D., Van de Peer,Y., Moreau,H. and
            Grigoriev,I.V.
  TITLE     The tiny eukaryote Ostreococcus provides genomic insights into the
            paradox of plankton speciation
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 104 (18), 7705-7710 (2007)
   PUBMED   17460045
REFERENCE   2  (bases 1 to 549133)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (22-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 549133)
  AUTHORS   Grigoriev,I., Grimwood,J., Aerts,A., Salamov,A., Zhou,K., Lou,Y.,
            Pitluck,S., Schmutz,J., Myers,R.M., Lucas,S., Detter,J.C., Glavina
            del Rio,T., Putnam,N., Rokhsar,D. and Palenik,B.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (21-FEB-2007) US DOE Joint Genome Institute, 2800
            Mitchell Drive B100, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP000600.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..549133
                     /organism="Ostreococcus lucimarinus CCE9901"
                     /mol_type="genomic DNA"
                     /strain="CCE9901"
                     /db_xref="taxon:436017"
                     /chromosome="20"
     gene            complement(<738..>13925)
                     /locus_tag="OSTLU_43542"
                     /db_xref="GeneID:5006508"
     mRNA            complement(<738..>13925)
                     /locus_tag="OSTLU_43542"
                     /product="predicted protein"
                     /transcript_id="XM_001422593.1"
                     /db_xref="GeneID:5006508"
     CDS             complement(738..13925)
                     /locus_tag="OSTLU_43542"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422630.1"
                     /db_xref="GeneID:5006508"
                     /db_xref="InterPro:IPR004273"
                     /db_xref="JGIDB:Ost9901_3_43542"
                     /translation="MRQRAIKSIETSSPLTDLAAHAHTFMSKLLDASNSHRTVLYVPD
                     DQSTGNLESVVANWSRQLRQVLGRGGDVGEDDESKRDAQRLDERVQSDGPLMRIMKFW
                     PERATDLRGVQEQLQSESVRLIVKKLASQKNANYLCDDIAAFEQLIVDRVHLAERISD
                     MFSRVKPACEALSVARLADVPQILPRLVDAIFLAWLNTDSNIKDAVSDQYVDLLKRIA
                     DQIMIICKGELNLNHIIQNDGSNEEAYNGAVCTLRECAFVADVWKNIYFERAAIESSG
                     ALLIDATTVFSHLDAFAHRCRDLLELCEAQEQFAPPASRSFPSAANVVRYRLDDRLEV
                     IRRVFLDVAINDLTKIEYDILDVSSMRWHDDFAAFKSRVKKLEMKMCAIFGEACERAE
                     TLQARVSLLRLLFTKIARRDGVVRAVESCAARAYSMFAEDLQCAKRQFDANRMKPPIE
                     SSLPRTFGAVHWANTLLHRLENDFGELRRAHAEGALPQLPESVDLLAVYDLTIPQIER
                     FINEKYDEWVVYVNAMNVEERLDQPLLRADDDGLLFITYAVDVGVACEDARGFASMSR
                     EVPANIKEVAFGGMRCAHDALCERLSSLVERNNTLLRQIGRDKHVNRLFRANVDILKN
                     LFAAASKELTWRSEISTIDAFCAESDKLCSFMSESLEKFRGSAARITEILEELSAVSL
                     RRREGDHVDPLDEFKNIYEQETVHIRSKFGETSATILHLTSHQRQSIGDVDTASEAWI
                     AYIKDIEDAVVRALRKVLLRTLSHLHLTMGRVESDCAPLKPVVLMSMNLSSCDVGTMR
                     VETSPQTTQLCETINTVFDAALDAYGSVPQISPLNESIQDRLLRDNRDMISRVRSSVT
                     NSVKDIAEDLMRFAARWEERYFHLWRENAVDVSDNSAIEARIHRVQESMEDVRSEEHT
                     HVIGFVRIECGYLKQSLLALAQNNVQGMISELRAKAATEIDDVMRYFEMSVARFEQPP
                     SDINELVKHVSELKQLQTNVDSVPASFVKPRDSFRILNEFVDVTETESQRLASIDDKF
                     EEFKFQLEKIESSLDATKDVFQNELRTSIVQLEKDAREYKVKFDRLAPMQTHPACAKR
                     ACDKSWEFIAGVDEVIEQFDHRLRVILNGLVVFEDLAPPTLVDMEELKADLEQLKMVW
                     RVVREWNDLYEGWKDGKFNDLDVESMENGATLLYKQITKLGRGKVKEWGTWISLKDTV
                     DSFKRIMPLIVDMRNPAVRRRHWELVMEACGKQFDPTSEGFTLDKVVELGLDHYAEAI
                     SEISTDATKELSVENTLRGIADVWTNVVLDTGPFKEGRDDVMKLRSADDIFTALEDNT
                     VTLSTLKASKFFSVFERTITSWEKTLGVVNDVVEMVLKVQLAWMYLENIFIGSEDIAR
                     QLPSETEMFGTINTRFIKLMQEMHKTSNVVLACTAMRAPDIGDTPDVSLLNELSAMDS
                     NLERIQKSLDDYLESKRQMFPRFYFLSNDDLLQILGQAKEPQNIQPHLKGMFEGIKKL
                     EMYAPDPLTGRRHCESVAMTSPDGETIPFDNPIRTEGRPEEWLNTVEAAMYSATRTHL
                     ASTFEQCRAKGIKKDKWVKDNPGQMLITAGCISWTMECERALRDPENVKEALKKLRRK
                     WIQYLNKLVELTRTPLDKVTRKKVTALITIEVHARDAIEKLIKTGCSSPNDFEWVSQL
                     RFYWDRETRHCTVKQVLSVFDYGYEYQGNNGRLVVTPLTDRCYMTLGAAMFTRRGGNP
                     LGPAGTGKTETVKDFGKALARYVIVFNCSDGVDYKMTGKMFSGLAQTGAWACLDEFNR
                     ITVEVLSVVATQISVVMAAVKQNLKMFDFEGQRIRLIPSCGVFVTMNPGYAGRAELPD
                     NLKAIVRPVSMMVPDFCLIAEIMMFSEGFTNAKPLAKKMVAIMELSQQQLSKQDHYDY
                     TLRSFIIPISRAAGAKKRQAPQADEQLILFNAMRDLIIPKLVYIDIPLFKALLNDLFP
                     EVNAPHEDSATLREALVQECRLNNLQPVDAWISKIVQIFDCKSARHGNMIVGKTGSGK
                     TRAREILIKAMSRLKQSGVQGDFQNVEVYPINPLALSNDELYGSFDEATHEWSDGVLA
                     KIMRNVCKDESANQKWILMDGPVDTLWIESMNTLLDDNKLLTLLSGERIMMSPQVSIL
                     FEVEDLSQASPATVSRAGMIYFNVEDLGWQPYVASWRCERKNRDRSDVDIEDALSNCM
                     DKYMDEVLGFKRSKCREPVATDELASIHQFTTLFDAHHIQSVGDVEPIFVFCIVWSIG
                     GSIDHASRLRFDAMLHRIMPLKLFPHTPASAPTDTTVFDFYYDAERRAFVPWVEKIPT
                     YHLPHENTPFFKIMIPTVDSVRTKHLATLLLKAGMNTLIVGNVGAGKSMVVDSCLSEL
                     PEGYIGSRITFSAQTSSNSLQETIEGKLEKRSKGSLAPPGGRKLILAIDDLNMPKKSE
                     FGFIPPLELLKLWHDNGFWYDRSKQERTHVSDMKLLAAMAPPGGGRNPFSQRVLSIFA
                     VLNMVDPSDAQLERIYGTILGETQGGFDQSIASIGTTIAKASIAVYNSLARELLPTPT
                     KSHYLFNTRDLAKVIQGVTRATKQFYDSKESILQLWIHENLRVFGDRLWDVNDSSWLR
                     RQIDTNMRLHFGVSWNEVLSTGATTSVASEVDEKLNECHPFVSFMRQGLDVPPYEAVV
                     DAPALKEFLTEKLEDYGLEPGNAPMDLVLFNDAIMHVCRIHRVLTQPRGHAMLVGVGG
                     SGRKSLARLAAYVAEMKSFSIEITKNYKQLEFREDLKSLYRQTGVAGKPTVFVLDDTQ
                     IVKETFLEDVNNALTSGEIPGLFAKDEISAICEDMRKIAKAQSIRAVTHDELFAFFME
                     RVMQNLHIVLCMSPIGDAFRERTRMFPGLVNCCTINWFKDWPVDALEEVAMKKLRDDD
                     VNAKVKADLCKIFGMIHASTVSTADEMFNAIKRKMYVTPTNYIEFVNFFRALMVEKKR
                     EFNAKITKLRGGLTKLAETEVQVREMQSVCKDKAAVVAQAKKDCEELLKVIVQDKRAA
                     DEQSMRVSAEAERIEVEAKKANAIADECQLKLDEALPALQEAEAALNVLTKKDMGELK
                     SYVKPPALVELCLKGVLTVLKRPTTWDESKKQLGDSGFLERLLNFDKDTLVDSLLTKI
                     AKFVNNPDYQPDVIGKVSNAAKGLCKWVHAMYSYGNVAREIAPKRLMLKQAQDELKGK
                     QDALALTQANLAEVMAKVAALKENYEKSASNKASLENELADLELKLERAEALVDGLSG
                     EKKRWVKSIEDFESQIERLPGDVCIAAAFMSYAGAFPSEYRKALVTDCWMPMLKEMAI
                     PCTLEFDFASFLANPSDVRDWNIQGLPADSFSTENAVIVTRGNRWPLLIDPQGQGNKW
                     IKSMESANGLIVTTLHAPDMVRQVEHGIQFGVPVLIQDVKETIDPILENIVAKVFIKK
                     GGSVTVKLGDKDLDYSPKFRLYFTTKMMNPHYTPEVSTKLAVTNFTVKEQGLNAQLRD
                     LVVRRERPELDAQKNELVVKVARGKRKLSELEDLILDLLSRASGSLLDNIELIDSLTR
                     SKNTSEEVTASLKVAETTGVEIENAAAAYAPVAKRATILYFTLYNLADIDPMYQFSLD
                     AYTSLFDASITKSRRQNADEDSVDVNERLAILNDYHTYAVYRYTSRGLFESHKLLLSL
                     QMCVRIQSEEGAIPSAEWQYFVRGSAGGVREKHEVVMRAEVGAWLSTDQWSNVVALAR
                     AFEDALSDLPTSINEMHADEWRVWYRHSKPETQALPGAWGESLSALQKLLILRALRLD
                     RVESAIRQFVADNLGAKFVDPPVLNLNEVYFDSACEVPCIFVLSAGVDPVANLRQLAT
                     SKGMSDKLFTVALGQGQASIATELIERGRKEGHWVFLANCHLMISWLPKLQEIIEDFD
                     SEAPHENFRLWLSSNPTPAFPLAILQRGLKMTTEPPKGLRANLARLYSTCVSEESFAQ
                     CANKTKYGRLLFSLSFFHALLLERRKFGTLGLNIPYDFNDTDFSVSDDLLKSYLDGYE
                     ETPWDALRYLIGEANYGGRVTDEIDRRVIKAYLLQFFCEDVLREEAAYELCEGPSGKV
                     YCIPSNTNELKNHREFVNKLPLSDQADAFGQHPNADISYMIAESEAILSASAKFQVCD
                     GGSTASSSSSAAAQMEANVLAVIGEMLETIPKPLDYGAIAQKKSTDMSPLNVNLLQEI
                     ERYNALLGTLSLTLQRLRKGINGTVLMSSELDDVYDALAANKVPAAFLKAYPSLKPLT
                     SWTLDLICRVEQLSAWGHGTYPKTYWLGGFTYPTCFLTSVLQMTARRDGIAIDALSFS
                     FSIVDESDSDQSPEDGVYVRDLYLEGAGWNHEKKCLCEPDTMKLIVKMPVMHFKPTER
                     KNKASASNVTYQAPLYMYGRRTGTRERPSFVTMVDLDAGGVDPSQWIKRGTALLLSLS
                     N"
     gene            <14734..>15888
                     /locus_tag="OSTLU_29296"
                     /db_xref="GeneID:5006688"
     mRNA            <14734..>15888
                     /locus_tag="OSTLU_29296"
                     /product="predicted protein"
                     /transcript_id="XM_001422413.1"
                     /db_xref="GeneID:5006688"
     CDS             14734..15888
                     /locus_tag="OSTLU_29296"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422450.1"
                     /db_xref="GeneID:5006688"
                     /db_xref="JGIDB:Ost9901_3_29296"
                     /translation="MIDTKRMNATLKDVGRWKRREYGVDACEVTILNLHAMSVGDVVR
                     AMRESGSSLSSGDACLVHETLPTTDGAQISIRALFKCFSRELEDELTKPLEPAYESGA
                     RADALVDEPNAAETVGLVHVEHRPTRVKNSKELAEAPPRNVLESTFDLPATRLADFAS
                     PLIACESDTRWRDAIEELDERDRHAIFFTIDDDTHCVVTAEDIVHFLGVAETLRLAIG
                     QCFDERVLFDTTQDTFIVVHQEHNYDITAADCFRWLHREGEGVNACVFVESSFRVPGD
                     THIDRHGHIICELSVRDLLDLTPDNFDQIFKVDPVTYVSTKPRLRGTCRGVFVEGQSG
                     TSSESARSSIEKLAKKAPRRLPRRFYVIHRERVRAFTPLSLLRTIVACSA"
     gene            <16016..>16615
                     /locus_tag="OSTLU_18911"
                     /db_xref="GeneID:5006509"
     mRNA            <16016..>16615
                     /locus_tag="OSTLU_18911"
                     /product="predicted protein"
                     /transcript_id="XM_001422414.1"
                     /db_xref="GeneID:5006509"
     CDS             16016..>16615
                     /locus_tag="OSTLU_18911"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422451.1"
                     /db_xref="GeneID:5006509"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="JGIDB:Ost9901_3_18911"
                     /translation="MVVKAPKDYAREPPRGWSSKWSWTTLDGDDRAQTGADARKLFEE
                     PQFHKRARIGDLLGVRAMLDARTVDVDDVDAGGRTALHFAVGFGREHVARELLDRGAA
                     LETRDDWGKAPVDFAMQGLHDECIQMLRMEAVKRGVWGGRGRVAPLKTYYEYAYNLTN
                     EEVHVQIEKHAREASENYTRQAKADSASYNEQRAELQRAK"
     gene            complement(<16734..>17606)
                     /locus_tag="OSTLU_43808"
                     /db_xref="GeneID:5006510"
     mRNA            complement(join(<16734..17396,17571..>17606))
                     /locus_tag="OSTLU_43808"
                     /product="predicted protein"
                     /transcript_id="XM_001422594.1"
                     /db_xref="GeneID:5006510"
     CDS             complement(join(16734..17396,17571..17606))
                     /locus_tag="OSTLU_43808"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422631.1"
                     /db_xref="GeneID:5006510"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="JGIDB:Ost9901_3_43808"
                     /translation="MDHGFDVPVSMGTTIMAVRYADGVILGADSRTSTGTYVANRASD
                     KITQICDNVWMCRSGSAADTQNVAAYVSRLAQEHAVSVSSAAAGADEVLTCDVKLVAN
                     LTKTIAYENKDRLQAGMIIAGWDRKLGPQVYGIPLGGSMVEAPFTVGGSGSAYVYGWC
                     DDTFKEDMSKEEAQAWVTNAISLAIARDASSGGVIRLVTIDGKGCERKMLQPIEHVLC
                     DDELPPVKRSVAST"
     gene            complement(17723..>19037)
                     /locus_tag="OSTLU_25814"
                     /db_xref="GeneID:5006689"
     mRNA            complement(17723..>19037)
                     /locus_tag="OSTLU_25814"
                     /product="predicted protein"
                     /transcript_id="XM_001422595.1"
                     /db_xref="GeneID:5006689"
     CDS             complement(18495..19037)
                     /locus_tag="OSTLU_25814"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422632.1"
                     /db_xref="GeneID:5006689"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="JGIDB:Ost9901_3_25814"
                     /translation="MPARTSRGVGRRARPATSTMRRAVETETETETETETDAESDGDD
                     DDDGSSTSQTELFGAIEDGDHDAFERALREDAACVKDVNSNGWTAAHQAAYSGEHKML
                     RRVLELGVDVNARCADGCLAAHYASAQGEKKCLQVLGELGSEFETKDKDGESPLDVCT
                     RGVRELLADLIVEARKRNAK"
     gene            <19272..20919
                     /locus_tag="OSTLU_29301"
                     /db_xref="GeneID:5006690"
     mRNA            <19272..20919
                     /locus_tag="OSTLU_29301"
                     /product="predicted protein"
                     /transcript_id="XM_001422415.1"
                     /db_xref="GeneID:5006690"
     CDS             19272..20918
                     /locus_tag="OSTLU_29301"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422452.1"
                     /db_xref="GeneID:5006690"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="JGIDB:Ost9901_3_29301"
                     /translation="MSTRRRARASPTREKTTTEEDADACRFCFESAREDDPLIAPCAC
                     RGGQEYIHAKCLLRWQRMVVVQAPTHPAFWNEDTRSNVCNVCKEAFTTPPPTRMTLMS
                     SFTGAEIAAMCAVGHLLVSHAAFSAKLREKLQDMNPAMRRICSYEYWIEGTYLITETR
                     ASSDEAGESSEGDVGDDTIVAVNLNGRCDVSEFIQGESQLFEIVGAGGQSRVRLRQEF
                     EEGNDDDDDNDDDNDGDNDDDNDDDNDDDERNTADVDDADVTNEDADEDDLPRDEIAD
                     DAEQTPELVIEVPEDVADDREAFIEHLQQLLSPSIFEVYQRFRRRRVIEDAYDEVARE
                     WRVTRQDVENAVEIEPFDGGPCDHDEVALCIVVGTDTSCGYTKVEGSLAGAISVAFRN
                     SRAYADSTDGLRAGAVVTCAATADVREAVGVLCGFSEESNTWNVASPFGVLKRTREEF
                     EVLRSPTRAKVLCFFGTAQWNRSQLLGEIARGHWGLTKSEPVDVARAETAYRRAMDSG
                     SLVFAPLTEMTEEFMRDELAEMSRIRSSGQLDRAGSSASH"
     gene            complement(20987..22269)
                     /locus_tag="OSTLU_25817"
                     /db_xref="GeneID:5006511"
     mRNA            complement(20987..22269)
                     /locus_tag="OSTLU_25817"
                     /product="predicted protein"
                     /transcript_id="XM_001422596.1"
                     /db_xref="GeneID:5006511"
     CDS             complement(21522..22145)
                     /locus_tag="OSTLU_25817"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422633.1"
                     /db_xref="GeneID:5006511"
                     /db_xref="JGIDB:Ost9901_3_25817"
                     /translation="MSRRDGRRRRPRAREDVVTTLLRRREARARATRAGDDDDAGEND
                     AFVDAAETWATDDGRGRREATTTRTSRSSASASSSSSSASSYASARAREDEDEDAKAW
                     TSTRDARELGWGPRPSNEARERAARAKALAKRLLEGDEDEPTARGEIVGGEVARDVGS
                     ERLRSVLTIDSATSGGDSDPERLAKRRARRRAAKRRHERRLREGVFT"
     gene            22436..24503
                     /locus_tag="OSTLU_29304"
                     /db_xref="GeneID:5006691"
     mRNA            22436..24503
                     /locus_tag="OSTLU_29304"
                     /product="predicted protein"
                     /transcript_id="XM_001422416.1"
                     /db_xref="GeneID:5006691"
     CDS             22535..24436
                     /locus_tag="OSTLU_29304"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422453.1"
                     /db_xref="GeneID:5006691"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="InterPro:IPR004112"
                     /db_xref="JGIDB:Ost9901_3_29304"
                     /translation="MRACERGCVAARNALTTSASGSGSGSGSGRSIATAASSSTSSYE
                     IIDHEYDALVVGAGGAGLRAAIGLGEHGFKTACVTKLFPTRSHTVAAQGGINAALGNM
                     TEDDWRWHAYDTVKGADWLGDQDAIQYMCREAPKAVIELEKYGMPFSRTDEGKIYQRA
                     FGGQSLDYGKGGQAYRCAAAADRTGHAMLHTLYGAALKHDVQFFVEYFALDLIMDKGE
                     CVGIMALCLEDGTLHRFRSHQTILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQ
                     DQEFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGERFMERYAPSAKDLASRDVVSRS
                     MTLEIREGRGVGKEKDHIYLHLNHLPPELLAERLPGISETAAIFAGVDVTKEPIPVIP
                     TVHYNMGGIPTNYKGEVVAPKNGDPDAIVPGLLAAGEAACASVHGANRLGANSLLDIV
                     VFGRACANTVADKLKRGAPHREIASDAGSNAIERLDKIRNSKGSAPTAMLRKTMQKVM
                     QEDAAVFRTQETLANGCKRIDDVAAQLDNLKLTDRSLVWNTDLVEALELHNLMPNAQT
                     TMHSAEQRKESRGAHAREDFPDRLDDVWMKHTLAYVENGKVKIDYRPNHHYTLDAEMD
                     VIPPKARVY"
     gene            <24613..28060
                     /locus_tag="OSTLU_25819"
                     /db_xref="GeneID:5006512"
     mRNA            <24613..28060
                     /locus_tag="OSTLU_25819"
                     /product="predicted protein"
                     /transcript_id="XM_001422417.1"
                     /db_xref="GeneID:5006512"
     CDS             24613..28005
                     /locus_tag="OSTLU_25819"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422454.1"
                     /db_xref="GeneID:5006512"
                     /db_xref="InterPro:IPR005612"
                     /db_xref="JGIDB:Ost9901_3_25819"
                     /translation="MAPPSEPAPELEADVKAYASSLGFAPRASDGAVTRGFDDRDFRA
                     EHLRKKEAAAARRAKEKSSTTREDDARDDGERGRGKKRAQTNDARANASQKATRDKAN
                     DGKKTSRDDGDGDGDGDAAARERPSGKKRPWNPGAGPMPSKGDVKGGKSNRDGGANAS
                     ASGGAWYEASEALDAELGSAGKRGKSKSEPTRGELEEKERMAKNALEDRVNTYAKRMQ
                     RHSDANAKWLEMVRTNGTASDKVAANVLSVTEDPAANLKALENLLGIVERARASGGKR
                     GAVQSITALETLFRESLLPDRKLRYFSEQPLSVAASAPHERKRLMYWYVEDSIKRMYL
                     RFIAALDELSRDPLPILKEKSLKSAYALLKSKPEGERQLLNIMVNKLGDPSRKIASSA
                     SYLCLELIKAHPAMKRIVAREVEAFTFRRGVGLKAQYYAAVMMNQIPLGHKGDGPALA
                     EQLIEAYFGLFQYLYNLSLKKDPAKEEEAKPEVKKKDKKRHRDGGRGRGGRGGRGGRG
                     GRGRGGKDSNKPTQPVQIGAGVDARVVSALLTGINRAFPYVASEKMDALIDRISPALF
                     TIAHSPNLSGALQAMMLLFQLLSARSSVSDRYYRALYALLLHPGLLRSANNAQVLSLI
                     FKSLREDVVPKRSAAMVKRLLQVASQAPATFACGALMAVSEFLSKQPSHWNAIRVPRE
                     TEEDGVEHFSDVRDDEDETNEGTGLFEGDKTTERTPKATKSDSEKSSDDDEDADQANA
                     VDGEKGSNRVGGPSERYDMEKREPMYARAETSCWWELNVLAANAHPSVSAMSRTLLEG
                     KPIEYDGDPLSDMTLTVFLDKWLQKKPKKRSKGGSLVMRALESDASAAYMPGTDEFAS
                     LMESEVDPSDVFFHRYFANKTEKAAAKKKKADKKTTDDDDQAESESDADGELPKKKFD
                     DSESEGDDSEDELAVEEININDASDSEDDEELAIPLKKIRKNDFKEDSDDAADEEFGK
                     SERQEEAIEDERYDLDAFAAAYGRQPGYLIREAAERERAAEAKAIEAIKRAVQRTPTG
                     ANDEDTIDDDFTAGGVFASAEEYETMINTDAVNAVDPNKLDDDEADDEEADIEVNDDD
                     DDDDDDDDDDDDEPSPPPSKKTKPSPSSSSKKTSERRRSRAE"
     gene            <28316..>29704
                     /locus_tag="OSTLU_43499"
                     /db_xref="GeneID:5006513"
     mRNA            <28316..>29704
                     /locus_tag="OSTLU_43499"
                     /product="predicted protein"
                     /transcript_id="XM_001422418.1"
                     /db_xref="GeneID:5006513"
     CDS             28316..29704
                     /locus_tag="OSTLU_43499"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422455.1"
                     /db_xref="GeneID:5006513"
                     /db_xref="InterPro:IPR010339"
                     /db_xref="JGIDB:Ost9901_3_43499"
                     /translation="MTDIGLPTTSARALTRVERVGAHSHVRGLGLDDALDAKKSSQGL
                     VGQVKARKAAGVIANMIRDGTIAGRGVLIAGAPGTGKTAIAHGMAKTLGEETPFASMA
                     ASEIFSMEMSKTEALTQAFRKAIGVRIKEETEIIEGEVVEIEIDKPVGALASARAKTG
                     KLTMKTSDMETVYDLGTKMIDAISKAKVNAGDVINIDKASGRITKIGRSFSRSRDYDA
                     MGATTKFVACPEGELQKRKEVVHTVSLHEIDVINSRTQGFLALFAGDTGEIRAEIREQ
                     IDNKVSEWKEEGKADIIPGVLFIDEVHMLDIECFSFLNRALENELAPILVVATNRGIT
                     KIRGTEFRSPHGIPIDLLDRLLIIHTQAYDEREMKAILEIRCEEEDVDLADDAKDLLC
                     KIACETSLRYAIQLISAASLRASKRKSAKVDVDDVSKVYGMFLDVKRSTQFMLDYHQD
                     YMFNETDTAMEA"
     gene            29883..31176
                     /gene="RPP0"
                     /locus_tag="OSTLU_29307"
                     /db_xref="GeneID:5006514"
     mRNA            join(29883..30192,30323..31176)
                     /gene="RPP0"
                     /locus_tag="OSTLU_29307"
                     /product="Cytosolic 80S ribosomal protein P0; Cytosolic
                     60S large ribosomal subunit protein P0"
                     /note="Has EST support. CTZ94_A08.x1d_t"
                     /transcript_id="XM_001422419.1"
                     /db_xref="GeneID:5006514"
     CDS             join(30061..30192,30323..31132)
                     /gene="RPP0"
                     /locus_tag="OSTLU_29307"
                     /note="Acidic ribosomal protein P0, component of cytosolic
                     80S ribosome and 60S large subunit"
                     /codon_start=1
                     /product="Cytosolic 80S ribosomal protein P0; Cytosolic
                     60S large ribosomal subunit protein P0"
                     /protein_id="XP_001422456.1"
                     /db_xref="GeneID:5006514"
                     /db_xref="InterPro:IPR001790"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="JGIDB:Ost9901_3_29307"
                     /translation="MPSAAQLKKQGYAERVHKLLDNYDTALLVHADNVGSKQFMDIRA
                     SIRPESVVLMGKNTLMRKCISNYCAAKGDDTWMILSNKLVGNVGIIFTKGDLLDVRKK
                     IQQFVVPAPARVGAIAPVEVVVPAGPTGMEPSQTSFFQTLNIATKINKGTIEILNDIV
                     VLQPGDRVSSSAAALLGKMKFTPFTYGLIVMEVYDKGAMYPSAVLDITNETLEKKFMS
                     GVAQVASLSLASGYPTLASVPHSIVNAYKNVLAISIGTDYTFELAQKVKDYLANPGAF
                     ASAAPAAGGDAAAGGAAKAAAVEEEEEEAEMDFDLFD"
     gene            complement(<31336..>32250)
                     /locus_tag="OSTLU_29308"
                     /db_xref="GeneID:5006515"
     mRNA            complement(<31336..>32250)
                     /locus_tag="OSTLU_29308"
                     /product="predicted protein"
                     /transcript_id="XM_001422597.1"
                     /db_xref="GeneID:5006515"
     CDS             complement(31336..32250)
                     /locus_tag="OSTLU_29308"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422634.1"
                     /db_xref="GeneID:5006515"
                     /db_xref="JGIDB:Ost9901_3_29308"
                     /translation="MTSPKKEASFGKSSGTALNAYASASHVRAVDDGVVGELADRRFS
                     HGASKEKRAGGDGGLPPTSLSTRTTPIKGRGMSVDMDVVTQRASFQKYRGDEVGAASK
                     DVIKGPSWVQPTKSTSIVAQARKRAMHKRTMSEEPGAFAVAFGGSTPARTLSGRFEDD
                     IQENGNVDDSLSAEQFLQKIASVVESMRERHDFVRALTIETIELCKNLVELEAPVSAM
                     LRLEEIDETSETGTFDGCATDFVAANEGSDCSFAGAAISSSAARNLAEEGFGEMMSAP
                     SPTPTTSGDFSLEAVEAELRSVRRLIEE"
     gene            <33009..>33458
                     /locus_tag="OSTLU_29309"
                     /db_xref="GeneID:5006692"
     mRNA            <33009..>33458
                     /locus_tag="OSTLU_29309"
                     /product="predicted protein"
                     /transcript_id="XM_001422420.1"
                     /db_xref="GeneID:5006692"
     CDS             33009..33458
                     /locus_tag="OSTLU_29309"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422457.1"
                     /db_xref="GeneID:5006692"
                     /db_xref="JGIDB:Ost9901_3_29309"
                     /translation="MTRDEIESEFELVDASDVPTIGWWDASRGCETVAEAQTRARGVA
                     KYLMHKARAMAAGEEEEMDVCIVTHGMFIDMLLKTLFDVPRTRGKQGALFCSQNACVH
                     ELHLDIAEDGDSVGLQVFNDVTHIPEEARSGGTVDGLSEAYTNEGSA"
     gene            complement(<33563..>34438)
                     /locus_tag="OSTLU_29310"
                     /db_xref="GeneID:5006516"
     mRNA            complement(<33563..>34438)
                     /locus_tag="OSTLU_29310"
                     /product="predicted protein"
                     /transcript_id="XM_001422598.1"
                     /db_xref="GeneID:5006516"
     CDS             complement(33563..34438)
                     /locus_tag="OSTLU_29310"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422635.1"
                     /db_xref="GeneID:5006516"
                     /db_xref="InterPro:IPR007109"
                     /db_xref="JGIDB:Ost9901_3_29310"
                     /translation="MLRRTARLRREFVYRKSLEGKERELYEKKRTIRQCLEDGKAIPT
                     ELRKEEARLREEVHAEDAKTASYGARGVIDDEYAKAAEREPRVLLTTSRDPSSRLQQF
                     AKELKLLFPTSQRINRGSQILPDLVDLCRNGGFTDLVMVHEHRGEPDGLVISHLPFGP
                     TCYFGLSNTVMRHDIKDQDIGHVSEVFPHLILENFTSPLGKRTATVLKHLFPEPKAKS
                     KRVVTFANDADYISLRHHMYEMPKGAKSVALTEIGPRFEMRLYQIKLGTVEMDDCDIE
                     WSLRPFMRSGKKARL"
     gene            34809..36580
                     /gene="psbO"
                     /locus_tag="OSTLU_29311"
                     /db_xref="GeneID:5006693"
     mRNA            join(34809..34909,35221..35323,35605..36580)
                     /gene="psbO"
                     /locus_tag="OSTLU_29311"
                     /product="psbO, PSII-O, OEE1, photosystem II polypeptide,
                     oxygen evolving enhancer 1"
                     /note="Has EST support"
                     /transcript_id="XM_001422421.1"
                     /db_xref="GeneID:5006693"
     CDS             join(34842..34909,35221..35323,35605..36342)
                     /gene="psbO"
                     /locus_tag="OSTLU_29311"
                     /codon_start=1
                     /product="psbO, PSII-O, OEE1, photosystem II polypeptide,
                     oxygen evolving enhancer 1"
                     /protein_id="XP_001422458.1"
                     /db_xref="GeneID:5006693"
                     /db_xref="InterPro:IPR002628"
                     /db_xref="JGIDB:Ost9901_3_29311"
                     /translation="MASLTQSAVFGKKFTTVKASTKRATKTTVARASMNDFAEKVSKA
                     SVALGVAGAVLAQSAGAVTYDELQGLTYLQVKGTGLANTCPVVEGGVSGKEIKAGDYA
                     LERFCMEPTSFTVKEESQFKQGESEFSKTRLMTRLTYTLDGMTGSFKVGSDGSVNVQE
                     NDGLDYAPVTVQLPGGERVPFLFTLKEFTGKGNTSQFGGDFVVPSYRGSSFLDPKGRG
                     GSTGYDNAVALPARADSEELQKENQKNTAALKGSAVFNVAKYDPATGEIAGVFESIQP
                     SDTDLGAKVPKDVKITGLWYANLGSK"
     gene            complement(<36603..>37418)
                     /locus_tag="OSTLU_43543"
                     /db_xref="GeneID:5006517"
     mRNA            complement(<36603..>37418)
                     /locus_tag="OSTLU_43543"
                     /product="predicted protein"
                     /transcript_id="XM_001422599.1"
                     /db_xref="GeneID:5006517"
     CDS             complement(36603..37418)
                     /locus_tag="OSTLU_43543"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422636.1"
                     /db_xref="GeneID:5006517"
                     /db_xref="InterPro:IPR002088"
                     /db_xref="JGIDB:Ost9901_3_43543"
                     /translation="MKACEKLLGLCPEILTAWNYRRETIEARTGDAATTSEGGDEGEG
                     EGEGDWWSDELRVSETALRNNPKSYPSWYHRKWVLRRMIEAFGTEEGKARETLEREAK
                     LCADMLNADDRNFHCWAYRRFVAEKLGRGVDEELQYTLTKIENNFSNYSAWHYRSAIL
                     ESRGAADAETLEREFELASNAFYTEPEDQSAWMYHRWLTSRARAIEDAKDRESLLERE
                     RQTCREVSDLEPTCKWPLLALASLGDEHPREMFQNLAALDPARGGYYRERRSE"
     gene            <38050..>38541
                     /locus_tag="OSTLU_43627"
                     /db_xref="GeneID:5006694"
     mRNA            <38050..>38541
                     /locus_tag="OSTLU_43627"
                     /product="predicted protein"
                     /transcript_id="XM_001422422.1"
                     /db_xref="GeneID:5006694"
     CDS             <38050..38541
                     /locus_tag="OSTLU_43627"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422459.1"
                     /db_xref="GeneID:5006694"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="JGIDB:Ost9901_3_43627"
                     /translation="VDITLQTTTTENGAVKAMVFSTTAPVDVLEVERLCACAGWPDRP
                     RAKLKRALENSFMVATLYECDVDASTGNVGETSRGRLVGCARATSDHVFNSTLWDIIV
                     DPEYQGKGLGKALVQQMIRSLLARDVANVTLFADQDVIPFYRALGFVQDPEGIKGMFL
                     YPE"
     gene            complement(38990..>39798)
                     /locus_tag="OSTLU_29315"
                     /db_xref="GeneID:5006518"
     mRNA            complement(38990..>39798)
                     /locus_tag="OSTLU_29315"
                     /product="predicted protein"
                     /transcript_id="XM_001422600.1"
                     /db_xref="GeneID:5006518"
     CDS             complement(39421..39798)
                     /locus_tag="OSTLU_29315"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422637.1"
                     /db_xref="GeneID:5006518"
                     /db_xref="JGIDB:Ost9901_3_29315"
                     /translation="MRGASLARRPLARVVAAPRSSASRARRPRPRAATATADDVDRCA
                     LVCASKECKRKGALRTLETLTRRASELELGVAVRVQTTRCQSECADGPNVKLLPEGRV
                     LNGVRTTAEADEALERCATYAPE"
     gene            complement(<39855..>41348)
                     /locus_tag="OSTLU_94041"
                     /db_xref="GeneID:5006695"
     mRNA            complement(<39855..>41348)
                     /locus_tag="OSTLU_94041"
                     /product="predicted protein"
                     /transcript_id="XM_001422601.1"
                     /db_xref="GeneID:5006695"
     CDS             complement(39855..41348)
                     /locus_tag="OSTLU_94041"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422638.1"
                     /db_xref="GeneID:5006695"
                     /db_xref="JGIDB:Ost9901_3_94041"
                     /translation="METLPRDFSGDERSAASALHETAWAREETLREAFYAACESDAPL
                     CPAMYCPTRAVATLVDDSRDGGGDGDAAALRVAFAINVPSCSFELTPIHPPRLATNDA
                     SVAAQARAASGDESGATTGFVTLDRARRVVFLSEAARGTEDEPITGVWVQGSKRVDDA
                     ATWAACVRFACSEHLNKHTQRGKFLCARLFAGSSAPAFYEVSASHSSSPFVPYGVDLI
                     VRPGEPAEARATPIDEGVVPNYYRVRPQEYGAEHYGFVEDGDGEEEDATEEDDGEYDD
                     YEEEYDEEYEEERRQRAAQMEFLQREIDSLREAIVSASFVDGEEEDEDDGDRYQVIRR
                     RNYVDDEDDDDVSATVRRLAEDLSADVRRSRLEVATASDESEDGDARTRALDAPSFDP
                     KALGYVKLPTDEAQAEAYDDALRLVDEDIARLRAPSRLADDGDGALRAEPRAAVARDV
                     EEEDYFPRIKYDVSLERDDDDDDGDDEIIRRYLAAYGDDLLGAASSV"
     gene            <41894..>43483
                     /locus_tag="OSTLU_43434"
                     /db_xref="GeneID:5006696"
     mRNA            <41894..>43483
                     /locus_tag="OSTLU_43434"
                     /product="chloroplast lysine N-methyltransferase"
                     /note="methylates large subunit of ribulose-1,5
                     bisphosphate carboxylase/oxygenase; chloroplast targeted"
                     /transcript_id="XM_001422423.1"
                     /db_xref="GeneID:5006696"
     CDS             41894..43483
                     /locus_tag="OSTLU_43434"
                     /note="methylates large subunit of ribulose-1,5
                     bisphosphate carboxylase/oxygenase; chloroplast targeted"
                     /codon_start=1
                     /product="chloroplast lysine N-methyltransferase"
                     /protein_id="XP_001422460.1"
                     /db_xref="GeneID:5006696"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="JGIDB:Ost9901_3_43434"
                     /translation="MTSRVARDVFAVARSPRATRGTSRRRARWGDATTSKTRRPRTRA
                     RRDAASSADHDALHEWLSANGADVASVEFYDARAGDEDDGGDAGWGARATRALARGAK
                     AIVVPKSLWITPEVGMNDDELGKALRDEDVAGGLARWTTLALTLLKERERGEESKYAA
                     YVKTLPEVLHSPLFWNAEELSEIQGTQLLDNAAGYDGYVRGVYETLRTGMFAKHADVF
                     DVEGAFSEDNFRWAFGILRSRTMAPCDGANIALVPGVDLVNHSSLSQARWRVSGGVAG
                     AVAGLFGGGKGDDGVSARVECDRALNVNEPLYVNYNPEGTDTSFALDFGFVDTITPSP
                     GYALSLSVPEDDPNVFDKLDVLDVCGLGETPTFTLRAYSDPDPDLRTFLRLLNCKNQD
                     AFLLEALFRQQCWSLISEPLSRENEADCCASMTDGVAAALSAYASRALDEEKAYLMSP
                     PSARRAAAGDDERARVRKDVAVRVRLAEKSTLIETASFFDVIASGLDGMEYYQERRLR
                     SLNLLDEDGSSTYDPFNETMA"
     gene            <43913..>47764
                     /locus_tag="OSTLU_29318"
                     /db_xref="GeneID:5006519"
     mRNA            <43913..>47764
                     /locus_tag="OSTLU_29318"
                     /product="predicted protein"
                     /transcript_id="XM_001422424.1"
                     /db_xref="GeneID:5006519"
     CDS             43913..47764
                     /locus_tag="OSTLU_29318"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422461.1"
                     /db_xref="GeneID:5006519"
                     /db_xref="JGIDB:Ost9901_3_29318"
                     /translation="MGALNARTLATLARTGSRPTSPSARERRAGTATESRASETLEIP
                     TREVDYGRGGAGRTGLKPGDVVALVTPEEGYPYACVSEIDEARDGERRYRYAIDAGGK
                     GGNAALRERAETQLEVLQHNGFVGFRSAFARDRLLQATRHARNRLGFVSANFGTWEEW
                     ILDEEEKRKLNDGAWTRCEVTLKHRRLDAYRLRVTMVRVGRIVGAGVGDGEQEEYKLG
                     TSVSRQSTPGGTTRALSAVDRFRLTREGEAAEGGRGAPSRPHAMHAMGGALMKEWAAA
                     LEKEVAARRVIEQELHDLHESDDKLREWALTELNRLRQFAQSEVDSLAAEVEERNKKM
                     VDLKQQRRALELRAKMLESLDEERLNSIVASFRGMQRGTLLRRAFSHWRRESGSMGVM
                     HNKSIENAFARYQAKDYKKNLLKRALEVWRREASKEKRARRVYSSVLNRYCHVAFRTW
                     ASEMRSSKLRREIAERIAPSRRIGVHLNNALTIGFQMRGALKQHQFRRCVVAHAQKIT
                     GVRVDLVEAAFDCGEEMETAATYALSDSLSDPLGSINLAREAVLRHVSGDDVASGAVV
                     HAFDQGIAVASRMIQVRQSYIWMNADTVEEAAALTVAYDLGESSDNASSQNRAMARGK
                     LIVDVSKLPPRISRLILGAFYRGNFVRDYADSRMSNIDEKDAFCAGLEAGLCQYKRRE
                     FTSQARSPEELRLVATAFDGGIAYACLSSTSNSYTKVQMVLDSVEDENQRSVSWMRET
                     LMTTVEVGAGNVASTNTEFLLHKILYPLRTDMMRATLHAWRKKHRESKEDELTVTRFQ
                     RRVNRRLVKEALFSWRNSASLNKKRFMILRRVGLRIKNASMAKYFDTWSANVDKLSAD
                     RVRLTRFKTRLTHRLLAAAFAAWAEVSSKRDDRLEKMANVLNKRMRRFELSKAFAGWA
                     DKAFTAISNREKANKFIARYRMRLLTRTLYGWHENAQKSKSNRKKVQKVISRSQNRLA
                     ASAFYKWRELVTSKSRQLLLLRRFVDRMRNGVKASAFDKWFEVTQNEKRKRAVITKVF
                     SRIKNEQMAHAFGRWREFAAESYDAKVNLRKIVSRMLRLRLSQSFTLWNENVVELRRQ
                     RAVLARFVGRMRNRCVTACFYAWVEALEERKRASKQDAYRDRLVANVLWRTNRSTLRA
                     AMHQWRMVVEERETHRELIRRNLRSKRVALNFFMTWYWDAFDGDIQSTVADMFGQTRS
                     YMNEAFDDFDEGSAQAALNFVGYYDDDKDIVIDSPPPPTWEGDAAGIHDDDDDDDDDD
                     RLFHTPGKVGRRADDQDDFTY"
     gene            <48176..>49045
                     /locus_tag="OSTLU_18927"
                     /db_xref="GeneID:5006520"
     mRNA            <48176..>49045
                     /locus_tag="OSTLU_18927"
                     /product="predicted protein"
                     /transcript_id="XM_001422425.1"
                     /db_xref="GeneID:5006520"
     CDS             48176..49045
                     /locus_tag="OSTLU_18927"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422462.1"
                     /db_xref="GeneID:5006520"
                     /db_xref="JGIDB:Ost9901_3_18927"
                     /translation="MSAWTSPLELGDDGHDFARTRIDERLERALAGRRGTYARKSLAR
                     AFVADAREGAPRAAPRVVVVAVDSEAGREIARAVVRGTRGKKYGAVLSADADCGEAAL
                     GAEDGDDAWTTLYESGEGAPRVVIAETLKDISPTGARAWARETLRACGCEEGGETKVL
                     ALTSCSEHETSEAEMSLGAIDRVVAYALDTTRVRMDRDGAWPASPRPLPVGLLLRSNG
                     AAAIASACEALGVAARVIAIPESEPVRVIHGGADVGASREAAAHASALVGCAVECEFK
                     PRMAPTRAENLYA"
     gene            complement(49113..50825)
                     /locus_tag="OSTLU_29320"
                     /db_xref="GeneID:5006521"
     mRNA            complement(49113..50825)
                     /locus_tag="OSTLU_29320"
                     /product="MscS family transporter: small-conductance
                     mechanosensitive ion channel"
                     /transcript_id="XM_001422602.1"
                     /db_xref="GeneID:5006521"
     CDS             complement(49149..50384)
                     /locus_tag="OSTLU_29320"
                     /codon_start=1
                     /product="MscS family transporter: small-conductance
                     mechanosensitive ion channel"
                     /protein_id="XP_001422639.1"
                     /db_xref="GeneID:5006521"
                     /db_xref="InterPro:IPR006685"
                     /db_xref="JGIDB:Ost9901_3_29320"
                     /translation="MRALDEFDALRGRVRKTTTDAMRTSLQTVGDFMGRVEAKTQEDW
                     HIEDVWVLVAWNWCIRRGREKLFEAAERAKNALNPSRTPKTFRGSFLDWFRQPMQLIQ
                     ALFVLSYAFDVGCDMIDQLSTEWDIPDNIKLGFDKGSYTFATGILVVMVIQNYGPRLL
                     GRFFPSIRYDASLQLVITRLTSAFVVVATLMLTLAAFGIPAQVLFSFGGLGGLAFGLA
                     AKDFISNLIGGLVLAVMRPFKVGEKIYLTGGGGKYRDSKEKDVSNYKVDEIGWYQTRL
                     IPKDGKVTTIPNGYFLGANVINTSREPNEFVGPQLRIAIPDYEGIPALTEEITTFLTN
                     HPDVHASYKPPLCVLKKIDVDHLSVQIELFMYGDAHYGKKIWKKKRELVLIDLLRIVK
                     KHCPNSPALPVSEVDGYVK"
     gene            51215..>52745
                     /locus_tag="OSTLU_29321"
                     /db_xref="GeneID:5006697"
     mRNA            51215..>52745
                     /locus_tag="OSTLU_29321"
                     /product="predicted protein"
                     /transcript_id="XM_001422426.1"
                     /db_xref="GeneID:5006697"
     CDS             51516..52745
                     /locus_tag="OSTLU_29321"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422463.1"
                     /db_xref="GeneID:5006697"
                     /db_xref="JGIDB:Ost9901_3_29321"
                     /translation="MTGEWDARTRAGGKKTTTARERRRATTRGNAARREGGKGNANGD
                     TGLGPNPYETLRKKSSAVLFENEVASSAREVATARRRAAEELRASGSKRDATKEEREA
                     LMRAEESLVKAERAAREVERAAKAEAARAAKEAAAAEKAAAAASRSSAAPSSSSSSSK
                     RSAVRASSDGRATDNAMGVVVEVGKFVLPAVVAWFARQPTVRKLRTDLNAMTTAKIRA
                     ALEATKLRAQLVELREKLALAEAESADVQAASEKLMTRRNSVKEVKCKQMAVDHVNLV
                     KKVRAEAAKDVSDAKALEIGARWREEACRRMKNRAVAEAETLRAQIAALEKKVDDLEH
                     KRHAENVEAVKNTVVGGFDKIKSLAKHASMKIGKKKNVTEAIEHLAPLAVEASSGDAR
                     ANRRKAKGKSKSKSKSK"
     gene            complement(<52878..>53786)
                     /locus_tag="OSTLU_43599"
                     /db_xref="GeneID:5006522"
     mRNA            complement(<52878..>53786)
                     /locus_tag="OSTLU_43599"
                     /product="predicted protein"
                     /transcript_id="XM_001422603.1"
                     /db_xref="GeneID:5006522"
     CDS             complement(52878..53786)
                     /locus_tag="OSTLU_43599"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422640.1"
                     /db_xref="GeneID:5006522"
                     /db_xref="InterPro:IPR003337"
                     /db_xref="JGIDB:Ost9901_3_43599"
                     /translation="MIEKYWNDEEEWRGYHPNACDEENKFVDAAEGKLLTVFLDYDGT
                     LAPIVPEPDKAFMSDEMREAVRQCAKRFPTAIISGRSRQKVSQFVKLDELYYAGSHGL
                     DIAGPKTTTDGEPIEKKLAHQPAQWARDVMDRVTKELIEKCADIPGTNIEHNMFCVSA
                     HYRAVSEELRPRVEAVVDEICASEECLIKHDGKMVWEVRPRVAWDKGKALSYLRDALL
                     PDLSEKGFRPEDVFTIYIGDDVTDEDAFMEINEELGDHLGVGLLVSSSPKVSAAKFSL
                     RDSGEVLRFLTRLRELGDAGTIKTLP"
     gene            <54818..>55183
                     /locus_tag="OSTLU_29323"
                     /db_xref="GeneID:5006698"
     mRNA            <54818..>55183
                     /locus_tag="OSTLU_29323"
                     /product="predicted protein"
                     /transcript_id="XM_001422427.1"
                     /db_xref="GeneID:5006698"
     CDS             54818..55183
                     /locus_tag="OSTLU_29323"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422464.1"
                     /db_xref="GeneID:5006698"
                     /db_xref="InterPro:IPR001289"
                     /db_xref="JGIDB:Ost9901_3_29323"
                     /translation="MDAAVYVNAKQYDAIVRRRQKRARANATRTPGVVNAKHPSRSAH
                     AKNRIRGKNGKYLTRDELLRGLGGPEGRARAEAREREIAEREAKRVERAAVREATKAR
                     ARAQRAAADAVRAAKKSRK"
     gene            <55296..>56903
                     /locus_tag="OSTLU_29324"
                     /db_xref="GeneID:5006523"
     mRNA            <55296..>56903
                     /locus_tag="OSTLU_29324"
                     /product="predicted protein"
                     /transcript_id="XM_001422428.1"
                     /db_xref="GeneID:5006523"
     CDS             55296..56903
                     /locus_tag="OSTLU_29324"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422465.1"
                     /db_xref="GeneID:5006523"
                     /db_xref="JGIDB:Ost9901_3_29324"
                     /translation="MPRPRAARLAAFDVAGVVALVAVAAAWCVVLSTAYGGENRCDMS
                     YMYPSFFPVTNVALASPAHALYRYRDARARDDDVDDRARASGDASACVVINVFVPGTG
                     GGYGQARSAASGTLESEGCRVEHYALDFAEELSAYNGMLLARQAKSVARALDGLRTLE
                     RARTERRVVAGWSVVGHSAGGLAAMEAAASALGSELGLTIVNLATPSAWNPVSLTLTQ
                     RAREAGVRRRWRTSDARRSVALVSVVGGERDRQVSSSPMGFVDDWVEEGLGVSASAST
                     ASRVGVSADHRCAAWCKQLIVAISRGFAEAFPRSKVLTAHQRARAFRDALGDKDAARA
                     PSPTFGVPARAYEATQERTPSALAGVVANVLAPRSVMSAFAFALIAHAASPSILRERV
                     VESVIASLAVYVASGWIANRAFDVRGDVRRALTTCMVLAHVPSLIAWAHHVLRTLPTY
                     GFHALVPPFGAMDAVALCFAAASTRFGAIARDQSSGASRARQVAWCLAAGAAAPGNVG
                     LIHIAGAVVHCAETLRLPRASLPKKVA"
     gene            <57136..58436
                     /locus_tag="OSTLU_25825"
                     /db_xref="GeneID:5006524"
     mRNA            <57136..58436
                     /locus_tag="OSTLU_25825"
                     /product="predicted protein"
                     /transcript_id="XM_001422429.1"
                     /db_xref="GeneID:5006524"
     CDS             57136..58377
                     /locus_tag="OSTLU_25825"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422466.1"
                     /db_xref="GeneID:5006524"
                     /db_xref="InterPro:IPR000560"
                     /db_xref="JGIDB:Ost9901_3_25825"
                     /translation="MFARARALALTGAAAATATMPLVSHARARDDARRVARAPPHDAR
                     ELLLVQAVFRHGDRTPIAGLGAGLEDLEETWRRLLPSAADEERLRRLARVRSEMEATC
                     VPRGAGGWEGRLTTRGATQMRAFGREIIREWLIAQEFLSNDFARAVAKGEVKVRSTAA
                     SRCVASAANALAGGWPDAWENGGGGSPLIIEVREKERETMFPKPGSACDRLSEVFRGA
                     MASNDEKFTHDETLARLRESIETAREKKAGLLEVWDPLQCRINHDLPLPRGVTKDQVR
                     SLLTMMEDRHFATFTSPLANGIMGTQLLREICEEMGEHGGKVKLSLYAGHDSTIMALF
                     SALGTLGSTLTTWPPTGSSLIFETWRMKDGSVGVRAVYNGEPMALTPKSRERDGLTSY
                     ADFKAYVKTRVPEDYVAACKL"
     gene            complement(<58652..>59851)
                     /locus_tag="OSTLU_2858"
                     /db_xref="GeneID:5006525"
     mRNA            complement(join(<58652..58909,58985..>59851))
                     /locus_tag="OSTLU_2858"
                     /product="predicted protein"
                     /transcript_id="XM_001422604.1"
                     /db_xref="GeneID:5006525"
     CDS             complement(join(<58652..58909,58985..>59851))
                     /locus_tag="OSTLU_2858"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422641.1"
                     /db_xref="GeneID:5006525"
                     /db_xref="InterPro:IPR000687"
                     /db_xref="JGIDB:Ost9901_3_2858"
                     /translation="VTNAMKEARRKEDKSMSLNKDKEDRATVEQALDPRTMLILFKML
                     SRETFTEIHGCVSTGKEANVYHARKDVVVGETGAREVTDFAVKVYKTSILVFKDRDRY
                     VSGDWRWRNGYSKKNPRKMVQTWAEKEMRNLIRLKEAGLRVPAVEMLRSHVLVMEFIG
                     NDGIAAPRLRDADISVKKMRSLFTELIVDVRMMYQKCRLVHADLSEYNLLFHDGHIWI
                     IDVSQSVDQDHPRCLEFLREDLLHVIQYFAKQDVAVPTVRELFDFVTDPAINDDNMEA
                     VLEALSESAEEHAMMERRAEAEIQANVFHQAFIPRALDEVDLFERDQKRLIQGKGESE
                     GIYYQTITGMADDLSSVRTTPTLLMTKKLDVVDEDEDEEDE"
     gene            <60482..>61912
                     /locus_tag="OSTLU_43856"
                     /db_xref="GeneID:5006699"
     mRNA            <60482..>61912
                     /locus_tag="OSTLU_43856"
                     /product="predicted protein"
                     /transcript_id="XM_001422430.1"
                     /db_xref="GeneID:5006699"
     CDS             60482..61912
                     /locus_tag="OSTLU_43856"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422467.1"
                     /db_xref="GeneID:5006699"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Ost9901_3_43856"
                     /translation="MTDAEDVELRGAAEIARKQREELVREFESRRRLRATHAPTHDAD
                     VRAMLRKYREPITLFGERESERRDRLRALLASLDARDGGELDDGAGTRTATDKYGATI
                     VDEGEYNAHATQKETFYTEGTERLLECRIDIAEWSLPRAAKRVATQREARGKGGRKDE
                     RATIDAVVASTSGFQAQCSEIGDASRPICEVKFYNGGRNAVSASWSGEARKWACDVEG
                     GKLTSELVIRASDHRITGIDAFDAGDGRARIVTGHADGSAAIWNADGSRAAELKGHAS
                     RCGRVAFHPHGGKYVATASFDATWRLWSAETGEELLCQEGHAKEVYDVAFHPDGSLAA
                     SVGLDAVGRVWDLRIGKSIAVLRGHVKQILSVDFSPNGYHVVTGGDDRTVKSWDLRKS
                     AECAYTNAAHSALVSCVRYEKTSSNGAFFTSSSYDGSVVVYSARDFAPHKKIGDGAAG
                     KLTAVDVAGDALILSGFDRTLKYYTK"
     gene            <62324..>63100
                     /locus_tag="OSTLU_4668"
                     /db_xref="GeneID:5006526"
     mRNA            join(<62324..62772,62803..>63100)
                     /locus_tag="OSTLU_4668"
                     /product="predicted protein"
                     /transcript_id="XM_001422431.1"
                     /db_xref="GeneID:5006526"
     CDS             join(<62324..62772,62803..>63100)
                     /locus_tag="OSTLU_4668"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422468.1"
                     /db_xref="GeneID:5006526"
                     /db_xref="InterPro:IPR000878"
                     /db_xref="JGIDB:Ost9901_3_4668"
                     /translation="VCLVGVGPGDPGLLTLRAYQLMQTADVVLYDRLVSNEILNLARA
                     EARMVYVGKRAGYHTRTQEEIHELLAAFADAGATILRLKGGDPLVFGRGGEEFEFLRE
                     HNPNVRVEVVPGITAAAGVGSELGIPLTHRGVATSVRLLTGHLREGAGDPVDFAVTSA
                     DVETTLVVYMGLGTLPKLSEKLIASGFPADMPAVAIERGTTVDERRVFSSIEHLPEAA
                     AACELVSPTLLIVGRTVTLSPHWPYAADESS"
     gene            <63397..>63788
                     /locus_tag="OSTLU_43771"
                     /db_xref="GeneID:5006527"
     mRNA            join(<63397..63516,63615..>63788)
                     /locus_tag="OSTLU_43771"
                     /product="predicted protein"
                     /transcript_id="XM_001422432.1"
                     /db_xref="GeneID:5006527"
     CDS             join(63397..63516,63615..63788)
                     /locus_tag="OSTLU_43771"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422469.1"
                     /db_xref="GeneID:5006527"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="JGIDB:Ost9901_3_43771"
                     /translation="MSAAEEDAAVREPLDLIRLALDEKVYVKLRGDREARGRLHAYDQ
                     HLNMILGDVEEVITSTETDEETFEEFTKTTKRSVPFLFIRGDAVTLVSPPLRS"
     gene            complement(<63860..65666)
                     /gene="PAFD3501"
                     /locus_tag="OSTLU_25826"
                     /db_xref="GeneID:5006528"
     mRNA            complement(<63860..65666)
                     /gene="PAFD3501"
                     /locus_tag="OSTLU_25826"
                     /product="predicted protein"
                     /transcript_id="XM_001422605.1"
                     /db_xref="GeneID:5006528"
     CDS             complement(63860..65590)
                     /gene="PAFD3501"
                     /locus_tag="OSTLU_25826"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422642.1"
                     /db_xref="GeneID:5006528"
                     /db_xref="InterPro:IPR004343"
                     /db_xref="JGIDB:Ost9901_3_25826"
                     /translation="MASDDEARDDDDFDVLAAAGSSDDDADADDFDDGYGSDLMGDAA
                     DRARLASLNELEREEIMLERADARKRLESRRAIIAAARSKELELARKKTGARAISSKQ
                     RDELEALERIAEAKKRKERSRRVFGDLSEDEEEFGGAASESEDKERVARPRRKKRETR
                     ADVDLEAEYASSDVPATRDEIASVTVKRHQLEQWVNEPYFEAAVTNCLTRVGIGLNKE
                     GQNVYRLVEIAGVADGKYKQYSLKKYEYLANKPPTQKWLILRWGKSEKTFRLSEVSNS
                     DVQDAEWKAWVAHCAQAGCTPITARDVKKCLQGLEEAKNYRYTSDDVTKILAEKREKQ
                     GTRHNLLFEKEQIKAAIAHAEAENDLDKVEELRQRFDEVDREIKDKLQQRSGSTQDAL
                     ANINRRNEIQNSEKLSKRASEQVAKLKAGVLNTGSGDPFSRRPTRLTTYWDMGAGAAE
                     RSATAAEEEEAAAATAAALATDGGDEEDDIFLTAGVDAQQSEKELVDVLQQAHRETVG
                     SLNIDLSRLDAPADADALRLKTTKSVLDRGAVLLKSAYDAQRAEQLATQPPGKAFTVA
                     EYLAEFVAPT"
     gene            complement(<65853..>66059)
                     /locus_tag="OSTLU_29331"
                     /db_xref="GeneID:5006700"
     mRNA            complement(<65853..>66059)
                     /locus_tag="OSTLU_29331"
                     /product="predicted protein"
                     /transcript_id="XM_001422606.1"
                     /db_xref="GeneID:5006700"
     CDS             complement(65853..66059)
                     /locus_tag="OSTLU_29331"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422643.1"
                     /db_xref="GeneID:5006700"
                     /db_xref="JGIDB:Ost9901_3_29331"
                     /translation="MKGFESFEAYRDAFAQATLDIAALPEGKKLTGARQIVILPGIEP
                     GISGLRLERLVRRSVVCAFRHSWL"
     gene            complement(<66270..>66956)
                     /gene="FBP17-1"
                     /locus_tag="OSTLU_29332"
                     /db_xref="GeneID:5006701"
     mRNA            complement(<66270..>66956)
                     /gene="FBP17-1"
                     /locus_tag="OSTLU_29332"
                     /product="peptidyl-prolyl cis-trans isomerase, FKBP-type"
                     /transcript_id="XM_001422607.1"
                     /db_xref="GeneID:5006701"
     CDS             complement(66270..66956)
                     /gene="FBP17-1"
                     /locus_tag="OSTLU_29332"
                     /note="FKBP-type peptidyl-prolyl isomerase, possibly
                     targetted to thylakoid lumen (TAT pathway)"
                     /codon_start=1
                     /product="peptidyl-prolyl cis-trans isomerase, FKBP-type"
                     /protein_id="XP_001422644.1"
                     /db_xref="GeneID:5006701"
                     /db_xref="InterPro:IPR001179"
                     /db_xref="JGIDB:Ost9901_3_29332"
                     /translation="MAPVARAPPVAVTPRRRVACAGTRARDSSDAVGDVARRACLLFA
                     PSVAAALGRRAAFADEASVKIVRDVAGFGAKEATSKSLVLVKYEGTLASDGAVFDTTL
                     GGRVYATSSSGVGSVSIAPAAARPVVVNLSSDAPVPGVPEGLRLGIRGMRVGGTRTFE
                     VPPELGFGSAAARSPYATIPANSALKYEVTLLRLSDTGPDALYAGISRCGLGGASQMS
                     DGCASVEPME"
     gene            complement(<67177..>67611)
                     /locus_tag="OSTLU_8354"
                     /db_xref="GeneID:5006702"
     mRNA            complement(<67177..>67611)
                     /locus_tag="OSTLU_8354"
                     /product="predicted protein"
                     /transcript_id="XM_001422608.1"
                     /db_xref="GeneID:5006702"
     CDS             complement(<67177..67611)
                     /locus_tag="OSTLU_8354"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422645.1"
                     /db_xref="GeneID:5006702"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="JGIDB:Ost9901_3_8354"
                     /translation="MGLTASSLNLTQYDIEDVQQHCGGKFTSREIQALYQRFRALDKK
                     HKGFITEDELMAIPELAISPLAPRIVQMFQNQNFKDFVRMISALSSKATREERLRFMF
                     HCYDVDRDGVVSRSDLETITRHLVGSSISQEDFDQLISKAFGE"
     gene            complement(<67741..>68988)
                     /gene="APR1"
                     /locus_tag="OSTLU_13445"
                     /db_xref="GeneID:5006703"
     mRNA            complement(<67741..>68988)
                     /gene="APR1"
                     /locus_tag="OSTLU_13445"
                     /product="APS reductase"
                     /transcript_id="XM_001422609.1"
                     /db_xref="GeneID:5006703"
     CDS             complement(67741..68988)
                     /gene="APR1"
                     /locus_tag="OSTLU_13445"
                     /note="Phosphoadenosine phosphosulfate reductase,
                     3'-phosphoadenylsulfate reductase, APS reductase;
                     catalyzes the second step of S assimilation, the
                     conversion of APS to sulfite and AMP; probably
                     chloroplast-localized"
                     /codon_start=1
                     /product="APS reductase"
                     /protein_id="XP_001422646.1"
                     /db_xref="GeneID:5006703"
                     /db_xref="InterPro:IPR002500"
                     /db_xref="InterPro:IPR006662"
                     /db_xref="JGIDB:Ost9901_3_13445"
                     /translation="MRSARARGALRGPSARRAARRATTKARTTRAPSRATKADVDGMR
                     DALERARATPLEIMDKALETHGDGLAIAFSGAEDVAVIQYAALTGRPYRVFSLDTGRL
                     NPETYELFDKVEKHFDIKIEYCFPESEAVKALVNEKGMFSFYEDGHKECCGVRKVKPL
                     RAKLATLTAWVTGQRKDQSPGTRNAVPACQIDPVFEGAAGGAGSLVKFNPLTDATSQE
                     VWDFLRVMGTPVNALHERGYVSIGCAPCTRAVLPGQQEREGRWWWEDASDKECGLHSG
                     NLTAEEKAKQDDREATEEDIFEHDSIRNLSRDDIAALKDEKTHGETTLAVLYAPWCPF
                     CQRMVSGFETAAERLGPKGVKFAKFRADRDEKEWSQENLSMKSFPTLLLFPKGRSGYV
                     KLGSERRDPDSLEIFIESITGKL"
     gene            <69668..>72394
                     /locus_tag="OSTLU_18937"
                     /db_xref="GeneID:5006704"
     mRNA            join(<69668..70320,70426..>72394)
                     /locus_tag="OSTLU_18937"
                     /product="predicted protein"
                     /transcript_id="XM_001422433.1"
                     /db_xref="GeneID:5006704"
     CDS             join(69668..70320,70426..72394)
                     /locus_tag="OSTLU_18937"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422470.1"
                     /db_xref="GeneID:5006704"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="JGIDB:Ost9901_3_18937"
                     /translation="MEEDLRERDEFEQRLRAKDEAKTKKLSGDRGPTEAERAEAERRG
                     AHLETDEQRTDLVPELRKVSRQEYLKKRELQKLEELKESIKETEYFYEGQDVTEEQRK
                     DLEKRKKVYELAMEQINSINDALEERYSIPTAYDDPNKPKSTNERFAVARQRYKEPDP
                     EDDANPFKDQDQWEAHQVKQAQAQFGAKNKKSEVKEYDLVYDDQIKFIKDEIMAGDGV
                     AKIEADRKSLPIFPYRESLIKAVEDHQVVVIVGETGSGKTTQIPQYMWEAGFGGKTQK
                     IGCTQPRRVAAMSVASRVAEEAGVKLGHEVGYTIRFEDCTNDKTRVKYMTDGMLLREF
                     LGEPDLSSYAVMMVDEAHERTLHTDVLFGLVKDIARFRPEIKLLISSATLDAEKFSEY
                     FDFAPIFRIPGRRFPVDILYTQQPEADYVDATVVTVLQIHLTQPEGDILVFCTGQEEI
                     ESCEELLKTRIHEMEKKPPELIIAPIYASLPSDMQAKIFEDTPKGSRKVVLATNIAET
                     SLTIDGIKYVIDPGFCKQKSYNPRTGMESLVVTPTSQASALQRAGRAGRTSAGKCFRL
                     YTAWSFQNELDPNTVPEIQRTNLGNVVLMLKSLGINDLMHFDFMDPPPAETLLRALEQ
                     LYALGALNDRGELTKLGRKMAEFPLDPMLSKTLCASDKYKVSDEVMTICCMLSCGNTV
                     FYRPKDKLQLADHAHKSFHIGNVGDHIALLNVYNSWRDADFSVTWCYENFVQQRTMKT
                     ARDIREQLEKLLERVEIEPSSNTNDLDGIKKCITSGFFYHTAKLQKNGSYRTVKNPQT
                     VAIHPSSGLAKELPRWVVYFELVYTSKEYMRQVIEIKPEWLVEIAPHYYKRKEIEGET
                     IKTGKAAAGKKSDVVLA"
     gene            complement(<72669..>73130)
                     /locus_tag="OSTLU_8508"
                     /db_xref="GeneID:5006529"
     mRNA            complement(<72669..>73130)
                     /locus_tag="OSTLU_8508"
                     /product="predicted protein"
                     /transcript_id="XM_001422610.1"
                     /db_xref="GeneID:5006529"
     CDS             complement(<72669..>73130)
                     /locus_tag="OSTLU_8508"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422647.1"
                     /db_xref="GeneID:5006529"
                     /db_xref="JGIDB:Ost9901_3_8508"
                     /translation="EYDVFRDSLLRYMGYANECGEAFVAWLPVWGVPATYGIAATYVL
                     ADTVDKGVKRWNKAEGASDRANQAAAVATETLTWQMLASVFWPGSFIRVVVATTNLAL
                     AKADVSAFDSLAAQGLDVERILPTLLGLAAIPFIVKPIDTTIDAAAEISFAK"
     gene            <74185..>74502
                     /locus_tag="OSTLU_29337"
                     /db_xref="GeneID:5006705"
     mRNA            <74185..>74502
                     /locus_tag="OSTLU_29337"
                     /product="predicted protein"
                     /transcript_id="XM_001422434.1"
                     /db_xref="GeneID:5006705"
     CDS             74185..74502
                     /locus_tag="OSTLU_29337"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422471.1"
                     /db_xref="GeneID:5006705"
                     /db_xref="JGIDB:Ost9901_3_29337"
                     /translation="MGRERGNGGSGMSASARAFAPKKATRKDRWADSFDPDFIRRDPS
                     VGSARMVPMNVPGVMPMMMPPPMGGMTWQQAAPSYFAPPMPPPMPPGPPPPRPSRERG
                     DDV"
     gene            complement(<74846..>76412)
                     /locus_tag="OSTLU_29338"
                     /db_xref="GeneID:5006530"
     mRNA            complement(join(<74846..75007,75182..75271,75411..75624,
                     75771..75865,76011..76171,76331..>76412))
                     /locus_tag="OSTLU_29338"
                     /product="predicted protein"
                     /transcript_id="XM_001422611.1"
                     /db_xref="GeneID:5006530"
     CDS             complement(join(74846..75007,75182..75271,75411..75624,
                     75771..75865,76011..76171,76331..76412))
                     /locus_tag="OSTLU_29338"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422648.1"
                     /db_xref="GeneID:5006530"
                     /db_xref="JGIDB:Ost9901_3_29338"
                     /translation="MEAPRTVDEVHANFSRRRDGLVKALTRDVEAFYAQCDPDKENLC
                     LYGNPDGTWDVQLPAEEVPPELPEPALGINFARDGMQRKDWLALVAVHSDAWLMAVAF
                     YYGAKFDAKKRDALFAQINAVPTVYETLSAAHGREEKPTSAGARQNGGAQANGRDATG
                     KGAKTALADVKGNSSKVKKHKVDPMDAQGFKKPSPGFILDPDQALTTLKNAQIELFWP
                     DDNLWYRAEVISLNERNRTAKVLYATSDVETLNLDELIREGHVNVRREA"
     gene            complement(<76588..>79599)
                     /locus_tag="OSTLU_94049"
                     /db_xref="GeneID:5006706"
     mRNA            complement(<76588..>79599)
                     /locus_tag="OSTLU_94049"
                     /product="predicted protein"
                     /transcript_id="XM_001422612.1"
                     /db_xref="GeneID:5006706"
     CDS             complement(76588..79599)
                     /locus_tag="OSTLU_94049"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422649.1"
                     /db_xref="GeneID:5006706"
                     /db_xref="JGIDB:Ost9901_3_94049"
                     /translation="MRDADDASIERARAAVVALYDARSTRATRDEANARLMALSEDPR
                     AASVALGLLERARGDACVAYYAANALSATTRSRERWNGASEGAREAMMRRTTAAFAAT
                     ANDETTETAARRLGLALARGGARMGSAKMREVVETAFGAVRSSGVGSSAMRAGMELLA
                     LAAEACDEAETSSRRELAMACANEGERVLITVREVFSACGSARSRQTDALKASCVRAA
                     RGWLKLDPSGDVGGGLRLSPTEFAVRHGQLFGDVLQCLAIESGGCGAAAVDFLVDLHQ
                     GRSGGEAEEFQAMNAVTRGLLAHASAANDSDDGVSLARNICLVAVALSERCVSVLARG
                     DEDSLALVSLILSLMERHGREVTEVAVDFFLMMDVVGVSSRHESLRAPMHARLTEVLL
                     KQATLPDDFTTWAVANEDEDTFERFREHVVADLLDNCYGVLRGQYFSIIGSALGAAQN
                     WQAAEAGAFALRAPASRVNDDLEDAPSEEIETFLAQLLSTISEHTTDNSGLFSSHQLV
                     RAGTCRLIASYANWLGRRGPPANSAAQAARARGVLMYITSSFPHPPAWSRAALAFKSV
                     CSRCARHLKEPSTFAALLEHTERCIADVRLTFESEDDEDGRASVTEGLARVIAAMPVQ
                     QASEASARLIAPVLARCKRIAAEMAPQIPPNQIAHASAARAMAAELALIAASVRFLEF
                     LPSATIASSCEHPAISVLAAAWPTLEEIVAKRTWQAPSVIKAAAEIYVAALLSAKESS
                     VNMIVPMLESIARTFMATKCASLLEPIATAIEVASISSPESGTSELLPSAPHVGATLS
                     AAFSQIACETVRGVRSGSDDWDLAEALFSTARAFVIFAPAQGLANETLFDVLDLSVAA
                     LELREYAPVRASLALLNAIVSPGEKAKRSAPWVANACRVDEYFLSRGPLAANAILRAA
                     CAEITPRACLRPAASFLATLLHTAPDVVTPWIITAIDALEPIHPARERFAATLARRPP
                     LPHPRLVAALCDFVFIAIGVGDVDDLLAYDV"
     gene            <79694..>80310
                     /locus_tag="OSTLU_29340"
                     /db_xref="GeneID:5006707"
     mRNA            join(<79694..79830,79893..>80310)
                     /locus_tag="OSTLU_29340"
                     /product="predicted protein"
                     /transcript_id="XM_001422435.1"
                     /db_xref="GeneID:5006707"
     CDS             join(79694..79830,79893..80310)
                     /locus_tag="OSTLU_29340"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422472.1"
                     /db_xref="GeneID:5006707"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="JGIDB:Ost9901_3_29340"
                     /translation="MPREVREGDIALARGAAHRAFTLVVVRDYEGGRVLLGEKLRGFG
                     AGYYNGFGGKVERGETVEAAAARELTEEANVEATNMTRRGALRFVFDDKPLEPWLVHV
                     FHCSRYDGEIAASDEMRPEWFDLDDVPFENMWADDPYWWPLFLEEKEFVGTFTFTNTT
                     TLVDYWIRETKDLMLDVEAMTANE"
     gene            complement(<80388..>81236)
                     /locus_tag="OSTLU_94051"
                     /db_xref="GeneID:5006531"
     mRNA            complement(<80388..>81236)
                     /locus_tag="OSTLU_94051"
                     /product="predicted protein"
                     /transcript_id="XM_001422613.1"
                     /db_xref="GeneID:5006531"
     CDS             complement(80388..81236)
                     /locus_tag="OSTLU_94051"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422650.1"
                     /db_xref="GeneID:5006531"
                     /db_xref="JGIDB:Ost9901_3_94051"
                     /translation="MNARSRHYCVVLVAGSMRKHDKDWAGLVLATSRRAVTVKPLEVL
                     RDDDDEKGDDETKTAEVRLRIARAYPMKRVDGSAIMERLTFAPDGVGAVARRNERADA
                     PPMLTRKYRVDVTSAERAMVGAESPERARGVVDDAIEDDGDDGDGVSESVYSLFEVHR
                     GESSIDESPPEDVGEIEGGEIEGESLDAFEPAPHADESGDSISPERLGIIRRGSRSAD
                     GEASESQAECVAAAFVATRDDEIEWKGSISFLREQLAAQVGVKLVLDRVDVERLLEEL
                     TSSAPV"
     gene            <81482..>81765
                     /locus_tag="OSTLU_29342"
                     /db_xref="GeneID:5006708"
     mRNA            join(<81482..81619,81721..>81765)
                     /locus_tag="OSTLU_29342"
                     /product="predicted protein"
                     /transcript_id="XM_001422436.1"
                     /db_xref="GeneID:5006708"
     CDS             join(81482..81619,81721..81765)
                     /locus_tag="OSTLU_29342"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422473.1"
                     /db_xref="GeneID:5006708"
                     /db_xref="InterPro:IPR001705"
                     /db_xref="JGIDB:Ost9901_3_29342"
                     /translation="MAKGATKAGAILVKLVSAARTGFFYVKRKNPKKTPRKLEFVKYD
                     PRVRRHVLFTETKINK"
     gene            <83009..>83896
                     /gene="CCSA"
                     /locus_tag="OSTLU_43520"
                     /db_xref="GeneID:5006532"
     mRNA            <83009..>83896
                     /gene="CCSA"
                     /locus_tag="OSTLU_43520"
                     /product="plastid-localized, cytochrome c assembly
                     protein"
                     /note="Has EST support"
                     /transcript_id="XM_001422437.1"
                     /db_xref="GeneID:5006532"
     CDS             83009..83896
                     /gene="CCSA"
                     /locus_tag="OSTLU_43520"
                     /note="usually encoded in plastid genome in other
                     organisms"
                     /codon_start=1
                     /product="plastid-localized, cytochrome c assembly
                     protein"
                     /protein_id="XP_001422474.1"
                     /db_xref="GeneID:5006532"
                     /db_xref="InterPro:IPR002541"
                     /db_xref="JGIDB:Ost9901_3_43520"
                     /translation="MYVGNASLFGLLAARWIESGHFPLSNMYESLLFLAWGITAVHLV
                     VTERDGFSESAIPGALAGPTAALTVAGATLALPAELQRATALVPALKSNWLMMHVSVM
                     MLSYATLLVGSLSCVSYLVVDASQDWAAAKGALEKLDKMVSNDGERVRNRPKVSVAAD
                     GETVAVETMNASEDYGGELAIEATRDGERILTEMDNLAYRCLGAGFTLLTAGLVSGAV
                     WANEAWGSYWSWDPKETWALITWLVYATYLHSRLVAGWSKKDSCAVGAAGFLVVWVCY
                     VGVNLWGVGLHSYGWFANK"
     gene            <84135..>85088
                     /locus_tag="OSTLU_29344"
                     /db_xref="GeneID:5006533"
     mRNA            <84135..>85088
                     /locus_tag="OSTLU_29344"
                     /product="predicted protein"
                     /transcript_id="XM_001422438.1"
                     /db_xref="GeneID:5006533"
     CDS             84135..85088
                     /locus_tag="OSTLU_29344"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422475.1"
                     /db_xref="GeneID:5006533"
                     /db_xref="JGIDB:Ost9901_3_29344"
                     /translation="MPVIAITLTVVSACAINVGKGIQKKASKSLPKLSLASLRSYLTD
                     PNWRRGLELDVIGGAGMLLALSIAPMSVVQPASASGVAILAVVSHAYLGESLTLREWK
                     GVASCGFGIAVLSKFARGGGETRALGAFRLMVAIGLGFACLATPSVISHRFRSGASAS
                     AAKRYELIKIGAQCGTCFALSAFSVKAAMGFLYAWRLFSAPIAFGVSGTLTAMGLYFQ
                     TAGFREAGDVSIVVVCVAGNVAQMFVAALYGLIILSEPLPETIPAFIGWIMSWVFITY
                     GVVALSGADSASSLVKAREVRGAPILPTAIGPGAMPPFKTN"
     gene            <85223..>87433
                     /locus_tag="OSTLU_29345"
                     /db_xref="GeneID:5006534"
     mRNA            <85223..>87433
                     /locus_tag="OSTLU_29345"
                     /product="predicted protein"
                     /transcript_id="XM_001422439.1"
                     /db_xref="GeneID:5006534"
     CDS             85223..87433
                     /locus_tag="OSTLU_29345"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422476.1"
                     /db_xref="GeneID:5006534"
                     /db_xref="JGIDB:Ost9901_3_29345"
                     /translation="MSKAWLDHDKLSATAAAMGAKLKAQASATVRELVDTNAVERGVA
                     TTTTRADDAMDADPRARELTELTELLQAKDEELMALKDALRRVAEDGGGGGGGATRRD
                     AALATGAVEGYEKEMKKLRDGKAWAEEEAKAFEKECDEARAEASEATRKLEALEKELE
                     RAQKGERVESEARIPSDGNGDDNAASREALESMTKERDDAVEKAQSMKTVNDGVLQQL
                     KSMKGVNETLQKQLKEYAELVPTIRKALDDARAETAELAESLASARKEAEDATTAVSD
                     SQALKKTNEALERRQKSLENEIVVLKNKIENSKQVQSDVEAAKERVSAGALKKSLAAT
                     EEKLAAANAQIKTLRTDLSVKHSESNALAESKEKGESELRRLREELKSLTGAVAERNV
                     AMTELAELRTELADAKRSLETSSFAGSSIEDVTSARDKAESELLTMARRVAKLEQQLL
                     DAQRAQDDAMADVASKVDQSVRNDRDEIEKLKSRCDELESARDDAVKRVESLSAEASA
                     SRSALAEAQKIAAEAESVRAELNSRIEAAEIRIMNANALADASKNALEEYKRKSTEST
                     RAVQDALRSERDAAMTAASAAERDRDAWSEKCTEARDTLDRWREKARKLMADKDAELE
                     LARGAAAPLRSKSRLFDDDADDGSDDAKVESPSIADASKPARVDDVHAEYLAAVVKRF
                     LLLPYDAYDRGDALVPVICTILGFGKEDEFRIRAHRASQRVKSSSSKFLGGVFG"
     gene            <87521..>88441
                     /locus_tag="OSTLU_94053"
                     /db_xref="GeneID:5006535"
     mRNA            <87521..>88441
                     /locus_tag="OSTLU_94053"
                     /product="predicted protein"
                     /transcript_id="XM_001422440.1"
                     /db_xref="GeneID:5006535"
     CDS             87521..88441
                     /locus_tag="OSTLU_94053"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422477.1"
                     /db_xref="GeneID:5006535"
                     /db_xref="JGIDB:Ost9901_3_94053"
                     /translation="MSFKTFTTTPSRAHGATARATASSTRIGQKSARPAAARNRGATR
                     AHARDDAPASEGRTVDALNKLSSLYESESERDERIRATQRERDAMEGLGLADAFKTAK
                     RGSKTRRDFARKRTYGVTRTSFGAVVELGCAAEVVYGYWTTPAALAETLPELEKCEAA
                     ADGGRARCEWVYAFGDIRKKHGRTAVDAVERHLSVVKATELEAGSSVRYEATAGMPVG
                     ADIAVTSTGANSCTLDIDAWVHLPLSLTHTSGTMAVALDVQDKFYQALAAFKTLCDEG
                     DAAARLEEIKSSARDACAVGDRPNFQFRGK"
     gene            <88629..>89732
                     /locus_tag="OSTLU_43686"
                     /db_xref="GeneID:5006536"
     mRNA            <88629..>89732
                     /locus_tag="OSTLU_43686"
                     /product="predicted protein"
                     /transcript_id="XM_001422441.1"
                     /db_xref="GeneID:5006536"
     CDS             88629..89732
                     /locus_tag="OSTLU_43686"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422478.1"
                     /db_xref="GeneID:5006536"
                     /db_xref="InterPro:IPR001636"
                     /db_xref="JGIDB:Ost9901_3_43686"
                     /translation="MSAPARASHASPQRVFSNAASKFRARQTPSKSARARRVRAKATH
                     DDALRKSQALEALDACVTASDLGTGTKYEGKVRDTYVTGDTMIAVTTDRQSAFDRHLA
                     YIPFKGAVLNQTSQWWFKQTEHIVPNAVVATPDPNVTVMRRCEVFPIEFVVRGYLTGS
                     TSTSLWTHYKTGGRNYCGNALDDGMVKNQKLPANIVTPTTKEKEHDRPISLEDIVKEG
                     WMKQDDLDYCVAKTLEVFAYAQEVAATRGLILVDTKYEFGRDADGTIRLIDEINTPDS
                     SRYWLSNSYVERHAAGMEPDMIDKEFLRLWFAERCDPYKDETLPEAPADLVAELSSRY
                     VKLYEMITGETFDVPPAGVDVNKRMRDALKGVI"
     gene            complement(<89749..>90843)
                     /locus_tag="OSTLU_94054"
                     /db_xref="GeneID:5006537"
     mRNA            complement(<89749..>90843)
                     /locus_tag="OSTLU_94054"
                     /product="predicted protein"
                     /transcript_id="XM_001422614.1"
                     /db_xref="GeneID:5006537"
     CDS             complement(89749..>90843)
                     /locus_tag="OSTLU_94054"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422651.1"
                     /db_xref="GeneID:5006537"
                     /db_xref="JGIDB:Ost9901_3_94054"
                     /translation="LREALEEAERKAKTSAEMVVELQERVRALREENVGEARVLTRLE
                     AQLRRREHEFEAHREMLSSQLEAAIYSANERDNEALARDQEARDEVRAAKMAASQYVL
                     DDAQRREFSLKAGWCARYFNLMIALGLAPIDEDIKQEAETWTRAFGIALEKDDTHASI
                     ARKIGDVLIEAGAKPVASYEVDTSLVTASASAMDTEEPVENDENGVQPDEHAGPTHTS
                     LPPSLNPSWPRNFRDALGVEIAMRYLASRRIEERVVVSLADVRRASAISSISRNAASE
                     DDSSALSDDEIHEFHFRRAWLRFMWARAREAGMDAGVADEREEHWLSEMQTMTNPNMR
                     QPLRFKRDALAVDKGLKELRAFLVESRLWR"
     gene            <91584..>93431
                     /locus_tag="OSTLU_43507"
                     /db_xref="GeneID:5006709"
     mRNA            join(<91584..91763,92841..>93431)
                     /locus_tag="OSTLU_43507"
                     /product="predicted protein"
                     /transcript_id="XM_001422442.1"
                     /db_xref="GeneID:5006709"
     CDS             join(91584..91763,92841..93431)
                     /locus_tag="OSTLU_43507"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422479.1"
                     /db_xref="GeneID:5006709"
                     /db_xref="InterPro:IPR002569"
                     /db_xref="JGIDB:Ost9901_3_43507"
                     /translation="MMGLGGDGIVAAADALPGRAQAMRVSDQHYVLKGHAMRAPFPEN
                     LERATFATGCFWGTEKMFWRLPGVHSTSVGYVGGRATNPTYEEVCSGSTGHTECVKVT
                     YDPRKVSFADLLAMHWTCHDPTQGDGQGNDRGTQYRSGIYCTTDAQLAMAKDSAKAYG
                     EALRAAGKSGAITSEIKGPGDTFYYAEDYHQQYLAKPGSRPYCSAQPTGVPMPVTWLE
                     TNGAKFGAGFWAKYGPKPTCTIGVPNEPISSEDASAAR"
     gene            <94248..>95610
                     /locus_tag="OSTLU_43847"
                     /db_xref="GeneID:5006538"
     mRNA            join(<94248..94353,94628..>95610)
                     /locus_tag="OSTLU_43847"
                     /product="predicted protein"
                     /transcript_id="XM_001422443.1"
                     /db_xref="GeneID:5006538"
     CDS             join(94248..94353,94628..95610)
                     /locus_tag="OSTLU_43847"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422480.1"
                     /db_xref="GeneID:5006538"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="JGIDB:Ost9901_3_43847"
                     /translation="MQAGLSDGDRARKVAFITGVTGQDGSYLVELLLSKGYTVHGIKR
                     RSSSYNHPRLEHIMEPGYPNGQNFFLHYGDLTDLHALVAICRDVRPTEVYNLAAQSHV
                     QVSFQMPMYTAEVDGVGTLNLLEAIRLSGQEKTARFYQASTSELYGKVQEIPQSEKTP
                     FYPRSPYAVAKMMAFWAVVNYRESYDMYACNGILFNHESPRRGETFVTRKITLAVANI
                     KAGKQECLYLGNMDAKRDWGHARDYVECMWKMLQQDTPEDFVVATGETNTVRHFVDRA
                     FDVAGMKLKFEGEGVDEVGIEIATGRTLVRVHERYFRPAEVDLLIGDPSKALNKLKWN
                     PRTTSLEELIKEMVEADIARIENPGLRF"
     gene            complement(<95717..>97540)
                     /locus_tag="OSTLU_25832"
                     /db_xref="GeneID:5006539"
     mRNA            complement(<95717..>97540)
                     /locus_tag="OSTLU_25832"
                     /product="AEC family transporter: auxin efflux"
                     /transcript_id="XM_001422615.1"
                     /db_xref="GeneID:5006539"
     CDS             complement(95717..97540)
                     /locus_tag="OSTLU_25832"
                     /codon_start=1
                     /product="AEC family transporter: auxin efflux"
                     /protein_id="XP_001422652.1"
                     /db_xref="GeneID:5006539"
                     /db_xref="InterPro:IPR004776"
                     /db_xref="JGIDB:Ost9901_3_25832"
                     /translation="MDDGDARETTRGDASANAMDAAAAAAAAMREESEEAETAETAER
                     EPSTDDDDETEEEMEAREREEKSERNKVSRRVFGAETDTRATTWTRSLFMLGAIFVFL
                     AAYPKFVGWLCSYFEPLDTAVSAYEALTSNVGLDLRIMRATSTATFKVVALCAVITGL
                     MREGKLPLETPVVVSKLAFNVMLPAYLCTRVAATLYLSPLTKALAILPISAMAQVIFG
                     SIIGVGVTYFVNRFHAYASSHTREEEDLDEEEEIKLEREKRDMSRLGIAACSFGNTFT
                     LPLVFLTEVLGRARADETAGYIALYLIGWTPVLWTVGFLLIAGPVAVAGLSKDGEKKD
                     ALRDAFLTAKATMARIGKELLNPPLLGIIAGVLIGATPLKEIFVGNFADATTEFPAVL
                     TFISVIFRALFELAASIGAAALPGQMLVLASSLVKITPEDVEKRIARAKKAKERSVPV
                     DDDEMEENAKKRKKKSLFVTVLDVFFGSFAGAFALVMRPLRKIRAGWNYLTRLDSPDM
                     LALVSACLVRFVFLPGACLFGLLFLRALNSPWFPSDRSAALVLLTMSCMPAAQNLVLL
                     TQLRDATRPLATRLAALMLRQYVFAIIPVTFWLTAFTSAVV"
     gene            <98211..>98741
                     /locus_tag="OSTLU_18950"
                     /db_xref="GeneID:5006710"
     mRNA            <98211..>98741
                     /locus_tag="OSTLU_18950"
                     /product="predicted protein"
                     /transcript_id="XM_001422444.1"
                     /db_xref="GeneID:5006710"
     CDS             98211..98741
                     /locus_tag="OSTLU_18950"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422481.1"
                     /db_xref="GeneID:5006710"
                     /db_xref="JGIDB:Ost9901_3_18950"
                     /translation="MTIADRARAIAITAMTTVSAAGAARADAQEVQDYLLAFWKFRTA
                     DTTSFLLYTVAPIMVPYAVFAVLIKRKTEAQLEKLEGGGWIAFMAERGLDAKTLELPQ
                     LNAFCKAADAGVLDDAMVTEFVRKLKLSEQWKKSTIAIDDTRAEEAKKRARAEAILEA
                     KRARGDFEKSKEESSV"
     gene            complement(<98862..>100775)
                     /locus_tag="OSTLU_94056"
                     /db_xref="GeneID:5006540"
     mRNA            complement(<98862..>100775)
                     /locus_tag="OSTLU_94056"
                     /product="predicted protein"
                     /transcript_id="XM_001422616.1"
                     /db_xref="GeneID:5006540"
     CDS             complement(98862..100775)
                     /locus_tag="OSTLU_94056"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422653.1"
                     /db_xref="GeneID:5006540"
                     /db_xref="JGIDB:Ost9901_3_94056"
                     /translation="MRRRRPFARASSRFVACVALALACWSSRCESTSAKDADAAARAL
                     RDELSTLRHALQEAKEASTALGKAVHGAERALKRMGGLVKTPGVAATDETRCDAGGPT
                     KDDEMSFDGDSKRVASSSMPVSGELTLEEIRRAAEEHVRAALAGESKRSKTFSDAFDR
                     VSAARVSTKVTAVHVLPFRNGKARKARYYATGDEFGRIVVRRTETGDAECEVQTNTSA
                     SVRSMTAYLLALNTTVLVTGHDDGTVAFTKIEQEVVENVGPDADAFPTDYTLRASSLA
                     AMTVREANAKYRVKLRELGKTSRASSSSSGALEHVEESFPVEALGMYRIMGKRYVTAA
                     DTDGRVVVFLPSLGNFANVHGVFSAGSKVFAFRPYNKAVVALTRRGVAYADINAFTTK
                     SYACDGLMRYDIASATFDPRMSSRLTGITTEGHVISGFVALDGPRTGCVIYSGAETHE
                     SRVSVTTIAALRGYVVVAMNAGLEILNITNTKIAKRVLHSSNRWQLADEGVTPTTAGE
                     YAPVIASDGESQIVISHPDEGAVFVYESAMYVAAPASLLGENPWFQPLAVMIALGVGI
                     WSYRRQKMSFTPEARSSSHNETMEALRKLGYGQDMARARALVSGETRPGYEPWTPATI
                     RKEVEAARLNGDL"
     gene            complement(<101005..>101519)
                     /locus_tag="OSTLU_29355"
                     /db_xref="GeneID:5006711"
     mRNA            complement(join(<101005..101217,101286..>101519))
                     /locus_tag="OSTLU_29355"
                     /product="predicted protein"
                     /transcript_id="XM_001422617.1"
                     /db_xref="GeneID:5006711"
     CDS             complement(join(101005..101217,101286..101519))
                     /locus_tag="OSTLU_29355"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422654.1"
                     /db_xref="GeneID:5006711"
                     /db_xref="JGIDB:Ost9901_3_29355"
                     /translation="MASERAREEGEKPRYGLGEGPYALNEDDTAKDPVAFREALLEDQ
                     EKLKDIERDEALAKALLGEDTGAMQEALKKLVAIARHQAEQDSNYDMNSSDIMRARCT
                     VPRDPTVLYQGMLKAGLQYGPSFRLLSQVWVPEALDREQREGGGAS"
     gene            <101631..>102155
                     /locus_tag="OSTLU_29356"
                     /db_xref="GeneID:5006712"
     mRNA            <101631..>102155
                     /locus_tag="OSTLU_29356"
                     /product="predicted protein"
                     /transcript_id="XM_001422445.1"
                     /db_xref="GeneID:5006712"
     CDS             101631..102155
                     /locus_tag="OSTLU_29356"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422482.1"
                     /db_xref="GeneID:5006712"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="JGIDB:Ost9901_3_29356"
                     /translation="MAPPSKACATRLTRELRQFRAAPPPLAPRVHVDDGDLLEWFVLI
                     QGAHDTPYERGWYVMKIKFKPTYPFAAPAVSVLTPNGRFAENQSICMSMTEWHQESWN
                     PAWSSQAIVTGFISFMSANEHTSGGVRTTDEEKKRLAAASLAWNAAQPGLVKKFPELA
                     DAEAMKALETAKPR"
     gene            complement(<102263..>103138)
                     /locus_tag="OSTLU_94057"
                     /db_xref="GeneID:5006541"
     mRNA            complement(<102263..>103138)
                     /locus_tag="OSTLU_94057"
                     /product="predicted protein"
                     /transcript_id="XM_001422618.1"
                     /db_xref="GeneID:5006541"
     CDS             complement(102263..103138)
                     /locus_tag="OSTLU_94057"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422655.1"
                     /db_xref="GeneID:5006541"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="JGIDB:Ost9901_3_94057"
                     /translation="MRRASEALDAEVVAHDSCGFGLTARPRDVKKYTRASDAKACRAI
                     AREVGGDAAARSLTLMGHSLGAVGAALAAAQGGVDYVVLVAPAIIGGKLRKNDAGDDA
                     ALSLPTFVRVAFAAVGAAAATAAWCLTCAVKPFLILLLRKLVRSKEFWTKGLRAAIDP
                     SRVDAMASDWIDGYRKPSVVRDWDVGMFRVVLASVVAASSPREIWRDAMARARATTQP
                     STLEREDAVNALVESGAKILIVHGENDVIVPASNSRTLAKLLNCELRILPKCGHMPHE
                     ESPEAFIDVLRDFIS"
     gene            <103740..>104732
                     /locus_tag="OSTLU_18953"
                     /db_xref="GeneID:5006713"
     mRNA            <103740..>104732
                     /locus_tag="OSTLU_18953"
                     /product="predicted protein"
                     /transcript_id="XM_001422446.1"
                     /db_xref="GeneID:5006713"
     CDS             103740..104732
                     /locus_tag="OSTLU_18953"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422483.1"
                     /db_xref="GeneID:5006713"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="JGIDB:Ost9901_3_18953"
                     /translation="MATARIARVAPARADARARRARGARASSTAPSTPARATRRRAEA
                     PRRDERLEVITFDLDDTLWPTTPVVNAANEALIEWCSARLGGRFPRTARVHATMKRIR
                     EQRECEAAARGTTAEPMSYAAIRIAGATRAAIECGIPESDAVATVARGYHLAWIPMRN
                     AMARELVYPGAAEALRAIRERHPGVAVGSITNGFGSAAGAGLGEFFDFEISAEALIDE
                     HMVHGEMARKPNAYPFQLAMGIAIADHGYSGDADSWTHVGDDVLNDCYCAKQFDFKTV
                     HVCDPTTKPYESGGGAPYAEKSLRGGVEANSDAVVDGVISHVRELPELLDRWYV"
     gene            complement(104900..>105486)
                     /locus_tag="OSTLU_29359"
                     /db_xref="GeneID:5006542"
     mRNA            complement(104900..>105486)
                     /locus_tag="OSTLU_29359"
                     /product="predicted protein"
                     /transcript_id="XM_001422619.1"
                     /db_xref="GeneID:5006542"
     CDS             complement(104935..105486)
                     /locus_tag="OSTLU_29359"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422656.1"
                     /db_xref="GeneID:5006542"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="JGIDB:Ost9901_3_29359"
                     /translation="MRELRHHERKLLKKVDFLQWKSEHSHREVSTIRRYHLRDRDEFK
                     RFNVLVGSVTKLANALKKLDARDETRQHTTEALLAKLYDIGAIPSTKSLTLCDRLSTS
                     SFCRRRLATVLVRARMCETLREATTFIEQGHVRVGAKVTRNPGYIVTRDMEDYVTWVD
                     TSKIKRKVAAYNDKLDDYDLLGE"
     gene            complement(<106074..>107426)
                     /locus_tag="OSTLU_29361"
                     /db_xref="GeneID:5006714"
     mRNA            complement(<106074..>107426)
                     /locus_tag="OSTLU_29361"
                     /product="predicted protein"
                     /transcript_id="XM_001422620.1"
                     /db_xref="GeneID:5006714"
     CDS             complement(106074..107426)
                     /locus_tag="OSTLU_29361"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422657.1"
                     /db_xref="GeneID:5006714"
                     /db_xref="JGIDB:Ost9901_3_29361"
                     /translation="MACELEEEEFYDHVELKRTHGKIPLYPWEGETWTGPRMLDVVEH
                     GLTCADVDAGLGRPCTLKMSNERQIQHLRNAIADVMQSVAFEFAMKVFEGHDTPPEVA
                     CQRFLRRLCEACHGGVYCRLRIVHKTKDACLANLQDSKNLGAALYTRIFMLRFLKRFP
                     PQHGFRHREIDADETKERAVRDLADTFDMFKIWPASESHPAALFCCMTTAGMKNLLRT
                     EVTDSWYGVNQMYEVALAQPSEYLSGKLPPMIVDVKKCSVTVFTRANIALIARQFAVA
                     EFHPEPFAHFIVTNCPYLLAALWSIGKLFLTESARNKFVICTGDASTEIQKRYGVAKR
                     DQPVECGGEARDEMIAARDWLAVVPHEGAIKDLQRAMAGRRAIAGTASDPDASPLVRK
                     FSALNMTPKMAFKTGIRPSSTSLVSVAIRAVEFVFLLALFALVFRSPARRLYMVAMNT
                     "
     gene            <108136..>108993
                     /locus_tag="OSTLU_6302"
                     /db_xref="GeneID:5006715"
     mRNA            <108136..>108993
                     /locus_tag="OSTLU_6302"
                     /product="predicted protein"
                     /transcript_id="XM_001422447.1"
                     /db_xref="GeneID:5006715"
     CDS             <108136..>108993
                     /locus_tag="OSTLU_6302"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422484.1"
                     /db_xref="GeneID:5006715"
                     /db_xref="InterPro:IPR000878"
                     /db_xref="JGIDB:Ost9901_3_6302"
                     /translation="EPGLFLVATPIGNLEDVTLRALRVLRDADAVLAEDTRRTKQLMR
                     AYDIATPLVSYHAHNEAKRRESVLGRLASGAALALVSDAGMPTVNDPGADLAARAAAM
                     GVRVFPVPGPSAVLAAIAGAGLPTDEFTFIGFPPPKSSQRAKRFKSFARNKATLIMFV
                     PPHKLIGTLEDAHAALGDRRCSVCRELTKVHEEFWRSTLSEARAEFERRAPRGEITLV
                     IEGYDDDQPALASDEDDDDDNSAPSSSNVEDAVRSLLEDGASPSDASRRVAKELGVRR
                     RETYGVAQRL"
     gene            <109137..>111899
                     /locus_tag="OSTLU_89668"
                     /db_xref="GeneID:5006543"
     mRNA            <109137..>111899
                     /locus_tag="OSTLU_89668"
                     /product="predicted protein"
                     /transcript_id="XM_001422448.1"
                     /db_xref="GeneID:5006543"
     CDS             109137..111899
                     /locus_tag="OSTLU_89668"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422485.1"
                     /db_xref="GeneID:5006543"
                     /db_xref="JGIDB:Ost9901_3_89668"
                     /translation="MPEGVGDGLPFGRSRQRAYGDITRALTRPPREDLSAAASHTENR
                     NHDRADRRSVGGEIDLLRREITRVQKALTDLKAKRIENKSPNALPERKRWSVMDRCRP
                     TRKCDEKDERHSLKPSLVRDMSARQLILRKPPEPATRGMAIMLLRRLDDVLPEGAIEN
                     KCAELSKMGGLGTVSGALARYASLHIDTFSDDFEIIDTAFRESARQVSAGCRDRGELL
                     DAIRERYGELFSTMRNVCDRWQRRNESLVIELDELQGALETKENEQLALTERVARCKF
                     EADSARRRQQVDNERADLMTKRSRARENELMMMQKIDRAEIHRLHERLKLMETQSRRD
                     LEFAVMSMEQSLYDALNDRDNLSKRVRFLDNQLLQTRMMLPDKSCYSTTETQTLERMD
                     GQSTYKGEAAATAGVSAEVQTDHVVISKRRRKEKASRSGMDGKDTRLHAPDLGTDADQ
                     WKREILGGFATLITSQKIGRRKPRAWVLKCIAHIYTDKLTLDSTAQINGDDGAMCDAS
                     AQPLTNFVYDWHLHKFGLKQLAETNLHDLIASTSHHAEECGLISQFGAFCGFGAHRAH
                     RAPVLTDSPTVTFYLRLLEALASETNLGQLFMEFGLGNDSKIDITPTMTGTLALTRAL
                     DAIKRVFTEYKDDASALKDFVGKQLGIKHATNSTTVKFASLMRGAMDEYTSRRLASLE
                     TLKALFLAADCDDDGALVRDEFAAALRLCDYKVTEQFAARAFESCATRRGDKPSELFV
                     GVDAFIKSCLMNGMETFRVIPERPPGETAATTKMTASATSSHKNQGSSSPTAPSLSMS
                     SNAWMALVDQHVASPEGAVAKLRALPPGVSLDRCRRQLRRLDQLRAARTDGQAAYLAL
                     KLLTNDVRTATVRAKGGFKRLGATVLHQVSFSMRAARVESDPTVVASASPDHPRDDDF
                     DPLATS"
     gene            <112086..>112874
                     /locus_tag="OSTLU_43750"
                     /db_xref="GeneID:5006544"
     mRNA            join(<112086..112119,112459..>112874)
                     /locus_tag="OSTLU_43750"
                     /product="predicted protein"
                     /transcript_id="XM_001422449.1"
                     /db_xref="GeneID:5006544"
     CDS             join(112086..112119,112459..112874)
                     /locus_tag="OSTLU_43750"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422486.1"
                     /db_xref="GeneID:5006544"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="JGIDB:Ost9901_3_43750"
                     /translation="MASKRIIKELLDLQKDPPTSCSAGPRSDDDIFHWDATIIGPSDS
                     PYQGGLFFVAIHFPPDYPFKPPKVNFKTKVYHPNVNSQGSICLDILKEQWSPALTISK
                     VLLSICSLLTDPNPDDPLVPEIAHIYKTDRNRYNDLAKEWTRKYATL"
     gene            <113714..>114055
                     /locus_tag="OSTLU_8317"
                     /db_xref="GeneID:5006545"
     mRNA            <113714..>114055
                     /locus_tag="OSTLU_8317"
                     /product="predicted protein"
                     /transcript_id="XM_001422450.1"
                     /db_xref="GeneID:5006545"
     CDS             <113714..>114055
                     /locus_tag="OSTLU_8317"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422487.1"
                     /db_xref="GeneID:5006545"
                     /db_xref="InterPro:IPR001646"
                     /db_xref="JGIDB:Ost9901_3_8317"
                     /translation="SSQNFTGADLRFAKLRGANLRGAYMMKMVAPEVDFTGADMSDAL
                     MDRAVLVKANFTNAILNRVVLTSSDLEGAIVENADFTDALLDVKTQQALCKTASGKNP
                     ETGVSTRVSLGC"
     gene            complement(<114223..>115080)
                     /locus_tag="OSTLU_29366"
                     /db_xref="GeneID:5006546"
     mRNA            complement(<114223..>115080)
                     /locus_tag="OSTLU_29366"
                     /product="predicted protein"
                     /transcript_id="XM_001422621.1"
                     /db_xref="GeneID:5006546"
     CDS             complement(114223..115080)
                     /locus_tag="OSTLU_29366"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422658.1"
                     /db_xref="GeneID:5006546"
                     /db_xref="JGIDB:Ost9901_3_29366"
                     /translation="MSDAADDDDAPQTADELRAKLDEYERSLADVEASLADAPGDEEL
                     IDLKDSLEDVIEITRDVLATTLAARDDVDDDELGAGDGANDARGATAATATTTTTLGG
                     TFAGRDVLALDAEGAWRRGRCVRAMDDGTLDVYLTESHTRVAVKASDVRIDIGGQAKT
                     KAKAPPPPPPREVYRGVPEPRRVELTRKTEFVRKEPPKNLEIKPGDDSETRELKRKKL
                     KTFKYKQRQQEISAEQNQKASSWQNFQSKGLKKGKKGIQKNSIFALPEDLTEAKGVGF
                     AGSKPVGNR"
     gene            <115379..>116434
                     /locus_tag="OSTLU_43907"
                     /db_xref="GeneID:5006716"
     mRNA            <115379..>116434
                     /locus_tag="OSTLU_43907"
                     /product="predicted protein"
                     /transcript_id="XM_001422451.1"
                     /db_xref="GeneID:5006716"
     CDS             115379..116434
                     /locus_tag="OSTLU_43907"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422488.1"
                     /db_xref="GeneID:5006716"
                     /db_xref="InterPro:IPR004044"
                     /db_xref="JGIDB:Ost9901_3_43907"
                     /translation="MPRENEAEDGARGDEDARDFDDDDDDDENVEVLPYIGGELLKPD
                     PPGHKSGYAAIVGRPNAGKSTLMNDLVGTKLSIVTYKPQTTRHRILGILSDENSQMVL
                     LDTPGVMVEEFNKLDGMMLKSVRNSMANADVLFYIVDAARDPYGAWEGLAPKKGKRVP
                     TALILNKCDMVGDRERIMELIEYFQAQEAIDEVLPISALNSTGTRNVKEWALERLPLG
                     PTLYPKDAISEHPERFFIAEIIREKIFLQYKQEVPYSTQVWIETHKERDGVKKDLILA
                     KVFVERQSQIGIIVGQGGAAMKKLSSSARADIEKFLGRPVFLDIQVKVRDGWREDDRS
                     LEDLGLDDPNRLESPSI"
     gene            <116907..>118490
                     /locus_tag="OSTLU_43800"
                     /db_xref="GeneID:5006547"
     mRNA            <116907..>118490
                     /locus_tag="OSTLU_43800"
                     /product="predicted protein"
                     /transcript_id="XM_001422452.1"
                     /db_xref="GeneID:5006547"
     CDS             116907..>118490
                     /locus_tag="OSTLU_43800"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422489.1"
                     /db_xref="GeneID:5006547"
                     /db_xref="InterPro:IPR008671"
                     /db_xref="JGIDB:Ost9901_3_43800"
                     /translation="MRARRAPAARVTRAIRARGDAGTRARDVAPGATRRGASATPRAT
                     RRPSARETRPELYGLDASWDPLTSGDRRESEESRTPLPETLPNVRWGTSASEAYDLVI
                     VGCGPAGLTAADEASKRGLRVALMDPSPLAPWMNNYGVWCDEFKSLGFDDCYRAVWNK
                     ARVIIDDGDADGKMLDRAYAQVDRKKLKQKLIARSVTQGVEFGIAAVDSCDNSDPNHS
                     VVTLSDGRKVYAKMVLDATGHSRKLVDFDRDFTPGYQAAFGIVCTVEKHDFPLDTMLF
                     MDWRDEHLSPEFKRANDRLPTFLYAMPFSETEVFLEETSLVARPGLEFDDLKLKLKER
                     LDYLGVKVTKVHEEEYCLIPMGGVLPTFPQRTLGIGGTAGMVHPSTGFMVAKTMLCVR
                     TLVGTLDEALKAGKRGDITGALEAAEAAQMNNGKFDADATAALVWNSIWPENDLRMRT
                     FMCFGMETLMQLDIDGTRQFFDTFFDLPKDVWAGFLSWRIQPVGLLSLGVNLFALFSN
                     YMRVNFVKSALPFMGSFFAN"
     gene            <118707..>120098
                     /locus_tag="OSTLU_43511"
                     /db_xref="GeneID:5006548"
     mRNA            join(<118707..119180,119247..>120098)
                     /locus_tag="OSTLU_43511"
                     /product="predicted protein"
                     /transcript_id="XM_001422453.1"
                     /db_xref="GeneID:5006548"
     CDS             join(118707..119180,119247..>120098)
                     /locus_tag="OSTLU_43511"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422490.1"
                     /db_xref="GeneID:5006548"
                     /db_xref="InterPro:IPR008671"
                     /db_xref="JGIDB:Ost9901_3_43511"
                     /translation="MKDDREWIAFQQRKVFSEQKQIKEYLSALNDRDKVDVLVVGAGP
                     AGLAIAAETAKKGLSVGLVAPDTPFVNNYGVWLDEFKDLGLEHCLLHKYDDALVWFDD
                     SDPASGTELGRPYGQVCRRRLRDHLLKECAAAGVKYLPGLVDFVRHGDVEKNELAEAN
                     RGQQFTLNSRLVVAGTGHNRDMLSYEEGAPPGWQTAYGVEVRIPNHGFPVNKAVFMDF
                     RQSDPEAMKEEQDEGVWRVPSFLYVLPVDKDVVFVEETCLVARVQVPFDELKRRLYRR
                     MKRMGMEIVEEDILEVEASWIPLGGTPPVAPQRTIAYGAAAGMVHPASGYSVVNSISK
                     APRVATAMAEGLKEGGEIEASRRAWEILWGAEPRRQIGFYQFGMELLMSLRIEQMRNF
                     FSTFFALPTNLSRGFLGNRLSSSELIMFALTTFAIGNNELRGLLLAHLVS"
     gene            <121409..>121810
                     /locus_tag="OSTLU_29369"
                     /db_xref="GeneID:5006549"
     mRNA            <121409..>121810
                     /locus_tag="OSTLU_29369"
                     /product="predicted protein"
                     /transcript_id="XM_001422454.1"
                     /db_xref="GeneID:5006549"
     CDS             121409..121810
                     /locus_tag="OSTLU_29369"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422491.1"
                     /db_xref="GeneID:5006549"
                     /db_xref="JGIDB:Ost9901_3_29369"
                     /translation="MAAMLDQSLDAMIKDAAKATPKRRNAKKSANVKVGGKKNARSAM
                     KKTNAGPTPMAVGGVKKTKNNKKKPARSNAATAMAVDGMMRGGGGRQANAQAGGRTKL
                     VVGNLDFKVNDRDIKVRRRATLAWEGPSVRA"
     gene            121897..>123162
                     /locus_tag="OSTLU_29370"
                     /db_xref="GeneID:5006550"
     mRNA            121897..>123162
                     /locus_tag="OSTLU_29370"
                     /product="predicted protein"
                     /transcript_id="XM_001422455.1"
                     /db_xref="GeneID:5006550"
     CDS             122557..123162
                     /locus_tag="OSTLU_29370"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422492.1"
                     /db_xref="GeneID:5006550"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="JGIDB:Ost9901_3_29370"
                     /translation="MRPETRPRLRSRRFIFARSTWLDSRTLDFLKDESIDDFAAAIAL
                     PRLSQELFGQVGRVLNAGINYGPNGKSKGTAEVTLATLESALKAVKTYNGVKLDGRPL
                     NIVIVDAPQQPKQKPITQRLSGLKQQPKNKNGKQQQKKAPVPAPKRGKATQKVVASAK
                     KAAPKKKPARKPKEKKAAPTAADLDASLDAYKASADVQMAA"
     gene            <123292..>123471
                     /locus_tag="OSTLU_29371"
                     /db_xref="GeneID:5006551"
     mRNA            <123292..>123471
                     /locus_tag="OSTLU_29371"
                     /product="predicted protein"
                     /transcript_id="XM_001422456.1"
                     /db_xref="GeneID:5006551"
     CDS             123292..123471
                     /locus_tag="OSTLU_29371"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422493.1"
                     /db_xref="GeneID:5006551"
                     /db_xref="JGIDB:Ost9901_3_29371"
                     /translation="MLKTIASLVVKDNGEYSRIHVFAFVLVALHVTALFVWIFLTARQ
                     RPPSARDRVDPTKDE"
     gene            complement(<123639..>124625)
                     /locus_tag="OSTLU_29372"
                     /db_xref="GeneID:5006552"
     mRNA            complement(join(<123639..124395,124546..>124625))
                     /locus_tag="OSTLU_29372"
                     /product="predicted protein"
                     /transcript_id="XM_001422622.1"
                     /db_xref="GeneID:5006552"
     CDS             complement(join(123639..124395,124546..124625))
                     /locus_tag="OSTLU_29372"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422659.1"
                     /db_xref="GeneID:5006552"
                     /db_xref="InterPro:IPR001107"
                     /db_xref="JGIDB:Ost9901_3_29372"
                     /translation="MPNASVVSAALQTLVYGGAASYGLYNSLFNVEGGHRAIVYNRFV
                     GVKDKVYAEGTHFMIPWVERPYVYDVRARAHQVNSQSGSRDLQMVNISIRVLTRPDAG
                     KLPEVYRTLGMDFNERVLPSVIHETVKSVVAQHNASELITKREQVSLSIRHLLKQRAA
                     QFNMVLDDVSLTALTFGREYTAAIESKQVAQQEAERAKFVVDKARQDKLSAVIQAEGE
                     AKSAKLIGEAIANNPAFLTLRKIEAARAIAQTMANSNNRVMLSADSLLLNLQDDKPAD
                     KK"
     gene            <124704..125658
                     /locus_tag="OSTLU_29373"
                     /db_xref="GeneID:5006717"
     mRNA            <124704..125658
                     /locus_tag="OSTLU_29373"
                     /product="predicted protein"
                     /transcript_id="XM_001422457.1"
                     /db_xref="GeneID:5006717"
     CDS             124704..125621
                     /locus_tag="OSTLU_29373"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422494.1"
                     /db_xref="GeneID:5006717"
                     /db_xref="JGIDB:Ost9901_3_29373"
                     /translation="MAAFDGERGEFRFAFGVSDDGAIERARGAATATATAAATATPAE
                     EIVARDVARRARDDPATWSGTYETHGDVEVVRSAHGTTASTLEGCPEDADVVRGVYEG
                     GLKAWECARDLAAHVGTAAFDVDGLVDAAGGRVRAMELGAGQAGPGLAAARRLGARCE
                     TLTLTDYNRDVVEEVTAPNALATFALMESEGEATPGRLRLLCGDWSGYDAFVEADGVD
                     LLLTSESIYDASQYGSLCAFIAHALSPRGVCLLAAKSYYFGVGGGTNAFASYCETYFG
                     ALRVERVKTISDGKSNVREILAIRKISEQ"
     gene            complement(<125670..>126749)
                     /locus_tag="OSTLU_89674"
                     /db_xref="GeneID:5006553"
     mRNA            complement(<125670..>126749)
                     /locus_tag="OSTLU_89674"
                     /product="predicted protein"
                     /transcript_id="XM_001422623.1"
                     /db_xref="GeneID:5006553"
     CDS             complement(125670..126749)
                     /locus_tag="OSTLU_89674"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422660.1"
                     /db_xref="GeneID:5006553"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="JGIDB:Ost9901_3_89674"
                     /translation="MSAPSPAPLPNFARAASRRAFLTASALGISAITRVGGAHARAVA
                     ANPRTATKPELDGPRTRVALNGRRLIAIGDLHGDFLAMVKSLELAQVIDGNGKWNGGD
                     AVVVQVGDVLDRGDSEIAILRKLRSLAKQAKEAGGDLITMNGNHEIMNVMGDFRYATP
                     GAFEECRRYAEKKRAKENAKEGKGEEASATRGDEDEATAGIRARQQLFKPGGEIAKWL
                     AKQPTVLVVDDGTVFAHAGIDLSHVEYGFERINKEVAMWMEGKTKMPPKQVLESDGVV
                     WTRDYGGKDAGIQYEAQSCRRLASALEGADAKRLVIGHTPQTTGVTSGCKGTVWRVDV
                     GASRGIYGNSAQVIEIIGGKVRVLA"
     gene            complement(<126871..>129369)
                     /locus_tag="OSTLU_311"
                     /db_xref="GeneID:5006718"
     mRNA            complement(<126871..>129369)
                     /locus_tag="OSTLU_311"
                     /product="predicted protein"
                     /transcript_id="XM_001422624.1"
                     /db_xref="GeneID:5006718"
     CDS             complement(<126871..>129369)
                     /locus_tag="OSTLU_311"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422661.1"
                     /db_xref="GeneID:5006718"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR007148"
                     /db_xref="JGIDB:Ost9901_3_311"
                     /translation="VTCVARSPNGDVVACGASDGSIRLWSLSDLDCDVTFRGHKRDVT
                     ALRFSQDGSLLVSGGRDADVVVWDVVAESGLTRLRGHRDQITDVVIIDGKMHKSAELF
                     GRKVVSTSKDGYVKVWDLGTRACTQTCTGFEGETWSLDVNPTQTRCVIGTWDDKLHVY
                     DCDESRDGYDQESPLVRMGTVTRAAKGRAMTVRFHQTGNYLGVQGAGRGLEIYRVRGD
                     KEAMKKQKRRLKRKREKMEAKAREAEELGDLDAAKEAREEHDEEGARSAGDELELAST
                     VTTKTKMRGFAFATEAPKRTDVMCKVAVLLDDNSVQEWEIIEEEEPEKLHAIENPGHR
                     SDVRAVALSPDDETVLSCSSNGCKLWNVADGACLRTVKGGYGLCASFAPGGRHAIIGT
                     KQGAIELVDVNAGTQLTVPDEAHEGAVWAFAMLPDDSGFVSASADKTVRFWEWTLEKG
                     ENGLRTLSFNHMRTLQMAEDVLSCQISPDGKLLSVSLLDNTLKVFFVDSLKFNLSLYG
                     HRLPALCHDISSDSQLLASAGADKNIRIWGLDFGDCHRSIFAHQDSVMALKFVPKTHY
                     LFSVGKDKLVKYWDADKFDPLLTLEAHHGPVWCLAVSTRGNFVITGSGDRSIRMWERT
                     DEPFFVDEEQEKRLESMLDEGIDDERVRPNTDLPAEGEAGMAGRKTLETLTAADAIVE
                     ALELAEHETKRLAEHAADSAKSGGKLAPIQPNPLLLGQSPETYALNAIAKIRPSELEQ
                     AILCIPFDFAHEILNHLTTWLNAGQKVELTCKIAALVMRLHANSFGRTPETRRTLVKL
                     RPLLRARAKEARDLMGFNLAGLNVLDAFIRDNEEV"
     gene            complement(<129800..>130537)
                     /locus_tag="OSTLU_29376"
                     /db_xref="GeneID:5006719"
     mRNA            complement(<129800..>130537)
                     /locus_tag="OSTLU_29376"
                     /product="predicted protein"
                     /transcript_id="XM_001422625.1"
                     /db_xref="GeneID:5006719"
     CDS             complement(129800..130537)
                     /locus_tag="OSTLU_29376"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422662.1"
                     /db_xref="GeneID:5006719"
                     /db_xref="JGIDB:Ost9901_3_29376"
                     /translation="MRASPIGARAATRAAPRRERRRDAKRSAAARARGSDDARAGATT
                     TRRRFARGLQLSLLPLLAKDARARDEGDATKETRTFSVETRSFRVGNVPEYFEEIDLG
                     DSASGKTYETLLRDKRFGLAGNTITLSKQTASSGGPRSLRDIGSIEDVAARLVDSENK
                     KSRGKANAKLRVFAERRKDSIEYYDIVYEKNVLGVRRVIQCTLALDVDDAGSSTLYTL
                     TVEEDAERYDDAEAEMRAVADGFKIFR"
     gene            <130663..>132777
                     /locus_tag="OSTLU_94061"
                     /db_xref="GeneID:5006720"
     mRNA            <130663..>132777
                     /locus_tag="OSTLU_94061"
                     /product="predicted protein"
                     /transcript_id="XM_001422458.1"
                     /db_xref="GeneID:5006720"
     CDS             130663..132777
                     /locus_tag="OSTLU_94061"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422495.1"
                     /db_xref="GeneID:5006720"
                     /db_xref="JGIDB:Ost9901_3_94061"
                     /translation="MARDAVVERRSSARATPRVAARSESRAGHRSRRLERRDGRAGAA
                     TSLGFRRARDVANEDGIERCEWNASSEAMSRSVLDAATTRAVAKVAALRAANGDDEER
                     RAAVEDALRAVDLVASSAKEEVKSAMRSVKRGRARAKELREELARETRRSVKAETDAR
                     ELRCDLECARTASTCVDVDGASRITASDDSNGLGHTDDDDDSRVRRASQSSSECASAS
                     PRTERELSEVASSLGDADVVASLPVFVTDLNRECGGETGTAVAGRDRHVDDDDARFFA
                     DTEALDSPTTHRLATLIAIELALSYDSSMDVSHRVREFFYKRHGSRTLGDKHHQMFTK
                     ALATINAQSEWVQTFTRFKELDAFELERVMSTIRFTQHVLIESPQTAPVLGVEEATRS
                     LAHLLAPVLGEAAPSTEDVDVIRRSATHRNGISRVSFALVIERGLVGIVRARTFAREA
                     IAATFAKRHPYGTLAHHPALVKTLSEAFKSAGAIARAMLNDDDMIDRVAADIARRDAS
                     TQDFVTLECFVDVASRELERSGVSKASDVVTPLRPHTGPSPPKVASNSIRLVSSLALV
                     AHAWSMAAAVVDRWLQKCAADARRPPAPTAVHRTAPSIATGASRAPNPPNPPLPQPID
                     ASKRRLIKRHVGRLAKLRATADFAVRAAQSLARRADATSDVDRAWQTYASTVCAFEAA
                     FLARRRSLGVVEGALADCWRPH"
     gene            <133003..>133353
                     /locus_tag="OSTLU_43453"
                     /db_xref="GeneID:5006554"
     mRNA            <133003..>133353
                     /locus_tag="OSTLU_43453"
                     /product="predicted protein"
                     /transcript_id="XM_001422459.1"
                     /db_xref="GeneID:5006554"
     CDS             133003..>133353
                     /locus_tag="OSTLU_43453"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422496.1"
                     /db_xref="GeneID:5006554"
                     /db_xref="InterPro:IPR010301"
                     /db_xref="JGIDB:Ost9901_3_43453"
                     /translation="MSSSFAKKLADSDKRVRDKTFVNVSKWLASRETLTAIDGKKLWR
                     GLFYSYWHADGRATQLEVANKMGALVHVLNREVAMVYLEAGLWTMRTEWGGIDKHRMD
                     KYCLLTRRVLHHGFR"
     gene            134683..136257
                     /locus_tag="OSTLU_29378"
                     /db_xref="GeneID:5006555"
     mRNA            134683..136257
                     /locus_tag="OSTLU_29378"
                     /product="predicted protein"
                     /transcript_id="XM_001422460.1"
                     /db_xref="GeneID:5006555"
     CDS             134693..136201
                     /locus_tag="OSTLU_29378"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422497.1"
                     /db_xref="GeneID:5006555"
                     /db_xref="JGIDB:Ost9901_3_29378"
                     /translation="MPALEEVDCEFIGPGGARVERALGDVVRCPVAVRGACATSDAHP
                     RDASRQQSDSAKPSLARAVRDAALSNGALTEITRALSQSTRDGAAPKAALAWHPTKEI
                     LATTDDGGRCATRDAAMDDKGAVRARKRASDDESECEDEVTTLRHRAHGRCAAMAWRP
                     RRGRALALAGASGVCVWTRERRATRASSAVASETGALSPVDAAKVRALAQRGTSGKTS
                     GYRWRLTIYNERGAHEAGPTAPPGGICASECVAWSPDGLLLVACSRRCRVIHCWDVSA
                     GTYTPLGGGGAGISRVAFSACGGYLLAAHVGEGFSVWQCDTMTCRKWSTNGREVTATA
                     WGNVQGKQGDAPVALIATRGSAKLSAVHLSPRDCVNEIAAHVLPLELPDIVGGDASRS
                     GTSEHDVADMVWDASSSRLALALRGGDRDGVVALYATRTTNIVSSSLIGYFDTADDDT
                     GARVPAQAVKISTPLAVAAGRLRATLAVAFANGDVALVPLTFADPSLASAAS"
     gene            <136516..>137304
                     /locus_tag="OSTLU_29379"
                     /db_xref="GeneID:5006556"
     mRNA            <136516..>137304
                     /locus_tag="OSTLU_29379"
                     /product="predicted protein"
                     /transcript_id="XM_001422461.1"
                     /db_xref="GeneID:5006556"
     CDS             136516..137304
                     /locus_tag="OSTLU_29379"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422498.1"
                     /db_xref="GeneID:5006556"
                     /db_xref="JGIDB:Ost9901_3_29379"
                     /translation="MLDVMEGGPKLRRWYGSDSSVGDGTGASGDENGDETAAYGDADE
                     ADEDDDDVELNLPKTSILVTNADGALGESIVVQLILAKASVVAACEAEQIVGAETRFG
                     PYVNVVSNSMSAGARLNGVRAMVVTDALEEDLLAACVRRGVKHVVLVSSAKSAGGGLF
                     PSANEKARRDKTREELAKRSGVALTIIRPCSVKSSPSQGREIRFGQGDTLTGEVSMED
                     LAEVCARALTRPPKPGESLEFEVSNGAAAAERDWKALFAPLVIV"
     gene            complement(<137765..>138969)
                     /locus_tag="OSTLU_29380"
                     /db_xref="GeneID:5006557"
     mRNA            complement(join(<137765..138757,138886..>138969))
                     /locus_tag="OSTLU_29380"
                     /product="predicted protein"
                     /transcript_id="XM_001422626.1"
                     /db_xref="GeneID:5006557"
     CDS             complement(join(137765..138757,138886..138969))
                     /locus_tag="OSTLU_29380"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422663.1"
                     /db_xref="GeneID:5006557"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR006845"
                     /db_xref="JGIDB:Ost9901_3_29380"
                     /translation="MATRSRGFPRAARPDVVRAAQKDETHAAATAERLHDACARALGP
                     RLSVRWNRALRACGRAAYPALTYLSGRATLGEEYCDLASGDARGRKSSARALWTRFVI
                     DAFGEEIARELRGCVVRNHERGVGLGGGETSAATRAMDASARTALALVGRRVERGMGD
                     ETTSHGQAMIDARGGFANAAHLALFYANGEYYDWSCRASGTRRAFTGAYAGEERPSYA
                     LLGVFVAFQLAVVTCENVASFARGGGSSETSGAPSVGARVLESDGSPAIEAAIVASPR
                     LDVFGNPVDEGASASRKSKSTSPLIAAKCALCLSPRESPTATPCGHVFCWRCIAGWAS
                     KKPECPLCRAPTTPQSLVPLSNLA"
     gene            <139333..>140232
                     /gene="TPR2a"
                     /locus_tag="OSTLU_89680"
                     /db_xref="GeneID:5006721"
     mRNA            <139333..>140232
                     /gene="TPR2a"
                     /locus_tag="OSTLU_89680"
                     /product="TRP-containing protein"
                     /transcript_id="XM_001422462.1"
                     /db_xref="GeneID:5006721"
     CDS             139333..140232
                     /gene="TPR2a"
                     /locus_tag="OSTLU_89680"
                     /note="contains a tetratrichopeptide repeat"
                     /codon_start=1
                     /product="TRP-containing protein"
                     /protein_id="XP_001422499.1"
                     /db_xref="GeneID:5006721"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="JGIDB:Ost9901_3_89680"
                     /translation="MEPIQFTLSARTGIADEEGRTRDGPARVEALDACAMTMRVGERA
                     TFECGAALAYGKEGNFSFPAVGKDRAVVLDLEILGARGSAAAPEMRQRDMTYEQRVER
                     VRAHRSNGNAAFAGGRAREAVREYSMALTYLTEDFMMQLFDKYEVEAHEEFVAAHGNL
                     AAAYLRLGAFEDAVTHVGYVLKVDENNAKAYYRRGKARAGLGQEDAAREDFLKAKKIT
                     EAAGLVDANVVKALREIDAAIRDRERATSAAFKGIFNTKTDGGDASSNADANVARKPP
                     DGGGSFISRAVASLFGKSRREGP"
     gene            <140260..>142218
                     /locus_tag="OSTLU_89681"
                     /db_xref="GeneID:5006558"
     mRNA            <140260..>142218
                     /locus_tag="OSTLU_89681"
                     /product="predicted protein"
                     /transcript_id="XM_001422463.1"
                     /db_xref="GeneID:5006558"
     CDS             140260..142218
                     /locus_tag="OSTLU_89681"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422500.1"
                     /db_xref="GeneID:5006558"
                     /db_xref="InterPro:IPR000399"
                     /db_xref="JGIDB:Ost9901_3_89681"
                     /translation="MSEEPKEITGATALCKVAAAGGVEVCFANPGTSEMHVVGALAEC
                     ADIRSVLVLHENVATGAADGYSRVKRDVNRDRNAMAMTLLHLAPGLMNGLSNLHNASR
                     GRSSILNVVGEMSTFHRGNEALLENDIESLARTVSTKYVHTSAAVDAIASDAADAIEA
                     ALRHRGVATQIVPHDLTWSRVLDSGRLSDAIARAENVRNRRDGAEDVVVTDAVRAFLR
                     EMLARAKPLARGEVLFYIGGDACGEEELRIVGDVAEALGADVVCECFFSCIERGGDMP
                     KVQRAPYFPKDAANAFAKYKVVIFLDVPRPPTAMFGYRDSPTKLFAQNDDDMWFVDPP
                     GNAMMLDVLRALAMEVNIGVQCAPKMSDVAAVVEHVVSEALAKSVEDKEDSLWNYGMT
                     STKAVSVHDKLCKEFDIKLQSTIVFNHNSINALTNAVATKLGIADESPKTAIAPKDVD
                     ASPKSTLEGEYVQVRCDSPTGALNGAKVCRIIAGMQPAGAIVVDESLTSGSTYWKDSE
                     SSARFTHMTLTGGSIGFANAAAVGVALAAPERQTIALVGDGSAQYTVQALWTQAREKL
                     NVVTVIMNNSKYQILRVECAIQGVRASGGACDSLTKLDDPSIDWCKLAEGYGVRGVRT
                     TTCEEFADAFARALDADGPTLIDAVLEA"
     gene            complement(<142268..>143161)
                     /locus_tag="OSTLU_29382"
                     /db_xref="GeneID:5006559"
     mRNA            complement(<142268..>143161)
                     /locus_tag="OSTLU_29382"
                     /product="predicted protein"
                     /transcript_id="XM_001422627.1"
                     /db_xref="GeneID:5006559"
     CDS             complement(142268..143161)
                     /locus_tag="OSTLU_29382"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422664.1"
                     /db_xref="GeneID:5006559"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="JGIDB:Ost9901_3_29382"
                     /translation="MARAQSEAVITPQDACYLRVCLKLKAYDALAASDGILAAPAMDV
                     APALDATDFLLRCYYGGRALLALRRYPEAARWFQDALSAPATALSAIAVAAYKKYALA
                     TLLADAVADASTFSSPAKKYSTSRECDAYASLLAAAKKRDAAKELADVVERHEATYEL
                     DGNAGLVALVRDRAVAAKARSLAKTYSTLRLGDFASAIGFSDVEAAERVLYGMIVRGE
                     IAARIDGVDGVVRFSEGDESSATIEDIAEALKRGLRAVSVLDARVREESDALSRHKKF
                     ASHALTEERRAAALAHVETES"
     gene            <144498..145433
                     /locus_tag="OSTLU_29383"
                     /db_xref="GeneID:5006722"
     mRNA            <144498..145433
                     /locus_tag="OSTLU_29383"
                     /product="predicted protein"
                     /transcript_id="XM_001422464.1"
                     /db_xref="GeneID:5006722"
     CDS             144498..145427
                     /locus_tag="OSTLU_29383"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422501.1"
                     /db_xref="GeneID:5006722"
                     /db_xref="JGIDB:Ost9901_3_29383"
                     /translation="MREPTTTTTTPDATSEVIRVETRAEGEYELRQTTTPKRFAVADG
                     ELLNVATAAAPIALRWTSGLMCHGYEAKVVDGEVGEGEYAVWSGSGKAVRETSDVAKF
                     PRPEKPLKMYQFQGCPFCKKVREAVISLDLDVIYYPCPRDGPEYREFVRAEGGRAQFP
                     YLVDDNTGTKMYESDDIIAYMYEKYGPGKANIGPALTSGTLTSVTAGLALLPRLGKGS
                     AYAPSKKPENMQPIVFYGYEGSPFCVLVAEKLCELELPYLQRSCGRGSPKRQELFDKR
                     GTFQVPYIEDPNTGIAMFESKDIVNYLQEQYAA"
     gene            complement(<145540..146727)
                     /locus_tag="OSTLU_29384"
                     /db_xref="GeneID:5006560"
     mRNA            complement(<145540..146727)
                     /locus_tag="OSTLU_29384"
                     /product="predicted protein"
                     /transcript_id="XM_001422628.1"
                     /db_xref="GeneID:5006560"
     CDS             complement(145540..146724)
                     /locus_tag="OSTLU_29384"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422665.1"
                     /db_xref="GeneID:5006560"
                     /db_xref="JGIDB:Ost9901_3_29384"
                     /translation="MSRRDAVANGAFVAEDGEEFDLVRGADYASERVELLEVDEEILS
                     EILSNDGVIAFKGEPDDVAVVCTRSKTYQVTRVESSNQCLIVGPALGGEEDETEAMEE
                     EEDGPRRATVRAQTSSHLDLTEIAPRLDRLREMMASVAYAGTAEAMDADEGEGEGVGF
                     GFDELNARVQASELEILKCLQEEIVAIEIDGKWRGVDAEYRLHALAMMTASAFGNGWS
                     TSALPTDAVVDAMASDGFAPEMARNTLHAFATKHDVDATWALDEEAVCRALAQRVLRD
                     GAGLKAWRLVEMMDQWREKLSEFNLGHVEAKEEYLSGLALIDRPERAAEAFVRTLIAS
                     DLPREPGDRFAALWAVKPRWTLSELDPYLKGQARPGQNIEAQLLKYCRVTQGNPPTYS
                     KR"
     gene            <146764..>148631
                     /locus_tag="OSTLU_19906"
                     /db_xref="GeneID:5006723"
     mRNA            join(<146764..146835,147024..>148631)
                     /locus_tag="OSTLU_19906"
                     /product="predicted protein"
                     /transcript_id="XM_001422465.1"
                     /db_xref="GeneID:5006723"
     CDS             join(146764..146835,147024..148631)
                     /locus_tag="OSTLU_19906"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422502.1"
                     /db_xref="GeneID:5006723"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="JGIDB:Ost9901_3_19906"
                     /translation="MGATDGTSAREARRKARELEEGRKAGLIPHEIDEDGNAINPHIP
                     QFMAAAPWYLKQDGPGLKHQKAPKKAEESAEWYKRGVTTTKATKFRKGACENCGAMTH
                     KKKDCMERPRARGASKTQKDIAADEYVQPELKLGFESKRDRYNGFDVDDYVKVVERYE
                     AADAMKQKLAKQKELERAFRRANKKEDDAASDSDSDDTSSDDDDDDDAKVADKAATGF
                     ANIKRAVRAPGGGASGTVRNLRLREDTAKYLRNLDVDSAYYDPKTRSMRENPTPNADP
                     KDNFFRGDNAARNDGQVVEFERLNRHAWEQAEAGGASAIHMQGAPSQAEALYKQFKEK
                     KEKLAGMNKKNIMEKYGDASAGKELPDGLALGQTEQYVEYDRAGRLIKGTEKATVKSC
                     YEEDVLLQNHTKVWGSYWNAGQWGYACCQSMVKNSYCTGERGVEAALASEQLMVDNME
                     NKRAMDEANEARAKSQLNATTKPSDLWGGDVKDDVEIDPQKLLEALKRQDEREEALKR
                     GGDGKNKRGYNVTHDSQVTAEDMEAYRMKKRAFEDPMKKASGAGTDGYDLV"
     gene            complement(<148669..149921)
                     /locus_tag="OSTLU_29386"
                     /db_xref="GeneID:5006561"
     mRNA            complement(<148669..149921)
                     /locus_tag="OSTLU_29386"
                     /product="predicted protein"
                     /transcript_id="XM_001422629.1"
                     /db_xref="GeneID:5006561"
     CDS             complement(148669..149865)
                     /locus_tag="OSTLU_29386"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422666.1"
                     /db_xref="GeneID:5006561"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="JGIDB:Ost9901_3_29386"
                     /translation="MPAAAPDAGTAYLDAAIDAARAIDDETRELLIEIGDLRTKKLWH
                     ELTLAIERAVAAPMNARVALLPGGLRGMYDGVVREAETRFNPLKTAHVAVAVSDALTG
                     EEAVEFLTETSARLVAAHGDDAREPGVYVAAHVTLLRLVAGDLEYAKRAVTEGDKEAL
                     EALPAPDPSVSAAYHYVASRYYKVRENYAEFYKSGMLYLAYVSCEMLPAETRAALSVD
                     LCLAALLGENVYNFAELLAHPIVESLNDGPFAWLMDVVKAFNEGDLHEYDQLCVKHAA
                     ALNAQPALVANERRLREKITILSLLQIIFKLPAEHREISLSDIAVKTKLTTDGVEYLL
                     MKALSVHLIEGIIDQVESKVIVTWVQPRVLLRSQIAELAGRLDGWIEKVSAVESNLTD
                     EIAVAA"
     gene            <150416..>150646
                     /gene="MRPS18"
                     /locus_tag="OSTLU_29387"
                     /db_xref="GeneID:5006724"
     mRNA            <150416..>150646
                     /gene="MRPS18"
                     /locus_tag="OSTLU_29387"
                     /product="Putative mitochondrial ribosomal protein S18"
                     /transcript_id="XM_001422466.1"
                     /db_xref="GeneID:5006724"
     CDS             150416..150646
                     /gene="MRPS18"
                     /locus_tag="OSTLU_29387"
                     /note="Putative mitochondrial ribosomal protein S18,
                     imported to mitochondria"
                     /codon_start=1
                     /product="Putative mitochondrial ribosomal protein S18"
                     /protein_id="XP_001422503.1"
                     /db_xref="GeneID:5006724"
                     /db_xref="InterPro:IPR001648"
                     /db_xref="JGIDB:Ost9901_3_29387"
                     /translation="MRGKAVEATLLERAAYEDARFLTQFVSDTGKIYPKRRLGVSAKA
                     QRKIARAIKTARQMGILPYTSRLPQFQRSRET"
     gene            complement(<150700..>150876)
                     /locus_tag="OSTLU_29388"
                     /db_xref="GeneID:5006562"
     mRNA            complement(<150700..>150876)
                     /locus_tag="OSTLU_29388"
                     /product="predicted protein"
                     /transcript_id="XM_001422630.1"
                     /db_xref="GeneID:5006562"
     CDS             complement(150700..150876)
                     /locus_tag="OSTLU_29388"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422667.1"
                     /db_xref="GeneID:5006562"
                     /db_xref="JGIDB:Ost9901_3_29388"
                     /translation="MAEMTVDEGLGRARDARRDAATREVEAANALREVETSLAEIERG
                     IRELLELELAERAV"
     gene            <151175..>151708
                     /gene="FBP14-2"
                     /locus_tag="OSTLU_29389"
                     /db_xref="GeneID:5006725"
     mRNA            <151175..>151708
                     /gene="FBP14-2"
                     /locus_tag="OSTLU_29389"
                     /product="peptidyl-prolyl cis-trans isomerase, FKBP-type"
                     /transcript_id="XM_001422467.1"
                     /db_xref="GeneID:5006725"
     CDS             151175..151708
                     /gene="FBP14-2"
                     /locus_tag="OSTLU_29389"
                     /note="FKBP-type peptidyl-prolyl isomerase, possibly
                     targetted to thylakoid lumen (TAT pathway)"
                     /codon_start=1
                     /product="peptidyl-prolyl cis-trans isomerase, FKBP-type"
                     /protein_id="XP_001422504.1"
                     /db_xref="GeneID:5006725"
                     /db_xref="InterPro:IPR001179"
                     /db_xref="JGIDB:Ost9901_3_29389"
                     /translation="MLARRDALLSAALSAGALARPRRARAAPAPTFAPTRDGVRFRDA
                     RVGDGPEVFAHDAVVILFTARVLPSDDGALDRRRAGDTFDPFVVGGAGASASKGFKLE
                     IGSATNDIPEGWARAFEGDGDAMPRMRIGGKRIVRIPPSLAYGERGHHCRDGVRGACE
                     VNPGESVEIDFEILRYT"
     gene            complement(<151722..>152432)
                     /locus_tag="OSTLU_29390"
                     /db_xref="GeneID:5006563"
     mRNA            complement(<151722..>152432)
                     /locus_tag="OSTLU_29390"
                     /product="predicted protein"
                     /transcript_id="XM_001422631.1"
                     /db_xref="GeneID:5006563"
     CDS             complement(151722..152432)
                     /locus_tag="OSTLU_29390"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422668.1"
                     /db_xref="GeneID:5006563"
                     /db_xref="JGIDB:Ost9901_3_29390"
                     /translation="MLGEDSAYAPVKLPARGALLMAASGGGSARTATATVKRALDDVR
                     GGKDEGSEFLYKMYPIDGAFEVGDEDGMRACVERVVRETRARSEDARSKSIAFAVVYN
                     KRVDSTASVSEEDTDASDVAHGRAVMVPKIAKACERAFKDADAECEVSVNLKDPNVVV
                     FAQIFTALPSGDEKKSYIVAIGAAAKDDGVFEAKAKGVAPASVSALSPRRDDAPKWML
                     KKKALAQAATTVSDDEHR"
     gene            <152848..>154917
                     /locus_tag="OSTLU_43765"
                     /db_xref="GeneID:5006726"
     mRNA            <152848..>154917
                     /locus_tag="OSTLU_43765"
                     /product="predicted protein"
                     /transcript_id="XM_001422468.1"
                     /db_xref="GeneID:5006726"
     CDS             152848..>154917
                     /locus_tag="OSTLU_43765"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422505.1"
                     /db_xref="GeneID:5006726"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR006935"
                     /db_xref="JGIDB:Ost9901_3_43765"
                     /translation="MRRRVANVSRHLNLNLATRATRGRAIWTARADRDDRADVAARTG
                     GRDAAGETSGREGVEVDAGTAARRTTNGVRAPFEPSGDQPSAIERCKELLSDRDRKFV
                     CLRGATGTGKTYVVANVLAAQRKPALVVVPNKTLAAQVARELRAYLGESHRVELFVSH
                     FSVYVPESYSNGRYTEKRSAIDSDLDALRHRATRALVEPGKTPVVVASVSCLYGLGLP
                     TDYVDAALTIEIGASASTFGIDGVEDKLRDDLLYERVMPYMDIERGQYKTTAAPDDDN
                     CFTITIWPPYLESALDVRVRGDDGVVVACEARGRRVDLPLTIWPRVHYITPAERLQRA
                     LVSIKAELDEQTKKLRAEGCAIEADRLEQRTNADLTLLRELGWCPGAEHYSRHLRCAK
                     PEEPPVTLLDYFSYSADSQTRRDWLLVADESHVMLPQLRAMHGGDRSRKTALVGAGYR
                     LPSALDNRPLMSEEFWQRVPQALLVSATPGDIETEWVGGKSSDAMVDMVVRPSGVLDP
                     PVHVVGKENQLEALAQRVNEKAKIGERSLVCVLTKADTEDLSMYLNAHGVRADWVHSE
                     LTAPQRAEKLSKLQQGELDCIVGAQLLREGLDLPSVSLVAILDADIPGFMRSARSLMQ
                     MAGRAARNKNGECVLFADSITAAMKEMMNEVDRRRVKQHKHNVDNNLVPVTATLGSST
                     STLSLFDV"
     gene            157019..>158540
                     /locus_tag="OSTLU_29392"
                     /db_xref="GeneID:5006564"
     mRNA            157019..>158540
                     /locus_tag="OSTLU_29392"
                     /product="predicted protein"
                     /transcript_id="XM_001422469.1"
                     /db_xref="GeneID:5006564"
     CDS             157023..158540
                     /locus_tag="OSTLU_29392"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422506.1"
                     /db_xref="GeneID:5006564"
                     /db_xref="InterPro:IPR000362"
                     /db_xref="JGIDB:Ost9901_3_29392"
                     /translation="MPALARALLNARVAPAPARSHARTHRRATIRAASRDRVFDAQDL
                     ALSDLTALSPLDGRYASKTAALRGAFSEFALIRARVYVEVRWLQTLAAIPEVVEVPPL
                     SAEANAFLENYLTNFDVVEAAKVKTVERTTNHDVKAVEYVLKDALMTQPELAKIMEFT
                     HFACTSEDINNLSHALMLRDGVATLKPEMTKMIDAIAAMGVDYAATPMMSRTHGQPAS
                     PTTLGKEMANVAYRLARQVKQLDSIPLYGKMAGAVGNYNAHMSAYPNVNWQAVAEKFV
                     TGLGLDFNPYVTQIEPHDYMAELFACVERFNTITLDFDRDIWSYISIGYFKQKTIAGE
                     VGSSTMPHKVNPIDFENSEGNVGLANAVFAHLAAKLPVSRWQRDLTDSTVLRNMGVGF
                     GYSILAYQSTLRGISKLEVNAQAMADDLDVNWEVLAEPIQTVMRRYAVEKPYEKLKEL
                     TRGRRVDAEGMREFVSNLDIPDEGKKSLLALTPSTYIGNATAQAKDILNKLAEIK"
     gene            complement(<158624..>163846)
                     /locus_tag="OSTLU_43496"
                     /db_xref="GeneID:5006565"
     mRNA            complement(join(<158624..162815,163047..>163846))
                     /locus_tag="OSTLU_43496"
                     /product="predicted protein"
                     /transcript_id="XM_001422632.1"
                     /db_xref="GeneID:5006565"
     CDS             complement(join(158624..162815,163047..163846))
                     /locus_tag="OSTLU_43496"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422669.1"
                     /db_xref="GeneID:5006565"
                     /db_xref="InterPro:IPR000722"
                     /db_xref="InterPro:IPR007066"
                     /db_xref="InterPro:IPR007080"
                     /db_xref="InterPro:IPR007081"
                     /db_xref="InterPro:IPR007083"
                     /db_xref="JGIDB:Ost9901_3_43496"
                     /translation="MPRDATATTARHRVKQRGLVQKEIASASFSFYDAEDVRKISVKR
                     ITNPVLFDGLNNAVADGLYDPALGPTDSKTTCVTCKFPGGMCAGHFGHLELVVPVYNP
                     LTFGTVVRLLKTTCFHCHKFRLHASRVRRFRERLEMLMDGDMEAAEGVLPEISKKAKE
                     EMSSVFKEVEGDGDAEEMDLDNIHDVLPRLKTRGRGEPVVWTSITSTAARNLIKEFLA
                     IQPKKCENCGAMNPKVSPEGHNKIFRGALPKAHHENNLAKGIDINDDMASDSETMSVD
                     ERVQEAAKSLYITPIEARALLKRLWMYEYDFCSMIWATTPPNKCTKRGEERRSDPARF
                     FIQTLLVAPSKFRPPSKMGDMIFDHPQNTALTTIIQANLSLAELFRTPPTVPEPPEVR
                     AGRAVRAWLALQSGVNRLIDATKADTQEAKQAIGIRQQLEKKEGLFRMNMMGKRVNFA
                     ARSVISPDPYLGTSEIGVPPVFAKKLTFPELVTPHNVDLMRTLVENGPEIHPGANAIE
                     DERGRVIHLDKFTAEKRAAIAKTLLATTAAGSADGPARPLAKTVYRHLRDGDVMLVNR
                     QPTLHKPGILAHTARVLPGQRVVRMHYSNCSTFNADFDGDEINLHFPQDHLGRAEAYE
                     IMHGDRQFTVPTDGKPLRGLIQDHICSGLLLSMRDSFFDRSEFTQLLYSGLVDYCGDE
                     HGKIDVPAPALLKPKALWTGKQVIAAVLSHITRGRPPLTFSAPCKIPATFFGGEDSGE
                     DRLIIRRNYFCSGVVDKNMFGKYGLVHAVAELHGRSTAGALLSIFSRLFTNFLQKHGF
                     TCGIDDLILTADAEKDRVVELNKADEMCKTATADVAEASGKSDEEVMTAIAAKLLENP
                     EWGAQLDMKASGALNKVTSATVKKCLPFGTKKPFSKNCLSIMTISGAKGSLVNFSQIA
                     AALGQQELEGRRVPRMPSGKTLPSFEPFDISSRANGYIACRFFSGLDPAEYFFHCMAG
                     REGLVDTAVKTARSGYLQRCLVKNLESMRVHYDFTVRDSDGSIVQFQYGEDCVDVTRS
                     GYLEKFEFLAENPELILLNNEAAISMLPKLNKKKVSVLETIGRKEELPRFCMENFGDQ
                     LGVLPEKFGDELKTFIDSRPKGYWAEEKGKKNESSLAAKSGLTAEEFAMLMNMRYLTY
                     VAPPGEAVGVIAAQSVGEPSTQMTLNTFHFAGRGEANVTLGIPRLRELLMAASKKLLT
                     PVMILPLKPGCRTKENAETLCRRLRRVILAELITKLCIKVKDYGIGPDEGLSRLYTVV
                     IQMREGQNDDDPNEVTFAEFLHAVKRKFAKMLVARIGSDMRKSKSNNGVIVKNAKNGP
                     MQGTTDPRKDDDEEEDDEKEKNSAARAKNVKFENGDASDEDEDDEEDEEGAKTENRKI
                     DETEVDSDSDGSSSSGDDDSDASSDDASAKTPKSKKKRVPSSEMTDCGVQLTEDEVVE
                     TIVCDEKSRTIEFTVPAGINSPHVLVLEIAQEVAVKTIIRETPGIKQTFVVGKTDDED
                     PTGSQPLSIQTDGINFGAAWANSDLIEVNSMKSNSVWDIMQTFGVEAGRSTLVSEVQA
                     VFGVYGIGVDTRHLSLIGDFMTQQGEYRPCNRSGIEKSTSPFLKMSYETATAFLTDAT
                     IRGETDDLSSPSSRIVVGRTVDLGTGSFSLKHDIVRAAQYQEANKATGKHIRL"
     gene            complement(164145..165490)
                     /locus_tag="OSTLU_29394"
                     /db_xref="GeneID:5006727"
     mRNA            complement(164145..165490)
                     /locus_tag="OSTLU_29394"
                     /product="predicted protein"
                     /transcript_id="XM_001422633.1"
                     /db_xref="GeneID:5006727"
     CDS             complement(164172..165278)
                     /locus_tag="OSTLU_29394"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422670.1"
                     /db_xref="GeneID:5006727"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="JGIDB:Ost9901_3_29394"
                     /translation="MGCAQGTLKRAGSVKARDRSLAVMKSLFPVAFVDAYEVESKATF
                     DAYGGAFDVVSREDGSARTAVLARLKKQADGESLTISQFSMEEYVLQLLRHDGVASVY
                     ESFTELRKRPAMGVLIVDRLRGAKLIDYLQQKDGAKLGEDEAREIMVQLASVLKHLVD
                     CGVTCGNLDLDTLVFREEDNMELVVTSMRYASLAGHPSPYVVEYGTYEIEDELGQPVT
                     RTFPEDARKLHFAAPERLKPDSRGRDRQPSVDVWSFGVIMYTLLAGYLPFEGEDSRTL
                     CEKIRQGNFTAFKYDVETWDSISMGAKDLIAGCLRVDPRRRFNIERIMKHPWIRKFED
                     PNATFIALGSDLGTPPLSYVSNSSDYDDLHSPMH"
     gene            complement(<165711..>166232)
                     /locus_tag="OSTLU_43898"
                     /db_xref="GeneID:5006728"
     mRNA            complement(<165711..>166232)
                     /locus_tag="OSTLU_43898"
                     /product="predicted protein"
                     /transcript_id="XM_001422634.1"
                     /db_xref="GeneID:5006728"
     CDS             complement(165711..166232)
                     /locus_tag="OSTLU_43898"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422671.1"
                     /db_xref="GeneID:5006728"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="JGIDB:Ost9901_3_43898"
                     /translation="MARLFLDREPLTQYKDRRFNGTLDEYLDRLRASTTLYVGNVSFY
                     TTENQMHALFRSVGVVRAIVVGLDSARRTPCGFAFVEYETRADAERCVRYLNGTKLDD
                     REIRIDFDWGYEPGREFGRGKSGGQVRDEYRTYYDAGRGGYGKLLRDELEGMRASAEV
                     GEKRARDDGAEDA"
     gene            complement(<166698..>167519)
                     /locus_tag="OSTLU_43577"
                     /db_xref="GeneID:5006729"
     mRNA            complement(<166698..>167519)
                     /locus_tag="OSTLU_43577"
                     /product="predicted protein"
                     /transcript_id="XM_001422635.1"
                     /db_xref="GeneID:5006729"
     CDS             complement(166698..167519)
                     /locus_tag="OSTLU_43577"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422672.1"
                     /db_xref="GeneID:5006729"
                     /db_xref="InterPro:IPR000445"
                     /db_xref="InterPro:IPR003265"
                     /db_xref="JGIDB:Ost9901_3_43577"
                     /translation="MAFEPARETTAPEGWEKTLATIKRWRAEGPRAAVDTMGCEKIAD
                     VEGEGGAMDEEKYRRYLTLTSAMLSSQTRDEINHAAMARLRAHGCTPENVLNTDEDAL
                     DAMLNPVGFHRRKAQYLRATAKILLDEYDGDIPSSVETLCALPGVGPKMAYLVMNVGW
                     QKPTGICVDVHVHRITERLGWTPERAIGKNGSPRKKTPEDTRASLERWLPRDEWIEIN
                     PLLVGFGQLTCTPLRPKCAECPLAADASCPSAFKESATPTSEKRRAKKIKLEPDA"
     gene            complement(167772..>168622)
                     /locus_tag="OSTLU_29397"
                     /db_xref="GeneID:5006730"
     mRNA            complement(join(167772..168541,168619..>168622))
                     /locus_tag="OSTLU_29397"
                     /product="predicted protein"
                     /transcript_id="XM_001422636.1"
                     /db_xref="GeneID:5006730"
     CDS             complement(join(167784..168541,168619..168622))
                     /locus_tag="OSTLU_29397"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422673.1"
                     /db_xref="GeneID:5006730"
                     /db_xref="JGIDB:Ost9901_3_29397"
                     /translation="MDQGRGANVKSCEFVQACVDLAGCPKPTLPEIAVIGRSNVGKSS
                     LVNMLTNRKSLAKTSKNPGKTQTINHYRMTTGDGKFYLVDLPGYGYANAPEDLREKWA
                     AFTREYLIKRESLITVLLLIDSTVKPQRLDLECLDWLGEAGVPVTVVFTKVDKRKKVG
                     AGKRANPAENVEEFCREVSEYWDELPPMLYTSSVNGEGKREVLNHIATLRQFFKKPLK
                     EEVLAAVAPAAAASPIVADARAADVADDEPEDDWN"
     gene            <169479..>170111
                     /locus_tag="OSTLU_18982"
                     /db_xref="GeneID:5006731"
     mRNA            <169479..>170111
                     /locus_tag="OSTLU_18982"
                     /product="predicted protein"
                     /transcript_id="XM_001422470.1"
                     /db_xref="GeneID:5006731"
     CDS             169479..>170111
                     /locus_tag="OSTLU_18982"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422507.1"
                     /db_xref="GeneID:5006731"
                     /db_xref="JGIDB:Ost9901_3_18982"
                     /translation="MVFPGQLSVSKEGRIGEMREMHTQAPVVYLDFEGGRIKMLGSIV
                     RPKSTRYFTLNAKSKDRMNLEEWFESVIVFPSWYWIGTKEENPEEKPLALPAELGDLA
                     GEAETDWDASVAAGSGKAATTPTTGATATAMKASETVVGDDAKDAADGGRRPRRQAAT
                     VARKKMYADDSEAEEASDDDDDDGRVTSPIVVRGKVESFMPPPPPVTAPAP"
     gene            complement(170431..>171492)
                     /locus_tag="OSTLU_25840"
                     /db_xref="GeneID:5006566"
     mRNA            complement(170431..>171492)
                     /locus_tag="OSTLU_25840"
                     /product="predicted protein"
                     /transcript_id="XM_001422637.1"
                     /db_xref="GeneID:5006566"
     CDS             complement(170446..171492)
                     /locus_tag="OSTLU_25840"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422674.1"
                     /db_xref="GeneID:5006566"
                     /db_xref="InterPro:IPR000146"
                     /db_xref="JGIDB:Ost9901_3_25840"
                     /translation="MRARAALGESLSAHLASASARGDIDADLAIALNSVAIACKRVRA
                     LVARAPIAGNTGAAGGSNASGDEQKKLDVIANDVFVETLRACGRASVIVTEEEDTPIA
                     VERASGYIVTFDPIDGSSNIDACVTTGSIFGVYAPGACEIKDTDSAEETLANCLTNSL
                     QSGEALVAAGYCMYSSSCVFVLTTGDGVAQYDFDENVGEFVCSKERVTIPDGDKMQRI
                     YSGNNGNVNLWAPELKDYVAHLQKGGSDGGKPWTYRYIGALIGDFHRTLLYGGIWLYP
                     PDTSAPNGKARLLYEIAPISMIAEQAGGMSTRGPKANESVLDVVPKHIHEKSPMFVGS
                     KSAVQDLQEFLKKY"
     gene            <172019..>172426
                     /locus_tag="OSTLU_8494"
                     /db_xref="GeneID:5006732"
     mRNA            <172019..>172426
                     /locus_tag="OSTLU_8494"
                     /product="predicted protein"
                     /transcript_id="XM_001422471.1"
                     /db_xref="GeneID:5006732"
     CDS             <172019..>172426
                     /locus_tag="OSTLU_8494"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422508.1"
                     /db_xref="GeneID:5006732"
                     /db_xref="JGIDB:Ost9901_3_8494"
                     /translation="LIAGAFVVGIGAGVVFDTAVDLEPSNVASREILDRRTPSSELCM
                     ANGASAMVFDQRVFLSLNPFNVYVAQPEVKPGCVVRRSNWGVLERNNVVDKKAEDVCK
                     QHLNTFAFVGDLDKSPEVSCVYHSEDAENQFMKD"
     gene            complement(<172617..>174533)
                     /gene="CHR3518"
                     /locus_tag="OSTLU_18985"
                     /db_xref="GeneID:5006567"
     mRNA            complement(<172617..>174533)
                     /gene="CHR3518"
                     /locus_tag="OSTLU_18985"
                     /product="predicted protein"
                     /transcript_id="XM_001422638.1"
                     /db_xref="GeneID:5006567"
     CDS             complement(172617..174533)
                     /gene="CHR3518"
                     /locus_tag="OSTLU_18985"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422675.1"
                     /db_xref="GeneID:5006567"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="JGIDB:Ost9901_3_18985"
                     /translation="MDAWDAWDDAVDAERAARAVADASEALRRRMRAESSTTTTTTTT
                     TATTATTAPTTIEFALREPGDAFAIARATPRAGALGEAAAAAARDAGATRASDGAWTA
                     PAGAVRAIRDALVRRTNARVLDVPGMALRCAEVRFEEDAAGAYARGVPKALDAKMFEF
                     QRTGVMYALRRRGRVLIGDEMGLGKTVQACALLACYREECPALILVPTSLREAWRNAL
                     QSWLDVADGDVACVGAASEGWKLDEGRPFDIVPYSLVVKLRSKLLAKRYKIVVCDESH
                     FLKDRRAQRTQAVMPLLKDANRAICLTGTPALSRPIELFTQLEALVPKVFARLNEYGA
                     RYCANGGPFGMYTGCTHADELHVMISKLCMVRRLKKDVLKDLPPKQRTQVWLALEKSS
                     MGDVRRIKSLLDELRQRGGNELEEKRLLNELFLASAKAKTKSVCEYLETLIDGSTSKF
                     LFFAHHGVLLDAVAQCMDAKKVKTIRIDGSTPAAVRGDLVNAFQRRDDVRVAILSIKA
                     AGMGLTLTAASTVIFGEMVWTPGDLIQAEDRAHRIGQQSSVLVQYLHAKDTIDEIIWQ
                     SIKKKLDNLGAVLNGQTSGNHLETTSTNGKSPKRQKVQPVIDVSQRTLTELFASQATQ
                     LSSPAGEDSQPTDA"
     gene            174788..178075
                     /gene="CLPC1"
                     /locus_tag="OSTLU_29402"
                     /db_xref="GeneID:5006733"
     mRNA            join(174788..175029,175169..175255,175523..178075)
                     /gene="CLPC1"
                     /locus_tag="OSTLU_29402"
                     /product="chaperone, Hsp100 family, ClpC-type"
                     /note="Has EST support"
                     /transcript_id="XM_001422472.1"
                     /db_xref="GeneID:5006733"
     CDS             join(175021..175029,175169..175255,175523..177949)
                     /gene="CLPC1"
                     /locus_tag="OSTLU_29402"
                     /note="ClpC, chloroplast-targetted molecular chaperone,
                     involved in protein import and folding and in
                     ATP-dependent proteolysis"
                     /codon_start=1
                     /product="chaperone, Hsp100 family, ClpC-type"
                     /protein_id="XP_001422509.1"
                     /db_xref="GeneID:5006733"
                     /db_xref="InterPro:IPR001943"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR004176"
                     /db_xref="JGIDB:Ost9901_3_29402"
                     /translation="MFERFTEKAIKVVMLAQEEARRLGHNFVGTEQIMLGLIGEGTGI
                     AAKVLKSMGISLKEARIEVEKIIGRGSGFVAVEIPFTPRAKRVLELALEEARQLGHNY
                     IGTEHLLLGLLREGEGVAARVLENLDADPAKIRSQVIRMVGETQEAVGAGAGGGQGAQ
                     SGSKTPTLEEFGSDLTKKAEEGKLDPCIGRANEIVRVTQILGRRTKNNPCLIGEPGVG
                     KSAIAEGLAQKIAANDVPDTLDSKRMMTLDMGLLVAGTKYRGEFEERLKKLMDEVKSD
                     ENIILFIDEVHTLIGAGAAEGAIDAANILKPALARGELQCIGATTIDEYRKHIEKDPA
                     LERRFQPVQVPEPSVDETIQILRGLRERYELHHKLKYDDDALIAAAKFSSQYISDRFL
                     PDKAIDLIDEAGSRVRLENAALPEEAKELDKELKALMKEKDTAIRSQDFEAAGGLRDR
                     EVELRAQIKQITERKQEENKAKAESGDASGPTVVEQDIADIVAAWTGIPVDKVSSDEG
                     TRLMDMEETLHKRLVGQEEAVVACARAIRRARTGLKNPNRPVASFIFSGPTGVGKSEL
                     AKSLSAFYFGSEEAMVRLDMSEFMERHTVSKLIGSPPGYVGYSEGGQLTEAVRRRPYT
                     LVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRVIDFKNTLIIMTSNVGASAIEKGGG
                     GLGFQLDDNAEDQSYNRIKSLVMEDLKNYFRPEFLNRLDEIIVFRQLNKQEVREIAYI
                     MLENVFKRLKEKEIVLECTERFKDRLVDEGFSPAYGARPLRRAIMRLLEDNLSEKMLT
                     GEISEGSSCIMDVNAEGEITVLTGDGRELKAGSAIGGPAGIA"
     gene            complement(<178257..>180524)
                     /locus_tag="OSTLU_51954"
                     /db_xref="GeneID:5006568"
     mRNA            complement(<178257..>180524)
                     /locus_tag="OSTLU_51954"
                     /product="predicted protein"
                     /transcript_id="XM_001422639.1"
                     /db_xref="GeneID:5006568"
     CDS             complement(178257..180524)
                     /locus_tag="OSTLU_51954"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422676.1"
                     /db_xref="GeneID:5006568"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="JGIDB:Ost9901_3_51954"
                     /translation="MSAGEHLHAAQAQRDEVAAQTYIWGTRVNVLDTQQRFRRFIENF
                     ELPDSADSYYDERMREIYEKEHTHLDLDCQHVHEYDEFLYKQLIHYPQEIIPLFDVVA
                     NEYFLENVVAPEDMDEDTPAARIIVRPFNMMDAKPMRDLNPSDIDKMVCVRGMVTRCT
                     TIIPDLKLAYFKCLMCGFAPEHVQVDRGRVNEPPLKCTECGKPGTMTLIHNQCVFANK
                     QTVKMQETPDAIPEGETPHTVSMCVFDELVDQAKPGDRVEVTGVYRAVPIRISSTRRT
                     LKSVYKTYLDIIHIRKDAGNRMRNTAGTEDDEAAKHSSAERASKPASNQNPNAQLEFT
                     PARTAEIEELGRSPDIYQRLVASLAPSIWELEDVKKGLLCQLFGATNKTFSGTAANKV
                     RGDINVLLVGDPGVAKSQLLTYVHRIAPRGMYTSGRGSSAVGLTAYVTRDPESKDMVL
                     ESGALVLSDRGICCIDEFDKMSDSARSMLHEVMEQQTVSIAKAGIIAVLNARTSVLAS
                     ANPVGSRYNPNMSMVENIQLPPTLLSRFDLLYLLLDRANPETDRRLARHLVSLHYKDP
                     PQKKRGAIEASLLTDYVSFARSHVQPVLSDEAAEELVEGYVEMRRMGGSRKVITATPR
                     QLESLIRLSESLARMRLSVRVDRDDAKEALRLMRVAMQQSAVDPRTGTIDMDKILTGH
                     SASDRQHRKVIADGITACLTSSSGRLRLSELVKMLAERDGSMALSVQEVRDAAMLLVE
                     QETCSIRGDLVQLLA"
     gene            <181706..>182476
                     /gene="PRPL11"
                     /locus_tag="OSTLU_13461"
                     /db_xref="GeneID:5006734"
     mRNA            join(<181706..181798,182123..>182476)
                     /gene="PRPL11"
                     /locus_tag="OSTLU_13461"
                     /product="Plastid ribosomal protein L11 large ribosomal
                     subunit"
                     /note="imported to chloroplast"
                     /transcript_id="XM_001422473.1"
                     /db_xref="GeneID:5006734"
     CDS             join(181706..181798,182123..182476)
                     /gene="PRPL11"
                     /locus_tag="OSTLU_13461"
                     /GO_component="plastid large ribosomal subunit"
                     /note="Chloroplast ribosomal protein L11; Chloroplast
                     large ribosomal subunit protein L11; imported to
                     chloroplast"
                     /codon_start=1
                     /product="Plastid ribosomal protein L11 large ribosomal
                     subunit"
                     /protein_id="XP_001422510.1"
                     /db_xref="GeneID:5006734"
                     /db_xref="InterPro:IPR000911"
                     /db_xref="JGIDB:Ost9901_3_13461"
                     /translation="MAAKVAGYIKLAIEAGKASPAPPIGPALGAKGVNIMMFCKEYNA
                     RTQDQPGMIIPVEITVFEDKSFTFILKTPPASVLLKKAAGVPKGAGDPQKQVVGRVTK
                     EQLEEIAKIKMPDLNCVKVESAMKVVAGTAANMGIKIDGWPEVDAA"
     gene            complement(<182743..>183200)
                     /locus_tag="OSTLU_29405"
                     /db_xref="GeneID:5006569"
     mRNA            complement(join(<182743..182832,182997..>183200))
                     /locus_tag="OSTLU_29405"
                     /product="predicted protein"
                     /transcript_id="XM_001422640.1"
                     /db_xref="GeneID:5006569"
     CDS             complement(join(182743..182832,182997..183200))
                     /locus_tag="OSTLU_29405"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422677.1"
                     /db_xref="GeneID:5006569"
                     /db_xref="InterPro:IPR001705"
                     /db_xref="JGIDB:Ost9901_3_29405"
                     /translation="MLAARANVCSTSSLAARPSAASARERSRGALVVTAASKKKDVRL
                     QVTLECTEQKESGVQGMSRYMTQKNRRNTSQRLELMKYNPFLQKHTLHRELKK"
     gene            <183389..>184082
                     /locus_tag="OSTLU_43645"
                     /db_xref="GeneID:5006735"
     mRNA            join(<183389..183589,183687..>184082)
                     /locus_tag="OSTLU_43645"
                     /product="predicted protein"
                     /transcript_id="XM_001422474.1"
                     /db_xref="GeneID:5006735"
     CDS             join(183389..183589,183687..184082)
                     /locus_tag="OSTLU_43645"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422511.1"
                     /db_xref="GeneID:5006735"
                     /db_xref="InterPro:IPR002779"
                     /db_xref="JGIDB:Ost9901_3_43645"
                     /translation="MSADASTRRFKIYTKTGDAGTSSLYNCERRDKDDAAFDALGDVD
                     ECNVACGIAREFCVDENNGLEAQLAEIQSRLLDVGSAVATPLYASSDAMKARAAFSET
                     HVETLEGWIDGMDAELPALSSFLLVSGGKASVFLHQARVVCRRAERRCVPLVRSGAVP
                     DVVRVYLNRLSDYMFTAARFAAMKAGREEEAYKKSTAN"
     gene            complement(<184161..>184931)
                     /locus_tag="OSTLU_29407"
                     /db_xref="GeneID:5006570"
     mRNA            complement(<184161..>184931)
                     /locus_tag="OSTLU_29407"
                     /product="predicted protein"
                     /transcript_id="XM_001422641.1"
                     /db_xref="GeneID:5006570"
     CDS             complement(184161..184931)
                     /locus_tag="OSTLU_29407"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422678.1"
                     /db_xref="GeneID:5006570"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="JGIDB:Ost9901_3_29407"
                     /translation="MATLGASPPPRATRGATAARASSASRGDSNRAALRRARVVLWDV
                     DGTLADSTELGFSSTNKVLRDAALREITRDEYLRGTRYTTPRRLAWHATKNADDACGE
                     ALGAAFDDAYVALVTTTTAGFYPGIARIVVRLREEGRKQAVLSNACGAYARAVIAANE
                     CVDVMARVYGADDVPRAKPEPDGLVQIARELGLDGIDRSMAYVGDAPSDGAAAKSAGM
                     LAVGVNWGSHDLREEANARNFHVVFDTVEELAASLFDD"
     gene            complement(184956..>186124)
                     /locus_tag="OSTLU_29408"
                     /db_xref="GeneID:5006736"
     mRNA            complement(184956..>186124)
                     /locus_tag="OSTLU_29408"
                     /product="predicted protein"
                     /transcript_id="XM_001422642.1"
                     /db_xref="GeneID:5006736"
     CDS             complement(185012..186124)
                     /locus_tag="OSTLU_29408"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422679.1"
                     /db_xref="GeneID:5006736"
                     /db_xref="JGIDB:Ost9901_3_29408"
                     /translation="MLAPVAWLVFRGIKPTRAEREKYAMETRESETLAKRRVERDDEA
                     AKLAKRLDEAKEAARAKAAKTMRATGPAGAATATATATATATNFKVEEKPKDVSAPAP
                     EGAADERADASTRSDVGADVEDTAVISASTSSDETEATDAAVRVVSVNERSFETPESE
                     APVAPTPTVSHDVEPIVERHHADGEAYDVIAEHPKLVRAIHEANALVHKAHARRVESN
                     QEFQDALRYREQVVHMASELGIPVAPLREVKETFKQSTYEAPLGPGAGEKAAEAAKSA
                     LAATKKFVDFAAPHVRSATTKAFDYSKQHATTAAGKLKQAHAKGDIRAPTLDEATDFA
                     KSTSRRALGACVHAFDAITDQFAAVANKSAVKPQKS"
     gene            complement(<186780..>188648)
                     /gene="HMGB3501"
                     /locus_tag="OSTLU_18991"
                     /db_xref="GeneID:5006737"
     mRNA            complement(<186780..>188648)
                     /gene="HMGB3501"
                     /locus_tag="OSTLU_18991"
                     /product="predicted protein"
                     /transcript_id="XM_001422643.1"
                     /db_xref="GeneID:5006737"
     CDS             complement(186780..188648)
                     /gene="HMGB3501"
                     /locus_tag="OSTLU_18991"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422680.1"
                     /db_xref="GeneID:5006737"
                     /db_xref="InterPro:IPR000910"
                     /db_xref="InterPro:IPR000969"
                     /db_xref="JGIDB:Ost9901_3_18991"
                     /translation="MSAEFTVAARALGRGSGTQGELTLSKAIGARFRAATGAGEQKKT
                     EIEAGKVREVRWSDAPTGGVLRVRSTDGRTLVLGGMGTEDAKNAAEYAARELGCASGE
                     TKMNVNGRNWGDVAIEGSGTVFEVGGKTAFEIDGQYISEATVVGKSDVVLQFHHDDTA
                     AEKDSLVEMSFYVPPGSETWKGDDMEDPDDTAAKRLHAAIMSIAAADAEAGEPVAEFD
                     GVSMVVPRGKVSIELHNTHMRMQSSTLDFKVQYSSIVRVYLLPKPHSNQSHAVIALDP
                     PIRKGQTFYPHILAMFNDDDHLTVEPNLAADMKDKFPTLESTYDGSSGEVFVRVLKNM
                     AGVKLTRQSLFTASAGGHAIRVSHKADVGLLYPLEKAFFYLPKPPLLLHYSEVDEVEF
                     ERHSAQGATSGRTFDVSVNMKNGSSYDFHGIQRSEFQNLVNFLTAKQVRISNVDANAR
                     ADQLIAEASDDDDEGYARRGDDDSEEDEDFAAGSESDGGEPTDSDSDSESDEGAKKSK
                     KSPKAKRAKKDPNAPKRGLSAYMFFSAAKRAEITAANPSFGVTDVAKALGEKWKTITD
                     EEKSVYQQQADEDKIRYEREMEAYRAGGSQPKVEIKDDDDSDADDAARDVDAMDED"
     gene            <190381..>191280
                     /gene="CPN20"
                     /locus_tag="OSTLU_43488"
                     /db_xref="GeneID:5006738"
     mRNA            join(<190381..190606,190811..>191280)
                     /gene="CPN20"
                     /locus_tag="OSTLU_43488"
                     /product="co-chaperonin 20, chloroplastic"
                     /transcript_id="XM_001422475.1"
                     /db_xref="GeneID:5006738"
     CDS             join(190381..190606,190811..191280)
                     /gene="CPN20"
                     /locus_tag="OSTLU_43488"
                     /note="co-chaperonin 20, precursor of chloroplast
                     protein(Rubisco-binding protein); co-chaperonin/groES
                     family; combines with CPN60A or CPN60B to chaperone
                     protein folding"
                     /codon_start=1
                     /product="co-chaperonin 20, chloroplastic"
                     /protein_id="XP_001422512.1"
                     /db_xref="GeneID:5006738"
                     /db_xref="InterPro:IPR001476"
                     /db_xref="JGIDB:Ost9901_3_43488"
                     /translation="MFAVSAHSRARIAPAVIPRARARVVTRAGAAFEVPSAYKTVTPC
                     GAGVLIKVAAAETVTKGGIVLTESAQRKPTSGDVTAIGPDVKHVKTGSTVLYSRFGIG
                     CTDVVVAGEEYTMIREQDLIGTLPSSGARANDIPKLQPCGDRVLLSVEKAAAETKGGI
                     LLTEGSKEKPIVGTVVAVGPGKAGEKDEEVKPMTLKAGDKVIYFKYAGDQMTDEEGNG
                     FVVLHESDCLAKL"
     gene            191721..193261
                     /gene="lhcb5"
                     /locus_tag="OSTLU_29411"
                     /db_xref="GeneID:5006571"
     mRNA            join(191721..192055,192391..193005,193103..193261)
                     /gene="lhcb5"
                     /locus_tag="OSTLU_29411"
                     /product="putative CP26, photosystem II light harvesting
                     complex"
                     /note="Has EST support"
                     /transcript_id="XM_001422476.1"
                     /db_xref="GeneID:5006571"
     CDS             join(191746..192055,192391..193005,193103..193152)
                     /gene="lhcb5"
                     /locus_tag="OSTLU_29411"
                     /codon_start=1
                     /product="putative CP26, photosystem II light harvesting
                     complex"
                     /protein_id="XP_001422513.1"
                     /db_xref="GeneID:5006571"
                     /db_xref="InterPro:IPR001344"
                     /db_xref="JGIDB:Ost9901_3_29411"
                     /translation="MQVNALLKKAAPAPAKTAKAPAKTQIKKAPAKKASPSLPSLPNP
                     FGGAAPKASAKTVKKAAPAKKAVAKKAPVKKAPVKKKAPVAKKAAKSPTAAKEALAKW
                     YGPDRKLYLPGGLLTKADLPSYLDGTLAGDYGFDPLGLGADGAIKQYRVAEVIHARWA
                     MLAIPGVVIPEALGLPGGVWTETGKVFLDGETGRPFFLENPIVFAAVQVALMAGVEQF
                     RSSGEGPAGFVPFKGKFDESAFKGLDPINPGGPLDFFNVASNPQDLALLKVKEIKNGR
                     LAMIAMLGVFVQGLTTGEGPAANWGKHVADPFGYNFVTLQAVDRTPVL"
     gene            <193750..>194571
                     /locus_tag="OSTLU_6328"
                     /db_xref="GeneID:5006572"
     mRNA            <193750..>194571
                     /locus_tag="OSTLU_6328"
                     /product="predicted protein"
                     /transcript_id="XM_001422477.1"
                     /db_xref="GeneID:5006572"
     CDS             <193750..>194571
                     /locus_tag="OSTLU_6328"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422514.1"
                     /db_xref="GeneID:5006572"
                     /db_xref="InterPro:IPR002794"
                     /db_xref="JGIDB:Ost9901_3_6328"
                     /translation="PHARAIGSMALGLLLALVGYKKKSLDESGALAAIGVGFGSIYAD
                     VRFGAALAAFFFASSAVTRVRSDVKKRVDEHFKVGGGRDWVQVFANGFVPTVIALAFA
                     SGGFGAEATSALASAYLGYYACCGGDTFASELGVLSKSKPRLIIDWRREVAAGTNGGV
                     TALGWVASASGGAVVGAAFHLGQSALRAVATDGGALVAPSNAASVIAFGAVAGVFGSL
                     VDSVLGATIQYSGFCEERQKVVSKPGPTVTRISGSEFLSNSAVNLVSGVITAVVAA"
     gene            <194655..>195224
                     /locus_tag="OSTLU_29413"
                     /db_xref="GeneID:5006573"
     mRNA            join(<194655..194974,195080..>195224)
                     /locus_tag="OSTLU_29413"
                     /product="predicted protein"
                     /transcript_id="XM_001422478.1"
                     /db_xref="GeneID:5006573"
     CDS             join(194655..194974,195080..195224)
                     /locus_tag="OSTLU_29413"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422515.1"
                     /db_xref="GeneID:5006573"
                     /db_xref="JGIDB:Ost9901_3_29413"
                     /translation="MFPPRAGQCACVIDGAHTEFLITEYADRVLVVATQIGKLGTVFH
                     LSRSQSVELSDPSYEDDGETMDDATASMDTVIARTVIGRRDDDALRACARRIADVLFT
                     EGLEKPIVCALGLRSDASLEAKRAVARVAVERGRELLAASRAAEGSGSRSFD"
     gene            complement(<195262..196504)
                     /locus_tag="OSTLU_25847"
                     /db_xref="GeneID:5006574"
     mRNA            complement(<195262..196504)
                     /locus_tag="OSTLU_25847"
                     /product="predicted protein"
                     /transcript_id="XM_001422644.1"
                     /db_xref="GeneID:5006574"
     CDS             complement(195262..196395)
                     /locus_tag="OSTLU_25847"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422681.1"
                     /db_xref="GeneID:5006574"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="JGIDB:Ost9901_3_25847"
                     /translation="MVLAESSTTTTTTTTATTRRRARGRGAKIVLACACAIVVAVRAR
                     ACEANFGWNGESDAATAADGETATANVVADAKREEVPVDVESVESVIKEKKRRKKSVK
                     KAAKKPVEEEEFKPYDPELGEGESAIGSIHEAIDDDDMEELEDLLRWKPNLREKCQKL
                     GETRHYVPIMKAAFLGNARAMDLLIDYGANVNEIDAIGYTVLMRSVLSKCAECVRILV
                     EAGAVVNYVQKTPMMDLGLSAQKLAMLMGEREIAEILRNAGADELETGAEKKRRLQKE
                     GAERFKEHVEAQGIDVDIDKLLNTTVDDLNVKNSQSGDVVVNVNGTNATMTHDETKDY
                     RNLEEKIAQAKLKAEAEARAKEACASDAGDGSCAFDPTTKDEL"
     gene            <196543..>198207
                     /locus_tag="OSTLU_43564"
                     /db_xref="GeneID:5006739"
     mRNA            <196543..>198207
                     /locus_tag="OSTLU_43564"
                     /product="predicted protein"
                     /transcript_id="XM_001422479.1"
                     /db_xref="GeneID:5006739"
     CDS             196543..198207
                     /locus_tag="OSTLU_43564"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422516.1"
                     /db_xref="GeneID:5006739"
                     /db_xref="InterPro:IPR002937"
                     /db_xref="JGIDB:Ost9901_3_43564"
                     /translation="MATRAALSTRPAPARARARPARRATIARARDADVVVVGAGLGGL
                     SAAALLASRGLRVTVLEAHVVAGGAAHAWTRGGYTFESGPSLYSGLEARPTTNPMGQV
                     LHAIDERVACARYNTWTCHLPEGTFVTEVGNDQFLEVLREYVDEEACEEWTRLKALME
                     PLATASASLPPAAVRSDVGGAFTLARFVPGLVRSAPYIGKIMAPYSKFMAENDIKHPF
                     IRNYMEMLCFLLSGAPASGTMAAEIGYMFDDWYKPNSMLEFPMGGSGAIVDALVRGLK
                     KFGGELELGTHVEEIIVEGEGKEKRATGVRTRDGKVYKANKAVISNATLWDTVPMLPP
                     DAMPREWIEEATSTAMCESFMHLHLGIDAAGLPDDLEIHHIYVEDWDRGVTAEQNMVL
                     VSIPSVLDPSMAPEGKHVIHAYTPGNEPLDIWDGLDRNSDEYKKLKEERSQVLWKAVE
                     KIIPDVRKRCEITMVGTPVTQKRFLRRAKGTYGGTGWISEDQDSIPITSASTPLPGLL
                     VVGDSNFPGPGVPAVAAGGWSAANELISPLQTAALLDKVCPPGTSK"
     gene            complement(198246..>198753)
                     /gene="PSRP-1"
                     /locus_tag="OSTLU_29416"
                     /db_xref="GeneID:5006575"
     mRNA            complement(198246..>198753)
                     /gene="PSRP-1"
                     /locus_tag="OSTLU_29416"
                     /product="Plastid-specific ribosomal protein 1"
                     /note="imported to chloroplast"
                     /transcript_id="XM_001422645.1"
                     /db_xref="GeneID:5006575"
     CDS             complement(198355..198753)
                     /gene="PSRP-1"
                     /locus_tag="OSTLU_29416"
                     /GO_component="plastid small ribosomal subunit"
                     /note="Chloroplast ribosomal protein Plastid-Specific
                     Ribosomal Protein 1; imported to chloroplast"
                     /codon_start=1
                     /product="Plastid-specific ribosomal protein 1"
                     /protein_id="XP_001422682.1"
                     /db_xref="GeneID:5006575"
                     /db_xref="InterPro:IPR003489"
                     /db_xref="JGIDB:Ost9901_3_29416"
                     /translation="MLVQGLHLEITPAIDEYCRAKIGKACSHVDPREIREVDVRCSAR
                     GGEDSRGGHEHKTEVTVLMTRGTTLHADGTGENLYATIDSCADIVTRAIRKHKEKHSG
                     KGSRHASHEASAKDAFMADDDDGDDVPPAA"
     gene            199254..200790
                     /locus_tag="OSTLU_29417"
                     /db_xref="GeneID:5006740"
     mRNA            199254..200790
                     /locus_tag="OSTLU_29417"
                     /product="predicted protein"
                     /transcript_id="XM_001422480.1"
                     /db_xref="GeneID:5006740"
     CDS             199559..200776
                     /locus_tag="OSTLU_29417"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422517.1"
                     /db_xref="GeneID:5006740"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="JGIDB:Ost9901_3_29417"
                     /translation="MRQRSWLFGHFRECAKVFGFDEFDAPVLESEELFTRKAGEEITT
                     QLYNFSDKGDRRVALRPELTPSFARLILQQGKSLALPAKWFAIGQCWRYERMTRGRRR
                     EHYQWNMDIVGVSGVEAEAELLAAITTFFKRVGVTSADVGIKVSSRKLLQEVLTRFGI
                     DSESFAPVCVVVDKIEKLPREKIEEELRELGVSDEAVEGILAATSMRTVEELEALIGP
                     DAEAVKDLKKLFEYADAYGYRDWLVFDACVVRGLAYYTGIVFEGFDRAGELRAICGGG
                     RYDMLLGALGGENQPMVGFGFGDAVIVELLKDKGLMPDFSKGDVQDLVFPLGESLRPA
                     AMRVAAQLRDAGRTVDLILEDKKAKWAFKQAERVGAQRVILLGEKEWEAGNVRVKDLA
                     SREEVDVKLEDLK"
     gene            complement(<200887..>201258)
                     /locus_tag="OSTLU_29418"
                     /db_xref="GeneID:5006576"
     mRNA            complement(<200887..>201258)
                     /locus_tag="OSTLU_29418"
                     /product="predicted protein"
                     /transcript_id="XM_001422646.1"
                     /db_xref="GeneID:5006576"
     CDS             complement(200887..201258)
                     /locus_tag="OSTLU_29418"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422683.1"
                     /db_xref="GeneID:5006576"
                     /db_xref="JGIDB:Ost9901_3_29418"
                     /translation="MSGLLSGDAQAIAGAVGLVANGVTSWSLWVLYNTGCGLPPGPGG
                     SLGALEGVSYLVVTAFVVAATAKKIKTGSGLPAGPGGVLGGAEGISFLVALIGLGVLA
                     NQVLHFGYVPNAIPTEGGKCY"
     gene            <202259..>203089
                     /locus_tag="OSTLU_29419"
                     /db_xref="GeneID:5006741"
     mRNA            <202259..>203089
                     /locus_tag="OSTLU_29419"
                     /product="predicted protein"
                     /transcript_id="XM_001422481.1"
                     /db_xref="GeneID:5006741"
     CDS             202259..203089
                     /locus_tag="OSTLU_29419"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422518.1"
                     /db_xref="GeneID:5006741"
                     /db_xref="JGIDB:Ost9901_3_29419"
                     /translation="MEAFELTAPRYRVRCVLEAFHAPVHVGGWYVKLDRGVPQSQWIS
                     RETGARIGRGSVVEAIERVVLKGLGSNGAKFNSSGREDMDVRMLSDGRPFALQVHDPK
                     TPLASAENVAAMEREINAQSDITGVRVRGLCFTTKENYHAVGMSSEEHEKEKSYVAIV
                     RVSREATPEDHEKIASTSRLVVQQSTPTRVAHRRADLVRPRTIVSMSSEPIPGSPDSF
                     ILRLRTQAGTYVKEFVHGDAGRTAPSLGDLLGCRAEIIQLDVIAINDDWNPSGAPRVA
                     "
     gene            <203133..>204131
                     /locus_tag="OSTLU_19001"
                     /db_xref="GeneID:5006577"
     mRNA            <203133..>204131
                     /locus_tag="OSTLU_19001"
                     /product="predicted protein"
                     /transcript_id="XM_001422482.1"
                     /db_xref="GeneID:5006577"
     CDS             203133..204131
                     /locus_tag="OSTLU_19001"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422519.1"
                     /db_xref="GeneID:5006577"
                     /db_xref="InterPro:IPR006139"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="JGIDB:Ost9901_3_19001"
                     /translation="MRRPRVLFCGLEFEDGYAHTRAYVDDNDLDVDVARCAREDVARE
                     ISRCDVAVPLMTKLDAELLKIGAAGALTHVLQFGVGLEGVDIECATALGVTVARIPSE
                     KTGNATSTAELAVYLVLAALRRHDAMSASVRSRKLGAPTGNALSECEVMILGWGAIGV
                     KIAARLRGFECALTAARKSKWAEDESDRCGIPLRAVCGTSDRDGLRALLRAADVVCVA
                     CTQDPSNAGMIDDEFLAAMKPGAALVNIARGGLFDRDAVLKSLKSGHLGYLASDVAWS
                     EPVDPEDPIVRHEHTYFTPHIAGVTHSSYRMMGEIVATSASRLVEFRKLTDIQVVN"
     gene            complement(<204534..>205805)
                     /locus_tag="OSTLU_2179"
                     /db_xref="GeneID:5006578"
     mRNA            complement(join(<204534..205138,205277..>205805))
                     /locus_tag="OSTLU_2179"
                     /product="predicted protein"
                     /transcript_id="XM_001422647.1"
                     /db_xref="GeneID:5006578"
     CDS             complement(join(<204534..205138,205277..>205805))
                     /locus_tag="OSTLU_2179"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422684.1"
                     /db_xref="GeneID:5006578"
                     /db_xref="InterPro:IPR002917"
                     /db_xref="JGIDB:Ost9901_3_2179"
                     /translation="RGEAETLHKDALSVPRRPAWTHEMRAEEVDENERRGFLEWRRAL
                     AAVEEDSRCSLTPFEKNLEIWRQLWRVCERSDVVVQVVDARDPLFYRCEDLEAYVKEL
                     NPGKATMLLLNKADLLSKELRRAWAEYFNAKGISFLFWSAKAAYEEIEAEQIAAKAAQ
                     TAKELEETNRRLTLHAAHIWSRAELLDILQKRAEAAVEAMGSTRVKRKGPQANRVVVG
                     MVGYPNVGKSSTVNAIVASKKTGVSATPGKTKHFQTLELGDDLLLADCPGLVFPTFST
                     SKAHLVCNGVIPVDRLTDVTKPIEIIAERIPRSTIEHVYNLTLPLPALHEDQGRNATA
                     REFLRAYCAARGYTVQGNRPDEVRAGRAVLKDYISGKLLYCVAP"
     gene            <206338..>206857
                     /locus_tag="OSTLU_29422"
                     /db_xref="GeneID:5006742"
     mRNA            join(<206338..206376,206633..>206857)
                     /locus_tag="OSTLU_29422"
                     /product="predicted protein"
                     /transcript_id="XM_001422483.1"
                     /db_xref="GeneID:5006742"
     CDS             join(206338..206376,206633..206857)
                     /locus_tag="OSTLU_29422"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422520.1"
                     /db_xref="GeneID:5006742"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="JGIDB:Ost9901_3_29422"
                     /translation="MATKVQRIMTQPINLIFRFLQTKARVQIWMYENPDTCVEGRIVG
                     FDEYMNLVLDDAEEVTEKKSRRVGVGRILLKGDNITLMRNVSK"
     gene            <207042..>209411
                     /locus_tag="OSTLU_43793"
                     /db_xref="GeneID:5006579"
     mRNA            join(<207042..208355,208434..>209411)
                     /locus_tag="OSTLU_43793"
                     /product="predicted protein"
                     /transcript_id="XM_001422484.1"
                     /db_xref="GeneID:5006579"
     CDS             join(207042..208355,208434..209411)
                     /locus_tag="OSTLU_43793"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422521.1"
                     /db_xref="GeneID:5006579"
                     /db_xref="InterPro:IPR007234"
                     /db_xref="JGIDB:Ost9901_3_43793"
                     /translation="MSSTDAFEHQNFNAVDFINRVLPDERALAGVDKMIAKLRARVKL
                     VDAEILGALRAQHGSEARARDDFEVIVSGIDALAERATETERKAAATEANVREICADI
                     VRLDRAKNHLTNSITTLRRLSMFVSGMEQLELFALRRQYGDAANLLQAASQLATHFEG
                     YSQIPKIAELQEKYRGVKNQLRAAVFDDFHTTWLPHVMDGDAAAQKKLRDACLVVNAL
                     EPSVREELVGNLTNRELTNYASVFSAHESGDFLGRIARRYDWITRQLQSKESMWAVFP
                     AHWRVPQLLSVSLCKLTRAQLAEALDARGPHDVQKLLHAMHVTIEFEMELDERFGTGA
                     GVEDDELEGDSASASMLRQKLERAEREKQTENLRGGRVLPMDSAAEAAATFMFRGSVG
                     SCFEDHLADYVALERRQLFEQINESIRNETWQGDETNPRILASATSVFVQVLIAYAKA
                     LNERIDVAALNATDARRPEAQRAAEIKCICLIVNTAEYCNETVGPLGDSMVKSLEDNF
                     KEKVDMMDVEDAFSTTLSEALNKLIGVVEAKSNLVSGMLRVNWGALDVVGDQSEYVDT
                     FERAIAHAMPVLRASVSDIHHTFFCEKLASSIAPKLYIAVFKCKRFSEIGGQQLLLDM
                     HAVKAILLSLPAIAAAGTDVTAEPSAPPMSYAKMIAREMGKVEALVKTILSPNDGLAE
                     TFKALLPMTANATDFKAICLLKGMKPNEISEPPFGLFASVGAPASSKPLEDLPNVPNR
                     PKAPRMDNVTAKMSGMFKQGTKQ"
     gene            <210023..211787
                     /locus_tag="OSTLU_29424"
                     /db_xref="GeneID:5006580"
     mRNA            <210023..211787
                     /locus_tag="OSTLU_29424"
                     /product="predicted protein"
                     /transcript_id="XM_001422485.1"
                     /db_xref="GeneID:5006580"
     CDS             210023..211720
                     /locus_tag="OSTLU_29424"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422522.1"
                     /db_xref="GeneID:5006580"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="JGIDB:Ost9901_3_29424"
                     /translation="MLVMRLNRTDEDRQRIAGALEMLERGFIVDSRDESGHNVLWGAL
                     MGAAAVAADEGAAAGEETVAVLRMLLERGARANQRYDSGETPLHLAASSGVLGAVAAV
                     LEHGGDPNARNDDGRTPLMLACARKLEESERPHIVETLVSCGTNVEARDSNGLTALHI
                     ACKCGNDVVVEALLRCKADWRARTPKLGESAVMLAYTHARASGVIAEILKYVESLEGE
                     AAMVGETEFFRATSPLFATTTAAVRCVKEDIALAKWCEREKEISACIAKVSGVTTGSV
                     DSGKIIRFPEDASWSPEARQEVTALYFRACDFELDDDDDKSNVAVSLYRKYGDVLSAF
                     IRFNHANFPMSLGESYADGGETLPIDFVARALYASKQASGSSTCVGVSSSLTPTKLHS
                     PVYVAFMTVMSLSVDRTFHYAPFITDNAKAWLMAESAFICVSRGGAYTAARLRDALNV
                     PTTVILLRSDDDATPACFVEDATVIEQSKFRETRLDSHSHATLLVELVPGDTELLELA
                     IDSYGGTTLTLVNARSDDAECGAVARARGFKEDARKRAPSFVASGRPFAFSRWTKSP"
     gene            <212933..>214009
                     /locus_tag="OSTLU_89708"
                     /db_xref="GeneID:5006581"
     mRNA            <212933..>214009
                     /locus_tag="OSTLU_89708"
                     /product="predicted protein"
                     /transcript_id="XM_001422486.1"
                     /db_xref="GeneID:5006581"
     CDS             <212933..214009
                     /locus_tag="OSTLU_89708"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422523.1"
                     /db_xref="GeneID:5006581"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="JGIDB:Ost9901_3_89708"
                     /translation="LAVQHECIPQAILGMDVLCQAKSGMGKTAVFVITVLQQLDPVPG
                     EVGAVVMCHTRELAYQISHEFERFSTFLGDVTTAVVFGGIPIAQQKEQLKLQPPNIVV
                     ATPGRLKALAQDGTLNLKKCAHFVLDECDKMLEAVDMRADVQEIFKMTPHDKQVMMFT
                     ATLSKELRALCKKFMNDPMEIFVDDETKLTLHGLVQHYVKLEEAEKNRKLNDLLDSLM
                     FNQVVIFVSSVQRCKALDKLLQECNFPSIAIHGSMGQEERLARYKSFKDGDKRILVAT
                     DLVARGIDIERVNIVINYDMPSSADTYLHRVGRAGRFGTKGLAVTFVASSEDTEVLSS
                     VHERFEVEIKELPDEIDQSTYMPS"
     gene            <214928..>215662
                     /locus_tag="OSTLU_5520"
                     /db_xref="GeneID:5006582"
     mRNA            <214928..>215662
                     /locus_tag="OSTLU_5520"
                     /product="predicted protein"
                     /transcript_id="XM_001422487.1"
                     /db_xref="GeneID:5006582"
     CDS             <214928..>215662
                     /locus_tag="OSTLU_5520"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422524.1"
                     /db_xref="GeneID:5006582"
                     /db_xref="InterPro:IPR000668"
                     /db_xref="JGIDB:Ost9901_3_5520"
                     /translation="TLPKDFDVREKWPKCAALVSEALDQGECGSCWAVAPAKVMADRL
                     CIATNGAVASHLSAMQLLSCGKLENGTFDAGSTYSGSCDGGFPNEAYEKARTSGIVSG
                     GLFGDDKTCMPYAFAPCQHPCNPNHVAQCPTTCRNKNVNLSSQRYEVTSLVTCGTNDF
                     NCMALELFYHGPVSSYVGDVFDEFYKYKSGVYSLSKDVAARGENHGGHVMEVIGWGTT
                     ESGTRYWKVYNSWLNWGDQGYGKIAVG"
     gene            complement(<215821..>217131)
                     /locus_tag="OSTLU_89710"
                     /db_xref="GeneID:5006583"
     mRNA            complement(<215821..>217131)
                     /locus_tag="OSTLU_89710"
                     /product="predicted protein"
                     /transcript_id="XM_001422648.1"
                     /db_xref="GeneID:5006583"
     CDS             complement(215821..217131)
                     /locus_tag="OSTLU_89710"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422685.1"
                     /db_xref="GeneID:5006583"
                     /db_xref="JGIDB:Ost9901_3_89710"
                     /translation="MATVAARATREFDLIVYGANGFTGALAVDYLARKYPHLSIAIAG
                     RDAAKIRARADATRDARGVTFPTVVARDAASREAMVRRARTVLTFAGPYDADAARALA
                     ASCADAGTDYCDITGEPQFVRDVVETCHERAKARGCALVSCVGYDSVPWDLGTALASE
                     ATMKRGGAAEIDVARGHAGRSRGGVSGGTIASAANVVAKPKSETRGMGDPHFFAKCAG
                     GWADKPDVEAAKRWPSPQGTWAFDEDTKRWTMPSIMAGINAKVVARSYALNPERYGKN
                     FRYDESDLCASKKNAILGTLTLGAFGAAFVVPPLRWLMRKTILPKQGEGPSEDTRENG
                     FSHVYVVANGRDAKGEAVDSYCCEFEFIKADPGYKGTAALACEAALCLAIPEERARLD
                     FAKEGSGGCFTPSACMGHVLMERLNNAENFSVKVQKLKDTVFLV"
     gene            <217244..>218533
                     /locus_tag="OSTLU_94067"
                     /db_xref="GeneID:5006743"
     mRNA            <217244..>218533
                     /locus_tag="OSTLU_94067"
                     /product="predicted protein"
                     /transcript_id="XM_001422488.1"
                     /db_xref="GeneID:5006743"
     CDS             <217244..218533
                     /locus_tag="OSTLU_94067"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422525.1"
                     /db_xref="GeneID:5006743"
                     /db_xref="JGIDB:Ost9901_3_94067"
                     /translation="VRRGRRYRDAPASRARAPASNGDGDDANRDGDDANRDERRARAS
                     NRDGDDANREGDDANRDGAGVAGARAGPHGRALVSSGHGDADALLGGGHALGSLAACA
                     SDGASAHAEALFGACFVAEGAATARHRTCWVRAGREGRAEATRTLPRRVVEREGESAT
                     TTDDRASEASEASDGLRIAWQYRRYLREGRNLDDSGVGAARATTTARTTKKRNLRAPD
                     VCQTYDWTREEDEATLRDADVSFERFGGDEGDGEGETDAWARCFEFVETFVRGLRDEE
                     VGRVLVQPETPRDEGEWAACARLARALKGLVRETNVACVMILPLALAPARWGAMIRHV
                     ADCAIDVQPLEGPTSEIESLLPEPHLCVGLVAVRKLQFQGGVVSPLTRMDRVYALQMR
                     RKRMAIKPLQIRPEEERKKSGGESACGAVEGVGLDDF"
     gene            complement(<218575..>220722)
                     /locus_tag="OSTLU_29430"
                     /db_xref="GeneID:5006584"
     mRNA            complement(<218575..>220722)
                     /locus_tag="OSTLU_29430"
                     /product="predicted protein"
                     /transcript_id="XM_001422649.1"
                     /db_xref="GeneID:5006584"
     CDS             complement(218575..220722)
                     /locus_tag="OSTLU_29430"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422686.1"
                     /db_xref="GeneID:5006584"
                     /db_xref="JGIDB:Ost9901_3_29430"
                     /translation="MPARAPTTRKTPRSPARKASPARGRPSTPKYNDDVVQSLLQILT
                     SGQKSKRTKSPLTLERAEALWELAKTNREPNVAATLTAIANGGGRGAGGVVKVEDDAA
                     RWLTARISSAFGEGEDGGERSSARKSGTKRNLSTRFEDGSDVEDGEEAASEERERRGG
                     TSPRGERAAKRRRLTVTERLMRRVTLATTRSTSKELRVIDGVSYDRAACAIVDESLKK
                     KGKVDSMCARAVELSVKATGSRYGITPAGLQTLRMIVEGGVDGHYTFQVDAAARKHLG
                     ALIADEESLGPEILLPTVKRRKVAAALQRLSNFARQAQYRTIDGVKYDENACHIADVA
                     TQTQGKIGLACAKAIHASIEDGGSHWGITDIELRTIEMIIEGGRADYSYVTDAAAMKY
                     LKDLVVNERSKREDAEIERVAAVSEARGNAAGGVLAHVRKLVRPKFYRYIDRQRYDEK
                     ACEIADDCMERIGRINLECAKEIHESILDGGSRWGITSTEFATIQLFLDGGRDDVLYI
                     CDDDARMYLLDILGTKAIEETENVTPPTKVQVRRQSPASALQSALKNPPPSALRHAAA
                     KSVKKKGVNFTPAKRFELRTYIPSPTSGNTSEEEIDDDDDDDEVEVLTEQDEEMVEEE
                     ADEVDEDEQIVEVATTKRSSVRMITYSRPSIMTAFYRSMQFWMTPVSVLDTAAACLAT
                     AASFLVAHIFIIAALEATITPSSIKSLNMEAKL"
     gene            complement(<220881..>222371)
                     /locus_tag="OSTLU_29431"
                     /db_xref="GeneID:5006744"
     mRNA            complement(<220881..>222371)
                     /locus_tag="OSTLU_29431"
                     /product="predicted protein"
                     /transcript_id="XM_001422650.1"
                     /db_xref="GeneID:5006744"
     CDS             complement(220881..222371)
                     /locus_tag="OSTLU_29431"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422687.1"
                     /db_xref="GeneID:5006744"
                     /db_xref="InterPro:IPR004963"
                     /db_xref="JGIDB:Ost9901_3_29431"
                     /translation="MAGASIGNKLFDVVSVRHAARDHEREATSGLSGVRRLTAEKMEL
                     DMERYPKARCLDGTPGAYYVNLAPIRVRNVDDEYPSAKRGSVARAGDSSGGSGSAREF
                     ATSKTWVVMLQGGGECTNAPECSERSGTERGSSELLPDEIVFDRGIQAVTADDDGEDL
                     PFSRANMVTVGYCSGDVYMGRSDEADASGMWHSGAHIVEAVLQELVRAYNIEDADVIV
                     LAGRSAGGIGLIAQVDQWAELLRTKFSAIARSTVKIVGAPFAGFHYFHNDTEGAADDS
                     LKYVPWDEASFKQYVDYWHASESLPKACVEVNQDAPWRCMVADYSFPHTRTPLFFSQA
                     LLDSVVMRLHDNFGGDFTRHKQVTFAHEWQSQMRRVLEPAMSHATAGVFAPSCYMHTD
                     FDGIVIDGISHHRALAEWVFENKPIRLIDDCRELMCNPTCRSRDKSSTLSNDLDDGAL
                     GHAFDRKRRKDEDELSAEKVAAERKTDDARARRKSNRRRARHRPSD"
     gene            <222860..>223990
                     /locus_tag="OSTLU_29432"
                     /db_xref="GeneID:5006745"
     mRNA            <222860..>223990
                     /locus_tag="OSTLU_29432"
                     /product="predicted protein"
                     /transcript_id="XM_001422489.1"
                     /db_xref="GeneID:5006745"
     CDS             222860..223990
                     /locus_tag="OSTLU_29432"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422526.1"
                     /db_xref="GeneID:5006745"
                     /db_xref="InterPro:IPR007751"
                     /db_xref="JGIDB:Ost9901_3_29432"
                     /translation="MSVVVGVASALRAPRVLDEGRTRRPWRHRRGIRRHELRARVEAA
                     RVRDETNEQKTHLFVCVHGLAGTPDDLCAMEARLLSQRGAATHRVTCNAPLNSFDGVD
                     AGARRIVEELREVRKKYPGLRRLTLYGNSLGGIYARYVAGLLYAESKDGTMLDGLTPC
                     TFLTTATPHLGVGPWGYFKIVPEGARNLWARNLGASVEELTLRDGHRRASGRPLLADM
                     ADPETKDPVDFIAALGAFERRCAYANAVNDFLVSYETAAISPEYLDSETERRWRTLEK
                     PQIVEEYVVEGSPMPPTTTSTSRGWRKDSLALQRRMASGLRTLTWKHVNVAFPGPTPL
                     AHNKICALQRSEVIERLFKEGEFIVDHQASYLLEPLRRQTSS"
     gene            complement(224039..>225815)
                     /locus_tag="OSTLU_25853"
                     /db_xref="GeneID:5006585"
     mRNA            complement(join(224039..225051,225241..>225815))
                     /locus_tag="OSTLU_25853"
                     /product="predicted protein"
                     /transcript_id="XM_001422651.1"
                     /db_xref="GeneID:5006585"
     CDS             complement(join(224049..225051,225241..225815))
                     /locus_tag="OSTLU_25853"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422688.1"
                     /db_xref="GeneID:5006585"
                     /db_xref="JGIDB:Ost9901_3_25853"
                     /translation="MTIDARDDGAVATERRRAKAFWAQRRASLSLRFDARDAREIEIE
                     VEDADSVGAGRSIVRVSYVARLGDEGEPEEDGSASDASAAFECELELYGAVAPARKAE
                     IKRTARAFTVVFRKTTPGAHWPRLSLTKEKSRFVATDFDAWMDEDDEAAADAAFKFDL
                     SSLEKISNYEDKSYYFPDVDDSDDDMPDMTDVGNTYEREALEKFWSSAPGRARDPLTN
                     VETRANSRVVYTNWDKRREVRDYLDARSEDYVPSGWTSRAVPAPRSDGDGDARERGRG
                     LANGAVKASAVLTVLAIAALVSASGAKGGTWGFGAVGARRGTPRMPNVDEYGRAVELR
                     APAGSRVRARKVSSGTPALEITVPAQSVNTAALLFSVPWFAITGTWTYGAWNAANPLF
                     ASFSLPFWAVGLNMVHQSATSAFETTKLLLTTDQFYLEKTIFDRRMFYLKGDVADLSK
                     AAVETYAYVNGAPQSNLVLHHGVKSYVLARGLHSSEDEFVADEIEKFLKKYRRARKGG
                     DAVKIDTTTPFFARARM"
     gene            <225999..>228383
                     /locus_tag="OSTLU_19010"
                     /db_xref="GeneID:5006746"
     mRNA            <225999..>228383
                     /locus_tag="OSTLU_19010"
                     /product="predicted protein"
                     /transcript_id="XM_001422490.1"
                     /db_xref="GeneID:5006746"
     CDS             225999..228383
                     /locus_tag="OSTLU_19010"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422527.1"
                     /db_xref="GeneID:5006746"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Ost9901_3_19010"
                     /translation="MDRAREPAGDAGGRAPSLDALDAPDRARDDARDGANDVEWRTVN
                     GRKNAKSSRERLARSSSSQSRAEEIADASVARVNAYEAIAPPGTPTRSEREGEGEGTE
                     GRDARRRAKRRARRGTRRTSAALRVLGGASTGASEDEYYGEGADGGWGIGGIAARAAA
                     LAAATARARFDTAREATTTPDSDAAGRGKEEGEVVPLMMRTFPPIGGSRPPLPGRATV
                     RAPMSPPRPRPPKTPKTPKSPTTLERTKSGRHGGDGEEREHQNALDWFFHQMDLAFAG
                     VMLAVYAFYDTVMKFIGIKVLRVSQSSRSVRQTEARVAEERAAVEEFEEILSARQTAT
                     EASSRSPSASDVDGANRTSRPRTPPSASTSATTSKHATIPSVEQRVVEEREEGELTPS
                     HALRRRLSSSLGGAWGGGGNTPPSFRVARVDEDATHAHNELVSCVGSRGDEYITGGWD
                     GTLRTWKWDPTKGLSGGLPMTGQHNDNVEFLSVDAREDHERLAISGGRDCTVRIWDVA
                     KRSQRSRIYAFENIASGCVDWESQTVAVGSRGGAVMLWDAEKGSKKCTLRGHDGEVTS
                     MCTYDWSEGGATLYVSGGADGTVRVWDARQHVAVATMTEHRRRVYAVCPGPKGIIFAG
                     DFSSNVKVHSLSNPGALPRLLPNVPSMDGCEAPIAGLQYVKLDGMNGGGLLLSTAAYF
                     PLNENGEESDDDDAPQGCVHVRAVDATGAGVGPVSDQDGDGYMYTLKGIEGLLTCASL
                     TATSDGHRMRLVVGAGSGALGAYAEGGALSGQTADDAYASTIERADDLGVESFD"
     gene            <228516..>229049
                     /locus_tag="OSTLU_43572"
                     /db_xref="GeneID:5006586"
     mRNA            <228516..>229049
                     /locus_tag="OSTLU_43572"
                     /product="predicted protein"
                     /transcript_id="XM_001422491.1"
                     /db_xref="GeneID:5006586"
     CDS             228516..229049
                     /locus_tag="OSTLU_43572"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422528.1"
                     /db_xref="GeneID:5006586"
                     /db_xref="InterPro:IPR002478"
                     /db_xref="JGIDB:Ost9901_3_43572"
                     /translation="MFRKYHVDGVQQLKSSVQRGIRAKISDQYPALDDALDDLMPKKA
                     TVVIGKCEHKTNVVLVDDEPLFFNQRDGPYFPTLRVLHKYPDMMPKLRVDKGAIKFVI
                     SGANIMCPGLTSSGATMHDECEEDEPVAIYAEGKEHALAVGITKMSTEAMRTVNKGIG
                     VDLVHYLKDGLWEATAK"
     gene            complement(<229255..>229791)
                     /locus_tag="OSTLU_7961"
                     /db_xref="GeneID:5006587"
     mRNA            complement(<229255..>229791)
                     /locus_tag="OSTLU_7961"
                     /product="predicted protein"
                     /transcript_id="XM_001422652.1"
                     /db_xref="GeneID:5006587"
     CDS             complement(<229255..>229791)
                     /locus_tag="OSTLU_7961"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422689.1"
                     /db_xref="GeneID:5006587"
                     /db_xref="InterPro:IPR004932"
                     /db_xref="JGIDB:Ost9901_3_7961"
                     /translation="SPLARAQAKLAQRLQIFLDKSVPKRAERWSAYACVALVYAIRAY
                     FLRGYYIVTYGLGIYNLNLLIGFLSPRNDPESLRASNDGDDGPSLPTSNEQEFKPFVR
                     RLPEFKFWWMSLKSIGTAFAMTFMPMFDIPVFWPILLMYFIMLFFMTMKQQVKHMIKH
                     KYVPFTTGKPKFAGASAGG"
     gene            <229934..>230704
                     /locus_tag="OSTLU_94071"
                     /db_xref="GeneID:5006747"
     mRNA            <229934..>230704
                     /locus_tag="OSTLU_94071"
                     /product="predicted protein"
                     /transcript_id="XM_001422492.1"
                     /db_xref="GeneID:5006747"
     CDS             229934..230704
                     /locus_tag="OSTLU_94071"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422529.1"
                     /db_xref="GeneID:5006747"
                     /db_xref="JGIDB:Ost9901_3_94071"
                     /translation="MRRAPPVADAPLRRAATGALVVVDDFLPRATAARMRRELERAPE
                     SAWDRADANDDDDAEDVAHAFDASTAVRAVSAFTSVGFEMQRAAEDDARAREDDDDED
                     WRALVPSFTASRYANGHKIDPHDDAAYAPVELANGGFEMHLRAYAVAYYLTPDDWDVE
                     RDGGAFVDMDDETAPGKTIEPKFNRLVVFKVPRVHAVAPVTSENRRRHAIFGWFYRPA
                     REDELPSSDADDASASDASDASESRARKRKRARRERGE"
     gene            <231170..>231793
                     /locus_tag="OSTLU_5483"
                     /db_xref="GeneID:5006588"
     mRNA            join(<231170..231562,231641..>231793)
                     /locus_tag="OSTLU_5483"
                     /product="predicted protein"
                     /transcript_id="XM_001422493.1"
                     /db_xref="GeneID:5006588"
     CDS             join(<231170..231562,231641..>231793)
                     /locus_tag="OSTLU_5483"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422530.1"
                     /db_xref="GeneID:5006588"
                     /db_xref="InterPro:IPR000462"
                     /db_xref="JGIDB:Ost9901_3_5483"
                     /translation="ERNFNAPNALCVGRIVAGPALAYGVASGASPELVLGGVAAAAFT
                     DYLDGFLARRWKQGTILGSYLDPIADKVFVGCVGTALALEGSLPVWLVGLLVSRDAIH
                     VVGGAWRRAGALGWKWKTVGEFLGFDDKPRGALRPLFIGKVNTALQMALITFAVSEPV
                     FAAHAGSPMMAPALELVADRTV"
     gene            complement(231987..234198)
                     /locus_tag="OSTLU_29440"
                     /db_xref="GeneID:5006589"
     mRNA            complement(231987..234198)
                     /locus_tag="OSTLU_29440"
                     /product="predicted protein"
                     /transcript_id="XM_001422653.1"
                     /db_xref="GeneID:5006589"
     CDS             complement(232032..234182)
                     /locus_tag="OSTLU_29440"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422690.1"
                     /db_xref="GeneID:5006589"
                     /db_xref="JGIDB:Ost9901_3_29440"
                     /translation="MRASSETSDESDDDDAWCASCERCGEVCFGASETLASLALAKHR
                     DGACGARVRGDGDGATRETTPKREYHRKCTLCENFEVNEDDKKQFFAAWGRHANSEEH
                     LLNAERRRRTKLEKREPGGRARATVGESALEFPTRTCETCAVTIRGSGEANLANNWLQ
                     HARTRRHQELAHAAKETAKAAKFASVVEQKAPPPVRVRNVYDALESAGSERSGSPAPV
                     FDDSAEISPKHGTDSSPIALDKSAGAASVLAYMCDRSVGRAWRDARPTLVSHDRVDET
                     ARDMAVLGTLFDVPKHFAQNEFVDKREMFMDVGIPFCGLVYGAPGASTSHTVDVLVEN
                     CLMRQGMVDPPQDWTTAITFSTSTTDAFSKDASLANFLGLSVLSLHLETLCGKNSNCR
                     APNVKVLSAPKHIESRAPEICDEYDRNGFVGMVSPLLFGWNSLTSEHLCIMLGIEDDE
                     QILKMIRHRTSFKQFFEGLCDSFRAQRDGSRGQLLLARAQQVKSFIYENYENVHVEGV
                     VMRVFEQAVLVDALNVVDVTHSEYEPDFVDAIFQVALSMFQKMDLPLKRTARNRRSPP
                     KKLIVIDDADLLLSLGSRAGFAGQLVNAARTMHRTNTRLVVGTTSPFAIPEALVELAT
                     VHVLHQFNSARWFDHIARNAALQEANLSDVRNLQPGESLVCANMLCYNWSAPRARAVK
                     MRIRNRLTRESVRVVRTPLEEATHRFMRDIDDSR"
     gene            <234465..>234980
                     /locus_tag="OSTLU_29441"
                     /db_xref="GeneID:5006748"
     mRNA            <234465..>234980
                     /locus_tag="OSTLU_29441"
                     /product="predicted protein"
                     /transcript_id="XM_001422494.1"
                     /db_xref="GeneID:5006748"
     CDS             234465..234980
                     /locus_tag="OSTLU_29441"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422531.1"
                     /db_xref="GeneID:5006748"
                     /db_xref="JGIDB:Ost9901_3_29441"
                     /translation="MAREDALEDGEAREARAGARAREGGDGDGKGASGLAASAREANA
                     RGGVRAETSADDDGTLVRVIAPGAFDARWRANDPANAATTTARAVDGGVTAAHAALSD
                     RLLEFAADALARAGDAEAASIEILAWLEDLRDVFVVPDFASGGRVLAPDPSRGGVLVP
                     GRLLPGRVARA"
     gene            <235501..>244683
                     /locus_tag="OSTLU_89715"
                     /db_xref="GeneID:5006590"
     mRNA            <235501..>244683
                     /locus_tag="OSTLU_89715"
                     /product="predicted protein"
                     /transcript_id="XM_001422495.1"
                     /db_xref="GeneID:5006590"
     CDS             235501..244683
                     /locus_tag="OSTLU_89715"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422532.1"
                     /db_xref="GeneID:5006590"
                     /db_xref="InterPro:IPR005046"
                     /db_xref="JGIDB:Ost9901_3_89715"
                     /translation="MGLTLAVEGATSPFTSRGDLDNAIMACLADDETLATCRDSAATP
                     VPIGSWDVAAIVDMSRLFDSGSVGRFVNVDIGLWDTSSVTDMNAMFKGQTNFNQDLST
                     WDTSSVTDMSGMFHDASSFNQNIPTSGVQWDTSQVEFFDTMFKNAVAFNQDISSWVVS
                     AAANFNSMFSGATSFNQDITGWIGASGASADNMFSGATAWLNNYGPTTAGSTTTDGPA
                     SAWGKLCAANQRVVSNACQACPTGSVRAAGDNAKGVDTACACPANHYYVSGGGCLACA
                     SGLFRLAGDVAPGGHTACTYASPFTLKAELVNTIASSYCLGGAAAPTGASCTDGKGLG
                     IANWDVSGVNDMAGLFQASSSSWTSTTFNADLSLWDTSSVVDMNNMFNGATSFNQDIS
                     SWDTSLVVNMNNMFNGATSFNQDISSWVTQSVTDMGAMFENAAAFDQPIPKSGSQWDT
                     TLVKDMSNMFFGAAAFNQDLSTWVTQSVVDMSAMFQNAPLFNYSMVTSGSVWDTSSVT
                     NMDNMFKDAVAFNQDISSWVVSAVANFNSMFSGARSFNQDITRWNSASDASADNMFSG
                     AVAWITDYGPMTAGSVDGPASAWGKICAANQRIVSNACQACPTGSVRAAGDNAKGEDT
                     ACACPANHYYVSGDGCLACASGLFRLAGDVAPGGDTACTYASPFTLKAELVNTIASSY
                     CLGAAAAPSGASCTDGKGLGIANWDVSGVNDMAGLFQASSSSWTSTTFNADLSLWNTS
                     SVVNMNNMFNGATSFNQDISSWNTALVTDMNNMFNGATSFNQDISSWNTSLVVNMNNM
                     FNGATSFNQDIRSWVTSSVTDMGAMFENAAAFDQPIPKSGSQWDTTLVKDMSNMFFGA
                     AAFNRDLSTWVTQSVTDMGAMFQNAPLFNYGMVTSGSVWDTSSVANFNSMFSGATSFN
                     QDISSWNTALVTDMDNMFKDAVAFNQDISSWVVSAAANFNSMFSGATSFNQDITGWIG
                     ASGASADNMFSGATAWLNNYGPTTAGSTTTDGPASAWGKLCAANQRVVSNACQACPTG
                     SVRAAGDNAKGVDTACACPANHYYVSGGGCLACASGLFRLAGDVAPGGDTACTYASPF
                     TLKAELVNTIASSYCLGGAAAPTGASCTDGKGLGIANWDVSGVNDMAGLFQASSSSWT
                     STTFNADLSLWDTSSVVDMSNMFNGQMAFNQPIPTSGSQWNTALVTDMNNMFNGATRF
                     NQDISSWDTSLVVNMNNMFNGATSFNQDISSWVTQSVTDMGAMFENAAAFDQPIPKSG
                     SQWDTTLVKDMSNMFFGAAAFNQDLSTWVTQSVVDMSAMFQNAPLFNYSMVTSGSVWD
                     TALVTDMNNMFNGATRFNQDISSWDTSSVVNMNNMFNGATSFNQNISSWNTALVTDMG
                     AMFQSAVAFNQPIPKSGSQWDTSLVTNMNNMFGGATAFNQDIGSWVVSAVANFDSMFS
                     GATSFNKNITGWIGAGGASANNMFSGATAWIARYEHTSNPGNSFHGPASAWTGPVPFA
                     NLAALQTAVTNCLNSAPSGACTCSPSVDCGAALYEPITNWDTSLVADMNALFQSATLF
                     NANIGSWNTEQVTRMDNMFSGAAAFNQPIGSWNVTAVTDASHMFQGATAFVHDITGWV
                     LSQTPQANVTSMFVNAIAWINERDRIDGSASLDGPPSAWYTPAPPPPPSPPPPPPPTC
                     GNGVYDAAGTNPDGTLGETCEPYGNSIDNTVLVQGCDPATCAPFENWQCNDPSTIGTP
                     DYNCTCNNPAGTYALPDVNFCARVKCVYADRCLSEGRGCAPGAGGNACDRCYTAQDIV
                     DLGLEASLAKAGYYKTGQTCTECPGTSAGQLFAAATLVVVLAFFGFKASQVMGPQATN
                     NLKKIIESLQFFSLSLSMDIKWPGPVLNLGKYLEAFTFSVDFLRPECVATGLNWLNIF
                     LASVFVVPALIFFIIVFNNFRSRRRFERTVRSIHCERRDGGAMVYWIERPGRLWGIRR
                     TFESKGGDKIVKELQRQYRFRASLRSFGVLSMTVLYLPIVRMCLQAFDCLEIDGIEST
                     RLEHDIDIDCESTSHVTIQAAAAVMLAIVGIGMPIYVISQVRKLSNTGKLDDPQTIDA
                     YGPFYDIYRREDLTYSHKLEIARLRQTTVRSRSIPRGSDDEDDREETTFDTETERVAD
                     EIENDIRQDIEEPNEGTSLETTDGPTDDVEQGEDFNPELGKKKVFGKGRKSKDGRLAQ
                     VLSMSKSMLQRTPSAQARERVKKMSWKDRFSVYYLSVELCQKSGVILMTSPFISASPL
                     SGWGLVFIHWFLGIFVYICQPWRIITLSFFGFKVSNCLNKVETMAAFLQGVTPALAMI
                     WPVKRDADGIVQESFTLEMMTGLMTAIITGLLAIRIIVFVGERVAVKRAKMDIDKEPE
                     ACIEIVRERLVEMAKKRAVVSLFAFKADFDITRRKARARIEITRQAMLTRIDTLKSEM
                     ASTEGQGIDYTEQITALYEVANQMAHIVNTVVPMPPPVGPAVEERIDALEAQLSKLSV
                     AEDERYVAARQESEPSPNAAAMHIIFKVHIVDCIVAQVNEQLEVYASAELVSDLAVLG
                     RRHAELLSEQSAITSQFGDSELRATSDELSSSAVPLLEANERDDFEKVSSTLHHCASV
                     IDAHAQWCMTQSELFSGLKREHPTFLPDEPPLTTECFESCIKDLKTHEKQMELVRTQC
                     ISDWLPMFKHFGCVKYLRGFAEQIRNQLSLNLNGEITPEEAKVVYDDTVAFMDGFASW
                     CADLCGIIETSDVFNEFQPIASAMMKSLKVIQIDAKKQSMLAQKVLSAVDYALAQKST
                     AEAVRNNLQQALRDLTSKMEEHLAVQMDEMKNEKIALERAYEEEKVQTEEDINVLEKT
                     FAERKATMEREFALQRDIVERLLVMKQEEKAAVAPSLNPFRRVRFEYENELASANKEC
                     LRISRALEREENVKNMQCENLLRAMQQTERQLRAQIKIHDSLMAKMEADVLDHLKKQG
                     NVAQKRTAHDIAANKAVLASRKAIYKQQRIAAQLYVSVERETTRAQVGLTRTKLAVAK
                     RKGLLVRTTSRLTGKSLRSKSRKKAHDENETVKDDQQEKEVEDQTAVDEKSNVTETKT
                     "
     gene            complement(<244712..>245581)
                     /locus_tag="OSTLU_29443"
                     /db_xref="GeneID:5006591"
     mRNA            complement(<244712..>245581)
                     /locus_tag="OSTLU_29443"
                     /product="predicted protein"
                     /transcript_id="XM_001422654.1"
                     /db_xref="GeneID:5006591"
     CDS             complement(244712..245581)
                     /locus_tag="OSTLU_29443"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422691.1"
                     /db_xref="GeneID:5006591"
                     /db_xref="JGIDB:Ost9901_3_29443"
                     /translation="MSARGAAVPHLHYFSAWFCPFAHRATLALEHHHGHLTYDWEEAL
                     GWEKRRATDASVETAHENWYHYKSPTLLKHNPLGMVPTLVSPETYNAKRGDATKNVVT
                     ESLVCVQFIDEIVRGGTTPIMSSCPYERARARVDADWVNKQICSKYYHVLVRQNPAEQ
                     REAFEAIIEGLERFASWCDENKKSPFYSGEAPGLVDYALFPWAWRLPVFEHYRGADYA
                     IPKTAALASYHAWLDAMLAREQVRKTLPDWAAYLEHIGRYADGSARSKVANAVRSGRA
                     AHEYDDELDDTKK"
     gene            complement(<245734..>246885)
                     /locus_tag="OSTLU_89717"
                     /db_xref="GeneID:5006749"
     mRNA            complement(<245734..>246885)
                     /locus_tag="OSTLU_89717"
                     /product="predicted protein"
                     /transcript_id="XM_001422655.1"
                     /db_xref="GeneID:5006749"
     CDS             complement(245734..>246885)
                     /locus_tag="OSTLU_89717"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422692.1"
                     /db_xref="GeneID:5006749"
                     /db_xref="InterPro:IPR001356"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="JGIDB:Ost9901_3_89717"
                     /translation="VRSRIQSQFAMIRRHQSLLDAYAGDGWRGAASQKPKPLGELALA
                     REKIFKGKVKIRELFKGLEFDPNEREITTVEDELGETDAADIFCSKCAMADDREEDDI
                     LLCDGFCDRAYHQSCVVPAVKTEDIPPDDEGWLCPLCDARVDVIYVLNDEYEQDLGQK
                     CVAEDVFKAEAEMQEKGIVPGTAQFAHAHEEAWPSDESEDEDFDHGRASDDGRDDENE
                     ALSGSARSSSEESSSESESDLIIEGPRRRTKVDYVKLNSDMFGDDEAYEGEAEELGWK
                     RSNKTKAEMLAALQNKNVGSNAATSSPKTGDKKRRKDNCNDNGTAEKRHRARARFSSE
                     QKATLERLFQTGTRVPKSSALAEIAADVGASSPSSIRIWFMNRRRKDRT"
     gene            <247408..>250350
                     /gene="SDG3503"
                     /locus_tag="OSTLU_19017"
                     /db_xref="GeneID:5006750"
     mRNA            <247408..>250350
                     /gene="SDG3503"
                     /locus_tag="OSTLU_19017"
                     /product="predicted protein"
                     /transcript_id="XM_001422496.1"
                     /db_xref="GeneID:5006750"
     CDS             247408..250350
                     /gene="SDG3503"
                     /locus_tag="OSTLU_19017"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422533.1"
                     /db_xref="GeneID:5006750"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="JGIDB:Ost9901_3_19017"
                     /translation="MTTRAARAPRAASPRGADATRRRDGAIDADDADATATARARASA
                     NDARARSAAVLDVVDLTLDVEAPRAATATATATADARGDATRGDDAEAVKILDDGLPT
                     SKPKARDGKPTARSGENGKSRASGSGRIERVAEVLQSPEKAWPREEAAAEDDDDAKVS
                     VSFELEFCAAMREGLEGRRTEAMEAMETLEATVGSRVFQNADAAAAEARTRTRSAAKR
                     ARRIFREETKLWAAAVVKAQQLTIDDDVPSTSEPVAMELPFWQRISSEHLGASSARNT
                     KIFTQRTERPYSSDPTDVSGWKLQTIVGRQSVPRIDIGSAKAVPPYAYFAYSTHCNSY
                     EAEGNVSRLLFRDDDGEFLESDPVDRREDESNELTREQEIIMCAICAEFSEFILTEKE
                     VVRGVNREDGVKAVVVQTAEYLNLDENQVKDWFDETRTKHSTSRAWCMFLEVASHVRK
                     LMGFSSAHWRAKMANTFSVLETLGISELFWRKFSRIIINCPTLAPLKKPVIVFDNLNE
                     AMDQLAGMFCPRCFIFDCRTHGSLQPKSEGRKLDAERKLAWRERMAKSGMSAEKPLAE
                     RRCSTDCWYQTEEYKYYSAQTTCAPCDPTETLNRPSTKDPFIETTRKWRNAMDIEVLK
                     KAVKIIGEKTTACEAALFFGRRRTCAEVGKQMHCLDLINLGTVVKEEERDAMDEDTDE
                     LSNPKKRKRAPTGVKNPTIARRLKMQKDADFLETQYSPCECVGACDANTCSCIKNGTF
                     CERFCNCGPKCHNEFEGCKCDSTKRATCGTRTCPCYAAGRECTPDKCKRCCKTADAYS
                     LPARKRYGLVDPNMQLPMPAFPCENMKLQLRQKEHICLGRSGVAGWGAFVLKGARKGE
                     FIGEYVGELVTQDEAERRGTVYDVNNCSYLFNLNSEWCVDAQYRGNKLRFANHSKNPN
                     CVPRVLAVNGDHRLALISDKDIKPGDELLFDYNYKDEVAPDWHEKNASTLPKSKHLPT
                     KSAKKSSN"
     gene            complement(<250679..>251614)
                     /locus_tag="OSTLU_2686"
                     /db_xref="GeneID:5006592"
     mRNA            complement(<250679..>251614)
                     /locus_tag="OSTLU_2686"
                     /product="predicted protein"
                     /transcript_id="XM_001422656.1"
                     /db_xref="GeneID:5006592"
     CDS             complement(<250679..>251614)
                     /locus_tag="OSTLU_2686"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422693.1"
                     /db_xref="GeneID:5006592"
                     /db_xref="JGIDB:Ost9901_3_2686"
                     /translation="GQPVVVQVTRLGSGYKGPRVTARPTLPGRNVVLCPDGEGVYVSR
                     KLMGRARKYVKDVGATVCPKGSALIMRTEAAGVNQDTLKLDIGCLAEDWDTIVEESER
                     AIRHAELTLRPPPPRRLLQAASREQVLVRDLFGERVAKLTVDTEESYKTIVDDLLRTG
                     ASQEIINRVVLHQGAEPVFKALEVDKVIETMMGTERIFLGPELSGAHIVIQHTEALTA
                     IDVNAGRTAMGAGEDGEEVALRVNIAAAELVARTLRLRDIGGLVMLDLIDMHTDDARK
                     AVETAFEAIASRDRAQVVFVPISALGVMEVARERLQ"
     gene            <253992..>254762
                     /locus_tag="OSTLU_29447"
                     /db_xref="GeneID:5006751"
     mRNA            <253992..>254762
                     /locus_tag="OSTLU_29447"
                     /product="predicted protein"
                     /transcript_id="XM_001422497.1"
                     /db_xref="GeneID:5006751"
     CDS             253992..254762
                     /locus_tag="OSTLU_29447"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422534.1"
                     /db_xref="GeneID:5006751"
                     /db_xref="JGIDB:Ost9901_3_29447"
                     /translation="MCPGLEFTSDVIEAERNGEACAGGMFVPNGVVVDAPRYLTALWD
                     ACGILASRGAAGTRATLRIAEVDDVKALLDEFDQVALCCGAGVAALFDFETIPVSLQG
                     GHVLELKPEGLSVGILGTTYVAPLGDDRAMIGPTKEYDATPEDCARSGVVDDVDDERS
                     ARAISELRELGARAYPPCANWEFLRLKYGVRANPPRTHAGALPLAGSVHVDGRRCWFA
                     AGLGARGLIYHGLLADWLSSAILDDDINAIPVDVRRTC"
     gene            <254836..>255507
                     /locus_tag="OSTLU_29448"
                     /db_xref="GeneID:5006593"
     mRNA            <254836..>255507
                     /locus_tag="OSTLU_29448"
                     /product="predicted protein"
                     /transcript_id="XM_001422498.1"
                     /db_xref="GeneID:5006593"
     CDS             254836..255507
                     /locus_tag="OSTLU_29448"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422535.1"
                     /db_xref="GeneID:5006593"
                     /db_xref="InterPro:IPR005175"
                     /db_xref="JGIDB:Ost9901_3_29448"
                     /translation="MRVHAVRLDPGQDLKRSLLEYCSAQNLASAWILTAVGSLRAANI
                     RLAHHDKFLGAGANAVLALPDQKFEICSLVGTISRAGASCHLHVSLADRRGDCVGGHV
                     LEGNVVFTTCEIVLGSSSTMAFDRELDERTGFDELVVREAGAGAETGAGETRGKTARR
                     ARQLRAEARERELRAAAGERERARGLFEWLVKVIVPKPGARRAESDEEEEGEEEEGAA
                     ADAPR"
     gene            complement(<255611..>257041)
                     /locus_tag="OSTLU_13471"
                     /db_xref="GeneID:5006594"
     mRNA            complement(<255611..>257041)
                     /locus_tag="OSTLU_13471"
                     /product="predicted protein"
                     /transcript_id="XM_001422657.1"
                     /db_xref="GeneID:5006594"
     CDS             complement(255611..257041)
                     /locus_tag="OSTLU_13471"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422694.1"
                     /db_xref="GeneID:5006594"
                     /db_xref="InterPro:IPR000642"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="JGIDB:Ost9901_3_13471"
                     /translation="MEFVDFLKSPKKYEALGAKIPHGALLVGPPGTGKTLLAKATAGE
                     AGVPFLSISGSDFMEMFVGVGPSRVRDLFAQARQQKPSIIFIDEIDAIGRQRGRGGFA
                     GGNDERENTLNQLLVEMDGFGTKEGVIVLAGTNRPDILDRALLRPGRFDRQITVDRPD
                     IQGREQIFRVHLAKIALDGPVDHYSERLAALTPGFAGADIANMCNEAALAAARDNMTT
                     VTLTHFEYAADRVIAGLEKKSKVVNKTERRTVAYHEAGHAVVGWFLEHAEPLLKVSIV
                     PRGSAALGFAQYLPNENLLATTQQLIDMMCMTLGGRAAEQVMLGKISTGAQNDLEKVT
                     QMAYNTVAVYGMNEKIGLLSFPKDEQSLKSPYSEDTARMIDEEVRLLVDTAYKRTLAL
                     VKEKKHLVEAMAQGLLDKEVLQRHDLVKLLGDRPFVSENPQNIDILNEGFKMHYPKTA
                     TAPEDEPADTDEPEDDEPSPAFPLAT"
     gene            complement(<258185..>260452)
                     /locus_tag="OSTLU_29450"
                     /db_xref="GeneID:5006752"
     mRNA            complement(<258185..>260452)
                     /locus_tag="OSTLU_29450"
                     /product="predicted protein"
                     /transcript_id="XM_001422658.1"
                     /db_xref="GeneID:5006752"
     CDS             complement(258185..260452)
                     /locus_tag="OSTLU_29450"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422695.1"
                     /db_xref="GeneID:5006752"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR001679"
                     /db_xref="InterPro:IPR004150"
                     /db_xref="JGIDB:Ost9901_3_29450"
                     /translation="MHDGKYYNDAEPVISDSEYDGMRARYDAIAAAHPTAAKAGGARA
                     RVGATPDGASGLEKIAHAVPMRSLGNAFDVGQVEAFMKRVEKLRGETEGEAATTTAIE
                     YCAEPKVDGASASLRYENGELVYAVSRGDGEMGEDVTRHLIGARGVPMKLAEPYPAVL
                     EIRGEVHVADEDFQRVNAERAATGLRVFKNARNAAAGAMRTLVVDDNQMPLRFLAYGW
                     GAVGASNEETNAPWRTQSEFLSAFLPAQGFDAVPFLGVAKTIGELIEAYDALEIARPT
                     MPYEIDGVVYKVNSVELQTALGADARQPRWAIAHKFTAMSAVTTLRAIEIQVGRTGAL
                     TPVALLDPVDIGGASISRATLHNFDEIARKHLKVGAQVTVERAGDVIPRVVSLAGDDL
                     AEASAYAEDIKPLPEWLPPSKCPDCGSSVVRAPLSASKTAMGSIVRCTGGLKCPSQSM
                     ERLLHFCARDALDIRGLARGTLETLHREGVVKTPADIFTLERRFGPDSGDAVPTWWRY
                     AGVKNSKGEIKHGSDGLKQSAVKLFQAIEVRRQGVPLHRFIYALGIPNIGAHTAKVLA
                     THYGSLAAFKKAALAAAKGGPASLAHAALTHVDGVGPVLAQSLVDFWGEPGNAFIVDE
                     IIATGVVVLDADASSSKNQPSPRFAEPASSSSVSPTPSPTVPSPEPTADLRGMKILFT
                     GTIDGFSRDDVHDLIRAAGGDVASTLSRKTALVVAGVGAGPSKLAKARDLAVPIVDAS
                     RFVSALTSGDGSLPL"
     gene            <261059..>261559
                     /locus_tag="OSTLU_29451"
                     /db_xref="GeneID:5006753"
     mRNA            <261059..>261559
                     /locus_tag="OSTLU_29451"
                     /product="predicted protein"
                     /transcript_id="XM_001422499.1"
                     /db_xref="GeneID:5006753"
     CDS             261059..261559
                     /locus_tag="OSTLU_29451"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422536.1"
                     /db_xref="GeneID:5006753"
                     /db_xref="JGIDB:Ost9901_3_29451"
                     /translation="MSRADDEWATSERTWASLFGVLERNGYAKKKLWAPFVYDGDAGR
                     RMRSAGFERVVHRRADFFERVRDGVFVRSLDAVVDNPPYTGKGMKERILKALRDAEVP
                     FCLLLPLGVLHAAFVRDILEETHVQVIVPRKCYVFKKGGTEVPFKFLCWLCYKMELKR
                     DLYFID"
     gene            complement(<261612..>264974)
                     /locus_tag="OSTLU_19022"
                     /db_xref="GeneID:5006595"
     mRNA            complement(<261612..>264974)
                     /locus_tag="OSTLU_19022"
                     /product="predicted protein"
                     /transcript_id="XM_001422659.1"
                     /db_xref="GeneID:5006595"
     CDS             complement(261612..264974)
                     /locus_tag="OSTLU_19022"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422696.1"
                     /db_xref="GeneID:5006595"
                     /db_xref="JGIDB:Ost9901_3_19022"
                     /translation="MTVRRASMTPPQALRMSLMSPKPPTTVRVASSSTMDVDARALVV
                     AGGMNAKAVEFEVEQLRAKVTAIQRDLEAMAIEKQTWLNERVRMGAMISATEEDLKTT
                     EARMSKTESRLMAMTKQRDEALDETERLQEALANARREHESALKAAGEEYASESTKLE
                     FSVRDYSIKIERLEMSLQETETKIHADESTIQNLEASLAASATDLRDANAKLENYQVA
                     QATMEGEAENFKLEIARLSEALATSEEKIVAAVAEFQAQQTKQNEKSSQFEILESENA
                     RLKEDIVRLNETVTMTNSTMLQKDAAIDAAQAETERARVERGEVADEVIKLRAEIIAR
                     ESVIENEKRIKEETIVALEDTRAALQTKTSECRNFETELESLKVEMSTLRIKLEKESK
                     KAMTTEEKSESAKEAFAARLAAAAEKQAGFQGRMLEMKSSLEAEKKKLEAQARAEIES
                     GTAELKSLRQKLAEKEAAYEAVSQNAILFEEKLEVTLEQLSEAKSALSDLKSKLAEKE
                     FSNVEFSHLNEELQAANAKLKLMEVERSEHVLELKSAREEVLSLEGKVAGLETAADLA
                     GSETEELRKKLHVAEQEISSMADEHELESSMAAKANMIANSQVTKLEKQVGFLNKEIE
                     ILREKHASSAKVERDRDSSSAVVAELHRKLEAAESRIVELAKELGEWKASAEESKKSL
                     DESERRLKAECEVRVTVETELEEVRRQFAAAESRVYEVNTELLLLNKELEKEKVASKT
                     HSKTDAGELREAKASRDAALAKVKDLTIDLTKVTAERDLLQQSITSMEKRLELERLAF
                     AAQVKNAVKDAVQSKDKEMLVIRKELDTIRQMSASGDHASEALSKALDDKQHELSQAR
                     ESISELRANYTSLQHQLEHANELLATARRDASMTQEGDYDELRKVRAERDEAKSTMRD
                     LESQLSDAVAAKVWLEKHSAATEAELKASKEALAAANKMSEHARTQLARYQNNSPSLI
                     SPKKSRSFGSPLMQTQLASPLKWFSRQTNRTVARTPPNNLFNKFTLATPTAPTRTPGG
                     SWRVPSRPETLNEAVQMLVTFFIIVSVVLLFLTLTAMFAPNETLRRISVLPPSDSTSC
                     GVLYRFNDLLLEIGHGLIRREYRSLCAGHPPS"
     gene            complement(<265699..>266556)
                     /locus_tag="OSTLU_19023"
                     /db_xref="GeneID:5006754"
     mRNA            complement(<265699..>266556)
                     /locus_tag="OSTLU_19023"
                     /product="predicted protein"
                     /transcript_id="XM_001422660.1"
                     /db_xref="GeneID:5006754"
     CDS             complement(265699..266556)
                     /locus_tag="OSTLU_19023"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422697.1"
                     /db_xref="GeneID:5006754"
                     /db_xref="JGIDB:Ost9901_3_19023"
                     /translation="MSRYGVDEAIGGLLDDALIGVDRRARAVEAASVAPTPRYGGSLS
                     EDDDDVPLAARVGGGKRAREREETNGVGRGRTAWGSFVAGQLPGRAVSETFDVDEEGR
                     RVSTEAPAGWDELCRKEFDGKKSARRAVMDWYCSTSACSARLIVDKWQESKVRYVLRC
                     CRSLPKRQDKNNAKLVQQIQKRCSMAVCLRYNRDQNCWLVAESESSPRHSALCEDHVR
                     PNVSSALFAQHLDGIEKVPIEFRAEFVARRLKESGLKVTSGTKQRAVSLALERAERAS
                     ADAPRASLA"
     gene            <267003..>268064
                     /locus_tag="OSTLU_19024"
                     /db_xref="GeneID:5006755"
     mRNA            <267003..>268064
                     /locus_tag="OSTLU_19024"
                     /product="predicted protein"
                     /transcript_id="XM_001422500.1"
                     /db_xref="GeneID:5006755"
     CDS             267003..268064
                     /locus_tag="OSTLU_19024"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422537.1"
                     /db_xref="GeneID:5006755"
                     /db_xref="JGIDB:Ost9901_3_19024"
                     /translation="MRTGTKTTRAARDVAVVGPRDDAARTLNRTYLSSKAARAGAGEE
                     EAWTRCVVDRVEARSRSLVLRVIDGSDRVFPIFAETESDERALVRIVHVLRRKRKGSG
                     GLASRDWTLAPQILTCSISVDADGLRAKLSKKLPVLASALMTDSDVDTYDESNVPVFQ
                     ALREAIDPRQSPALYLSSSAVDRLCFDGSWRLTYTPGMACLRRAAFTFGGALLASHVY
                     RAEREIVLKRKARKDEEVWILTHTLISRETRVLDHVLTLRVMLACSVREERALRMNKR
                     DTVDDFVNRLRSQNAGSQAIARMIDGALPGSIRDRSPGFWMLAYENFVLDEDYERAAT
                     ARDVLNELNVFVDEEGAFD"
     gene            complement(<268087..>268743)
                     /locus_tag="OSTLU_89724"
                     /db_xref="GeneID:5006596"
     mRNA            complement(<268087..>268743)
                     /locus_tag="OSTLU_89724"
                     /product="predicted protein"
                     /transcript_id="XM_001422661.1"
                     /db_xref="GeneID:5006596"
     CDS             complement(268087..268743)
                     /locus_tag="OSTLU_89724"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422698.1"
                     /db_xref="GeneID:5006596"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="JGIDB:Ost9901_3_89724"
                     /translation="MKKRQDAISAAYEAQWNGGKGSHHPDYRPNASGPDVVKASRETE
                     ELLMAIQKNDLKLIYNKIEEGADVNFVFGSAYGCDEGYTPLMSACHRGRLEAAKALLR
                     SGADPNFINSNGDATIFWAIDGGPELVKLLYDYGADLNVRTAKDATPLSYARAMGKYG
                     LVDEKGIYPEDVLKFYGANEIGSEPPCHGTRSPRESFDISASNFSRDRGSYQNEPEHP
                     "
     gene            complement(<269081..>271666)
                     /locus_tag="OSTLU_25858"
                     /db_xref="GeneID:5006756"
     mRNA            complement(<269081..>271666)
                     /locus_tag="OSTLU_25858"
                     /product="predicted protein"
                     /transcript_id="XM_001422662.1"
                     /db_xref="GeneID:5006756"
     CDS             complement(269081..271666)
                     /locus_tag="OSTLU_25858"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422699.1"
                     /db_xref="GeneID:5006756"
                     /db_xref="JGIDB:Ost9901_3_25858"
                     /translation="MREHAREVMKEMDGVRERARGAREALESEKHLALLDRANRERAV
                     SARARYEKLTTTQNERFDEYSRRAEAYERALSRLRLRTENADVVRDIVHDRLADEERD
                     LDALREYEAEDDRVLKTLEAALSKVSHEVHKSQSDAEDAASTRAALAGELQRVQKSLK
                     DAHARQIELNEELAKANVTLSDRQGLIKRTMRVKDQTSTALEDKQANLRELKETAKRI
                     ELLNKASQSKVTVKEQLLRRKTEKCQALKSDLTSSTQALETATHMRRAAARGAECAKA
                     RRCEAEETLKAHCYARDEKSRQVNKAQKTLDDECAALMTSERCLRELQEAHDQEESTL
                     RDVQTALERDKDDLLDVSKTLHDQKNSQCRLEVELNGAMMQSKNLREKEHALQAKILK
                     QRELIYTTSLQLQHLERKTSRLEGVRSNEESEKLEALIESLRLELEEREREHVALVAE
                     TKENEYKVERTRLEMDARCEQTLNAAHARSTLEVEAEGSERHERSVLDGMEYLQVELD
                     ELRLQLARRHRVLFLSSGQAQELTDRKKQIIGELETQYESLSDEHRSLLAHLTTLQQD
                     AHAAIMDLNHREQRLDHLRSRYDVVRAKSPYGEGVAIDEQKDIYAIIERQRDELVVER
                     KELSGLIHSAECEVESMRQILEDAELSNSSLRAKLVHPTKDVKGASREEWMKTEAALE
                     KLQTENDALVRMRERAAELSNALTKLKTTLANAVDEHNALSNDVDAAQHTHDSAMRKY
                     KSQKSKLRRSRTAAESAVAAYRAAIGLTSEDPVTVAEQRVRAQRLKESIHKANEIVRG
                     SVTSQALKTVPDSDASSIALSPTSSLTSFFTFASSTTCSSVASVSSVSSSPTSAGSSV
                     VVADA"
     gene            complement(<272053..>272433)
                     /locus_tag="OSTLU_29456"
                     /db_xref="GeneID:5006757"
     mRNA            complement(<272053..>272433)
                     /locus_tag="OSTLU_29456"
                     /product="predicted protein"
                     /transcript_id="XM_001422663.1"
                     /db_xref="GeneID:5006757"
     CDS             complement(272053..272433)
                     /locus_tag="OSTLU_29456"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422700.1"
                     /db_xref="GeneID:5006757"
                     /db_xref="JGIDB:Ost9901_3_29456"
                     /translation="MRASAGADDAGGRAADATSREGRATREIAFRNYVPRDGALAAAK
                     LPATTAPALDVAAARDGDEGAVTLGLEPNVGDVDPGMVAPRRANWDLKRDVEARLEKL
                     ERRTRRALVDVAREEARARAAMDA"
     gene            <273970..>274329
                     /locus_tag="OSTLU_43531"
                     /db_xref="GeneID:5006758"
     mRNA            <273970..>274329
                     /locus_tag="OSTLU_43531"
                     /product="predicted protein"
                     /transcript_id="XM_001422501.1"
                     /db_xref="GeneID:5006758"
     CDS             273970..274329
                     /locus_tag="OSTLU_43531"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422538.1"
                     /db_xref="GeneID:5006758"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="JGIDB:Ost9901_3_43531"
                     /translation="MLVPSSPFKISEVRNLFSFARHGRYGELKKLIMKGVPLDARDEM
                     GNSALIIACQNGQGRCVKLLIRSGADPNVQNKHGNTSLHFSLHFRFDAISDFLQRHGG
                     LTNIQNHDGQTCYEFVG"
     gene            <274706..>275944
                     /locus_tag="OSTLU_5299"
                     /db_xref="GeneID:5006597"
     mRNA            join(<274706..274894,275309..>275944)
                     /locus_tag="OSTLU_5299"
                     /product="predicted protein"
                     /transcript_id="XM_001422502.1"
                     /db_xref="GeneID:5006597"
     CDS             join(<274706..274894,275309..>275944)
                     /locus_tag="OSTLU_5299"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422539.1"
                     /db_xref="GeneID:5006597"
                     /db_xref="InterPro:IPR004254"
                     /db_xref="JGIDB:Ost9901_3_5299"
                     /translation="DAPEWMVWNPYVRSGYRVGARWLGATRSIFMLHNETVNIWSHLL
                     GVLMFAALIVQTFRTAHSGFVPDDPEPARPVTRWPMYIFLTGAVVCLFFSTMCHTYCC
                     VGEIDAERMWRFDYLGIAVLIVASFYPMLHYSYYCLPGWRDMYLTGITVFGCLTVVPT
                     FMRAFQKKEYAPLRASLFVALGCLGLFPIFQQVFFVWHIVPTPMMEAFYFEMAMGFGY
                     VFGAFLYAKMIPERWSPGSFDFFGCSHNIFHFLIVLSTYFHYRASIIYLTWRDNYTC"
     gene            <276140..>276388
                     /locus_tag="OSTLU_29459"
                     /db_xref="GeneID:5006598"
     mRNA            <276140..>276388
                     /locus_tag="OSTLU_29459"
                     /product="predicted protein"
                     /transcript_id="XM_001422503.1"
                     /db_xref="GeneID:5006598"
     CDS             276140..276388
                     /locus_tag="OSTLU_29459"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422540.1"
                     /db_xref="GeneID:5006598"
                     /db_xref="JGIDB:Ost9901_3_29459"
                     /translation="MTIRSAISGAFLFLARLALACSYWFSAKKPRTLLESFQRATFEV
                     STYRGDPEYMTYRHEAEYMRREAERLSYKLACVRRRCE"
     gene            complement(276424..279394)
                     /locus_tag="OSTLU_52010"
                     /db_xref="GeneID:5006599"
     mRNA            complement(join(276424..278932,279113..279193,
                     279340..279394))
                     /locus_tag="OSTLU_52010"
                     /product="predicted protein"
                     /transcript_id="XM_001422664.1"
                     /db_xref="GeneID:5006599"
     CDS             complement(join(276476..278932,279113..279193,
                     279340..279348))
                     /locus_tag="OSTLU_52010"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422701.1"
                     /db_xref="GeneID:5006599"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005517"
                     /db_xref="JGIDB:Ost9901_3_52010"
                     /translation="MVKFTIDELRKQMDHNKNIRNMSVIAHVDHGKSTLTDSLVAAAG
                     IIAQENAGDARLTDTRQDEQDRCITIKSTGISLFYTVSDEDLARLPKDVPRDGNNYLI
                     NLIDSPGHVDFSSEVTAALRITDGALVVVDCVEGVCVQTETVLRQALGERIKPVMTVN
                     KLDRCFLELMLDGEEAYQNFCRVIENANVIMATYTDEALGDVQVAPEKGTVCFSAGLH
                     NWAFTLTVFAKMYAAKFGIDQDAMMGKLWGDNFFDPKERKWTKKNTGSKTCMRAFVQF
                     CYEPIRRVIDAAMNDNKDKLWPMLEKLQVKDRLKPADLDLMGKPLMKRIMQTWLPADV
                     ALLEMIIYHLPSPATAQKYRADTLYEGPLDDAYANAIRECDANGPLMLYVSKMIPTAD
                     KGRFLAFGRVFSGTVQTGQKVRIMGPNYVPGEKKDLYIKSIQRTVLCMGRRQDAIDNV
                     PCGNTVAMVGLDQFIQKNATITGEKDVDAHTIKAMKFSVSPVVRVAVECKNSQDLPKL
                     VEGLKRLSKSDPMVQCQIEETGEHIVAGAGELHLEICLKDLQEDFMGGAEIRISDPVV
                     SFRETVNGTSDHICMSKSPNKHNRLYFQAVAMDEGLAEAIDNGEVTPRDDPKTRGRFL
                     ADKYGWDKDLGAKKIWCFGPDTTGPNLIVDMCKGVQYLNEIKDSCVAAFQWATKEGVL
                     AEENMRGIKFEIHDVVLHTDAIHRGGGQIIPTCRRVLYASALTAEPRLLEPVYLVEIQ
                     APEQALGGIYSTVTQKRGMVIEETQRPGTPIYNIKAYLPVMESFGFTGTLRAATSGQA
                     FPQCVFDHWDMLNSDPLNPDSQSGKLVKDIRKRKGSKENVPPLNEYEDKL"
     gene            complement(<279468..>282173)
                     /locus_tag="OSTLU_94078"
                     /db_xref="GeneID:5006759"
     mRNA            complement(<279468..>282173)
                     /locus_tag="OSTLU_94078"
                     /product="predicted protein"
                     /transcript_id="XM_001422665.1"
                     /db_xref="GeneID:5006759"
     CDS             complement(279468..282173)
                     /locus_tag="OSTLU_94078"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422702.1"
                     /db_xref="GeneID:5006759"
                     /db_xref="JGIDB:Ost9901_3_94078"
                     /translation="MRGAEGGTPTCAYAARRETCGLGARRAAFDVVGDARCDAIEGDA
                     MCAMRSNGVVFEPTSTRRAMMTSRGEENGAMALIGEGDGTFTIEMRIVPDFTATTPEE
                     RQPLLVFSLNDDETSWAHTGCFEGYYMSIWIQDGFLSTKMRVTHSTHPFECSWDDHMR
                     RGHMGIPRLSHGDLNHVALVYDAQGIRLFLNGTKAFPPVDWFFESPGGDAVSTWNASR
                     SRIAVGAYGDDAFAGIIYGINIYDYALSDDELAISANASLENSKPFAISQNVTCEEDD
                     SVDAELVAYDADGDDVWYRITSLPKRGHLYDVHANGDAIEILSAPHSLASASVRFAPA
                     PNDFSIEGNATALFDYDSFEFDVSDGTEAFGSAFVHIRVTNVNDAPVSTGSNVIAYRG
                     VPAIVRLVVEDIDATCPQRAILCRGDRVTSVHITREPALGSLYACDDVEGANALRTGA
                     NVTSPNATCLTYVSFALGESDSVAYVVVDENGALSDQSEVMFFLKTPCALLDRTQTVS
                     EDEGGIIRVTAACVGESLSSLAFFATVTTAPRYGEIVGDTDAQLSAMACSSTQNATCQ
                     AWAANTSSFTAIGHACACGSFTYVPERDYFNIPSVDVYGVEMSLMGTRAENWNVGRPD
                     TLRMSLKTSNGWTTDPYAAYVFVRNRPDAPTIRIDQNRLNQIERITPNTTSFVLSGII
                     DIDTDPDYDAYAMSVKMWSPSSTVLEVRDARAARLAPIISSNRRNRIDLIGPPSEIAA
                     LFRQATIAYVPRDTNTAAFEDTVKLRVAVGVLPTSSCENLPADVKCFFQTTVYAQPCA
                     STSPLSTPCLIERTIYVPVGDSPSHIARVLEARVERRSVASRRRAVFLIWFVLSFLTS
                     ALASRLKRAFCTIARPRASSTARDVRPRSPASPSRLASRASPDIE"
     gene            <282733..>283254
                     /locus_tag="OSTLU_29462"
                     /db_xref="GeneID:5006760"
     mRNA            <282733..>283254
                     /locus_tag="OSTLU_29462"
                     /product="predicted protein"
                     /transcript_id="XM_001422504.1"
                     /db_xref="GeneID:5006760"
     CDS             282733..283254
                     /locus_tag="OSTLU_29462"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422541.1"
                     /db_xref="GeneID:5006760"
                     /db_xref="InterPro:IPR000433"
                     /db_xref="JGIDB:Ost9901_3_29462"
                     /translation="MYEPSVLCPSLQYSCDACGDLPILRRRWVCERCEDYDLCEQCHA
                     RQHKRQRERARGRPESGSSTTTTTTSEEDENGDFAHDATHEMRAFAVEDDMEPVTKGK
                     LRDCVLDAASRWYVETLRNAKQGDANAAALAAQMLLVGYGCNADADEASYWQNVARSS
                     GARRVEGVYDELP"
     gene            <284123..>284563
                     /locus_tag="OSTLU_29463"
                     /db_xref="GeneID:5006600"
     mRNA            <284123..>284563
                     /locus_tag="OSTLU_29463"
                     /product="predicted protein"
                     /transcript_id="XM_001422505.1"
                     /db_xref="GeneID:5006600"
     CDS             284123..284563
                     /locus_tag="OSTLU_29463"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422542.1"
                     /db_xref="GeneID:5006600"
                     /db_xref="JGIDB:Ost9901_3_29463"
                     /translation="MASSGEDAADAKSVADALTANERAAVEALESFGVIGGVENGRSG
                     TMAFALMDDARVKKGPDGRKYYVFSYETEVCRAKIEEGMGGSKICVGPQGDVLDSIQR
                     RSRVVVTFVGNRVVKLHASAVSSRFDEVEEIMNRAVDSFALNVV"
     gene            complement(<284620..>285237)
                     /locus_tag="OSTLU_19031"
                     /db_xref="GeneID:5006601"
     mRNA            complement(<284620..>285237)
                     /locus_tag="OSTLU_19031"
                     /product="predicted protein"
                     /transcript_id="XM_001422666.1"
                     /db_xref="GeneID:5006601"
     CDS             complement(284620..285237)
                     /locus_tag="OSTLU_19031"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422703.1"
                     /db_xref="GeneID:5006601"
                     /db_xref="InterPro:IPR003958"
                     /db_xref="JGIDB:Ost9901_3_19031"
                     /translation="MKEDTEKAYEAAVAAAVARGEVPEEKTADVDGKPAENDTVLPVA
                     RVKRIIKLDKDVKQASADAIKCVTKATELFLEGLAVGSHAGMRAAKRKGVQYKDLESF
                     VLRRGKYEFLHDHVWAMRPREGEKGDDDDDDDDDDDDDDAPSAKKAKKLADANGSRRV
                     TEFFKPGESPTKKPANDEDEIVIDAAPTQTQTAAAVIPETEIQTQ"
     gene            complement(285447..>286579)
                     /locus_tag="OSTLU_25861"
                     /db_xref="GeneID:5006761"
     mRNA            complement(285447..>286579)
                     /locus_tag="OSTLU_25861"
                     /product="predicted protein"
                     /transcript_id="XM_001422667.1"
                     /db_xref="GeneID:5006761"
     CDS             complement(285686..286579)
                     /locus_tag="OSTLU_25861"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422704.1"
                     /db_xref="GeneID:5006761"
                     /db_xref="JGIDB:Ost9901_3_25861"
                     /translation="MARPRADDARASSAVATRSCVFTVALHPSALADPLAGARAVLDA
                     MKMRHVDALGGVLMAYDDEALCGARRRERDDDGDDDGDDETSTSESDDAEADDDDGRG
                     GFGRVLHASGHVDVRVRARCEVFTPVKESRLVGTVNKIAHDFIGALVLDRFNVAIAAE
                     NIREELVSSSDDGCWRSAWDATHVIKVGSQIVFTVKAVTESDDVVLLRGAMKDPATGE
                     REYVARSSSGITSIERKLVAPADSDSRREKKSKKEKEKKEKKEKKEKKEKKEKKEKRK
                     SENDLEKSDGRSSKRAKDSPS"
     gene            complement(287215..>288972)
                     /locus_tag="OSTLU_52000"
                     /db_xref="GeneID:5006762"
     mRNA            complement(join(287215..287656,287819..288126,
                     288280..>288972))
                     /locus_tag="OSTLU_52000"
                     /product="MFS family transporter: hexose"
                     /transcript_id="XM_001422668.1"
                     /db_xref="GeneID:5006762"
     CDS             complement(join(287269..287656,287819..288126,
                     288280..288972))
                     /locus_tag="OSTLU_52000"
                     /codon_start=1
                     /product="MFS family transporter: hexose"
                     /protein_id="XP_001422705.1"
                     /db_xref="GeneID:5006762"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="JGIDB:Ost9901_3_52000"
                     /translation="MTTESRRGADVGPGLAPSAVAASLGAFLFGYHTAACNAPLSALA
                     RDLGFADDDYVKGAVVSALVIGGAIGGLTVGGLSDKYGRKWALTATSAPLALGTMLSG
                     MAPNAVTMIAGRFICGLGVGASSQIVPLYLSEIAPPALRGTLNGFRRLAYVFGCLAAF
                     QLAAPLKETGGEGWWRPIFYDAAIPALMLAVGAAFVAQETPVWLLTQSDEKAAEKSRR
                     SLAILQNIRGRAAEQKLSTWSELISDDKNRLPLSLGLSLCALAAFSGSNTVIFYASTV
                     FTSVGINNPEILTWAVGVPNVVGGFVALALSDKMGRRPLLLTSFGGMSACLGILSLAA
                     AGPAQPEAAVALVTIPLYVLFFSLGAGPIPWLLYNEVFPTRIRARAVSACTALNYVSN
                     SIVGATFLPMVGAYGLSGSYGFYTLLCASGYVFVDRFIPETKGLRLEDVESTLKRHAR
                     KRSTSRSKSIDE"
     gene            289230..>290841
                     /locus_tag="OSTLU_29467"
                     /db_xref="GeneID:5006763"
     mRNA            289230..>290841
                     /locus_tag="OSTLU_29467"
                     /product="predicted protein"
                     /transcript_id="XM_001422506.1"
                     /db_xref="GeneID:5006763"
     CDS             289297..290841
                     /locus_tag="OSTLU_29467"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422543.1"
                     /db_xref="GeneID:5006763"
                     /db_xref="InterPro:IPR001333"
                     /db_xref="JGIDB:Ost9901_3_29467"
                     /translation="MATREASYDALKRELATLNDLRSLEGLAGWDELVMMPSGDGAAN
                     ARARAMATLAGVIHDKATSKALGALIEACDGTPRGKDGTLRGKDGANVRRAKESYAKA
                     TAIPSEMAKKRAELGSRGYQTWVKARESGEYGAFAPVLEEWVALTKARCELIAPGADA
                     YDVALDDYERGMTSARLREIFTVVREGVVPLIEKVYAKDGPKALRGRANPLSGTFDVD
                     KQAELARDVAVALGFDLTKGRLDVSVHPFTGGCGPDDVRMTTRYKADDLLEGLSGCVH
                     EAGHSAYEQGRSVDYRGQPVSEAHSMGVHESQSLLWERMVALSEPFAHFLLPKLQSTF
                     PGRFDGVTEEALYAGYNVVKKPSVIRVESDEVTYPMHVILRTELEMDLLSGKITVHDL
                     PKLWNAKMKEYLNVDIENDKQGVLQDVHWGSGAIGYFPTYIIGQILACQIFNAAKRSI
                     DDLDGQIKRGEFAQLLAWLRVNVHERGSECDSVDELMMKVTGKPLDAAEFVTYLTEKY
                     TKLYDL"
     gene            complement(<290860..>291330)
                     /locus_tag="OSTLU_29468"
                     /db_xref="GeneID:5006602"
     mRNA            complement(<290860..>291330)
                     /locus_tag="OSTLU_29468"
                     /product="predicted protein"
                     /transcript_id="XM_001422669.1"
                     /db_xref="GeneID:5006602"
     CDS             complement(290860..291330)
                     /locus_tag="OSTLU_29468"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422706.1"
                     /db_xref="GeneID:5006602"
                     /db_xref="JGIDB:Ost9901_3_29468"
                     /translation="MVEIEASASASASRRVSRDDAKDSYPAVVVARERPRDTRRVEEL
                     ETELKKLQAKSERQTKKINALKEELATERRARSNELQTVRAKHEREMRDLVASVSGVQ
                     KSNVQRRRRVSSNEYPPPPSRIVSGADEFDAFIAGFAAETDRLRKTLEHKRFLA"
     gene            <296761..>298674
                     /locus_tag="OSTLU_43691"
                     /db_xref="GeneID:5006764"
     mRNA            join(<296761..297675,298528..>298674)
                     /locus_tag="OSTLU_43691"
                     /product="predicted protein"
                     /transcript_id="XM_001422507.1"
                     /db_xref="GeneID:5006764"
     CDS             join(296761..297675,298528..>298674)
                     /locus_tag="OSTLU_43691"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422544.1"
                     /db_xref="GeneID:5006764"
                     /db_xref="JGIDB:Ost9901_3_43691"
                     /translation="MTQVPVISSASSEPSSPVPGETPNAYPTQSPVPGETPNAYPTQS
                     PVPGEAPNAYPTSSPNAYPTQSPVPGEAPNAYPTQSPVPGEAPNAYPTPSPNAYPTQS
                     PVPGEAPNAYPTQSPVPGEAPNAYPTPSPNAYPTQSPVPGEAPNAYPTQSPVPGETPN
                     AYPTSSPNAYPTQSPVPGEAPNAYPTQSPVPGEAPNAYPTPSPNAYPTQSPVPGEAPN
                     AYPTQSPVPGETPNAYPTSSPNAYPTQSPVPGEAPNAYPTPSPNAYPTQSPVPGEAPN
                     AYPTQSPVPGEAPNAYPTPSPNAYPTQSPAPNAYPTPSPNAYPTQSPVPGEAPNAYPT
                     PSPNAYPTPSPSAYPTPSPE"
     gene            <299626..>300612
                     /locus_tag="OSTLU_43595"
                     /db_xref="GeneID:5006603"
     mRNA            <299626..>300612
                     /locus_tag="OSTLU_43595"
                     /product="predicted protein"
                     /transcript_id="XM_001422508.1"
                     /db_xref="GeneID:5006603"
     CDS             299626..>300612
                     /locus_tag="OSTLU_43595"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422545.1"
                     /db_xref="GeneID:5006603"
                     /db_xref="JGIDB:Ost9901_3_43595"
                     /translation="MSYEEYVKTYGEDLDEIASAYPTPSPVPGEAPNAYPTSSPNAYP
                     TQSPVPGEAPNAYPTQSPVPGEAPNAYPTSSPNAYPTQSPVPGEAPNAYPTQSPVPGE
                     TPNAYPTSSPNAYPTQSPVPGEAPNAYPTQSPVPGETPNAYPTQSPVPGKAPNAYPTS
                     SPNAYPTQSPVPGEAPNAYPTQSPVPGETPNAYPTSSPNAYPTQSPVPGEAPNAYPTQ
                     SPVPGETPNAYPTPSPVPGETPNAYPTPSPVPGETPNAYPTPSPVPGETPNAYPTPSP
                     VPGEAPNAYPTQSPVPGEAPNAYPTQSPVPGETPNAYPTSSPNAYPTQSPVPG"
     gene            complement(<301979..>302893)
                     /locus_tag="OSTLU_43558"
                     /db_xref="GeneID:5006604"
     mRNA            complement(<301979..>302893)
                     /locus_tag="OSTLU_43558"
                     /product="predicted protein"
                     /transcript_id="XM_001422670.1"
                     /db_xref="GeneID:5006604"
     CDS             complement(301979..302893)
                     /locus_tag="OSTLU_43558"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422707.1"
                     /db_xref="GeneID:5006604"
                     /db_xref="InterPro:IPR001544"
                     /db_xref="JGIDB:Ost9901_3_43558"
                     /translation="MRGAVYDGALDVIVRVNDARCAPVMRLYDRGFTRGHAVFDACTV
                     HEGRCHLLAAHLRRFARSAREAGVGEMNDEALATMEALVLEVVARGGVTHGQVRMYAT
                     SGCESENFSLCGATDSPPTYYVVAYEKDPDAWMVVRGLTASSSPVPIKPPRYATLKST
                     NYLPNVNVAQIARGNGVDVGVFLTQDGMIGEGPGANVAFLTPDGTLRTPPATNVLGGI
                     TIQRLRELIETESNRKALRKVGIKRFDDSQPLSPFVVLGAEEAMLVGSAVGVQGIISW
                     DGRQVGDGRVGPATSFLAELLLDDMRSI"
     gene            <303181..>304635
                     /gene="SDG3522"
                     /locus_tag="OSTLU_89730"
                     /db_xref="GeneID:5006765"
     mRNA            <303181..>304635
                     /gene="SDG3522"
                     /locus_tag="OSTLU_89730"
                     /product="predicted protein"
                     /transcript_id="XM_001422509.1"
                     /db_xref="GeneID:5006765"
     CDS             303181..304635
                     /gene="SDG3522"
                     /locus_tag="OSTLU_89730"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422546.1"
                     /db_xref="GeneID:5006765"
                     /db_xref="JGIDB:Ost9901_3_89730"
                     /translation="MRDARDDDFLDWMRARGVTRDDARCAVRGDGDRGRFVECARATL
                     AVGTTLATIPKSACLTTATSALGAIEGARGSGVVGLCVAVAHERSLGAKSTFAAYLKT
                     LPAREALPSTFAADDEARRALRGTTVEGMLGADERAIADDYHAFAREMKERFARRGVK
                     MPTLEEFRDAATLVASRAFFVDDALGQGLVPFADLFNHKGGSDGAHFNVVGCDDADAD
                     ALTLVTCRTAKRGEELFNSFGDDHDNTVLLYKYGFVERDNRVATSSFGFGLLRDAGDI
                     SFESVHSWMTESYDGVDELEVDANGAMSRPLLALLRIASFEFLRDVDSGDDESHSDDV
                     DYDTSIGVLLERTMAGDESEAEILASVDDYVVLALFRGRFNAYLDTKDEDRCDDDVSS
                     LLRDVAREIKRCADLANDASGVRQQFGSGISGVAAAYHVRADELGLLMKAIIRAFDFG
                     DDEETNEDVPDTKKPKLVEVVPAYAPTIYIKPKE"
     gene            complement(<304673..306220)
                     /locus_tag="OSTLU_29472"
                     /db_xref="GeneID:5006605"
     mRNA            complement(<304673..306220)
                     /locus_tag="OSTLU_29472"
                     /product="predicted protein"
                     /transcript_id="XM_001422671.1"
                     /db_xref="GeneID:5006605"
     CDS             complement(304673..305767)
                     /locus_tag="OSTLU_29472"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422708.1"
                     /db_xref="GeneID:5006605"
                     /db_xref="JGIDB:Ost9901_3_29472"
                     /translation="MVSAYAAAERGGERRALERFVERAREGKTASEGGVKMTLADAEA
                     VLEDFRTLDAVLEAAKSEATMREALLARLQAETESSARRLRDHDEAHALLTAEISDLR
                     QALAKSKSEANGLAEETTALNEALTSAKAEALEWKNAAETLKQMRPNDAAVGVGEGGT
                     GNKMLVLELECALEALTTTRAELQDVGARLLETQHRAERAEKREAVAAAALEASESRS
                     KTSPSTVSLGNKGASRELKERLDRAEVRVAQLTRRLEAIGGEHRKELAMLQAEHERLS
                     LNLKMMHLTHDDATEVMRLEIGDATREAAARASAERDEYWRRILDEERECHANQIESV
                     RQDVENELITKNTKLNRIKHDLVQMLKDAT"
     gene            <306798..>307997
                     /locus_tag="OSTLU_29473"
                     /db_xref="GeneID:5006766"
     mRNA            <306798..>307997
                     /locus_tag="OSTLU_29473"
                     /product="predicted protein"
                     /transcript_id="XM_001422510.1"
                     /db_xref="GeneID:5006766"
     CDS             306798..307997
                     /locus_tag="OSTLU_29473"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422547.1"
                     /db_xref="GeneID:5006766"
                     /db_xref="JGIDB:Ost9901_3_29473"
                     /translation="MTLRCRIRATWLKNYANASADGATELSMVSGLESESSAVTDATP
                     PNLLREQDLSGFQQLLSPVAESVSPVIVRQSERREEQARAELEAQRRLNADMEVRLEA
                     VRNELEKTKEELATQRRAVENESARAQSEIAAAKEEAQKTLREKERAIDRVLSDIAAI
                     EKERNAAVRASKDQGFHIEALERSLRERDSDIARLKSLKDTDEATATLEAERIAHSRE
                     IERYKSQLDAADTQIETLSRSHKNAHAAFQRKLDSQLKLRAEAEKVFERELEQKHVEC
                     DDLRQQCSNIVAETTALTTALKRSADEQHRASTNTAKAEAAQAKCDLRAVSEELCDVR
                     KVLDAHVIELVEAKLNLAESQGSQLVLRRELARTKGKLTEYAARCTRMESMYATIIDE
                     STGTTET"
     gene            complement(<308055..>314150)
                     /locus_tag="OSTLU_29474"
                     /db_xref="GeneID:5006606"
     mRNA            complement(<308055..>314150)
                     /locus_tag="OSTLU_29474"
                     /product="predicted protein"
                     /transcript_id="XM_001422672.1"
                     /db_xref="GeneID:5006606"
     CDS             complement(308055..314150)
                     /locus_tag="OSTLU_29474"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422709.1"
                     /db_xref="GeneID:5006606"
                     /db_xref="JGIDB:Ost9901_3_29474"
                     /translation="MDGAKEVLAATVPIGDEGRTTVTYDATTWTLSVRSENYASDEVE
                     SYSTTSILNTLKTLTYVHNGENIAMTPRGVTAIVTDASGRMSAPALATIKMSRTNAAP
                     VLDLNGPRDGQTYSVVLTEKERMIGVRLTDVEYACGDDDDVVLASAAIANVDVGSLPD
                     GAAEYISADTTGTSIASAWDSTQKRLLLSNYDSVTNYCKVIGTIRYHNEGSVEQVTGS
                     QYEGGGDQVSNNLKFTAGIRAFNFTLTDSSGNSVTATANVDVQESSRVGDALYDELIT
                     DPLFCNNNGKRGKNSAVCSCTIIPPAVESEYSGDACETHVCSERGTYDRPTQTCDCID
                     SFSGSNCGIECNAHGTYNSSTNVCECNVGFTGRDCSVVCGACSAETGTCSLTATSEAS
                     WNAATKEYTLKEPQCTCSLGYSGSSCTQECPCATEPLAQQGTCGADASGEGICICNPG
                     YTGADCTIGCTVECGTYGECYPPPELAAGIKDKLMEIYTDTTIGDQSAREDAALAYQE
                     NNITTLCKCLAGADGKLVRAGATCNLPCPDCGFGECTENATCSCFPGYTGADCSQACN
                     GNGAVRYLTSEEVATVTDRFPNATSTGLFNTTDVHEYTSPDGREIAFCNCEDGWTGDY
                     CEVQCATCSAFGTCVFNGTHGNCVCSPGFTGADCSITCVPCVHGTCGPTGACVCNAGY
                     SGNDCNIECGDDIYLSRGTRNLNGALDGLGLLGTTVTCECNEGFTGPMCNYICPYSYN
                     AANGVCVMKDANDADFGDPWMTEVVCKPGWTGLPQVNRLADGSVSRGRDCNKACDACA
                     FGTCQDDGECVCDYGYIWQPATRSTADVGRTAAVTPYPWWTGGSNGVFESADIGGTSS
                     LFYDAAYHTCAIKHPCSMNGEYVNATCAPGFSMVAGTGQPWTNVDPNGVGGYGCSGTL
                     VADGTCQGGEYLVAMPYVEKRVDGSIIRDPTALKSHTEWGIIAGAVCAPDDSTTGPQM
                     PITGGYCVCDALSVGRSEFPSSQSLTSKVYDEYWQGWAGSTCDIPCAPCSGNGVCNST
                     TGTCDCADGWTGYRCLTPCEPCVHGTCQYDGSCLCDGTRRLRDHSFALRLDRDPHYAT
                     NGELASGEYIPPYYMSAIQVEDYVWGVDSVCADRPDCASRTIDSKLPFRPNETYFRYG
                     VTTAADAVGAATRTALEAQLLQYQNDIVNIPESMRADDICSKLDYKNDATTGECMASL
                     ASTTNCGDDWEAANPWDCDDALKAHFLRMRKEAIGATRVDLKIATESSDQERWYTNSK
                     DERQRLMNVFLAGMYDATSGEYVTTRTTGADRTMIWIINTLIHGVNSGLTGAYTGTTC
                     SIACDACDPDHGTCQLNGKCECETGWYGERCDKSCNCFKEYATNEDGSVSEVIKTTAH
                     GVQIRSWGFCKRDGTCVCGTDDGGVQYSGEDCFVPCAPCHNGACQADSTCLCNKGWLG
                     TTCDIRNFTECLPCNYDHGACLTDGTCKCDVGWTGLSCDVQCNPCVNGYCQMDGSCAC
                     QDGWSFVDCSRPEASSFIVKSEFTEGPEGWTVYNNSCSGELAESILSGNVYDPFAINS
                     EQLMRGECNFAFAGGDSGLLWEGISGYLHLTDKLTDDSTNGLAYLRAPEKFTGDLLSK
                     NAYGASITYSLYMVESAANSAANAGTAHVEAHQTSAYDIILMGGRPRYNREVPVWGSR
                     DQVYNWSRTNFPELGLNQQLSRAQTIAIVEQYLNTPQVFLGYKIDSDQKGYPPTSCSA
                     ARCGLNFKVDLLESAGWKNLEPVLSGFKWSNDPAVHYMDGTVYTTRTSGNPYDPFSGL
                     TAATLNLAADIPIVTDTTGRSDGGTVLQQSSGREIARDRLDFDVYPEVYEAVVANRLS
                     RTGNPATFSDLAWCLASLTEILVRADYYVQEAVDPSATVVGESIRFDSFGIGTFVDVN
                     AEEQRQISLFNYYRQYKNDYSVAYLDELYESMRPSVCKGKWYLTGDPDASLGDACKQD
                     PAQLRVTCAGIFDTTTTELGDYCVIKCPGYDVAAGTTCSGFGTCGLNDANVPTCTCNE
                     GYSASTTGCASSGAR"
     gene            complement(<314761..>315489)
                     /locus_tag="OSTLU_29475"
                     /db_xref="GeneID:5006767"
     mRNA            complement(<314761..>315489)
                     /locus_tag="OSTLU_29475"
                     /product="predicted protein"
                     /transcript_id="XM_001422673.1"
                     /db_xref="GeneID:5006767"
     CDS             complement(314761..315489)
                     /locus_tag="OSTLU_29475"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422710.1"
                     /db_xref="GeneID:5006767"
                     /db_xref="JGIDB:Ost9901_3_29475"
                     /translation="MARRRATATRTATRALVAALAALALEATTTRATTAAEEASFYRT
                     TYSPNDATTCEVGPYGWFCEPSNIEYSTQIWDPNTAYEADDVTASTSECAYCGICATC
                     ETGNLTCVRNAAAVCYESCTDDEVRARLATCDVEMETCMSLYHDVVRYDLRESVGYAY
                     EFYVNEFNGSDAWLGTRSEPWKTLARAERRVRFIRTVTEASGLGKELSAPIQVWIRDL
                     KADGGLDAKNNTHNGRYSGKTYLK"
     gene            315611..317378
                     /locus_tag="OSTLU_29476"
                     /db_xref="GeneID:5006768"
     mRNA            315611..317378
                     /locus_tag="OSTLU_29476"
                     /product="predicted protein"
                     /transcript_id="XM_001422511.1"
                     /db_xref="GeneID:5006768"
     CDS             315826..317361
                     /locus_tag="OSTLU_29476"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422548.1"
                     /db_xref="GeneID:5006768"
                     /db_xref="JGIDB:Ost9901_3_29476"
                     /translation="MESLARAVMTSIPPNAIDRQRVCEVIGRAEGARASGRHRDAAKM
                     LIDVGGALTRLQHETAVAVAEQAFQCAVQQARLNDEDVPEYMKNATEGSNAELGEAYA
                     SLGNCERALGKLADAEGHYKAAVKAVEDDGLEPFSNKFVLRVMVTRVRKDFQKHEQLC
                     DAWEETIRKAAREGTESQTALLAATGICLQERAGGMAEQKKFNEAAELRGGKFLETVL
                     RLQAHGLRTKPDVLLPNVYDSIAALYLQAKDIKKALGFLHRAVASTACTECYGDKFIP
                     EGETRGIKAEGKWDDVCWHPSLLASKKGVEQDEVDVVPRAPWEVSPEEKKIIDQILGV
                     GDKWTMKKGKEGPEPARGANALGHILYTLGNHLMQAAKWEEAGRPLKTAAAMLQNDLD
                     MQGNCFHLLGVVHFQIAKLPMNRARVKEILPRAASSFALAADCRIVDGKCTKKGAAES
                     INSLLFLGRCMFELGEFEQTEQVTAQAISLGRQVLGDNAKETNEAIKAMMEFKRQMSM
                     MGR"
     gene            complement(<317539..>319293)
                     /locus_tag="OSTLU_992"
                     /db_xref="GeneID:5006607"
     mRNA            complement(<317539..>319293)
                     /locus_tag="OSTLU_992"
                     /product="ABC(ABCG) family transporter: White protein-like
                     protein (ABCG)"
                     /transcript_id="XM_001422674.1"
                     /db_xref="GeneID:5006607"
     CDS             complement(<317539..>319293)
                     /locus_tag="OSTLU_992"
                     /GO_component="membrane"
                     /GO_function="ATP binding"
                     /GO_process="transport"
                     /codon_start=1
                     /product="ABC(ABCG) family transporter: White protein-like
                     protein (ABCG)"
                     /protein_id="XP_001422711.1"
                     /db_xref="GeneID:5006607"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="JGIDB:Ost9901_3_992"
                     /translation="TTKTILRDVTGSARPGEVLALMGPTGSGKTSLLNALAGRTPLGG
                     TLRGTITVDDAGRDETFMREKVAYVMQEELLFPFLSVEETLTLHCRLRRARLSEAEVA
                     ASVEEIVAELGLAKVRASPVGRPGGLPRGVSGGERKRVNIGVEMVGDPEALFLDEPTS
                     GLDSFQAQRVVYALRQLAAVGRTVVCTIHQPRSSIYGMFDQLLLISEGRLLYIGEAKD
                     AVGYFASLRFECPNLTNPADYFMDITSLDARNPEREKSSRERIEFFATEAMTRRLGEK
                     AVASALKQHRARSAAPTEYDPTHASWIQQFVLLVRRGLINQRRDFIGVRVTLALEMMY
                     ALIVSALFRGVGHDQKGVQDRIGCLFFVVLNVAYTSALPAINVFAGEKGIVVRERASG
                     AYKWSSYYMSKYVTELPRLIPRLIFCALVYWIVGLRKTQYNFWIFVAIIIAEAMSLTA
                     LGLLMASAMPIGAALALGPACITIFTLFGGIYLNIDSIPAGARWIRFMDPIFYAYSAL
                     VSNEFGGDPIAFSCESSTTRCLETGAAVLELYAFEDVKVGIQIMAQYLLQIGIHFFAF
                     NALRRTSKQYMPLSALTGN"
     gene            319568..320691
                     /locus_tag="OSTLU_25867"
                     /db_xref="GeneID:5006769"
     mRNA            319568..320691
                     /locus_tag="OSTLU_25867"
                     /product="predicted protein"
                     /transcript_id="XM_001422512.1"
                     /db_xref="GeneID:5006769"
     CDS             319577..320647
                     /locus_tag="OSTLU_25867"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422549.1"
                     /db_xref="GeneID:5006769"
                     /db_xref="JGIDB:Ost9901_3_25867"
                     /translation="MRASPLATRASIDARAIGARRDAKARARRARDARAGATRDDDES
                     WAFDPLALDARATRGATRGATRVASGACALVAVIACGASEDARAGGAAIDPFYAFSPV
                     CPASDGVFRVGQRAAISLAGDENIENYRPLINDVLIRVRTELCVLESFVRETAVPFVR
                     EKGLGWVLPRRETSETYLAGVVFMLGANFILLGSTKVVAIMAIYHDLSLGLATRLFGS
                     ALGALGPTNEREKREKELNKVMDEQMNELKGVMSNWTIGKDDRARKTQEINDKYATKL
                     EALRGSQEERSDRDDAVGLSKFRQVAGVVAVPLKVYGTVSSKGRQVLEVFDTFCSRYF
                     VAFTVTYIIIKTAHYTVLKDFP"
     gene            complement(<320709..>321086)
                     /locus_tag="OSTLU_29479"
                     /db_xref="GeneID:5006608"
     mRNA            complement(<320709..>321086)
                     /locus_tag="OSTLU_29479"
                     /product="predicted protein"
                     /transcript_id="XM_001422675.1"
                     /db_xref="GeneID:5006608"
     CDS             complement(320709..321086)
                     /locus_tag="OSTLU_29479"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422712.1"
                     /db_xref="GeneID:5006608"
                     /db_xref="JGIDB:Ost9901_3_29479"
                     /translation="MRGFGFDDAKAETLTRRYAEEALRGERGAATRRGTATNRSDAYD
                     GLEWRLDANVSSRASLVESEAKYLLKLGLARGDDGGTKKTTLAETDYQTLKALKDACE
                     SALAASTGAHATRLARYVRRPKT"
     gene            321395..322605
                     /locus_tag="OSTLU_29480"
                     /db_xref="GeneID:5006770"
     mRNA            321395..322605
                     /locus_tag="OSTLU_29480"
                     /product="DMT family transporter:
                     phosphate/phosphoenolpyruvate"
                     /transcript_id="XM_001422513.1"
                     /db_xref="GeneID:5006770"
     CDS             321552..322562
                     /locus_tag="OSTLU_29480"
                     /codon_start=1
                     /product="DMT family transporter:
                     phosphate/phosphoenolpyruvate"
                     /protein_id="XP_001422550.1"
                     /db_xref="GeneID:5006770"
                     /db_xref="JGIDB:Ost9901_3_29480"
                     /translation="MSDVGGKSAKELSMSAYLTAMTYGVAYITAATTIIMLNKYMLSV
                     TAFHYPIVLSSLGVVCGWTLSLIGVHVTKTVDISTHGDITFTTWVKNVLPIGFFQGTT
                     LMLGNMAYFHLTLSFLQMVKALSPAVLFFILYLTGLDKWHAKVAMAVAVIIGGTLIAS
                     LGETSFTWVGFALIFGAELTEAFKNALMQFLLANKKFSMWEGMYFISPASLIFLLLAA
                     TAFEFKHMRENDAWGMMVDKPYLFVAAGFLGFVVNFCSLGVIKHIGSLTLKVLAQLRS
                     ILIIVFGVVFYHDVVTPMQMFGYGVALVGFTAYNVAKVQAKEQEILEEQREAGLSKPL
                     LP"
     gene            <322725..>323499
                     /locus_tag="OSTLU_43894"
                     /db_xref="GeneID:5006609"
     mRNA            join(<322725..322985,323116..>323499)
                     /locus_tag="OSTLU_43894"
                     /product="predicted protein"
                     /transcript_id="XM_001422514.1"
                     /db_xref="GeneID:5006609"
     CDS             join(322725..322985,323116..323499)
                     /locus_tag="OSTLU_43894"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422551.1"
                     /db_xref="GeneID:5006609"
                     /db_xref="InterPro:IPR005339"
                     /db_xref="JGIDB:Ost9901_3_43894"
                     /translation="MASTSFGKKACELVREIAESEAGTLPPYNQDLMRTIADQCADHG
                     EAMQTLAVQINEVNDAEDDGAEDADAREDKTGSLRTGMFAHHQAILRNKRAMLVYLNE
                     RMNRIKDLRWQIGTGLPDNVSSNLSHGERAFFTKYSENLNEYMREVDLNLTLDLEPPK
                     HHKIQVRCLEDRGELFTRDGSVDLKRNTVHLMWREEAQPLIREGVLEQLDDDGC"
     gene            complement(<323611..>323949)
                     /locus_tag="OSTLU_29482"
                     /db_xref="GeneID:5006610"
     mRNA            complement(<323611..>323949)
                     /locus_tag="OSTLU_29482"
                     /product="predicted protein"
                     /transcript_id="XM_001422676.1"
                     /db_xref="GeneID:5006610"
     CDS             complement(323611..323949)
                     /locus_tag="OSTLU_29482"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422713.1"
                     /db_xref="GeneID:5006610"
                     /db_xref="JGIDB:Ost9901_3_29482"
                     /translation="MGEALNTRENVAEGTPGRPNLAFVGPASGALCGAFALIQSDNEL
                     ASPAGLALGAVATLALGYQYAKRFDETPRNPLEWPGPRLMPTLGVLFSLFAFLANVEA
                     LPRVLSPLAI"
     gene            <324127..>324882
                     /locus_tag="OSTLU_29483"
                     /db_xref="GeneID:5006771"
     mRNA            <324127..>324882
                     /locus_tag="OSTLU_29483"
                     /product="predicted protein"
                     /transcript_id="XM_001422515.1"
                     /db_xref="GeneID:5006771"
     CDS             324127..324882
                     /locus_tag="OSTLU_29483"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422552.1"
                     /db_xref="GeneID:5006771"
                     /db_xref="JGIDB:Ost9901_3_29483"
                     /translation="MRRTAARAARASRSAREYLPKAFPSLDADDVARELFDDARAVAT
                     FGASDEATARKQLGHACAQAIGGEARRCRHGYSRALLYAPASTTTTDARAALKAEHAL
                     SRLSCPELIEAVDAWEREGGIHAVAAACDADESLFQSLERAHRDAPRVRNWLVGEETS
                     ARVREGETKTDFIVNRTGLVGVSLEALTSQKTWKKVKCLHAHIADTLVRGRGKNAVGA
                     FALDVLRTRRGVDVDGTPECWRRCAPGVAESRK"
     gene            complement(324884..>325990)
                     /locus_tag="OSTLU_25869"
                     /db_xref="GeneID:5006611"
     mRNA            complement(324884..>325990)
                     /locus_tag="OSTLU_25869"
                     /product="predicted protein"
                     /transcript_id="XM_001422677.1"
                     /db_xref="GeneID:5006611"
     CDS             complement(324947..325990)
                     /locus_tag="OSTLU_25869"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422714.1"
                     /db_xref="GeneID:5006611"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="JGIDB:Ost9901_3_25869"
                     /translation="MRVASTSRVPTTPRARAPRRSTRRASPPPPRAFAESDDGGRDFA
                     GDIALADVRRGEKIGAGSFGDVFAGTLRGRTAVVLKEGSAFRGGARFVEAEGRIWRRA
                     RGWRGGATFLGVAGANAYLVFEDEGRDTLEGALGGGGLGGVFGGGRDGAAFAEALGCA
                     TEAQACKKVSRELLKCVKGLHDKKIIHRDVKPNNVLLTKNGLRLIDLGGAADLKTGQN
                     YDEAETVFDPVYGPPERYLTGKFGGGGGAGEWNKNKPDLFDAFSVGMVILQVSVPAFR
                     KKNGMKGVRGELKTWAYDCEAWRASLPERRQSDFAILDENDGAGWKLVCGLVANRSQR
                     ISVSKALSSSFCR"
     gene            <326251..327756
                     /locus_tag="OSTLU_29485"
                     /db_xref="GeneID:5006772"
     mRNA            <326251..327756
                     /locus_tag="OSTLU_29485"
                     /product="predicted protein"
                     /transcript_id="XM_001422516.1"
                     /db_xref="GeneID:5006772"
     CDS             326251..327717
                     /locus_tag="OSTLU_29485"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422553.1"
                     /db_xref="GeneID:5006772"
                     /db_xref="JGIDB:Ost9901_3_29485"
                     /translation="MTPAGYRATLRDEDGEDYASMRHALDALRNIDKVDASGGADARG
                     ASNAAREGWASARASAIAGDADRGTYEVVETLRAGGAASSASFSKVGERSLAIGDRAG
                     SILVRRCATDDMACASTSEVGAHDGEIVGMDWSLNGGRLVTVGKVGEVKTWNVTHTSK
                     TTIQMTKQSAFKVHTEVTCVLFHAAKDDLVFVGTKLREVLVVDVQVGVLLDKFTMNAV
                     PLCMESNTSGCVLFVGDAEGNISVLTCDARMKKTLSLKSEGDAAVENPLQRVINERSA
                     SQSERMSVVGHQQLPDEDGSDPSTVGSKLRSTLASMLSKAKTAVPVPRVAQVKTGYRL
                     RAAKTISAEKSPIRAIRYCPFVTITGRAALLSFHECGIVRMYHANDLRYSSFNSFTHG
                     QIHDWTTPARGSGAVSFAHGHSIDLPLLSASRANRTALYVMPTIPEAPIQALQFTDDV
                     EENSEQAVDIATVSEWSHDSTELVIGYASGKLVVWRKM"
     gene            complement(327762..>330849)
                     /locus_tag="OSTLU_29487"
                     /db_xref="GeneID:5006612"
     mRNA            complement(327762..>330849)
                     /locus_tag="OSTLU_29487"
                     /product="predicted protein"
                     /transcript_id="XM_001422678.1"
                     /db_xref="GeneID:5006612"
     CDS             complement(328117..330849)
                     /locus_tag="OSTLU_29487"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422715.1"
                     /db_xref="GeneID:5006612"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="JGIDB:Ost9901_3_29487"
                     /translation="MATAWTPNGDGAARIIQMIAEYLDPRANQREMLGRLEQCAGFPD
                     FNNYLAHVLTSDEDAGRREDVRQSAGLLLKNNLKTSWTTTMSEEYRTYVRETLLRALG
                     HPSRLIRGTCGTCVAVIVRCGGVENWGDLWPTLVRAVEAGDENSRDGALGALYKACEE
                     VNGRLDVKVPGLPDSPAGMVIPRLFALFSSPAAKVRQQAVGVVNMIAPCWPENHYALL
                     DSYLQGLFSLANDPDNDVRRLVCSGLVMLIHICPEKLAPNLREIIVYMLERQDDEDKD
                     VAMESCEFWGAFCEAELGDDYVQILREFTPRLIPVLLTNMAYTEDDEEVISAEDDEVN
                     VGREDRDQDIKPTFRDTKDKGSQGEGEDDGQDDSDDFVWNLRKSSANGLDILSNVFGD
                     ELLPLLLPVVEQRLRESRWEIRESAILALGAVAEGCSGGLLQYLPMLINFLLPMLDDA
                     RPLVRSTTCWTLSRFSRWTLQCARPSNDPNAMPQQQGMEQLNTLTTALCKRCLDHNKH
                     VQAAACGAIATLLAEGQDTLAPWTETIVQTLTQALATYQRKNMRNLYDALTMLAENIG
                     PSIEDARYAGAILPGMLQKWENANKVDPELYHLLECLTAIIVGLGQASAEFSSGIFAK
                     CISALTYQLQQRTAVQRGEMPAEEYAIDIVICTLDLLSGLCEGMGQAIEPLVAQSPIR
                     DILIASCMDESPGVRRSAFALVGDLTRSSTAHLTPSLQQLMELIVAQLQPAMVISMNM
                     SVCNNASWAAGEIAIRTSSDVLRPFVAPLAQCLVQILDMRMVNRALGENAAISLGRLS
                     MTCPEELQGGLAHFITSWCSALRRLRDGVEKEHGFMGLCKLIQMNPSGATSGLSAFVE
                     AVASWRQCRNNELVATMGQLVRGFKDHVGTDQWAMVVRDLEPGVMRKLAEQYGV"
     gene            <331197..>332138
                     /locus_tag="OSTLU_43628"
                     /db_xref="GeneID:5006773"
     mRNA            <331197..>332138
                     /locus_tag="OSTLU_43628"
                     /product="predicted protein"
                     /transcript_id="XM_001422517.1"
                     /db_xref="GeneID:5006773"
     CDS             331197..332138
                     /locus_tag="OSTLU_43628"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422554.1"
                     /db_xref="GeneID:5006773"
                     /db_xref="JGIDB:Ost9901_3_43628"
                     /translation="MKRVFIDGEAGTTGLQVRERLEARGDVELIQLDEGSRKNLEARR
                     AALNECDAAILCLPDQAAEEAVKLVENETTVVIDASTAFRVADGWTYGFPELAPGHRE
                     LVKASKRISNPGCYPTGFIALTRPLVDAGILSPGAALTVNAVSGYTGGGKALIKVYEE
                     EEHEPWGAYGFNLEHKHLPEMAKWSMIGREPIFMPSVGSFAQGMVVSVPLHYDQLAAD
                     ARSAKRLHECLRARYAQSTYVSVRDLNKMDDLERGAFMRPDSLANTNKLELSVYANDS
                     KRTAVLVARLDNLGKGASGAAVQNMNLALGLDETMGL"
     gene            complement(<332264..>333213)
                     /locus_tag="OSTLU_29489"
                     /db_xref="GeneID:5006613"
     mRNA            complement(join(<332264..332593,332708..332795,
                     332939..>333213))
                     /locus_tag="OSTLU_29489"
                     /product="predicted protein"
                     /transcript_id="XM_001422679.1"
                     /db_xref="GeneID:5006613"
     CDS             complement(join(332264..332593,332708..332795,
                     332939..333213))
                     /locus_tag="OSTLU_29489"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422716.1"
                     /db_xref="GeneID:5006613"
                     /db_xref="JGIDB:Ost9901_3_29489"
                     /translation="MRTIANERDALAATEARAARAILDHRLGIIDDDQRARRAALVAK
                     QFAEREALAIDEELDEPFDLHELYAFLMMPADKVAKAFGMPSGSFRLQCRKAGVTRWP
                     HRHAQAVVGCHEYIAQLMQHTLAQFEYSIDDMEMCDVNYYSHRARSAFLRMDYAMTDL
                     LEDLDTLEKYARALEGMFLRTGTFDSVRSPEAFNRIRTKIYKHRSKVGCFVRKLFPSN
                     LGGAIRPSLFDK"
     gene            <333632..>334918
                     /locus_tag="OSTLU_19051"
                     /db_xref="GeneID:5006774"
     mRNA            <333632..>334918
                     /locus_tag="OSTLU_19051"
                     /product="predicted protein"
                     /transcript_id="XM_001422518.1"
                     /db_xref="GeneID:5006774"
     CDS             333632..334918
                     /locus_tag="OSTLU_19051"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422555.1"
                     /db_xref="GeneID:5006774"
                     /db_xref="JGIDB:Ost9901_3_19051"
                     /translation="MRRALDDDDDLGGARRRRDGARARAGARTSAAKADGDGCAARGA
                     SAAAREENGGAAAPGEGEGAGGAMRVAREWVGGDGAKARARGVGSGGAARRAARGLNI
                     ATTTAVGMYVYWILMGTVAWISHLGERAPWLRFALPAEGYPGNAPSSAGALGFVARNV
                     PLSLIFVVPHSVFLPSRLRKIFGKHGRLMYNFVSAATLHFFLLNFTPLKTPVVMTIPF
                     NTNFHNALSIGCLAYASYAFLSSPATLGLLGVSSALELRDSKYSNPAAGMDAITWMGV
                     TTWRLGGASAFVLFTGLSIIPRELTLGDCITRCVAAVYLRQRSRSFREWVEKIEGVHL
                     LTWILRGTLLSFACHGALQGGGNVRTVGWILFGAASLAGILRLAESESPNAKKKPISR
                     AASFDVAEAAPAALDDVARVNRPERWHAWNPHARMT"
     gene            <335139..>337001
                     /locus_tag="OSTLU_1733"
                     /db_xref="GeneID:5006614"
     mRNA            join(<335139..336345,336460..>337001)
                     /locus_tag="OSTLU_1733"
                     /product="predicted protein"
                     /transcript_id="XM_001422519.1"
                     /db_xref="GeneID:5006614"
     CDS             join(<335139..336345,336460..>337001)
                     /locus_tag="OSTLU_1733"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422556.1"
                     /db_xref="GeneID:5006614"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="JGIDB:Ost9901_3_1733"
                     /translation="FEDLVPALRASSLAVLERAGFARSTPVQAATVPLLCSHKDVSVE
                     ACTGSGKTLAFVLPMIEILARAKRELKRYQVGAVIVSPTRELAKQIHEVAAPFVRTLG
                     KERSETNEGEGDLAMLLVGGTDVAKDVATFAATSPLVLIATPGRLWDVMQRSKELDGK
                     KCELLILDEADRLLGMGFMATLNNIISRLPKQRRTGLFSATQTEEVAELARAGLRNPV
                     RVTVRDALNSAAKAAGEKAGKLPTQLQLLYRICSVDSKLWHFVNFIKEHRECKVIVYF
                     LTCACVDFYESALKELLPESTAIALHGKMKQSARESALGKFTEQKSGILMCTDIAARG
                     LDIPGVDWIVQFDPPQDPAAFVHRVGRTARMGRDGSALVFLSPNSEASYVDFLRIRGV
                     EIKPAPGTREGAAHVHAVLRKASEKKREIMEKGVRAYVSFIRGYKEHHCRFIFRFKEL
                     EYGALAMSMGLLRLPKMKEIRKAPKKFMECFVESSVHADSVAFEDKAREKQRQRTLKE
                     QEEAAEAQRLLDADKPKPKKEKVKEEKRQTAFKRRKEESRADIEEMEDDYRALKKLKK
                     GKMTEEEFDLEIGFDEV"
     gene            complement(<337103..>337645)
                     /locus_tag="OSTLU_89738"
                     /db_xref="GeneID:5006615"
     mRNA            complement(<337103..>337645)
                     /locus_tag="OSTLU_89738"
                     /product="predicted protein"
                     /transcript_id="XM_001422680.1"
                     /db_xref="GeneID:5006615"
     CDS             complement(337103..>337645)
                     /locus_tag="OSTLU_89738"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422717.1"
                     /db_xref="GeneID:5006615"
                     /db_xref="JGIDB:Ost9901_3_89738"
                     /translation="VTREEIERAANARGLTLETKFYGPVFKMEARRMRTGRGGEGEAD
                     VVATHDGFVAPPPFGILHMDSMRVYNSKVSERERGKMRSTFGIAILLGTMSLLEGAEA
                     GCKKCELLAIDDGNGYAEKLVRYYGRLGFETVRVVGENGLRDIPDLLVWGGVGTRMNG
                     DVDALLAKWGGVIRKQLSRD"
     gene            <338107..>339548
                     /locus_tag="OSTLU_29493"
                     /db_xref="GeneID:5006775"
     mRNA            join(<338107..338117,338309..>339548)
                     /locus_tag="OSTLU_29493"
                     /product="predicted protein"
                     /transcript_id="XM_001422520.1"
                     /db_xref="GeneID:5006775"
     CDS             join(338107..338117,338309..339548)
                     /locus_tag="OSTLU_29493"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422557.1"
                     /db_xref="GeneID:5006775"
                     /db_xref="InterPro:IPR000023"
                     /db_xref="JGIDB:Ost9901_3_29493"
                     /translation="MRKTNFVSNSDRILLNSVAYGSAADPTQTCSLSSDVYDPSGCDY
                     VPEWVVRAGPRAEVYFDPEEVHAAVVTCGGLCPGINDVIRSLVNTLEVGYGVKKISGV
                     RYGFKGFFSGDEFMPLNRKVVRNIHNIGGSALGSGRGGGDVEKIVESIVNNGINMVFV
                     IGGNGTHAGANAISNECAKRGVKVSVVGVPKTIDNDILLLDKTFGFDTAVEEAQKAIQ
                     AAAIEAQSAYRGVGVVKLMGRQSGFIAMFATLANGQVDCCLIPEISWAAHGPNGVVEY
                     VRNMLDAQGHAVVVLAEGAGQEFVSAGGTDAGGNPKLGDIGQWFCKQLKAEIKCDVKY
                     IDPTYMVRGCVANAHDSIMCTVLGQNAVHGAFAGFTGISVGSVSAHTAFLPIPRMIER
                     ERLVDPDGRMWHRTLASTGQPDFF"
     gene            <339658..>341578
                     /locus_tag="OSTLU_29494"
                     /db_xref="GeneID:5006616"
     mRNA            join(<339658..339728,339901..>341578)
                     /locus_tag="OSTLU_29494"
                     /product="predicted protein"
                     /transcript_id="XM_001422521.1"
                     /db_xref="GeneID:5006616"
     CDS             join(339658..339728,339901..341578)
                     /locus_tag="OSTLU_29494"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422558.1"
                     /db_xref="GeneID:5006616"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="JGIDB:Ost9901_3_29494"
                     /translation="MADAADEPTLKEFPEFPGEPMSKSEYKKRLKQRQNEEKKAAKDA
                     AKAEAEAAKPKKEKSEEDDEADLDPTQYTQNRINKVLSAKAKGESPYPHKYHVDTRVG
                     EFIEKYSGLADGTTAEGESASVAGRIMSKRASGKKLYFYDLIADGKKIQVTADEGAAS
                     GYDFQKIHSATRRGDIVGVKGTPGKTKRGELSLFPSNFEILTPCLKMLPGFSGLKDVE
                     TRFRMRFLDLMMNNEVRDTFYIRSNIIRYIRKYLDDRDFLEVETPMMNMIAGGATARP
                     FITHHNDLNMTLYMRIAPELYLKQLVVGGIERVYEIGRQFRNEGIDMTHNPEFTTCEF
                     YQAYADYDDLMQMTEEMISGMVYAIKGSYKIQYHAKGPDEDPIEIDFTPPFRRISMVS
                     GLEEALNIKFPSTDFSTQENEDFLKELIKKLGVEMSPPYTTARMLDELVGEYLESQLV
                     NPGFICDHPQIMSPLAKYHRNIPGMTERFELFVNTKELCNAYTELNDPIDQRERFDEQ
                     AKAKSSGDDEAMLIDEVFVQSLEYGLPPTGGWGLGVDRLTMLLADKNNIKEVLLFPAM
                     KPEENIPADGMKNLSV"
     gene            complement(<341733..>341945)
                     /locus_tag="OSTLU_9266"
                     /db_xref="GeneID:5006617"
     mRNA            complement(<341733..>341945)
                     /locus_tag="OSTLU_9266"
                     /product="predicted protein"
                     /transcript_id="XM_001422681.1"
                     /db_xref="GeneID:5006617"
     CDS             complement(<341733..>341945)
                     /locus_tag="OSTLU_9266"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422718.1"
                     /db_xref="GeneID:5006617"
                     /db_xref="InterPro:IPR002150"
                     /db_xref="JGIDB:Ost9901_3_9266"
                     /translation="PEWFEEAKVFCNGEEVMTVGGTQAEYVVDIWSGNHPFFQGRSSA
                     IMTDAGQVSRFANRFGDLGDLSAVETM"
     gene            <343142..>343519
                     /locus_tag="OSTLU_43587"
                     /db_xref="GeneID:5006776"
     mRNA            <343142..>343519
                     /locus_tag="OSTLU_43587"
                     /product="predicted protein"
                     /transcript_id="XM_001422522.1"
                     /db_xref="GeneID:5006776"
     CDS             343142..343519
                     /locus_tag="OSTLU_43587"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422559.1"
                     /db_xref="GeneID:5006776"
                     /db_xref="JGIDB:Ost9901_3_43587"
                     /translation="MEWVNAIVNEMGASVDVSDAQNRASRVLQTFEGAVRQRCAEFND
                     YSKVMKMKRENALLKRAVAIQNSRMQDLAPLQARVRELEAACAQYDDRLKTAERQNYS
                     LSVNLRLAMAEQSPFGSKNHDVF"
     gene            complement(<343670..>344071)
                     /locus_tag="OSTLU_9147"
                     /db_xref="GeneID:5006618"
     mRNA            complement(<343670..>344071)
                     /locus_tag="OSTLU_9147"
                     /product="predicted protein"
                     /transcript_id="XM_001422682.1"
                     /db_xref="GeneID:5006618"
     CDS             complement(<343670..>344071)
                     /locus_tag="OSTLU_9147"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422719.1"
                     /db_xref="GeneID:5006618"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="JGIDB:Ost9901_3_9147"
                     /translation="WAGDLPYKYSGQTLDPVPVPEVLRRLQTAVEAKCGATFNHILLN
                     RYRDGDDSMAFHADDEPELGKNACIAAVSVGHTRKFDVQVKSRAKKKTSIFLEHGSLM
                     VMDGSLQHTHYHAVPKNRVPTNGKERINITFR"
     gene            <345525..>346208
                     /locus_tag="OSTLU_43679"
                     /db_xref="GeneID:5006777"
     mRNA            <345525..>346208
                     /locus_tag="OSTLU_43679"
                     /product="predicted protein"
                     /transcript_id="XM_001422523.1"
                     /db_xref="GeneID:5006777"
     CDS             345525..346208
                     /locus_tag="OSTLU_43679"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422560.1"
                     /db_xref="GeneID:5006777"
                     /db_xref="InterPro:IPR003511"
                     /db_xref="JGIDB:Ost9901_3_43679"
                     /translation="MAQEQRRGATSSAITLRGSTELVTEFFGYAVNTILYQRGVYPAE
                     EFERKKKYGLGVMVTNEPKLKEYLVAALERVNAWLMEKDLKKLVLVLADAKTGETLER
                     WTFDVETDAEIVDENGGDANGTTTTTTTTTTTTTTTTREKPEKEIMQEIQAIIRQITA
                     SVTFLPLLDRECAFELLAYTDAASATPEECEESDPKYVRDGVEMRLRSFSTKIHTVDA
                     GVSYKTEDD"
     gene            complement(<346408..>346809)
                     /locus_tag="OSTLU_94088"
                     /db_xref="GeneID:5006619"
     mRNA            complement(<346408..>346809)
                     /locus_tag="OSTLU_94088"
                     /product="predicted protein"
                     /transcript_id="XM_001422683.1"
                     /db_xref="GeneID:5006619"
     CDS             complement(346408..>346809)
                     /locus_tag="OSTLU_94088"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422720.1"
                     /db_xref="GeneID:5006619"
                     /db_xref="JGIDB:Ost9901_3_94088"
                     /translation="VRHMVSSSDHTRGKSQKPIGTSQLRPRGPDKYRCRKTSGTPGIA
                     WFLYAFRADGENFSFSSFSQLFVEFGRDLSARMMDFASFEMVCDGLLAMVRRDFAPLD
                     GANVAETFVTTRELHVLACPNFSSTSDADSG"
     gene            347200..348387
                     /locus_tag="OSTLU_29499"
                     /db_xref="GeneID:5006778"
     mRNA            347200..348387
                     /locus_tag="OSTLU_29499"
                     /product="predicted protein"
                     /transcript_id="XM_001422524.1"
                     /db_xref="GeneID:5006778"
     CDS             347358..348350
                     /locus_tag="OSTLU_29499"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422561.1"
                     /db_xref="GeneID:5006778"
                     /db_xref="InterPro:IPR003767"
                     /db_xref="JGIDB:Ost9901_3_29499"
                     /translation="MVPIEELKTTTTKAIRGIGYNEKDAKVILDVLMYAQLRGNNQGI
                     IKVTTNGLAMAPDAEPMVVTHETKLSAAIDGKKTQGMLVLAEATRVAHEKAKEHGFGI
                     VGTCNTSTSTGALGYYCKSVADQGMISICFAQSPEFVAPAGSSKAIFGTNPIGVGIPS
                     SEGAMVLDMATSAYSWFGVLEAKTAGRELPDGAAQDKNGVLTKDPNEVLDGGAIRTFD
                     GGYKSSNLALVIELLAGPLVGAAIEGKLAAKNWGNLIMVIDPKMLGQADFEKNAAFVM
                     NRVRNAPKQPGVDAINLPGERGDAIAKANEAKGEIDVETNLWNNLKKAAEAFSG"
     gene            complement(348418..353638)
                     /locus_tag="OSTLU_51965"
                     /db_xref="GeneID:5006620"
     mRNA            complement(join(348418..353092,353503..353638))
                     /locus_tag="OSTLU_51965"
                     /product="predicted protein"
                     /transcript_id="XM_001422684.1"
                     /db_xref="GeneID:5006620"
     CDS             complement(join(348492..353092,353503..353590))
                     /locus_tag="OSTLU_51965"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422721.1"
                     /db_xref="GeneID:5006620"
                     /db_xref="InterPro:IPR002489"
                     /db_xref="InterPro:IPR002932"
                     /db_xref="InterPro:IPR006981"
                     /db_xref="InterPro:IPR006982"
                     /db_xref="JGIDB:Ost9901_3_51965"
                     /translation="MQAMGARVSPVAVTDARARRHRARVGAKNGGAVDNTQLLEEHDA
                     CGVGFIASLKGERTHKTVKDSLMAVGCMEHRGACSADNDSGDGVGVMTHIPWKLLDKW
                     CAANGISGFSEGSSAVGMVMLPTDGAKAAEAKKILEASCVAEGLKVLGWRAVPVDNSV
                     VGPLAKMTCPVHEQILVDGAGLEREELERKLFIARKTCEKSASSDAVLAESFYICTLS
                     SRTIVYKGMLRSAVLGKFYKDLEDPDYESQFSIYHRRFSTNTTPKWPLSQPMRFLGHN
                     GEINTLQGNLNWMASKEADMENPIWGGREPEFRPICNPAASDSANLDRVAELLVRTGR
                     APAETMMLLVPEAHRNHPELDATFPEVHDFYDYYAGMQEAWDGPALLVFSDGKQLGAR
                     LDRNGLRPARFWRTSDDYIYVASEVGVLGDVMSNASNVVSKGRLGPGMMIYADLETGE
                     FKENTEIAKEVSARLPYGEWMKAIDRVKGIEPIGATQLDPIQLIECQARAGYAAEDIT
                     MIIESMASDAIEPTWSMGDDTPMPVLSGRPRLLYDYFKQRFAQVTNPAIDPLREGLVM
                     SLAMTLGAKGNLLDTQGKETPPVMLDSPVLFDSELEHIKNHPKLKTQTIAARYAAGGA
                     AGALKAGLDKLCEEAAAAIRAGSECIVITDRPDQGPDSPAIPSLLAVGTVHHYLIAQG
                     LRTRASIVVESASAFSTHHIATLVGFGAHAVCPWLALETCRSWRKSPKVETAIQRGKM
                     GDVSVEGVQVNFKNALNKGLKKILSKMGISLITSYQGAQIFECYGLGPEVINTAFKGT
                     VSRIGGLTMDEVAAETHMFVQSAFPGEAEEMAKVEARGMFQVKPGLEYHGNNQEMSKL
                     LHKAVGLGGGEKNDEFWSAYQAHRNDRPYTCLRDQLEIKSDRQPISVDEVESVADICT
                     RFCTGGMSLGAISQECHESIAIAMNRIGGKSNSGEGGEDPKRFETITDATADGKSETF
                     PYLRGMENGDVASSAIKQVASGRFGVTTSFLMSANQTEIKVAQGAKPGEGGQLPGKKV
                     SPYIAWLRRSKAGVPLISPPPHHDIYSIEDLAQLIYDLHMVNKNSKVSVKLVSQAGIG
                     TVASGVAKANADIIQISGGDGGTGASPLSSIKHCGGPLEMGLVESHRTLVENGLRERV
                     VLRADGGCRSGLDVIQTALMGADEYGFGTVAMIATGCVMARICHTNNCPVGVASQREE
                     LRARFPGAPSDLVNFFMYAAQEVREILAQMGYRSLDEIIGRNDLLSQIDKAPAKTSSL
                     DLSFLTTSSGEAGASSDRIAQPVHNDGIVLDDKILSDPEVQKCIETEGTYTKKVEIVN
                     VDRCATARVAGQIAKKYGDNGFAGSLTLDIEGSSGQSFGAFVVGGLKVRLVGEANDYV
                     AKSMSGGEIAIMPPPNSPFAPESASIAGNACLYGATGGQVFISGRAGERFAVRNSLGE
                     AVVEGTGDHCCEYMTGGCVVAIGKVGRNVGAGMTGGIGYFLDEDGTFESKVNGEIVAM
                     QRVITPAGEAQLKGLISAHAEKTNSPKAKAILADWANYLPKFWQLVPPSEANTPEATN
                     DVKAGVEATA"
     gene            <354419..>356506
                     /locus_tag="OSTLU_29501"
                     /db_xref="GeneID:5006779"
     mRNA            <354419..>356506
                     /locus_tag="OSTLU_29501"
                     /product="predicted protein"
                     /transcript_id="XM_001422525.1"
                     /db_xref="GeneID:5006779"
     CDS             354419..356506
                     /locus_tag="OSTLU_29501"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422562.1"
                     /db_xref="GeneID:5006779"
                     /db_xref="JGIDB:Ost9901_3_29501"
                     /translation="MDDVLNATRTETETKEADFRVATTRVYASFTVDDRQYEESAEYK
                     AFVIATSHALDSTSRMRTPIDPPRAGGAEIFRLDLANATKTIEFIDHHRTRSFYRVTC
                     CVSVGRSTFVLSFDDGSECTVRSPSRDPVRHLRGTTNDPCVAKDLSLPYPDDITLEFT
                     PSERATFDEYRGFYRGSYEKMMRAKSKFALAVRFDEGPRLRATARFRGVSSFRDCERR
                     KSLTVELDGRGVRLMPGSFGTKFLLISLCIDDRYVKTHLVLSMAKALGTFPHAFRYVR
                     LKIRTRGQKRVEHSGLYLLMDDPKSSLERAHNQLSVVVRRRFDPARKNFTSSKGVPEV
                     KSYPNTDIEAIAGRVRYERVVLASESCEDKACFDVLNNLIDLEGYLSWMALMTWVESG
                     DYVDELWLYASNENDGKHRFKVHAWDPDDSFESCHHGGEDAIVGLGNLLYCAEGAIDR
                     VLVRSESMRAHYIKILNEVLRDRLNERALREIVDAQEGQIRRLLNDDDTALGLLELRE
                     IEPSIDSATEAVSEIIGSLRYYRDVINFRRRSLLRDAEAYASFDPSATAWTSQPTADD
                     CDDGAPTLVTQVRSYDRIDQDILLKVSGNGGSYALNVSFDPIVVYNGSTYVATRDEFV
                     LERWSSEQHENVTRMAMSSPCVRTFIGGGYIVLSSICDDSIPHMFSLHHRFWHGFANA
                     SSPMIVSRLLGCV"
     gene            complement(<356563..>357321)
                     /locus_tag="OSTLU_6696"
                     /db_xref="GeneID:5006621"
     mRNA            complement(join(<356563..357117,357154..>357321))
                     /locus_tag="OSTLU_6696"
                     /product="predicted protein"
                     /transcript_id="XM_001422685.1"
                     /db_xref="GeneID:5006621"
     CDS             complement(join(<356563..357117,357154..>357321))
                     /locus_tag="OSTLU_6696"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422722.1"
                     /db_xref="GeneID:5006621"
                     /db_xref="JGIDB:Ost9901_3_6696"
                     /translation="LDTTRGDRNAWLVKVPKFVSRVFHEAAAASKQAMADDDDMDTDT
                     KEEDEPAIGTVRHMTHAIMELTGKEANGVPKQYILANQPSDMPMRVFSDVREGTTSGQ
                     ADITLEAKVDLKLDMRPTSIDDVDYHRVSKDRMIQAQTKTRVTQSSSEMRFAPLPKAR
                     NLIRFTDAASNKKEKKERMEKKALENVLFGLFERQPYWSLKQLILETKQPVDWLKTNL
                     GEIALLTRRGPNMGLWGLKPEWK"
     gene            complement(<357467..>357790)
                     /locus_tag="OSTLU_94090"
                     /db_xref="GeneID:5006780"
     mRNA            complement(<357467..>357790)
                     /locus_tag="OSTLU_94090"
                     /product="predicted protein"
                     /transcript_id="XM_001422686.1"
                     /db_xref="GeneID:5006780"
     CDS             complement(357467..>357790)
                     /locus_tag="OSTLU_94090"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422723.1"
                     /db_xref="GeneID:5006780"
                     /db_xref="JGIDB:Ost9901_3_94090"
                     /translation="VTDDARAMPRWRTQDEELPANSEELQQAIKDWLTKKRTAAGKVK
                     QVLGLLNHERLGYVCAQCAVATRGGREVEGDDGEVLSRSRRANGPTDRATRAFHPSQG
                     GCGEV"
     gene            <358289..>359344
                     /locus_tag="OSTLU_29503"
                     /db_xref="GeneID:5006781"
     mRNA            <358289..>359344
                     /locus_tag="OSTLU_29503"
                     /product="predicted protein"
                     /transcript_id="XM_001422526.1"
                     /db_xref="GeneID:5006781"
     CDS             358289..359344
                     /locus_tag="OSTLU_29503"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422563.1"
                     /db_xref="GeneID:5006781"
                     /db_xref="JGIDB:Ost9901_3_29503"
                     /translation="MDRHAFFAAQAWLTATTTRARDGARASDDGDGDDGATREREEIY
                     AGTCSFSCADEEQYETRAIATMDGDDAADDGEDDAADDGEEDAAENGRGRRRARPRGA
                     LARDAQHLTFGTTATLRDPASVRVSFAAVKTTFGASSGTGSGSTSVGDATTANARARI
                     ELECELDGQTYRMSTRTCRAVVKSFKETARSGHTEAFPRYLSVIFPHVTMNVYSAAES
                     DASWDGLRALARALTDPALATTKTTTTTSENYDDGHDTDPDGNDPSPVGVGKPNPLPR
                     SIGNEIDLETVALADADAFAAQRFAADALCDAARLLVADGDPWRTLSHDLLAHGVRDV
                     FADDPSAYAGRAFPGDK"
     gene            359478..360930
                     /locus_tag="OSTLU_29504"
                     /db_xref="GeneID:5006622"
     mRNA            359478..360930
                     /locus_tag="OSTLU_29504"
                     /product="predicted protein"
                     /transcript_id="XM_001422527.1"
                     /db_xref="GeneID:5006622"
     CDS             359704..360801
                     /locus_tag="OSTLU_29504"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422564.1"
                     /db_xref="GeneID:5006622"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="JGIDB:Ost9901_3_29504"
                     /translation="MSGDGFFTFTDADPSQWLPKGIVDEREEHDAGAYASFALPQGSA
                     SRSASDDNSRGSFDSFGVKSKVLGSVLYDDEGLIPLGLGGHAYVDKSTSPKSTASPTA
                     AFVADAEFGAAAASGSRLRGPSGPRRAGQGVEEEEQQVASIEVMANGGLRLRVTLLAA
                     GFVIGASGASIREIMRHTGSTIQSWTQQPEMGVYHRPCRVFCIQGLPESVMAASNIIH
                     EAVERYKELCEGKRRGEFVQRLQYIRGVEFSYQPPPKNAVPNAASVNGATRQGTNPLL
                     MPRQPTNAANETMRLLAAAQAQRAAMQHYQNLATQSYAAGLAAGAKMGHVPAISAMSA
                     MPDSENPFAAAQMPNPSDFFTAFSAQTRPNV"
     gene            complement(<360957..>361331)
                     /locus_tag="OSTLU_8188"
                     /db_xref="GeneID:5006623"
     mRNA            complement(<360957..>361331)
                     /locus_tag="OSTLU_8188"
                     /product="predicted protein"
                     /transcript_id="XM_001422687.1"
                     /db_xref="GeneID:5006623"
     CDS             complement(<360957..>361331)
                     /locus_tag="OSTLU_8188"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422724.1"
                     /db_xref="GeneID:5006623"
                     /db_xref="InterPro:IPR001857"
                     /db_xref="JGIDB:Ost9901_3_8188"
                     /translation="APWTPTRALRKRKSYFKRCGHIMETLEREHMKELAKERAIVPFR
                     PGDVVKLTLEVPENNRRTQTFTGICIAKRHRGMGSSFTLRSAIGNLVVERSFPLFTPN
                     IKAMEVVERRKVRRAKLYYLRDK"
     gene            <361770..>362930
                     /locus_tag="OSTLU_43843"
                     /db_xref="GeneID:5006782"
     mRNA            <361770..>362930
                     /locus_tag="OSTLU_43843"
                     /product="predicted protein"
                     /transcript_id="XM_001422528.1"
                     /db_xref="GeneID:5006782"
     CDS             361770..362930
                     /locus_tag="OSTLU_43843"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422565.1"
                     /db_xref="GeneID:5006782"
                     /db_xref="InterPro:IPR002376"
                     /db_xref="InterPro:IPR005793"
                     /db_xref="JGIDB:Ost9901_3_43843"
                     /translation="MRATARATASTPEARAGATPTRAGRRRARRTVTRRTTTTRATGR
                     EDADGATRKRRVVFLGTPECAKEVLARVLDAAEGRESAFEVAAVVSQPGRPRGRGRKS
                     DEAAPSPVAELALRRGMAEDRVLCPEKANEEWFLDALRALDVDLAVTAAYGNFLPQKF
                     LDIPKLGTLNIHPSLLPQWRGAAPVQRALESGQSETGVSVAYTVLKMDAGPVLRQVTR
                     PLKGDEKAPDLLTELFETGVGALLEELPSVFAGDAAARAVPQSEETLSHAAKVSPEEG
                     ELDFTKQSALECHNKVRAFAGWPGTKATLKIKANGDEESKEVVLKIITTRVSAEGDEK
                     AANGQVEVTKKLLRVPCAGGGWLEVLEVQPPGKKAMPANAFINGIKGSTVFI"
     gene            complement(<362973..>363896)
                     /locus_tag="OSTLU_29507"
                     /db_xref="GeneID:5006624"
     mRNA            complement(<362973..>363896)
                     /locus_tag="OSTLU_29507"
                     /product="predicted protein"
                     /transcript_id="XM_001422688.1"
                     /db_xref="GeneID:5006624"
     CDS             complement(362973..363896)
                     /locus_tag="OSTLU_29507"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422725.1"
                     /db_xref="GeneID:5006624"
                     /db_xref="JGIDB:Ost9901_3_29507"
                     /translation="MGVDCQAGACRTWVDDELDAMGEAGAHIPRPGGCCEEDVKKQKE
                     AARMLGELREVDRSTARMRIAEGVVGECGEEDADDEDWARSDGDDDDDEALREIQEAR
                     LRELKGAAAIAAAEARRARYVEIKESALGETVRASSRVVAHLVLEGAEQCARIDEVCD
                     DLAPVFAKTKFVRIRPSHDSALMRQHRISALPAMLIFRRGRLTFTTCALDDFGGAENF
                     EEERVTRWLAKHDALPGHPFAEKTVTNVDSDASSDEENDDASDEELFGVNKPCETCGR
                     TYPHKHIRALRPGESMRRADDSDGDYDDDDF"
     gene            <364372..>365196
                     /locus_tag="OSTLU_89745"
                     /db_xref="GeneID:5006783"
     mRNA            <364372..>365196
                     /locus_tag="OSTLU_89745"
                     /product="predicted protein"
                     /transcript_id="XM_001422529.1"
                     /db_xref="GeneID:5006783"
     CDS             <364372..365196
                     /locus_tag="OSTLU_89745"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422566.1"
                     /db_xref="GeneID:5006783"
                     /db_xref="JGIDB:Ost9901_3_89745"
                     /translation="LFDIKRGFKRVVVLGGASEAITRRLLAERDDVEKIVVVDLSQDM
                     LNFVERRIGAEPRRRDGAPVEVLYVQGDEENLPIQENSVDAVISCLGLHWVNDLPGAM
                     SRAAAALVPDGLFLSCIFGGNTLQELRVACALAETEHEGGVSPRVSPLAHVRDCGSLL
                     GRANLTLPAVDVDIVTVGYASPDELVEHLRAMAETNSGLMRRHLLPRATARAASAMYS
                     QKFPAPDAPDPGAVEATFEILYMTGWRPHSSQQTAKQRGTATVSLSDLQKHLDGDA"
     gene            365476..366546
                     /locus_tag="OSTLU_29509"
                     /db_xref="GeneID:5006625"
     mRNA            365476..366546
                     /locus_tag="OSTLU_29509"
                     /product="predicted protein"
                     /transcript_id="XM_001422530.1"
                     /db_xref="GeneID:5006625"
     CDS             365669..366442
                     /locus_tag="OSTLU_29509"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422567.1"
                     /db_xref="GeneID:5006625"
                     /db_xref="InterPro:IPR001092"
                     /db_xref="JGIDB:Ost9901_3_29509"
                     /translation="MDGATPTADWLSDFFDSFDADDVGAFDGANAFADVPTEVIGGEG
                     PRVRAAGTKRKATEEADGSQDERVAVTATSVAATSVAATTAAATTATGRSNVLSEGAK
                     KTKSTREKRRRDVLNSRFEELSAVLEPGESQGESQSKATVVFAATELIKRLRVEHARL
                     ANMIMRFQEDNLLKTELTQKLAAERDQLMQEKTHLLREKLRIEAQLQGFLTSMPFASP
                     ADGMVSTKSASGVAAWTVPMPFMPASEEGEDVTLRAPVA"
     gene            complement(<366545..>369658)
                     /locus_tag="OSTLU_19066"
                     /db_xref="GeneID:5006626"
     mRNA            complement(<366545..>369658)
                     /locus_tag="OSTLU_19066"
                     /product="predicted protein"
                     /transcript_id="XM_001422689.1"
                     /db_xref="GeneID:5006626"
     CDS             complement(366545..369658)
                     /locus_tag="OSTLU_19066"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422726.1"
                     /db_xref="GeneID:5006626"
                     /db_xref="JGIDB:Ost9901_3_19066"
                     /translation="MATATRDDDDDEALEIVARACCEAMMRTCDDATDGRADEDEETA
                     EERETETETWLGTLCATASTSGRALERALEATRRAAAMDERFTTRVCEEYDASVRRLG
                     DAKDATLAVLIEARAWGRAREASASASDVERALRACDARSLESMAKYVLEEVKESDAH
                     VLRAIARRDSEICVEILGALLSRLSTGVQTRAALRALEEIVQMDAAPHVDRMSSEIQR
                     AVEYLPQLSVKEGGDIARRAVAALSKISGVAPVMALFESVEDDCSKTILGLQMLGDMM
                     RAGNHLDAGIAALERAMVDDRSSVRQHAFVVATTLITSESIADEAMLQKAEAEAKVDA
                     ILSINEILRALSQRRETPTLSFATIQSLTSSLGLILALDVSGKSVKNREILRNSLRLL
                     SALSECLILQAESARDTDGEQINFVDADAFDDANDKVESHVLAKLVPVVEVVLDSMLS
                     YSTWFKEMLEQLEHPKIDEGTSETLESWITRLLFMHLQLSCGSENTRAGNVSSALCID
                     SCVRLSSDDAEWSPELQRHITQICAHTLRVARVSSGDMRASNQYATLMNTCARQCVET
                     LRDNWFAFDKKELAPNSDLWSTKTTLDALQTLRALCELAVSRNASYGPDLGVLQDLMR
                     ASFTDDELENAAKEVASYGKPHLARSDYEAAGRAGVEAPVSGVVAALVTSLHHQLQET
                     YNSRTVIDTWDRIINEVLNLLDTMLPLVENADLASASVVMLEDDIIQLRELPIEPTCH
                     IACTILQYHRRRFPLPDCVKTASEMLKMALSYSLTSIPDELNDLLSVLNEIVTDLSSD
                     NDQHGKIEKQDAFIALTTILVKSGDILWRHVHSKQKSLDDVEANFVSLATHSFERCIS
                     AASKLSRTDGNQKHLESQRRNASLVLAGIRLHHNTDKMSHLYDVKVLRSFELKRRQFM
                     VVCAGVFTNLRALQLVKNSGTPLDRGLVAIGNALAMDDIELYSENLSRLGESVQNVDG
                     EVLKCCPSNVSSRENSASKPRKRIRNPYLDAVVAQEGGAQDEYDDMADFIVCKPGRDY
                     RTVLGLT"
     gene            <370360..>371463
                     /locus_tag="OSTLU_43606"
                     /db_xref="GeneID:5006784"
     mRNA            <370360..>371463
                     /locus_tag="OSTLU_43606"
                     /product="predicted protein"
                     /transcript_id="XM_001422531.1"
                     /db_xref="GeneID:5006784"
     CDS             370360..371463
                     /locus_tag="OSTLU_43606"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422568.1"
                     /db_xref="GeneID:5006784"
                     /db_xref="InterPro:IPR003780"
                     /db_xref="JGIDB:Ost9901_3_43606"
                     /translation="MTLVVGGERATRRVAWWLGGGCAWVFSMVVLGGMTRLTRSGLSM
                     TDWKFEYEHPPLTDEDWAKEFEKYKQSPEYKKSNLGMTVEEYKFIYWMEYGHRMWGRV
                     LGLYFVAPLAYFASKGYVTSALAKRLGVFFVLGAAQGMIGWWMVKSGLEEQEFSYDVP
                     RVSPYRLATHLTGAFTIYTGMLWTTLNVIYPVSPSQSAGASKALIDATKRLHRVVHPL
                     AGLIGVTAISGAYVAGMDAGRAYNTFPLMGGRWIPEEYLDQWEQKGWRNFFENTAAVQ
                     FDHRVLALTTLASVSAVWLGHRNSTALHPRTRMLLHALLATTAGQVTLGVTTLLHHVP
                     VELGSAHQAGALTLFTVVLALMHSLRGPKRLRI"
     gene            complement(<371517..>372248)
                     /locus_tag="OSTLU_5312"
                     /db_xref="GeneID:5006627"
     mRNA            complement(<371517..>372248)
                     /locus_tag="OSTLU_5312"
                     /product="predicted protein"
                     /transcript_id="XM_001422690.1"
                     /db_xref="GeneID:5006627"
     CDS             complement(<371517..>372248)
                     /locus_tag="OSTLU_5312"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422727.1"
                     /db_xref="GeneID:5006627"
                     /db_xref="InterPro:IPR002931"
                     /db_xref="JGIDB:Ost9901_3_5312"
                     /translation="LLRWFKEDFFEWVDKPKCEKCGNAETRLKRTDQGEALRAEEREG
                     EASRAEVYECSTCRAETRFPRYNSAIKLLDTRRGRCGEWANAFTLCCRAMGYRARWVL
                     DWTDHVWTEVYSERQKRWLHCDPCENVCDKPLLYEQGWGKQLSYVIAFSVEGVVDVTK
                     RYTKDMKPLYRRRGEVYEPWLKSRCDALTRELRMQIPANEVKELEAQDAMESLELDKP
                     AVDIGESLPGRQTGSFSWRAARGELG"
     gene            372707..373738
                     /locus_tag="OSTLU_25876"
                     /db_xref="GeneID:5006785"
     mRNA            372707..373738
                     /locus_tag="OSTLU_25876"
                     /product="predicted protein"
                     /transcript_id="XM_001422532.1"
                     /db_xref="GeneID:5006785"
     CDS             372744..373694
                     /locus_tag="OSTLU_25876"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422569.1"
                     /db_xref="GeneID:5006785"
                     /db_xref="InterPro:IPR000156"
                     /db_xref="JGIDB:Ost9901_3_25876"
                     /translation="MTSEGATTTTTAAAAATREPRVGEKRARRDDDDDEANGRRDGGK
                     TTTDDERGGDDAREDGKTNEGKTNDVASEDAAKATTSGFGSALANAGFGGFGGLKSAA
                     ASGGGFGGFAAASASAGTGGFASKAATPVFGGAVAAPVALFGAGKKKETTTEEDEEGD
                     DDPEREVANDSIKPVVELEVIETKTGEEGETCAFRTEGALFEYVNDAENGSRWVERGR
                     GDVRLNEGENGSRLVMRAKGNFRLMLNAALFKGQKFQLMEGGKGVSFTCVNAASGADA
                     KMSTFALKMRAAASNAQSQAENFHVAAKKAIEKLSEETHN"
     gene            complement(<374180..>375903)
                     /locus_tag="OSTLU_19070"
                     /db_xref="GeneID:5006628"
     mRNA            complement(join(<374180..374202,374259..>375903))
                     /locus_tag="OSTLU_19070"
                     /product="predicted protein"
                     /transcript_id="XM_001422691.1"
                     /db_xref="GeneID:5006628"
     CDS             complement(join(374180..374202,374259..375903))
                     /locus_tag="OSTLU_19070"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422728.1"
                     /db_xref="GeneID:5006628"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="JGIDB:Ost9901_3_19070"
                     /translation="MQHDAWNDDTIGGASVSGKRSRSKRMVRARKRARALEAAAKATR
                     NDDDADDAGRRNSANEATTTTETIMLPRTSAPWFSRTLSVHEETSFETYYRRQGIVDE
                     GEWRDFLRYLRLPLPVTFRMNVMASRREEVREALNVAKHFLQNARETRDDRGRLIPPP
                     TRLPWCDGWQLGVDKMSLKFSRNPMLRDLQRWLVKCNNTGVLTRQAVDSMVPAAILQV
                     EPHHRVLDLCASPGSKTTQALEALNVNGEEGSASGCVIANDINPMRCYFLVRRCAALR
                     NATANLMVTTHQAQWYPNINVPTTDKALTERGGRYPEGSYDRIICDVPCSGDGTLRKN
                     PQIWSEWRPEFAMGLHKLQLRIAQRGAALLNVGGYMVYSTCSFNPVENEAVVAELIKR
                     CGGALEIVDASDRIPELLRRPGISTWNVMTMVEGNVVEYPKYEDSQASTVPIGLKRKF
                     AKSMWPPAQSLARMGHLGKRIKSTAIPLQHCMRLVPHLQDMGGFFAVLLKKVAPIPGP
                     QAKESTAEKVDRAYERTEPKHVYSKVSSTLVKKLAKEFGLEVYRVYR"
     gene            <376444..>377709
                     /locus_tag="OSTLU_29515"
                     /db_xref="GeneID:5006786"
     mRNA            <376444..>377709
                     /locus_tag="OSTLU_29515"
                     /product="predicted protein"
                     /transcript_id="XM_001422533.1"
                     /db_xref="GeneID:5006786"
     CDS             376444..377709
                     /locus_tag="OSTLU_29515"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422570.1"
                     /db_xref="GeneID:5006786"
                     /db_xref="JGIDB:Ost9901_3_29515"
                     /translation="MILAHLGGEVERLSAVADETIYPMLTTFGERANDADVMSDAELR
                     DAFVGKLEPLQDALLFMDQVRAVVCNLFTQLTVVYSTFAAYTPYQTVRLAWSFDMLGR
                     ALAIGVGIDEVVRNNRALRSALMNFKRVVLLLRANPEQFGMNEVDVVSLDSAVAIIEN
                     QLLSSSFFASVLTQLTETEQPDRFIKELAGTTLELLESTTARLNTDSERLNDKRTLLS
                     CLCLTMLHSGLVPDIADRKLCMKAWEVYKVCVLVSVTTTVSVCPGAILEAHLSPAARE
                     CFPDNGLESVISFRRETLETLDETFPAKLLDLLSASVAWLTKFTATPNVSHSLSSTMN
                     ARTSLFQEGMRLVNRLRHYTQEIIHLHVSLEAPVTKRRVRLIARAVEMLQAMCEAFTQ
                     NLNLSLEVQHVLKFLADRIHRMMVRLKRF"
     gene            <378211..>379797
                     /locus_tag="OSTLU_2105"
                     /db_xref="GeneID:5006629"
     mRNA            join(<378211..378477,378550..378630,378721..379098,
                     379150..>379797)
                     /locus_tag="OSTLU_2105"
                     /product="predicted protein"
                     /transcript_id="XM_001422534.1"
                     /db_xref="GeneID:5006629"
     CDS             join(<378211..378477,378550..378630,378721..379098,
                     379150..>379797)
                     /locus_tag="OSTLU_2105"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422571.1"
                     /db_xref="GeneID:5006629"
                     /db_xref="JGIDB:Ost9901_3_2105"
                     /translation="LVSAFRNCETLLMRAGASDSEVATFDNYIRTSLEREIIQPLCRD
                     IETDLRLHLHSARIAGVMNTNPFKDGVRDLSLFTNLPPIYTLKHQIDIRNRVEGYLNQ
                     TFHNHTAIALHNWKSYVEMRNLAIEKYGLRCAEIELPSQTLEQGLDVLELMRNIHVFV
                     SRYNYNLNTQCFVEKASAALDRKHLNTISIRHVANSIRTHGTGITHTTINFAYQYLAQ
                     RFQIFNQFLFDDHIRSQLMKEARMQAGYRASTVDEKFEYPVERALRVMRDIRKLGLSK
                     DGSSFIDEFRVLVTEIGNALGFVRMVRLGAMHYSTNAAKFVPSARGSKFALDESLDAD
                     GLSEWTKTALKNLQSELKALSTGGTDGTDYFQVLVSVFSTELRKGHEHLKDFYLVLPA
                     LTMSAAETILASKDKLVRRGKDSQTATFTDDGLALGIVYLLSVLDQHEAFDALHWFES
                     ASHHFEAE"
     gene            <380245..>381555
                     /locus_tag="OSTLU_43874"
                     /db_xref="GeneID:5006630"
     mRNA            <380245..>381555
                     /locus_tag="OSTLU_43874"
                     /product="predicted protein"
                     /transcript_id="XM_001422535.1"
                     /db_xref="GeneID:5006630"
     CDS             380245..381555
                     /locus_tag="OSTLU_43874"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422572.1"
                     /db_xref="GeneID:5006630"
                     /db_xref="InterPro:IPR001986"
                     /db_xref="JGIDB:Ost9901_3_43874"
                     /translation="MEQLTLKPMKKIEGTVRLPGSKSLSNRILLLAALAEGTTKVENL
                     LDSDDIRYMVDALKVLGLSFTEDRENNILEITGCGGKLPVEGAELFLGNAGTAMRPLT
                     AAVAAAGKGTFILDGVERMRERPIQDLVDGLVQLGVKAECTMGTGCPPVKVEANGLPG
                     GRVELSGSVSSQYLTALLMAAPLCEGSIEIVIVDELISKPYVEMTITLMERFGVKVEK
                     ADDLQSFKIQGGQKYISPGSAFVEGDASSASYFLAGATITGGTVTVIGCGSESIQGDT
                     NFAYTMEQMGATLEWGPNSVTCTGPKGPLKAIDVNMNAMPDAAMTLAVAALFADGITT
                     IRDVASWRVKETERMIAICTELRKLGCDVFEGADYCVITPPHKLDPPAKMKANVDIDT
                     YDDHRMAMAFALAACGDVDVVINDPKCTKKTFPTYFDVLKSVAK"
     gene            complement(<381664..>381951)
                     /locus_tag="OSTLU_13482"
                     /db_xref="GeneID:5006631"
     mRNA            complement(<381664..>381951)
                     /locus_tag="OSTLU_13482"
                     /product="MPT family transporter: inner membrane
                     translocase (import) Tim9"
                     /transcript_id="XM_001422692.1"
                     /db_xref="GeneID:5006631"
     CDS             complement(381664..381951)
                     /locus_tag="OSTLU_13482"
                     /codon_start=1
                     /product="MPT family transporter: inner membrane
                     translocase (import) Tim9"
                     /protein_id="XP_001422729.1"
                     /db_xref="GeneID:5006631"
                     /db_xref="InterPro:IPR004217"
                     /db_xref="JGIDB:Ost9901_3_13482"
                     /translation="MDPAMLDGFPEEDKAKMMGMIEAMQTRDSLKMYNNLVERCFSTC
                     VQSFRRKTLEKDEERCVSKCCEKFLKHSARTSVRFAELNAQSMQQMGGPPQ"
     gene            <383013..>383447
                     /locus_tag="OSTLU_9011"
                     /db_xref="GeneID:5006787"
     mRNA            <383013..>383447
                     /locus_tag="OSTLU_9011"
                     /product="predicted protein"
                     /transcript_id="XM_001422536.1"
                     /db_xref="GeneID:5006787"
     CDS             <383013..>383447
                     /locus_tag="OSTLU_9011"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422573.1"
                     /db_xref="GeneID:5006787"
                     /db_xref="InterPro:IPR001471"
                     /db_xref="JGIDB:Ost9901_3_9011"
                     /translation="RQVYLGGHLEEEFAAEAFDIIVLKLARIGDRSRTGTRPLKMNFP
                     ESRYANLIGFIDSLTLDELIMEVRRHSEGFARGNSGYRGVTQHSPKKFEARVGVPPQS
                     KHVYLGLYDSAEKAAVAYDTALVQARGRRASTNFPIYNYDEHI"
     gene            complement(<383620..>384561)
                     /locus_tag="OSTLU_29520"
                     /db_xref="GeneID:5006632"
     mRNA            complement(<383620..>384561)
                     /locus_tag="OSTLU_29520"
                     /product="predicted protein"
                     /transcript_id="XM_001422693.1"
                     /db_xref="GeneID:5006632"
     CDS             complement(383620..384561)
                     /locus_tag="OSTLU_29520"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422730.1"
                     /db_xref="GeneID:5006632"
                     /db_xref="JGIDB:Ost9901_3_29520"
                     /translation="MRRPSARNKSPYVADVRVKSDESVAIAHVPNLDSGGKLREGARA
                     LCSRQKGVTATTLGQHGTPKCELICRLLRCEERENEHLGGVWLSAHPSLVEKIALALL
                     ENGALDDRLHASPIIRDEIKTQKTLKREVTESASNSYRPDFALKHEDGSTTILEVKQV
                     VDTDYAREFVEAQAREQSPHPAYSPSAKKGEPYARAGIFPWGKRGQKGPDGEKVVSAR
                     AIEHLRELSELASKSPDVHPAVLFICSRADAMGMRPNGAACPSFAKHLSRAQRKGVRV
                     LVQKVRWGEGDDVGKAFDAGPLELWPALEEGDEFTMK"
     gene            <384795..>385829
                     /locus_tag="OSTLU_19075"
                     /db_xref="GeneID:5006788"
     mRNA            <384795..>385829
                     /locus_tag="OSTLU_19075"
                     /product="predicted protein"
                     /transcript_id="XM_001422537.1"
                     /db_xref="GeneID:5006788"
     CDS             384795..385829
                     /locus_tag="OSTLU_19075"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422574.1"
                     /db_xref="GeneID:5006788"
                     /db_xref="JGIDB:Ost9901_3_19075"
                     /translation="MPPDDARASAKDRSSAPAETSVDETSRYFTDGEREWYDSERIRA
                     CATHLLERCATCGEDQSVSNDYWRRVQRERYVRAVATRVATKDAAKPRRVVVEVECPL
                     FALARGGNAVFNVSVVAPLENLYAKVRERIAKVVEKLRHEGFPFQASGLGEEINDYVN
                     QFYLSRMDSERYTENGVHVFTHILYRDETLLDCMPTVIANQPTLSKLITEKSMELPPY
                     PLLTAVLKSCVQHMFIIADAYESTVQQLGEPNHSLSDEIFWMNPGDTFQRHFVDMCNF
                     FNRPVDDVRFVACDSDRKFFVVEPTDTPEKLHLRDQTELVMVNRALMSTIEFLQHRGS
                     KLFTRPAGGV"
     gene            complement(<385872..>386540)
                     /locus_tag="OSTLU_43762"
                     /db_xref="GeneID:5006633"
     mRNA            complement(<385872..>386540)
                     /locus_tag="OSTLU_43762"
                     /product="predicted protein"
                     /transcript_id="XM_001422694.1"
                     /db_xref="GeneID:5006633"
     CDS             complement(385872..386540)
                     /locus_tag="OSTLU_43762"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422731.1"
                     /db_xref="GeneID:5006633"
                     /db_xref="InterPro:IPR003697"
                     /db_xref="JGIDB:Ost9901_3_43762"
                     /translation="MILHRLSALNALHVVLASASPRRREILRDVVGVECDIAPSAFAE
                     NLPHEDYDGAAAYARATAWMKAMDVYENWDANERGSEMPDVIIGADTVVESADGTTME
                     KPADAASATAMLRALSRSESKVHTGVAIIGGKISKKTGKIYGKSFSETTRVEFAELKA
                     EEIAAYVATKEPYDKAGGYGIQGPAAVFIRGIVGDYFNVMGLPAHAFARELESMIDDV
                     VEHA"
     gene            <386744..>387121
                     /locus_tag="OSTLU_43597"
                     /db_xref="GeneID:5006789"
     mRNA            <386744..>387121
                     /locus_tag="OSTLU_43597"
                     /product="predicted protein"
                     /transcript_id="XM_001422538.1"
                     /db_xref="GeneID:5006789"
     CDS             386744..>387121
                     /locus_tag="OSTLU_43597"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422575.1"
                     /db_xref="GeneID:5006789"
                     /db_xref="InterPro:IPR001164"
                     /db_xref="JGIDB:Ost9901_3_43597"
                     /translation="MASDEREQQALQKRLLECLKRPENLTCAECAMRLPRWASTSLGV
                     FFCTNCSGSHRGLGVHISKVKSTTLDKWTEAQVAHMERVGNAKANAYWEANVRAGVKP
                     GATSGRDACERFIRDKYERQLYKD"
     gene            complement(<388354..>388566)
                     /locus_tag="OSTLU_9423"
                     /db_xref="GeneID:5006634"
     mRNA            complement(<388354..>388566)
                     /locus_tag="OSTLU_9423"
                     /product="predicted protein"
                     /transcript_id="XM_001422695.1"
                     /db_xref="GeneID:5006634"
     CDS             complement(<388354..>388566)
                     /locus_tag="OSTLU_9423"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422732.1"
                     /db_xref="GeneID:5006634"
                     /db_xref="JGIDB:Ost9901_3_9423"
                     /translation="KSMAPYMQTLARTAEFKRIRFVRVDIEAVPAVAEKCNVKALPTY
                     QLYKNGEKLEEMSGALPSKLVAMLKEH"
     gene            389014..392128
                     /locus_tag="OSTLU_25878"
                     /db_xref="GeneID:5006790"
     mRNA            389014..392128
                     /locus_tag="OSTLU_25878"
                     /product="predicted protein"
                     /transcript_id="XM_001422539.1"
                     /db_xref="GeneID:5006790"
     CDS             389092..392109
                     /locus_tag="OSTLU_25878"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422576.1"
                     /db_xref="GeneID:5006790"
                     /db_xref="InterPro:IPR003307"
                     /db_xref="JGIDB:Ost9901_3_25878"
                     /translation="MSDSESDYSDDDAHIGGGDRDAEETYDGAGGEATLNVDVGSSLT
                     SADWADIDNSDLVAKVRGSAGFRIMREIQPWDGALDAPPDLMKRHVFEYFYTQRKDSD
                     FYKKLAKDCFPSEYERAGADKSEKKRLANLWAGAVLDELKAMRDGAKHTLRWINAIKE
                     AQAGDLLFLKREALTHGPGSVQEIASQIVWDNVSNRIKDQTFAAMHAWTNKSGAQSGG
                     VARMYKHQHELIDQLDKHYAAIGKMQEAKKPLPKPLHVILSTPTGSGKTFTAILVHLR
                     LLKVKYPDAILLYSVPTKQVLKRVGQECEAHAVPYWTAARDNTGDGTLHQVRRPYSIR
                     DKARNKKALRAARAIGEKVSAGSGTIQQQLEYAADVGYKLKDHGAGKPDIIIADLNTT
                     AALLKACKEESSSSFYHESKILLYFDEPNMGIHLDPNVLGVVSSIQANMPLTAVLASA
                     TLGAWEGLEPWWRGPTDANQITISLEPYELPMAKLAVFNEGTSEFSPMSPLNLIENYA
                     EYQRVMEDYRLPTLLLRHLTARHGNDLLQIQPPGGPWDKVQGDVKSLRLAIEPTFTSL
                     SQKEFERLQGRWKMGEDAPTKVDGIRGALSKEGVTMVGCLDPRKVAFELAGFADQEAW
                     IQDVHKLNNKLKEAERMVKENAKAEKRKKKDDEDEAKDGGDEGGVGVVTLRPMLKISL
                     AEALEADINTLVMLSKGIAYACGSGTEPMVKRLYNQALLTVPDSLRGRSPPLNVLVVD
                     YSSIYGTDCPAVDTLLLQEDLGRLLAWEDLQQFLGRLRRDGTAVFYSKKTLRRAALGA
                     AVEEEETTALIEFQKLVENSVLDLEKAQKRDTDSVTALVTKLSASSGRSAGEVASYVL
                     ASVISFALSAPSHLDGAGVYPATIPESDKELLAAITKRVEGYSDALENVLKKMSEQVR
                     AVSAIEALSLSANPFASRTGGARVLGIAAQVLKMLYDADILSEEALFAWANAKRKELL
                     AESDGDARFFGKAKPFIQWLSEASDEDSDEEEE"
     gene            complement(<392175..>392744)
                     /locus_tag="OSTLU_19080"
                     /db_xref="GeneID:5006635"
     mRNA            complement(<392175..>392744)
                     /locus_tag="OSTLU_19080"
                     /product="predicted protein"
                     /transcript_id="XM_001422696.1"
                     /db_xref="GeneID:5006635"
     CDS             complement(392175..392744)
                     /locus_tag="OSTLU_19080"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422733.1"
                     /db_xref="GeneID:5006635"
                     /db_xref="JGIDB:Ost9901_3_19080"
                     /translation="MTMHGTTFVVNVRVLAREASNWRGIFVDLSGHAPEPATGTAATD
                     AWERVQAALLEALRAREGVIDISDIVDAQSDAIGPPTVSGVLLDFPCVYAFPTESMSS
                     AAAMLSSCSLSVHSLECRRRDGVDNESELAYGWSIPSSLIMDDDARVKFEAAVATWRD
                     VVADCLRSLGFCASHQVAYTAPGSNRIAF"
     gene            complement(<393122..>395419)
                     /locus_tag="OSTLU_43578"
                     /db_xref="GeneID:5006791"
     mRNA            complement(<393122..>395419)
                     /locus_tag="OSTLU_43578"
                     /product="predicted protein"
                     /transcript_id="XM_001422697.1"
                     /db_xref="GeneID:5006791"
     CDS             complement(393122..395419)
                     /locus_tag="OSTLU_43578"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422734.1"
                     /db_xref="GeneID:5006791"
                     /db_xref="InterPro:IPR004193"
                     /db_xref="InterPro:IPR006047"
                     /db_xref="JGIDB:Ost9901_3_43578"
                     /translation="MTTVVKTTTRTPPKPPAAVRGVCETPTRGNAQALGATRVRGDKD
                     DSVNFAVFSSSATAVSLVLWTPEALAKGEITAEIELDDRVNKTGSVWHVALPKCAENV
                     LYGYRVDGPYEPEKGHRFDRSKVLLDPYAKATVSRPRYGELGKKADGSEDCWPQYAGA
                     VPKKNKKDDREDFDWQGVTSPNRPMSDLVVYEAHVRGMTADLKTKAQPGTYAALVETL
                     PYLKTLGVNAIELMPCHEFNELEYHSVNPATGEFRRNFWGYSTVNFFSPMTRYAEAGD
                     KDCGRAAAQEFKYMVREAHRAGIEVIMDVVFNHTAEGNEEGLTLSFRGLDNRVYYMVA
                     PEGQFYNYSGCGNTMNCNHAVVREFIVECLRYWVLEYHIDGFRFDLASILTRASSEWD
                     RANIFGESTAETPMLEEVAIGTPLQDPPLIDAVSNDPVLAGTKLIAEAWDAGGLYQVG
                     SFPHFGVWSEWNGKFRDDVRNFIRGVDGYAGLFAERLCGSPELYADGRTPAASINFVT
                     AHDGFTLRDCVTYNEKNNIANGEENRDGEEHNQSWNCGLTCEDDGESCDPEICSLRDR
                     QMRNFMVALFVAQGVPMLYMGDEYGHTKCGNNNTYCHDNWMNWVNWDEANDPLAGEGL
                     ARFVRQLTTLRKDNSAFRLPAFPTAENIQWHGHKPEVPLWEEDSRFVAFTLQDTTESP
                     KFYVAFNAHHEPAFVKLPTPPEGQRWKLVLDTALETPFDFVSGDDVAEADLYTAEAMI
                     LPSLRRNAYVCVDRSAVIFQAVPIE"
     gene            <396653..>397048
                     /locus_tag="OSTLU_8942"
                     /db_xref="GeneID:5006792"
     mRNA            <396653..>397048
                     /locus_tag="OSTLU_8942"
                     /product="predicted protein"
                     /transcript_id="XM_001422540.1"
                     /db_xref="GeneID:5006792"
     CDS             <396653..>397048
                     /locus_tag="OSTLU_8942"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422577.1"
                     /db_xref="GeneID:5006792"
                     /db_xref="InterPro:IPR002180"
                     /db_xref="JGIDB:Ost9901_3_8942"
                     /translation="ERVRLGVCIGEFHNKLMDRMLEDARVSAEAMGATIDKVVWVPGT
                     YEAPLVVENMLQDPTLDACVVLGYIEKGSTLHGQEMGATFSIIAKQLELEYGKPVGMG
                     IIGPGATAEQAEMRVAYAGNAVRASVRMAR"
     gene            <397222..>398436
                     /locus_tag="OSTLU_43450"
                     /db_xref="GeneID:5006636"
     mRNA            <397222..>398436
                     /locus_tag="OSTLU_43450"
                     /product="predicted protein"
                     /transcript_id="XM_001422541.1"
                     /db_xref="GeneID:5006636"
     CDS             397222..398436
                     /locus_tag="OSTLU_43450"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422578.1"
                     /db_xref="GeneID:5006636"
                     /db_xref="InterPro:IPR000537"
                     /db_xref="JGIDB:Ost9901_3_43450"
                     /translation="MLAAARRRASAARASTVEACARALASGSATRARASACANAARGT
                     WAEASTSTPPRAAHASSFVARRPRTGDGEYFRSFAASASTSHSSRVKADEEASSASSA
                     ATPAPEAENTWVDRVVPSSLVPYAKLVRLDRPIGTALLAWPCFWSIALAADAGALPDA
                     RLLGLFGVGALLLRGAGCTVNDLWDRDIDNKVSRTRNRPIASGAVSVPKAILFLGAQL
                     ALGLGVLVQLNDYSKILGASSLALVAAYPAMKRITNYPQAFLGLTFNWGALLGWAAVH
                     GSCDWGAVLPLYASGVAWTLVYDTIYAHQDKHDDAKVGIKSTALHFGKDTKKYLGAFA
                     LAGTSALCASGAYVGLDYPFYVGVATATSHLFWQIATVDLDDREDCAAKFRSNSTYGA
                     LVFAGIVAGKVF"
     gene            complement(<398492..>401419)
                     /locus_tag="OSTLU_94099"
                     /db_xref="GeneID:5006637"
     mRNA            complement(<398492..>401419)
                     /locus_tag="OSTLU_94099"
                     /product="predicted protein"
                     /transcript_id="XM_001422698.1"
                     /db_xref="GeneID:5006637"
     CDS             complement(398492..401419)
                     /locus_tag="OSTLU_94099"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422735.1"
                     /db_xref="GeneID:5006637"
                     /db_xref="InterPro:IPR007187"
                     /db_xref="JGIDB:Ost9901_3_94099"
                     /translation="MPRDDAARAEDAREGIARAIDADARPRGGLDARKSRANASDGTN
                     VWMRGERRDGALTRAHGAEDDETRARDVGRAFCVERARPGGREPMRWRALDAARDLGL
                     RDACEVATFVDDDACVVFTEAGDGAYVRDVYSPTMRATAIETAYVEVKGARARATRCA
                     ATETTSGTARAVVGDSNGNLYAVESDGKDGVTWKVFDRTNTSHWVDDMHDEEEEEGNG
                     GSAPGSPMKTPGKSRAWGAIRSATMAAGALLSRRVNVGGVRSLSFVDGSTETKRRLLV
                     CVADGKLEEWSLDVSVSEKSPTLAHVHKLGKKIQKSLRVSSNIVFVSADWTLTKAGVD
                     ITVLVECDGRGSLHRFQRAHGTDTMNLIASAVPPAGALPNNFLHAKVVVDGEDTFVLA
                     GDGSAVMFSGVDYSRVSARMDASNHEPIIDIKRVGTGEWLILTKESGCSTFKPHASGR
                     QTTPRRSAKETPKRTTRSSSHVTSPSANPVDDTNASECVRVEFENYFAGQSGPLGQTK
                     SRLRASGAFVSDAAPFATMSKGLVDALPKKLSGKSTRGGGPTIEEHGAEKLNRHLLFL
                     DFLTESGAWSEINAEERSEILMHGEMIAALSQLRGLQHTVDDEMKPMLEEIVTHAGAA
                     IKETDSALDERSDVEVCFSRSSEARLMFPAVVYVLEKNLAKNKALEKRAITLDTCARG
                     LLVALEAANDFRRRRTGLYPPFSSSVGVNWTCEIEAREALRALSKTAITLYKEAALSK
                     THVGLAPVLGSRLMASAAPLLDASAANLNAALPSSTDRIEAHDEYVADRALVLPTLLE
                     CATHSTTVPQQDRPQRGSLTEGVDVSVESVAAVAEAHFGYAELFEICDAPNATGRLHH
                     YMRTLLGAQEDGEETFAHFVYRKLAIVQDRAAALLRDLPVEFHGDLERFLSSHPDLRW
                     LMELRMGKYARASETLASIGNRAGTAEDEKRRMLSMAKLAALAAGGDVEERIESIDAS
                     LSA"
     gene            <401710..>402711
                     /locus_tag="OSTLU_29530"
                     /db_xref="GeneID:5006793"
     mRNA            <401710..>402711
                     /locus_tag="OSTLU_29530"
                     /product="predicted protein"
                     /transcript_id="XM_001422542.1"
                     /db_xref="GeneID:5006793"
     CDS             401710..402711
                     /locus_tag="OSTLU_29530"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422579.1"
                     /db_xref="GeneID:5006793"
                     /db_xref="InterPro:IPR000467"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="JGIDB:Ost9901_3_29530"
                     /translation="MRAKGAIGGKAGVLRAQANALRAARSRTLRDAEARRAESKKRAR
                     ERKEDSRGGEDEVKTIEVAVASDEEETDDVDDGYDPAAPNDYERTLAERAERARRRRD
                     LNANEELRKELESKRKAMESQRSAMDREEVLGVDGREARRRRLAMGRDAGASRDTNSA
                     SGAQKANKGKSAAEKMMEKMGWTKGRGLGKSEQGMTTPLEVRKDSATSGKIVNAAPVI
                     FEKKKVPLRGKPTPVLLLRNVVLAGEVVDTLEDDVAEHCEKFGDVVRVFIFEIEEEGF
                     AKEETVRIFVEFVDTKTAISAGAELDGRVFANRVVKASYYDVERFEAGDLGPQAGET"
     gene            complement(<402838..>403095)
                     /locus_tag="OSTLU_29531"
                     /db_xref="GeneID:5006638"
     mRNA            complement(<402838..>403095)
                     /locus_tag="OSTLU_29531"
                     /product="predicted protein"
                     /transcript_id="XM_001422699.1"
                     /db_xref="GeneID:5006638"
     CDS             complement(402838..403095)
                     /locus_tag="OSTLU_29531"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422736.1"
                     /db_xref="GeneID:5006638"
                     /db_xref="JGIDB:Ost9901_3_29531"
                     /translation="MVRLYSKTDKMTHVLTADYAAARRAFSREGLKAARKHVEKAISN
                     SSSEYGLLLMIVGCVIIVTASVLAVVTFPTRESTRGKTKTE"
     gene            complement(<403867..>404304)
                     /locus_tag="OSTLU_8522"
                     /db_xref="GeneID:5006794"
     mRNA            complement(<403867..>404304)
                     /locus_tag="OSTLU_8522"
                     /product="predicted protein"
                     /transcript_id="XM_001422700.1"
                     /db_xref="GeneID:5006794"
     CDS             complement(<403867..>404304)
                     /locus_tag="OSTLU_8522"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422737.1"
                     /db_xref="GeneID:5006794"
                     /db_xref="InterPro:IPR009688"
                     /db_xref="JGIDB:Ost9901_3_8522"
                     /translation="KAKNAKEREIDATTRKWGLEAGLWKVFKNGGGAAGGTETGEGAS
                     EGAEELGTSRMDMAKKLLKRYGSAYLATSISLSLISITVFYFLVAGGVDVASLLDKIG
                     ISVNATSEQFGTFALAYAAHKASSPIRFGPTVALTPMVAKWFGK"
     gene            <404803..>406941
                     /locus_tag="OSTLU_43806"
                     /db_xref="GeneID:5006795"
     mRNA            join(<404803..405570,405667..>406941)
                     /locus_tag="OSTLU_43806"
                     /product="predicted protein"
                     /transcript_id="XM_001422543.1"
                     /db_xref="GeneID:5006795"
     CDS             join(404803..405570,405667..406941)
                     /locus_tag="OSTLU_43806"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422580.1"
                     /db_xref="GeneID:5006795"
                     /db_xref="InterPro:IPR004101"
                     /db_xref="JGIDB:Ost9901_3_43806"
                     /translation="MSRVSSATRRCVARRPSAATLGRATGRPRATTRRRTTRGCPRED
                     ARGRATRARATTRDARASDDDEGCDDDARDDVGTGAARAHAEIGREEDEEGDAEALLR
                     EIFEDAGVDARWIALEDDEDVEISGIANDVNALLSGDLFVCGSAREGGAMEDAAREAV
                     AAGAVAVVSERAIEGLADVPIAVVEDVDEALADIARVFYGDPSKALTAIALTGSVGKT
                     TTSYLVKAVFEEADIRMGLVGSNGNYVGDELKLTAQGGRGSDALQFQQLTAGIADNGA
                     QAAVMEVSAEQVRRKATRGMNFDIVALTSPLEGPDAMSDRRKDYRGLDAEYSSHVAEV
                     FKALEDAETQRAVINVDAIDDNDKTPYHELCKEHAKGVPQLTYSVDPENPNGADVYPA
                     RVDYSLFETAVSLSTPAGNVEVVVGLVGEHMVNAICCATAIGLAAEIPLDVIAAGLEA
                     TDSIPGRMELVDAGQDFSVLVDSANTPEAIRSVIDSVKATNCRRVITVIGCEGEMAES
                     ERGQRAVIGKTVHDHSDVVFVTNDSPKAEDPYKILEDICAGFRDEIYSKPGMEDEALF
                     PFLKDMYEVHENAQYECMRLQNLVRRYVMVDRYHAIRAAIGMAERDDVVLIIGRGAKD
                     YFVVGREKHWFDDVVEARDALQKIGAIQDSGVDTHNLPWMSLAARATNPGAGNLLG"
     gene            <407804..>408931
                     /locus_tag="OSTLU_29534"
                     /db_xref="GeneID:5006639"
     mRNA            <407804..>408931
                     /locus_tag="OSTLU_29534"
                     /product="predicted protein"
                     /transcript_id="XM_001422544.1"
                     /db_xref="GeneID:5006639"
     CDS             407804..408931
                     /locus_tag="OSTLU_29534"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422581.1"
                     /db_xref="GeneID:5006639"
                     /db_xref="JGIDB:Ost9901_3_29534"
                     /translation="MTEREYEWKHINARDFPSLEDGFRVLREIRYLIWKIGDVEILRA
                     AANVRESHPGTGAPLGDGLRNLDMFDHSNFVIAYFHVPVEIYRFYHEEMPSLVPDLED
                     RKKCKVLATQGGLYRKNMSEWWCVVDYLLAIGYEWPVETMAKLVHWHRKFDDTEKKAL
                     EDYKAAGCPYHPRVVREAAKQGSLDALKWLREKNAPFDKYAVSWAANSGQVETLKYLV
                     QEIKVKPDPMMCARAAEAGELTALQTLHEAGVPWDKRCIIAAAKEKKSKKKRKREEWS
                     SWNKLGRIRCLQFALAYGCPGAEDALALSDQISENTRIYLRQVVRCPGINHWFFRISR
                     ILGKTVQTKMPAAERTVLEVCTNELRLRQLNFESDAFAGIV"
     gene            409097..410856
                     /locus_tag="OSTLU_29535"
                     /db_xref="GeneID:5006640"
     mRNA            join(409097..409496,409531..410856)
                     /locus_tag="OSTLU_29535"
                     /product="predicted protein"
                     /transcript_id="XM_001422545.1"
                     /db_xref="GeneID:5006640"
     CDS             join(409494..409496,409531..410838)
                     /locus_tag="OSTLU_29535"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422582.1"
                     /db_xref="GeneID:5006640"
                     /db_xref="InterPro:IPR001431"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="JGIDB:Ost9901_3_29535"
                     /translation="MVTTLANGLRVATEAVPYAETATVGVWIDAGSRYEDAQTNGTAH
                     FLEHMAFKGTKTRSASGLEEEIENMGGHLNAYTSREQTTYYAKVFKKDVGAAVDILSD
                     ILQNSALENAQIERERGVILREMEEVEKDIEEVLFDHLHATAFQQTSLGTTILGSDKC
                     VRSVTQEDLQTYIKTHYTAPRMVVVGTGAVDHDELVKLAEKAFASLPTEGASTNALVA
                     KNPGHFTGSEVRIRDDDMTTVNFAVAFKGASWTSPDAVPLMVMQAMLGSWDKQAIGAD
                     DMMSPLAQAFSANKLGNSFMAFNTNYADTGLFGVHVSSDNIDGLDDTAFAVMREFQNL
                     IYCPEENDLLRAKEALKSSLLLHSESGTSAVAEEVGRQLLTYGKRMSRAELFARIDDV
                     NIETVKSVAWKYIRDQELAIAAIGPTQFLPDYLWFRTSTYNNFY"
     gene            complement(<410949..>411401)
                     /locus_tag="OSTLU_29536"
                     /db_xref="GeneID:5006641"
     mRNA            complement(join(<410949..411139,411308..>411401))
                     /locus_tag="OSTLU_29536"
                     /product="predicted protein"
                     /transcript_id="XM_001422701.1"
                     /db_xref="GeneID:5006641"
     CDS             complement(join(410949..411139,411308..411401))
                     /locus_tag="OSTLU_29536"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422738.1"
                     /db_xref="GeneID:5006641"
                     /db_xref="JGIDB:Ost9901_3_29536"
                     /translation="MSAARGALLRLGARLRLAQPMRPASGASRGFASGGGGVTHEGVT
                     LHDASFAHKALGTGFGAVMWFWVFYRFYHDGDTLIYGHAPHFEHDDDDHH"
     gene            complement(<411554..>413038)
                     /locus_tag="OSTLU_29537"
                     /db_xref="GeneID:5006796"
     mRNA            complement(<411554..>413038)
                     /locus_tag="OSTLU_29537"
                     /product="MFS family transporter: glycerol-3-phosphate"
                     /transcript_id="XM_001422702.1"
                     /db_xref="GeneID:5006796"
     CDS             complement(411554..413038)
                     /locus_tag="OSTLU_29537"
                     /codon_start=1
                     /product="MFS family transporter: glycerol-3-phosphate"
                     /protein_id="XP_001422739.1"
                     /db_xref="GeneID:5006796"
                     /db_xref="JGIDB:Ost9901_3_29537"
                     /translation="MDSAANAKRVAPGIRAYLNRRRRPLTASQHRSLVLAVTFAAYAM
                     YHASRKPPSIVKSVLHPDEESVKMGARGWAPFDGEDGTTVIGTCDFAFLASYSVGMFF
                     SGHIGDRMDLRKFLTFGMLMSGFWVSMFGMGYYWNVHSVWYYVAVQMVAGVMQSTGWP
                     SVVSVMGNWFGKGKRGLIMGVWNAHTSVGNMLGSILAASALRNSNWGMSFIIPGVLMM
                     VTGMLVWNFLVVAPEDVGLPPANAPTSSSSATALDEFDEESMARRRLIEGGSSRGTER
                     EKAVGFVAALKIPGVITFSLCLFFTKLVAYTFLYWLPFYIERTEIAGNYLSAAKAGEL
                     SIVFDLGGILGGILAGYVSDKYNARSMTAAGFVYLSIPVLYMYREFGSRSMSMNLGLM
                     ALSGMLVNGPYALITTAVSADLGTHESLKGNSRALATVTAIIDGTGSIGAAIGPMLTG
                     FITSFSDDWNHVFYMLYVADLCAGLLLTRLIFKEARAMLAASAV"
     gene            <413263..>414084
                     /locus_tag="OSTLU_19089"
                     /db_xref="GeneID:5006797"
     mRNA            <413263..>414084
                     /locus_tag="OSTLU_19089"
                     /product="predicted protein"
                     /transcript_id="XM_001422546.1"
                     /db_xref="GeneID:5006797"
     CDS             413263..414084
                     /locus_tag="OSTLU_19089"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422583.1"
                     /db_xref="GeneID:5006797"
                     /db_xref="JGIDB:Ost9901_3_19089"
                     /translation="MAPRARRIDAPRVARADARATSTLGDACASCDACACDDCGGFIV
                     DGGPAYGPKRALGAHFRSGAREWFDTSGMCGCERHAREACETCETTLRLDGFAGGGDH
                     AEYNEFVRQYLRAVRLHCDAKRESREGARDAYHPSARRGTAVEWARDGALLGALVVAA
                     IHLSLKRAKSKRGSDAESSRVLQMYVALLWRRPFPETADLMDVIASAVRSADADARAK
                     IFDALDKPRSNDLMDFEDAIETLMRSMQAGRVLGVRDDFIAALTALKAALSRNLR"
     gene            <414774..>415370
                     /locus_tag="OSTLU_19090"
                     /db_xref="GeneID:5006642"
     mRNA            <414774..>415370
                     /locus_tag="OSTLU_19090"
                     /product="predicted protein"
                     /transcript_id="XM_001422547.1"
                     /db_xref="GeneID:5006642"
     CDS             414774..415370
                     /locus_tag="OSTLU_19090"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422584.1"
                     /db_xref="GeneID:5006642"
                     /db_xref="JGIDB:Ost9901_3_19090"
                     /translation="MHAAAHARTSAFAGAILVPKRAAVRSRNARAAPVRAATTEERQE
                     LCKAEIPPHLPRADFVKQMYRWATSEFAESGLSRYGKRMAVECINELENGDTNGVLVR
                     LYDFEDGKEVEIARLIAQMDDEKVQVWDTIVPTKDGGIEKMNRDGKDKFIDGRFFVIS
                     RPLPANENANAALKAMIKNLMLAINAYYSFGSPFAEDF"
     gene            complement(<415524..>415856)
                     /gene="MRPL20"
                     /locus_tag="OSTLU_19091"
                     /db_xref="GeneID:5006643"
     mRNA            complement(<415524..>415856)
                     /gene="MRPL20"
                     /locus_tag="OSTLU_19091"
                     /product="Putative mitochondrial ribosomal protein L20"
                     /transcript_id="XM_001422703.1"
                     /db_xref="GeneID:5006643"
     CDS             complement(415524..415856)
                     /gene="MRPL20"
                     /locus_tag="OSTLU_19091"
                     /note="Putative mitochondrial ribosomal protein L20,
                     imported to mitochondria"
                     /codon_start=1
                     /product="Putative mitochondrial ribosomal protein L20"
                     /protein_id="XP_001422740.1"
                     /db_xref="GeneID:5006643"
                     /db_xref="InterPro:IPR005813"
                     /db_xref="JGIDB:Ost9901_3_19091"
                     /translation="MAIKDKIFKAAKGFRGRAKSCVKIARNRVEKAWQYQYRDRRNKK
                     RDWRALWITRINAATREHGVRYNEFINSLTAENVCVDRKILAELAVNEPKSFKALVDR
                     VRYMRGMD"
     gene            <416111..>417125
                     /gene="RPS8"
                     /locus_tag="OSTLU_29541"
                     /db_xref="GeneID:5006798"
     mRNA            join(<416111..416114,416246..416318,416540..>417125)
                     /gene="RPS8"
                     /locus_tag="OSTLU_29541"
                     /product="Ribosomal protein S8, component of cytosolic 80S
                     ribosome and 40S small subunit"
                     /transcript_id="XM_001422548.1"
                     /db_xref="GeneID:5006798"
     CDS             join(416111..416114,416246..416318,416540..417125)
                     /gene="RPS8"
                     /locus_tag="OSTLU_29541"
                     /note="Cytosolic 80S ribosomal protein S8; Cytosolic 40S
                     small ribosomal subunit protein S8"
                     /codon_start=1
                     /product="Ribosomal protein S8, component of cytosolic 80S
                     ribosome and 40S small subunit"
                     /protein_id="XP_001422585.1"
                     /db_xref="GeneID:5006798"
                     /db_xref="InterPro:IPR001047"
                     /db_xref="JGIDB:Ost9901_3_29541"
                     /translation="MGISRDSLHKRRATGGKQKPWRKKRKYELGRQPANTKLSSNVTV
                     RQVRCRGGNIKHRALRLDTGNFAWGSENCTRKTRILDVVYNASNNELVRTKTLVKSAV
                     IAVDAAPFRAWYAQHYGKKIGIKVKNGAKVESEDIEEKRSKSVTMKLRSRNQKHEVAK
                     AIDEQFATGRLLAIITSRPGQCGRADGYVLEGKELEFYQKKMMKKKHAAAAAAAAKDA
                     TH"
     gene            <417377..>417700
                     /locus_tag="OSTLU_29542"
                     /db_xref="GeneID:5006644"
     mRNA            <417377..>417700
                     /locus_tag="OSTLU_29542"
                     /product="predicted protein"
                     /transcript_id="XM_001422549.1"
                     /db_xref="GeneID:5006644"
     CDS             417377..417700
                     /locus_tag="OSTLU_29542"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422586.1"
                     /db_xref="GeneID:5006644"
                     /db_xref="JGIDB:Ost9901_3_29542"
                     /translation="MARALADRALGAVRVTCSVRGLDAVARAHGSALASCDVVDRDLP
                     RPVRCADDDESRAATSRADAVARERAVVSASDAPLYARRKWKAPMRLDVEVGASLGDI
                     ESASA"
     gene            complement(417771..420055)
                     /locus_tag="OSTLU_29543"
                     /db_xref="GeneID:5006645"
     mRNA            complement(417771..420055)
                     /locus_tag="OSTLU_29543"
                     /product="predicted protein"
                     /transcript_id="XM_001422704.1"
                     /db_xref="GeneID:5006645"
     CDS             complement(417779..420013)
                     /locus_tag="OSTLU_29543"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422741.1"
                     /db_xref="GeneID:5006645"
                     /db_xref="JGIDB:Ost9901_3_29543"
                     /translation="MALEGMAPECESTPLLRAPPARATAAHGATGRRLGAILSGALGV
                     FGVACAMMASRGVGDARARLGEVSGGQLSQLADVPCLAACEAGPTREAVARLANGTGT
                     CETVNSVSASDCFAKCDCFGKVDFNERRKVLCATNVGEDATHATMDDELWTTKINAKL
                     KAECSSDYQATGERTDEEIQGHEVVGNELDTTQASTNSTNSTSRLGAKLFPRGYSDVE
                     RAMMASAAALGEQDVWRGHVVNGRHTFLAPLPNAHERAPDRDPITFKLYTQCKTREVK
                     VAGGEFWFSAPKAAYIVRHNFESDKFFTKKNRIKMERKELSDGLYGYEVTTSHVDFEY
                     GFELENAAGNSYKDIGASTTLRRESCVQRYGEFFNRVVTLNRGQSTIGAVFGDCDSVC
                     PEDYVDEAYCRQPFTGEPGTSEADPMDLGLVDDARLINMASALLYSTSETVMNPSGRA
                     ETFRQDAGSKSEQKWIIAASDYYRAYIKMVQITIRRDPASGRASAWISGKRRYTLRSG
                     AGYEYGTSNVGQISGTGCGRQYCNTARYDIPSFYEQGVETTAFTASLTRMEYTKLSLG
                     DAPPTGHNVLFEPNFLTSPQMILAPGAWGEDMDVRRLILKNGVMCGRSIHSSNCMFGK
                     AFALKDTVSGYSGPSKTRKDWLFIVVEHVYFKMIRVAITLGDDNAVNAEVIAAGYVSH
                     IRVATDLQTSDSMAYDGSAKWNVRSFMYIASNFAAEGYGLGGFKFDLAAEMSASLRAV
                     DCGA"
     gene            complement(<420166..>421581)
                     /gene="VEF3501"
                     /locus_tag="OSTLU_29544"
                     /db_xref="GeneID:5006799"
     mRNA            complement(<420166..>421581)
                     /gene="VEF3501"
                     /locus_tag="OSTLU_29544"
                     /product="predicted protein"
                     /transcript_id="XM_001422705.1"
                     /db_xref="GeneID:5006799"
     CDS             complement(420166..421581)
                     /gene="VEF3501"
                     /locus_tag="OSTLU_29544"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422742.1"
                     /db_xref="GeneID:5006799"
                     /db_xref="JGIDB:Ost9901_3_29544"
                     /translation="MAPSAYTPSTSKTFDGRALRPDYKSASAGADDVDEYPVSSPVES
                     DCFGDSESEPDARFATYTGAISVYGEFRDRRSPRQVFLRRNLSYHVERASAGSRDERG
                     SARARGAAARERELAEKYETTYEYDRCTTRVRVRGYGCNMCKCVCVGLRGLMTHLRAS
                     HDLFRYSARREGRRAIVRIYPKGENFTADRSFVLRSQTDIQTANDKEFSFYRGKRSKR
                     EVFRERVTKAELDALYERDVRAAPPPRVVWRAVPNDDHYDRVKLEKRKRAQEEERRRI
                     AALPFKPMVCKKNANGAASAAATKPKPKPPKKPLGPFYNSRSFVEMSEIPEQDSDDEN
                     LIPVEIMESKRFMEEFVDFSTEELSFMEAWNDVAMKFRCVADYEAPSLCEAFVRVHGD
                     KLKVSDEFFKMFVLTLFGMYENGILNRRAVAEALGKCKSLSGASAFDRVSTSVTDREH
                     CSVALFEKFPKFVTTLKNLSY"
     gene            <422940..>423959
                     /locus_tag="OSTLU_43906"
                     /db_xref="GeneID:5006800"
     mRNA            join(<422940..423335,423408..>423959)
                     /locus_tag="OSTLU_43906"
                     /product="MC family transporter: peroxisomal membrane
                     protein"
                     /transcript_id="XM_001422550.1"
                     /db_xref="GeneID:5006800"
     CDS             join(422940..423335,423408..423959)
                     /locus_tag="OSTLU_43906"
                     /codon_start=1
                     /product="MC family transporter: peroxisomal membrane
                     protein"
                     /protein_id="XP_001422587.1"
                     /db_xref="GeneID:5006800"
                     /db_xref="InterPro:IPR001993"
                     /db_xref="JGIDB:Ost9901_3_43906"
                     /translation="MPPVDARDDVVEAAAGTLGALLALVTTYPLITLNTRQHVTRRRE
                     RDGDDGDDAPSTSSLSSMYDGIEPALVGTACSQAVYNYWYSRANGTYRARRGRDATGA
                     ASLAIASFAGCVNVLMTLPIWTIVTKMQADTAAAKLRSATSEGGKKNGDQNGSGKKKR
                     SFFDIAREVVRDGGVCGLWQGLTPSLVMVANPALQYAFYETVAKWRLKRDRKTTLSAP
                     EIFVFGACAKFGATMLTYPLMVVKSRLQVVSKDMADDRMRYRGTAHAVRCMAAEEGLG
                     VFYKGIETKLTQTILAAALMFTVKEKLAESVYAARRVLV"
     gene            complement(<424046..>424522)
                     /locus_tag="OSTLU_29546"
                     /db_xref="GeneID:5006646"
     mRNA            complement(<424046..>424522)
                     /locus_tag="OSTLU_29546"
                     /product="predicted protein"
                     /transcript_id="XM_001422706.1"
                     /db_xref="GeneID:5006646"
     CDS             complement(424046..424522)
                     /locus_tag="OSTLU_29546"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422743.1"
                     /db_xref="GeneID:5006646"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="JGIDB:Ost9901_3_29546"
                     /translation="MRREGDGTGRGREAKVERAKGSAEDANGGSARELASGDGEKMMS
                     RDEDAIGHRRAASVSLSTADVRGVNLTEIKREFARIKSSEREPRKSHRSETEDYDNSC
                     PTCFEEYEAENPKITLRCGHHFHLACILEWQEYLAVQSRDDTCPACDAPIDFQEWF"
     gene            complement(<425003..>425887)
                     /locus_tag="OSTLU_6184"
                     /db_xref="GeneID:5006801"
     mRNA            complement(<425003..>425887)
                     /locus_tag="OSTLU_6184"
                     /product="predicted protein"
                     /transcript_id="XM_001422707.1"
                     /db_xref="GeneID:5006801"
     CDS             complement(<425003..>425887)
                     /locus_tag="OSTLU_6184"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422744.1"
                     /db_xref="GeneID:5006801"
                     /db_xref="InterPro:IPR000537"
                     /db_xref="JGIDB:Ost9901_3_6184"
                     /translation="LWWRAVKLPMYAVAWIPLLCAAALTYCQFGFVDWRHAGTLAAGA
                     TATVAWLNLSNDAFDSETNVDARKPESIVRLMDGNVRAVHAIAIGCLVGGAAALWSAC
                     EASGNPTSWRALVAAVALGYAYQGPPFRLSYKGLGEPLCFTAFGPLATVAFYIAMAGK
                     AAGGAAVTVPAIVASVAILLGCTTAFILFTSHFHQEQGDRAAGKLSPVVRLGLPGALL
                     VADNLIGAHYATIATLAAAGWLPYTAVFGLIITYPLARHIVDFAQDRADAGAIEDLFY
                     TKYLAVRYHVVHGVLLALG"
     gene            426474..427763
                     /locus_tag="OSTLU_29548"
                     /db_xref="GeneID:5006802"
     mRNA            426474..427763
                     /locus_tag="OSTLU_29548"
                     /product="predicted protein"
                     /transcript_id="XM_001422551.1"
                     /db_xref="GeneID:5006802"
     CDS             426839..427660
                     /locus_tag="OSTLU_29548"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422588.1"
                     /db_xref="GeneID:5006802"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="JGIDB:Ost9901_3_29548"
                     /translation="MRRVNAFMVREREIRVFPGARGRVATSLSSVAGHVSFLLLGYSY
                     MTSDLLTLRALAVGGLSAAVVFQYFRDVPLWLPIRWNALFVAINVFWVAKLYYDEYNA
                     EHWCTTEERSLYDRHFSHMALNSFRTLLKHGKWRDIERGFEFTKEGKMNENVHVLIDG
                     SAEVYVGGKSVNSIDAGSFIGEMSLMRSIAGSNAKKQSKRPRAASATVVAAERCRVFS
                     WDDGELRQLIQQNEQIKSGVQAAFGVGLAEKLLTTRVMSTKVFAQEPQRVSHALA"
     gene            complement(<427826..>428068)
                     /locus_tag="OSTLU_29549"
                     /db_xref="GeneID:5006647"
     mRNA            complement(<427826..>428068)
                     /locus_tag="OSTLU_29549"
                     /product="predicted protein"
                     /transcript_id="XM_001422708.1"
                     /db_xref="GeneID:5006647"
     CDS             complement(427826..428068)
                     /locus_tag="OSTLU_29549"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422745.1"
                     /db_xref="GeneID:5006647"
                     /db_xref="JGIDB:Ost9901_3_29549"
                     /translation="MLVARGDVFDATEFLKTHPSGPAPILRAMARDNTEDLEMHSSRA
                     RGIWERFRVGKLTPCGEGGYGEFQPPPKLRLGCAIT"
     gene            <428940..>429446
                     /locus_tag="OSTLU_29550"
                     /db_xref="GeneID:5006803"
     mRNA            <428940..>429446
                     /locus_tag="OSTLU_29550"
                     /product="predicted protein"
                     /transcript_id="XM_001422552.1"
                     /db_xref="GeneID:5006803"
     CDS             428940..429446
                     /locus_tag="OSTLU_29550"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422589.1"
                     /db_xref="GeneID:5006803"
                     /db_xref="JGIDB:Ost9901_3_29550"
                     /translation="MTARVDCAALRRTLAWFLAGAAPMVPLKAVAFRARESGEGGKEK
                     FDAAASAPTLVAVGATAGFASGLLGIGGGTLVTPLLALVSPLPQAAVLGTSLLAMLPP
                     SVVALGTHYRMGNVDPRMGAALAVGTALGGAFGSSFAVDAPRGALEAVFFFGMLFLSN
                     RTFRSLRK"
     gene            complement(<429526..>430814)
                     /locus_tag="OSTLU_29551"
                     /db_xref="GeneID:5006648"
     mRNA            complement(join(<429526..430683,430728..>430814))
                     /locus_tag="OSTLU_29551"
                     /product="predicted protein"
                     /transcript_id="XM_001422709.1"
                     /db_xref="GeneID:5006648"
     CDS             complement(join(429526..430683,430728..430814))
                     /locus_tag="OSTLU_29551"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422746.1"
                     /db_xref="GeneID:5006648"
                     /db_xref="JGIDB:Ost9901_3_29551"
                     /translation="MERRKARGRFDWATTAARRRSGVGARSGRDLQVVSDSTDEENCE
                     AGRAEERRRKKTTYAPEPLPDYDAKPKPKRAGDYVHISTPYVPDPESDAARILAKRDQ
                     FRRDVRESGAGAWELNVFRSELPDDEVREFPTATTLKRSDFIAYKLRHPTPGVSGEYY
                     QGRVMHFDPVTREVRVKPMPEDRVTAAGHLFFKLRQRAPEPFNKLGELIGNFDEVMHD
                     VRLIGGRSVWEGDVPSKTWTPGRVYQKPPGWQPGQRETNEEYEEWLEEHIKIHEYQMA
                     NARKWDEKIVRGDRNWRDGDGASRRRPHRHERARQQREREEEREREEAHRWPTSAEEL
                     QAKLMAEWKAEEAANTLASPAAAPKPGGLPPRIPGVEQPPPPPGSPPKPTTARKKSPE
                     TRRARRASTAAAVAMFRDSGDI"
     gene            complement(<431289..>432299)
                     /locus_tag="OSTLU_43573"
                     /db_xref="GeneID:5006804"
     mRNA            complement(join(<431289..431671,431729..>432299))
                     /locus_tag="OSTLU_43573"
                     /product="predicted protein"
                     /transcript_id="XM_001422710.1"
                     /db_xref="GeneID:5006804"
     CDS             complement(join(431289..431671,431729..432299))
                     /locus_tag="OSTLU_43573"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422747.1"
                     /db_xref="GeneID:5006804"
                     /db_xref="JGIDB:Ost9901_3_43573"
                     /translation="MASRLARTRVKNTPRRWRASSAARAATRGRGRRATSFAPLEISA
                     ASRGAARAARGAARAARARGRRVVVVPGFLTGSDAYEGVARALARAIGDDARVRVAPV
                     KREMWFGTLRGGSFEEILDVVDACAREAARDGGERVCLVGHSAGGWLGRLYLGDARAY
                     RGEAPYDGARFVDALITLGAPHGSLEKYPFGSSLAFTNYYYPGAYRADVRYVDVVGDY
                     ARGSANFELFDALCDRSDTKRPLVDRVRAAWEAFTIGVSYAANCGRADVRGDGVTPID
                     TAHALTGSEHVILPGVYHGPTKPTRWYGADSVVELWYPYCL"
     gene            <432382..>433116
                     /locus_tag="OSTLU_43732"
                     /db_xref="GeneID:5006805"
     mRNA            join(<432382..432462,432616..>433116)
                     /locus_tag="OSTLU_43732"
                     /product="predicted protein"
                     /transcript_id="XM_001422553.1"
                     /db_xref="GeneID:5006805"
     CDS             join(432382..432462,432616..433116)
                     /locus_tag="OSTLU_43732"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422590.1"
                     /db_xref="GeneID:5006805"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="JGIDB:Ost9901_3_43732"
                     /translation="MVFFFDWFYDVLASLGLWQKNAKILFLGLDNAGKTTLMHMLKDE
                     RLAQHQPTQYPTSEELSIGQIRFKAFDLGGHEVARRVWKDYYAKVDAIVFLVDAVDKE
                     RFMESKKELDSLLGDDSLGNVPFLILGNKIDIPHAASEEELRHCLGLTNYTTGKGKVN
                     LENTNMRPIEVFMCSVVRRMGYAEGFRWVSQYI"
     gene            complement(433218..435134)
                     /locus_tag="OSTLU_29554"
                     /db_xref="GeneID:5006649"
     mRNA            complement(join(433218..434731,434846..434926,
                     435041..435134))
                     /locus_tag="OSTLU_29554"
                     /product="predicted protein"
                     /transcript_id="XM_001422711.1"
                     /db_xref="GeneID:5006649"
     CDS             complement(join(433316..434731,434846..434926,
                     435041..435121))
                     /locus_tag="OSTLU_29554"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422748.1"
                     /db_xref="GeneID:5006649"
                     /db_xref="InterPro:IPR001085"
                     /db_xref="JGIDB:Ost9901_3_29554"
                     /translation="MHAAARTIARRCARRASVSTSVARQFAAVPQGAGGATSNADEYA
                     KIRATHANVTWPEIINKPIEEVDPEMSEIIEREKARQWKGLELIPSENFVSKSVMDAV
                     GSIMTNKYSEGYPGARYYGGNEFIDMAESMCQERALKAFNLDPAKWGVNVQSLSGSPA
                     NFQVYTALLQPHDKIMALDLPHGGHLSHGYQTDTKKISATSIFFTSVPYRLDESTGLI
                     DYDACEKTAALVRPKLIVAGASAYARLYDYPRMRKIADNSNAILLADMAHISGLVAAG
                     EVPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGEKGKDKKGNPIMYDLESKIDFAVFP
                     GLQGGPHNHTIAGLAVALKQAASPEFKAYQRQVMSNMQAMANRLVQHGIKLVSGGTDN
                     HLALLDLRPMGVDGSRVERVLELAHIACNKNTVPGDVSAMVPGGLRIGTPALTSRGFT
                     EKDFEQVAEFIVRGIKIAQDVKSKSEGTKLKDFRAALESKEWPELTQLTKDVEEFATQ
                     FPTIGFEKAEGKYTQSL"
     gene            <435329..>436345
                     /locus_tag="OSTLU_43602"
                     /db_xref="GeneID:5006806"
     mRNA            <435329..>436345
                     /locus_tag="OSTLU_43602"
                     /product="predicted protein"
                     /transcript_id="XM_001422554.1"
                     /db_xref="GeneID:5006806"
     CDS             435329..436345
                     /locus_tag="OSTLU_43602"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422591.1"
                     /db_xref="GeneID:5006806"
                     /db_xref="InterPro:IPR000652"
                     /db_xref="JGIDB:Ost9901_3_43602"
                     /translation="MTRVATPTRVATPARDATKRTTRCRWLTRPRDDDARRRVATNAG
                     NGRFIVGGNWKCNGTRASVKTLIEELNAGELRDVDVVVAPPFLFLDEATETLKAPYEV
                     AAQNCWVEPGLVDPTHHYDSDTGAFTGEVSAEMLEDLRIPWVILGHSERRNLFNESNE
                     FVGKKVAHARFHGLSVIVCVGETLEERESGKTMDVIFAQLKAVATEIDDKEHSSWGSQ
                     VVIAYEPIWAIGTGKVATPEQVQDVHAKIRQWLADNVSEEVAKATRIQYGGSVNAGNC
                     SELARLSDIDGFLVGGASLKGDDFVKICNTSAVHYKAIGRKPRSGSVVTYSFDEDGEL
                     LETK"
     gene            complement(<436413..>438206)
                     /locus_tag="OSTLU_29556"
                     /db_xref="GeneID:5006650"
     mRNA            complement(<436413..>438206)
                     /locus_tag="OSTLU_29556"
                     /product="predicted protein"
                     /transcript_id="XM_001422712.1"
                     /db_xref="GeneID:5006650"
     CDS             complement(436413..438206)
                     /locus_tag="OSTLU_29556"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422749.1"
                     /db_xref="GeneID:5006650"
                     /db_xref="JGIDB:Ost9901_3_29556"
                     /translation="MNLGEAARAASAANVILRGEAEEEDAESDDDRGVDDEARATCER
                     VVERVRRVVDEEVSASVVFEGSSRVSIDAARLRRACERLAEISADETRLRTSIVARAL
                     VDEFLAPMIRAGAKSVVKVVEEDGGDSLRYETATTKSVDDDSAQASLETALRWIRSKL
                     PSEDVAKAVGVEAWGDIAKTCVNAWLSARPSERAIDRTCAVEVVASNCGFVPPPSDGA
                     ASYAGGALGPLEAEALATEMREAETRRAAVLARARELALSDDQTIVRTLGDAKTRGVG
                     RGTGEETETSKGANNLLDGAPRTVSKATDLLAAHVDDVLQSATELDPHAHRASASLAA
                     AAADCLDLFRACVIAARGEQLKTIHAASLVFYNDCHHLANRFSASVFARGVALERQIG
                     RTPALIWPVEPLRALGDATRAEANNRALRELHAALDVASGFLRSAEVQVKEDIVKSIA
                     RARHVIHRVGTTSMYVLPDPIGTQDAAELALHYARRVTLEILSMEDISVEESEALTEI
                     IGVAFASEGLVGKKGDEDAIRALLRAVGPEWQKVRELGVMLSAPLRDIATSWERGSLQ
                     KVGFTASEVRGFIGALFSETPLRAECLARIG"
     gene            complement(<438892..>439542)
                     /locus_tag="OSTLU_29557"
                     /db_xref="GeneID:5006807"
     mRNA            complement(<438892..>439542)
                     /locus_tag="OSTLU_29557"
                     /product="predicted protein"
                     /transcript_id="XM_001422713.1"
                     /db_xref="GeneID:5006807"
     CDS             complement(438892..439542)
                     /locus_tag="OSTLU_29557"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422750.1"
                     /db_xref="GeneID:5006807"
                     /db_xref="JGIDB:Ost9901_3_29557"
                     /translation="MFKNLLVPFVFGLAVAHTARADAGDTCSTHTDCVVSSGYASANP
                     WASSEEFCYNTGTYNGVTVSVCSDCFGCSAGPPPYGNSIDQSCPSKCTDTISSYTSCG
                     TEIATEVANGAKCWDGAHGCPPLHKKGGKWCSMYTGGQNVCCGDDCCKPDGGAIAGII
                     IGTVVGLTLLIVSCCYCGRCGCFAYRRDQLIATAVATRPQQPQVIYVQQAPAKVDV"
     gene            complement(<440093..>440740)
                     /locus_tag="OSTLU_29558"
                     /db_xref="GeneID:5006808"
     mRNA            complement(<440093..>440740)
                     /locus_tag="OSTLU_29558"
                     /product="predicted protein"
                     /transcript_id="XM_001422714.1"
                     /db_xref="GeneID:5006808"
     CDS             complement(440093..440740)
                     /locus_tag="OSTLU_29558"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422751.1"
                     /db_xref="GeneID:5006808"
                     /db_xref="JGIDB:Ost9901_3_29558"
                     /translation="MGCAQSTPTYYHADLLAVLRCDVTSWKGDRARQWFNSPLLTGDP
                     VWNVHHGTTTAPARPRDSDWSKNSPLATEIVDILNGALKAMGGWPRLPICCGAGVEDV
                     RWPPPQMVEAFNKVCKKLNEDKLFNVGLQCRVVSDRVDPLNPVCAFCVLVEKKSDTRD
                     EFDTPKCTSDLNELTTHIAPGVRRHAKEALAWSPPADWMSSCYMRREALPTPYNE"
     gene            complement(441778..>442814)
                     /locus_tag="OSTLU_25883"
                     /db_xref="GeneID:5006809"
     mRNA            complement(441778..>442814)
                     /locus_tag="OSTLU_25883"
                     /product="predicted protein"
                     /transcript_id="XM_001422715.1"
                     /db_xref="GeneID:5006809"
     CDS             complement(441870..442814)
                     /locus_tag="OSTLU_25883"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422752.1"
                     /db_xref="GeneID:5006809"
                     /db_xref="JGIDB:Ost9901_3_25883"
                     /translation="MGRFRGVDAPEIDLDAYVASLTPSRARHASHARASASRDAVRVA
                     RWLENEKVLLLTFRDAATQRRALGRLSMFIEDPEWRGKIADALPSGARGGVANYSGHN
                     ARAREVCAFYAAARREGGCWEDEEAVVEALVRCGALRRNEDGAVEVSESAMGRGGWCE
                     YDGEDDDEESVVPETCVIAVCASGDAREVQDALLHEAMHGLWYARENYASWCYEFYRG
                     DALGDEERAIWVDFLRELRYDVSVREVVVNEFQAYMATERVLFGGDGATANKGKKSGG
                     AIVRAGDALAAMQKKFAAAARDAVPDPPRCGQLTVVWE"
     gene            442844..>444176
                     /locus_tag="OSTLU_52011"
                     /db_xref="GeneID:5006810"
     mRNA            join(442844..443006,443262..>444176)
                     /locus_tag="OSTLU_52011"
                     /product="predicted protein"
                     /transcript_id="XM_001422555.1"
                     /db_xref="GeneID:5006810"
     CDS             join(442917..443006,443262..444176)
                     /locus_tag="OSTLU_52011"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422592.1"
                     /db_xref="GeneID:5006810"
                     /db_xref="InterPro:IPR001048"
                     /db_xref="JGIDB:Ost9901_3_52011"
                     /translation="MSAASCATRARASARGDGARGARRFATRSRTSTAHRARAIALSA
                     EQESDNQTRVKVLSEALPYLQRFAGQTVVVKYGGAAMKSEELKAAVIRDVVLLSTVGI
                     RPVLVHGGGPEINAMLNRVGVEAKFLNGLRVTDAQTMEIVEQVLTGKVNKSIVSLISC
                     AGGKAVGICGKDGNLLRGVVKSEELGFVGDVTQVDTRLIRELVNVGYIPVVATVAMDA
                     DGQALNVNADTAAGAIAAKLGAEKLILMTDVPGVCTDKDDPNTLIRELTMKETEEAIA
                     KGVIAGGMIPKVECCMTSITNGVKSAHIIDGRAKHSLLLEILTDTGVGTVITSPVVAV
                     "
     gene            complement(<444270..>445109)
                     /locus_tag="OSTLU_43411"
                     /db_xref="GeneID:5006651"
     mRNA            complement(<444270..>445109)
                     /locus_tag="OSTLU_43411"
                     /product="predicted protein"
                     /transcript_id="XM_001422716.1"
                     /db_xref="GeneID:5006651"
     CDS             complement(444270..445109)
                     /locus_tag="OSTLU_43411"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422753.1"
                     /db_xref="GeneID:5006651"
                     /db_xref="JGIDB:Ost9901_3_43411"
                     /translation="MNAFLSFLEREPDLEQALYGVDYKLEPGCAHCFETLSVRVVDEL
                     CPFGEVNLGVDGECVQSLTPEEWAAEVRSRDTTKSSLLDVRNFYESRLGHFFGSTCAP
                     IRRFSQFKEWLARDGVLEREIKDKDLYIFCTGGVRCEKVATYLTTRLPEGSRPRTVRK
                     LAGGIVAYAKSGINERDGLFKGSNYVFDARGSTPVGQDLPSTSWCDGCGDASGRISKC
                     VGKSCHVILIACERCGDTVYCCTSCRDQTERARLDEDNFRRRACECDSFESRERRLRH
                     AQR"
     gene            complement(<445418..>447331)
                     /locus_tag="OSTLU_19106"
                     /db_xref="GeneID:5006811"
     mRNA            complement(<445418..>447331)
                     /locus_tag="OSTLU_19106"
                     /product="predicted protein"
                     /transcript_id="XM_001422717.1"
                     /db_xref="GeneID:5006811"
     CDS             complement(445418..447331)
                     /locus_tag="OSTLU_19106"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422754.1"
                     /db_xref="GeneID:5006811"
                     /db_xref="InterPro:IPR004583"
                     /db_xref="JGIDB:Ost9901_3_19106"
                     /translation="MCLVARGRLVRAAASSEILRALVTSCAPRRLVDACTTTTATVEV
                     SALARLVDWFADATAPPIAIDGDDVLGAKKAVKDARWRRLAFRAAMHRASAGATGSAC
                     GIAARLASLWALRGRTEISEEECAALFAALCQGLGLMCRVVSSLEPVPVRASAAKLES
                     MGVLHTPKPLPLETVRRREGLVRHWCEVLCARHDAESNDKGNARWVSVVPTTRASVDA
                     PEIIFGNRKRGTTADATSSMPYVVAFYADSGARDVTRKYSAAFSQALHHRTPDWKWWE
                     KITEHVERIHRDAIARDASPELRKVVETADATELFEMDVRSSKERVPGTMTEIKNHPL
                     WVVERFLSRSQCIHPRHPVKGLIAGEPVFPRSCVKELKSAERWKSECRRRVIDTLMNS
                     PVRKIHSRASQARVKALTRAREGWFMTQAEGSKERLDSEEWRVSMSEHDDCPDDPQRI
                     PGDVALYGEWQTEPWTPPAAVGGLVPKNDRGNVDLYGNALPPPGTVHVNLPRIAKTAK
                     SMSIDYAPALVGFEYKAGGKTLPVFNGIVVCEEFKDDLLSKHEEAEETRRLAIEAKVY
                     KEACLHWRLLLGAIWTRAALREEFQDGEVFQDPTARRIAAARAMHESDNHPTAAVAVE
                     PLELGAAAYVEEL"
     gene            <448339..>449547
                     /locus_tag="OSTLU_19107"
                     /db_xref="GeneID:5006812"
     mRNA            <448339..>449547
                     /locus_tag="OSTLU_19107"
                     /product="predicted protein"
                     /transcript_id="XM_001422556.1"
                     /db_xref="GeneID:5006812"
     CDS             448339..449547
                     /locus_tag="OSTLU_19107"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422593.1"
                     /db_xref="GeneID:5006812"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Ost9901_3_19107"
                     /translation="MSFCDKAFSCAWLADDLALIGTKDNRLFELEIDRRGRRDAWREI
                     ELGREDAYTRNRAMEIAAQWVSRHTPQALRAINVSPPFLAGPYGHGAVRAAASRRGGA
                     HACSVSSTREHIVCSGGPSHNIVGFRRDEETECLVPRMAFSGHDDVVFDVGFIGRDAM
                     ASASRDCTVKVWQLPKSPSYDEIRITPSGSVHPIGECTQNERVRGVKVVDRCPARHLA
                     TCTSSGHVLQLDAETLSLVHSGYQCRGYLETCCLATDGQIVAVGSRTHIGFVDFRSKN
                     FYASVALPYGDTNSTRSLSFHEGGNLLTIGGGRGLISFYDVRMRKYLVDNGRGRVRQL
                     FNNQYCVPFADNGIFEDEHDDDFYDIEIRDYCLPAIFAHQWDPSGTRLLCAGGPLQSM
                     LHGFFVGVWS"
     gene            <449567..>450271
                     /locus_tag="OSTLU_94109"
                     /db_xref="GeneID:5006652"
     mRNA            <449567..>450271
                     /locus_tag="OSTLU_94109"
                     /product="predicted protein"
                     /transcript_id="XM_001422557.1"
                     /db_xref="GeneID:5006652"
     CDS             449567..450271
                     /locus_tag="OSTLU_94109"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422594.1"
                     /db_xref="GeneID:5006652"
                     /db_xref="JGIDB:Ost9901_3_94109"
                     /translation="MSSRRHAISPVRRNGDQATSRTAVGSSESTSCPVCGVDLNGVSF
                     DARSRHAATCAETLSQLDHVTQEDGNDEFDDDLIALVDEIDRKRELEAAKKASRATTS
                     GSASAIQDGETVERWLHRIGYAPYYHPLYVKEELLDVEIAKECSAMDLMSVGVDAEDA
                     RALAHCGGAPPDTIANVPQTTTVPRTRSAMQRAREIAVANDDSLWAVARGAENRGRGE
                     SLPSIERFTRAKTTER"
     gene            450406..451574
                     /locus_tag="OSTLU_29564"
                     /db_xref="GeneID:5006653"
     mRNA            join(450406..450524,450619..451574)
                     /locus_tag="OSTLU_29564"
                     /product="predicted protein"
                     /transcript_id="XM_001422558.1"
                     /db_xref="GeneID:5006653"
     CDS             join(450429..450524,450619..451515)
                     /locus_tag="OSTLU_29564"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422595.1"
                     /db_xref="GeneID:5006653"
                     /db_xref="InterPro:IPR004882"
                     /db_xref="JGIDB:Ost9901_3_29564"
                     /translation="MADAMRAMLDQLMGTERDVPLDQRTGRSRHYSDADVCKYYICGF
                     DVTCFKNTKSDADVLRCVGAEAQEKVRDDGAREAFRLAPEAEKAKCGYEMDTKMVLDR
                     MIRECDRRIERGMVRARAEKEEAMVKMATSADADTLRLLEVKMEESAAKAEKLGEEGD
                     VDGAEAELAHLETFEQRAKEVKAKMDSMDAYRLTEPCPVSGTLLCNTDTEERRQEHLM
                     GKQYTGWTHIRKLRDELAARLAKYEEAGFAIGGRSGGDGRDRKRRSRSPDRDRSYRPR
                     DNRDREYGRGDRDTYRGGGDRRYEPYRDDRRRGDDRRSYDRRDDRRRDDRYRYY"
     gene            complement(<451546..>453009)
                     /locus_tag="OSTLU_43663"
                     /db_xref="GeneID:5006654"
     mRNA            complement(<451546..>453009)
                     /locus_tag="OSTLU_43663"
                     /product="predicted protein"
                     /transcript_id="XM_001422718.1"
                     /db_xref="GeneID:5006654"
     CDS             complement(451546..453009)
                     /locus_tag="OSTLU_43663"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422755.1"
                     /db_xref="GeneID:5006654"
                     /db_xref="InterPro:IPR005599"
                     /db_xref="JGIDB:Ost9901_3_43663"
                     /translation="MDAYDVACAMTALAHAYTAPYCKVEESFALQATHDFMFLGLDVA
                     SYDHRAFPGVVPRTAIASLALAALARGPWAVWRAVRGTGETKAAARGAARGALGVALA
                     RSHAKFRGDVKYAFGDVVGALVAIVSLCEFHMWFYASRPLMNVFALAATLRGCGAWIR
                     STRSRERTDVREAVIYITVATFLLRCDVVLLLAPMGLHMLASGLISAPRAVGLGSVVA
                     LLTIATSTLVDSWFWGRLVWPEGAVLYFNTALNKSSEWGTSPWHWYFSSALPKSLLCA
                     YPLALMSVFIERRARPIMFAALFYVGMYSFLPHKELRFIFPTLPLFNVAAATTLSRVW
                     NNRRKRPLVAVIAAGLLFTSLALVCVFTAASSVNYPGGVAFHRLHHDANVAPRPGSVH
                     VDVPAAMTGVSRFGEAASASSGWSYSKTEGLSVSAFADHGFDYLLNAHEHVPGYEVAF
                     VADGYAGLAVDVKSAPSVLRVKTKPEIYVHRRASLEH"
     gene            <453166..>455262
                     /locus_tag="OSTLU_94111"
                     /db_xref="GeneID:5006813"
     mRNA            <453166..>455262
                     /locus_tag="OSTLU_94111"
                     /product="predicted protein"
                     /transcript_id="XM_001422559.1"
                     /db_xref="GeneID:5006813"
     CDS             453166..455262
                     /locus_tag="OSTLU_94111"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422596.1"
                     /db_xref="GeneID:5006813"
                     /db_xref="JGIDB:Ost9901_3_94111"
                     /translation="MTGIDVLSFAERLATDADADADAPTLEETLELCASDVREKKLVG
                     ALLATKVLARVAERQRASTCDAIAKALGAKFLNALLKPAAADADAESRLDATMRTSLG
                     LSVCSALCQSDAFASSKTMAFWVPTFEKCAGRVARSGFEDLCDEAAADALECAFAHVI
                     AKSKLAEAASAGEGEAVEVRLRVPEGTVLAAKEALREGKLCKLSAVAMDVFDYSMCSE
                     FLNEQSVDSVEIVSSLEILPQICKIMREAAGSELQLRAMTVLHHLYTFFLPLPPEAPR
                     RDVFQSGIERANQDILEAMWVVLNSRTPRLMRFYALDITALASNVVNTKKGAPNADNF
                     LPWLLAIDAQPPPVVLAGAVSAGATKKVPSLLALIVELVRVEISVALHGLSDATKGVD
                     VMAELGFGSAMRLYSEIMITISVIVSQVLSEDGEITERGKTLLKDEMGRLSIQELMRI
                     EATNRDIVNTMLEAFEDTETREIFSVETRQGLMQAIMFNWAESPSTWQSRFARLMPYW
                     FGEMLELDARRVESPLELDAIKMSRTIGFIHGFMSIIEDVEGVELLIESKFLSMFSDV
                     YVAHASKRIDAAESYETSVYLSTCLRAITESIDTLAKATSSADSPIHALRASFIESME
                     LMHKRVRDSYLERLPESMREKSNVDEYVVGENGERFSVAEKAYAEEVHAVLKKRGVFA
                     GDDAHLDSVTRGFEKL"
     gene            complement(<455401..>455991)
                     /locus_tag="OSTLU_29567"
                     /db_xref="GeneID:5006655"
     mRNA            complement(<455401..>455991)
                     /locus_tag="OSTLU_29567"
                     /product="predicted protein"
                     /transcript_id="XM_001422719.1"
                     /db_xref="GeneID:5006655"
     CDS             complement(455401..455991)
                     /locus_tag="OSTLU_29567"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422756.1"
                     /db_xref="GeneID:5006655"
                     /db_xref="JGIDB:Ost9901_3_29567"
                     /translation="MSSGDEASSSSVDAECPLETLLDPKLTGAVTKASVIELLRDASA
                     RALSETSDRCACSRRGCAYKKMVDCDELWWPRYAEAWYEPGMAPAFPGKAPKDKKSWK
                     NAYLAAKPEDGPTAEEVARREAKVKKREEMLARWKEENLAGSGALRGRAAGVGDVVAP
                     VDLSDKEAMRAFYKSVRAKPKGKSARGSHAPVFGAD"
     gene            <456911..>458458
                     /locus_tag="OSTLU_43431"
                     /db_xref="GeneID:5006814"
     mRNA            <456911..>458458
                     /locus_tag="OSTLU_43431"
                     /product="CPA2 family transporter: potassium ion efflux"
                     /transcript_id="XM_001422560.1"
                     /db_xref="GeneID:5006814"
     CDS             456911..458458
                     /locus_tag="OSTLU_43431"
                     /codon_start=1
                     /product="CPA2 family transporter: potassium ion efflux"
                     /protein_id="XP_001422597.1"
                     /db_xref="GeneID:5006814"
                     /db_xref="JGIDB:Ost9901_3_43431"
                     /translation="MGLLNGERQETALPTGEVVRALEDPVYFVENIANTISREAEAGA
                     IIDDQEWTKVLKSVDVDIGLLLASVVLIVPLFNRLKVSPVLGFLGIGLVLNRAGLFIE
                     NQEVDQFCELGIQFLLFEMGLELSSKKLSGLAKYAFGLGLTQVLFVNLAFASALLPAG
                     EALGTKVLEFIQPGNDEMLQVSSVLEAVVIGFALSLSSSAFGLQLLADRKMLTTKFGT
                     ASLGVLLFQDLAVVPFIILLPVLQSFKSGGADGGVDVPILAAGGATSFLDLGVLAFGG
                     RQLTLLGFRAICRENCTNDVFVAMSLLVLFGFSFATSAIGFSDSLGAFLAGIILADTP
                     YSHTIIRELQAFKGLFLSLFFVTIGTTIDFPLFLDLWPIALAMTLTLMASKTAVITAL
                     GPAVGLTWREALVAGAFLCQGGEFAFVIFGQATSGSTGSLFPMGLDELLVIVVILSMA
                     LTPLAVDAALAIAGADFMTPEATEDEDAIDVAIQVEGNMEALDIARMGSDRMGQSVDE
                     SADGDKV"
     gene            complement(<458560..>459543)
                     /locus_tag="OSTLU_94113"
                     /db_xref="GeneID:5006656"
     mRNA            complement(<458560..>459543)
                     /locus_tag="OSTLU_94113"
                     /product="predicted protein"
                     /transcript_id="XM_001422720.1"
                     /db_xref="GeneID:5006656"
     CDS             complement(458560..459543)
                     /locus_tag="OSTLU_94113"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422757.1"
                     /db_xref="GeneID:5006656"
                     /db_xref="JGIDB:Ost9901_3_94113"
                     /translation="MTPEGYERRTTHRTPTTRRDDDDDGWFASRTTTREKRRDGDALQ
                     RAALDSAWGGARGKTRRARDDGSPSKTRSRGGATATPEVALGAVDDAIDAMIVKSIGA
                     TSAAVSALTRGASYLGEVFDRAADSWDANDGKKDDDEGWTRTKFTTTNARAPTGKENV
                     PVTPRAMTFGTRDDDSSALEMEALRREVAAAKARERETTRLAEELKRQNLALQKRQVA
                     REAKASPEMVALVDQLRAQVEALMSEKSSLTHENKRLQRENRDLHAFIRTSDGDEDDG
                     DESTDASSDLGNLSPEEVEKLEREIAEMEASLENSTLDYAAQNSSMESESA"
     gene            <459779..>460249
                     /locus_tag="OSTLU_29570"
                     /db_xref="GeneID:5006815"
     mRNA            <459779..>460249
                     /locus_tag="OSTLU_29570"
                     /product="predicted protein"
                     /transcript_id="XM_001422561.1"
                     /db_xref="GeneID:5006815"
     CDS             459779..460249
                     /locus_tag="OSTLU_29570"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422598.1"
                     /db_xref="GeneID:5006815"
                     /db_xref="InterPro:IPR002350"
                     /db_xref="InterPro:IPR011497"
                     /db_xref="JGIDB:Ost9901_3_29570"
                     /translation="MSTSTALKLLALLLASVARDARSARATPAPVRALAPMAVAAGAG
                     DGVANALDACRARCGDEAFAPVCAANGAATYANKCWANCAFASGLLGSGARVNFVVDG
                     ACANPTRFRNPSFACATACAQVYEPVCGENGVSYSNGCIAECSGVRYVRGSCHA"
     gene            complement(<460313..>461377)
                     /locus_tag="OSTLU_43665"
                     /db_xref="GeneID:5006657"
     mRNA            complement(join(<460313..461041,461114..>461377))
                     /locus_tag="OSTLU_43665"
                     /product="predicted protein"
                     /transcript_id="XM_001422721.1"
                     /db_xref="GeneID:5006657"
     CDS             complement(join(460313..461041,461114..461377))
                     /locus_tag="OSTLU_43665"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422758.1"
                     /db_xref="GeneID:5006657"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Ost9901_3_43665"
                     /translation="MAPALDADAVVLRRPRAVWAVAHDPSRAGVAFACESSGATARVR
                     ADASTRRNWRVVETLEKCDRAARACAVSPCGRLVAVASFDGATTRWTRACAVEGHESE
                     VKSCAWSRSGSLLATCGRDRTVWVWERYGDEEFECAAALHGHGGDVKRVTWHPTEDVL
                     VSVSYDESVRVWREDADGDDWSCAQVLGGEDGAHGEGHEGTVWCASFEPRALDDGSRG
                     TRCVTCGGDGALIVWNGRGFCDTELEFGARFACGHDRAVLSCSWGKNGVVAAGGGDNS
                     IRLYAEIDGTWREIVTVENAHDDDVNDVQWSPHDSSLLMSASDDGTVKTWRFKP"
     gene            <461576..>462346
                     /locus_tag="OSTLU_29572"
                     /db_xref="GeneID:5006816"
     mRNA            join(<461576..461710,461870..>462346)
                     /locus_tag="OSTLU_29572"
                     /product="predicted protein"
                     /transcript_id="XM_001422562.1"
                     /db_xref="GeneID:5006816"
     CDS             join(461576..461710,461870..462346)
                     /locus_tag="OSTLU_29572"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422599.1"
                     /db_xref="GeneID:5006816"
                     /db_xref="JGIDB:Ost9901_3_29572"
                     /translation="MTATTTPDDAMEDARPSRDRGARVAELRASFESALRACAEPPTA
                     QEFIRAFPGLNPAHHAALYDAYAEALRSVGRHAEEEFEAICEEESVEARLNAIDALCA
                     ERGVMDLDVASNAARVAYSGKSPDEVARNTRAEAKRKEAETLREEAAALEMAAQETIA
                     ALEAKREAVRAAATGLKTGTQGGDVVQDASTRWAARAPQPLKS"
     gene            complement(<462463..>463452)
                     /locus_tag="OSTLU_4293"
                     /db_xref="GeneID:5006658"
     mRNA            complement(<462463..>463452)
                     /locus_tag="OSTLU_4293"
                     /product="predicted protein"
                     /transcript_id="XM_001422722.1"
                     /db_xref="GeneID:5006658"
     CDS             complement(<462463..>463452)
                     /locus_tag="OSTLU_4293"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422759.1"
                     /db_xref="GeneID:5006658"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="JGIDB:Ost9901_3_4293"
                     /translation="VTIDRPRALNALNRDAVERLHELFQRAERDDAAACYLLRGHGSR
                     AFCAGGDVRAVREMVVRGDVDGAIAFFDREFALNAALHALRKPSACVWNGVVMGGGAG
                     LSCYCPVRVATDATVFAMPECAIGLYPDVGAGWFLNALCGHAYATCLSLTGARVRGID
                     CKRIGLATHYVTMEVWDRETEKRVNALERGASVEDLARAAASGERDEPAATSYLTSER
                     GRAMIDEVFGNDAMSLDDITREIARKEDAAESEAERAFFAECRESVAKASPTSLGVSL
                     ELMRRSRGKSLEWVLAMDNALIVKFIHAPDFRRGVEAVLIDKVGAPPPGGWMPA"
     gene            complement(<463616..>468004)
                     /locus_tag="OSTLU_29574"
                     /db_xref="GeneID:5006817"
     mRNA            complement(<463616..>468004)
                     /locus_tag="OSTLU_29574"
                     /product="predicted protein"
                     /transcript_id="XM_001422723.1"
                     /db_xref="GeneID:5006817"
     CDS             complement(463616..468004)
                     /locus_tag="OSTLU_29574"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422760.1"
                     /db_xref="GeneID:5006817"
                     /db_xref="JGIDB:Ost9901_3_29574"
                     /translation="MLSHGRAATLDAPGSTYVVPESARRRLVEETTRAMEEYERATSA
                     PLRVVALGRSGVGKSHVLNGLLRELASRGDARGRVGTGGANGKLTLTKMRDHDERAEE
                     AEEDKARAMEDDWEDEGGAALDANASAFAPPPPLDRDTSAAVYMPRHMRGREIRGDAF
                     KDSEADAIRKEKLKEAAKKAQKKGQKVKPSYVLYKEHQEARDKEAAKKAAEEAKRQKY
                     DAAIAAYEIPVRKKKFPPPPTTLKDFLENDPRLKNARPPPFLLPEGDVMDTTSVASSV
                     RTSDAFRVSLVYFSEDVVKQHVHALQYAVRQARAIESARKGLGFYAESYVKKELKARG
                     LEETTLLDFRTKPKEGEAVPDDGYGLPSVLRVACAMVGLDPNISTLADLDESDVAIPA
                     EYIERLGKRVEFEYKTDRNKNGKPDEPIDYTDERTFQRALRATKHTVFTQTHIPSSCW
                     GLLREVRIDIPVPPQKRGLVLIDAPGAGDSDPARDRHLVAALRNAAAVICLGDSREVT
                     GDIVRSLHKSGFLQQLAIRPATRRFINAVQGDRIWGSTATTLKRASALLKRKLGRDVS
                     VEELAKDFPPVDEEIQWAIDRVINENTVEIATVRRAELLKMLMDQTGSVRELKQTANA
                     VIAVAWKFLEFRLSWAKVLDPEKFDVQSITGHGSLNATLEELKRARQLKAMRRVTRRV
                     HDVLKAFCVAAEPLCALPTCSDDSLRGFYDDIEFRLGEGGAYAARRVYELAHQFCTRV
                     IAVSMKVAMEPLDIHAIKHGRAAVVREVLTKNLRPEERIHDIRTPADVRGFIIEAVDY
                     FGKVLEATFYFNFNGKNTPQKPRGLLFQVCESVNAAWCHSLVSDQSTGELMFGALVKN
                     QIASLAGPEDDPKRAMMRALFNLALTKFKLSPAHRYAYMNSAKVAGESTTRLWLECTK
                     NIQIEINRQLKSVTAGLMCAFHPLDETTEVPPPEGVRAMMTDVINAISHTACTMNDLI
                     IEKATKEIEKFYTPYILIASEDAMQACLTCMSPYVKKQVMPEFRARVAKPSMFTVISP
                     DVKLAHSHMTVTSLILGSEAREPLSRAEKAKKLIALSEIGALPFQLTKPPVLSPAITD
                     AIKAADDGINVGLDEFPLQIHMPAEAPAAPEMEANEEESIEVTEQQIVPVEEDEDQIE
                     PVEEDEDQIEPVEEDEDQIEPVEEEEQITVGEEEEQTTVGEEEEQITVGEEEQTTVID
                     DREESIQGTLVPDADPDVDTDEIEVQSPAPIIKSTKGNAQMEKATSPQSKSSTPMKDV
                     QTQTEYTASAKQPTVSASPRREIAVQTDDFGESPRREIAVQTYDFDEPETAVQTEETA
                     ERTSSEPSPTTHDASPVENPPPHSSSKSDLTATTTTTTTNAGERTKKRKMMCANELHA
                     MPSVAANDPLTLAVNPVPGPLIALTSKIPTSDAKKRAKAERDRADFSPLKHTFDFDTD
                     GDSDGDEPSPRPPVARILRKRPKRAF"
     gene            <468887..>469060
                     /locus_tag="OSTLU_29575"
                     /db_xref="GeneID:5006818"
     mRNA            <468887..>469060
                     /locus_tag="OSTLU_29575"
                     /product="predicted protein"
                     /transcript_id="XM_001422563.1"
                     /db_xref="GeneID:5006818"
     CDS             468887..469060
                     /locus_tag="OSTLU_29575"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422600.1"
                     /db_xref="GeneID:5006818"
                     /db_xref="JGIDB:Ost9901_3_29575"
                     /translation="MLDKMKDLGNSLLGNFGLSLDNFKAEKDATTGSYSIHFVDEKKR
                     STTGDEDDEDDEN"
     gene            complement(<469137..>469850)
                     /locus_tag="OSTLU_19114"
                     /db_xref="GeneID:5006659"
     mRNA            complement(<469137..>469850)
                     /locus_tag="OSTLU_19114"
                     /product="predicted protein"
                     /transcript_id="XM_001422724.1"
                     /db_xref="GeneID:5006659"
     CDS             complement(469137..469850)
                     /locus_tag="OSTLU_19114"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422761.1"
                     /db_xref="GeneID:5006659"
                     /db_xref="InterPro:IPR005340"
                     /db_xref="JGIDB:Ost9901_3_19114"
                     /translation="MSRALARRAREAATRATRAVGPTRATPGATLGRAREVATRGDDG
                     DGRNGDGDGDEGARRRFSARRIVKGIARDALCDAVADVDSYAAFVPFCAGARRTPRER
                     WGREREREALARGEEYFEADLEIGFKLFNEKYTSAVTCARPERVTATSVSSGLFRSMT
                     TTWKFSPLDDDEDEDPVTGLPAEGVIVDFEIDFEVKDPMHAAAVSVVFDDVARSQIQA
                     FEKRCRQLALRGGLERDGD"
     gene            470035..471283
                     /gene="psbP"
                     /locus_tag="OSTLU_48109"
                     /db_xref="GeneID:5006819"
     mRNA            join(470035..470185,470418..470505,470669..471283)
                     /gene="psbP"
                     /locus_tag="OSTLU_48109"
                     /product="oxygen evolving enhancer 2 of Photosystem II"
                     /note="Has EST support"
                     /transcript_id="XM_001422564.1"
                     /db_xref="GeneID:5006819"
     CDS             join(470036..470185,470418..470505,470669..471180)
                     /gene="psbP"
                     /locus_tag="OSTLU_48109"
                     /note="psbP, PSII-P, OEE2, photosystem II polypeptide,
                     oxygen evolving enhancer 2"
                     /codon_start=1
                     /product="oxygen evolving enhancer 2 of Photosystem II"
                     /protein_id="XP_001422601.1"
                     /db_xref="GeneID:5006819"
                     /db_xref="InterPro:IPR002683"
                     /db_xref="JGIDB:Ost9901_3_48109"
                     /translation="MFTLSTTLAHAAVKANVKATRKSQSRRGAVKVAAQAPDASSRRE
                     AMSLIAGATTLAMSKPAFAAYGDSANVFGGVSNPTGFVPYAGDGFAFLLPSKYNPSKE
                     RPFPNTECYFEDNFDQVTNISVIAEKAEKGSIDAYGKPEQFLEKLGYLLGVQSYAGQT
                     RSEGGFAANKVSTAAVLDVYTRENKGKTYYQYEILTRTADGDEGGRHQLITATVSDGN
                     LYIMKLQSGDKRWFKGQERDLRTAMNSFTVA"
     gene            <471439..>472668
                     /locus_tag="OSTLU_43910"
                     /db_xref="GeneID:5006660"
     mRNA            join(<471439..472427,472488..>472668)
                     /locus_tag="OSTLU_43910"
                     /product="predicted protein"
                     /transcript_id="XM_001422565.1"
                     /db_xref="GeneID:5006660"
     CDS             join(471439..472427,472488..472668)
                     /locus_tag="OSTLU_43910"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422602.1"
                     /db_xref="GeneID:5006660"
                     /db_xref="InterPro:IPR004506"
                     /db_xref="JGIDB:Ost9901_3_43910"
                     /translation="MPARSEAATAGAREEYVVGLSGGVDSAVAAWALERCGARATATL
                     MRNWDARDEDAATDCSHRDDLKSARAIAEKLNLRFIESDFTREYWHEVFEPYVEAFES
                     GATPNPDLECNRRVKFGALLRRAMEDLGGRYLATGHYARIDRDVDEGAPPRLLRGIDQ
                     TKDQSYFLASVRGEALRSACFPLGAVFKSETREAARILGFDCADRRSSAGICFIGRRP
                     FGEFIGEYITPSEGAFVDAETARPVPGAAPHRGLASYTVGQRAKIGGAPKPWFVVGKN
                     VAANVVYVAKGAEHDALYSTRAALADEFWISNRRPTSDDGSSSVRLLAKTRYASFSSS
                     FVPRVESSPLRATFDRPERAVTPGQALVLYDGDVCLGGGVIEHVGVTEFEARAAS"
     gene            complement(473778..475904)
                     /locus_tag="OSTLU_29580"
                     /db_xref="GeneID:5006661"
     mRNA            complement(473778..475904)
                     /locus_tag="OSTLU_29580"
                     /product="predicted protein"
                     /transcript_id="XM_001422725.1"
                     /db_xref="GeneID:5006661"
     CDS             complement(473960..475642)
                     /locus_tag="OSTLU_29580"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422762.1"
                     /db_xref="GeneID:5006661"
                     /db_xref="JGIDB:Ost9901_3_29580"
                     /translation="MTRAGAVELEDSAETLGDAPRRRRRRSRDGKPAQEETSAANDGD
                     GAVATLSWCESACATVVGALAVRVRKGEMSPRTMSLCVLAMWATSLAYKALFIGLRMD
                     KNTPPPDRVALLAIKLFFSLMRWALGAALGAPVWTLKAFYSGVTRRAVDRGWDDDLVA
                     NEGPRDLADDVRDRVTNKDYEAFATAVANDEGDWDVIASGRVGCCTYRMLRGVSAEDK
                     RMMKKGLAKFRTEVLAAGVPAEILFHAQTDLLGRQAWDSTTLHPTCVEREDAENKEKE
                     FTAQDVVYWRLKYPRLMAPRDYLVSRRMWYDKKNEMATCICRDALESPSAVSAKNKLQ
                     QMMGARAVDVKSMYSAIMVGKNDEVKGSQYVSIYYEDPGVPPRLAHMAAAKGLDAYMA
                     TFNSELQRRVRANARMKNYDAIPAPPATREVPHTRSFRTGRTSVPQSDDEGEDATAGS
                     RAGSPPLDAEDVANKLHFAPTDSSREYLFSGRNGLNKRQRVRRRIGKVLKLLVELVDP
                     NSASAASRRATESSDDESFDERTAERPQGRKRKWARRIAFGALVWIGKFTDG"
     gene            complement(<476221..>476652)
                     /locus_tag="OSTLU_7434"
                     /db_xref="GeneID:5006820"
     mRNA            complement(<476221..>476652)
                     /locus_tag="OSTLU_7434"
                     /product="predicted protein"
                     /transcript_id="XM_001422726.1"
                     /db_xref="GeneID:5006820"
     CDS             complement(<476221..>476652)
                     /locus_tag="OSTLU_7434"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422763.1"
                     /db_xref="GeneID:5006820"
                     /db_xref="JGIDB:Ost9901_3_7434"
                     /translation="ADTTPPRPVTKDDVVVSFARSGGAGGQNVNKVNTKVDMRLDVAG
                     AVAAGWLPQWCADRLVVAEKNRVNSNGELVVNSTRHRTQSQNVDDALEKLQSYINRAA
                     KLPGSQSDKRKKKKLQANVEKGNRRRLQDKKQTSQKKTERRS"
     gene            <477725..>478294
                     /locus_tag="OSTLU_19120"
                     /db_xref="GeneID:5006821"
     mRNA            <477725..>478294
                     /locus_tag="OSTLU_19120"
                     /product="predicted protein"
                     /transcript_id="XM_001422566.1"
                     /db_xref="GeneID:5006821"
     CDS             477725..478294
                     /locus_tag="OSTLU_19120"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422603.1"
                     /db_xref="GeneID:5006821"
                     /db_xref="JGIDB:Ost9901_3_19120"
                     /translation="MAYETPRDARAYSSANALKTYNMGFALGKRVNDIRAKGTFVEGR
                     PDRFDALSKMQFVWDDEEFNWSQRLIPALQLYEQVHGHLNVPSAYAVPAKMPCPFGVA
                     RPVVVRRDLVGFELGSAVAQIRHWRFQRPGTSEGAARSRVRQLDRLSPLGFPWDVAEW
                     ERRARVLKRVRRRRVDARLASDAAASSSV"
     gene            478395..481071
                     /locus_tag="OSTLU_25890"
                     /db_xref="GeneID:5006662"
     mRNA            478395..481071
                     /locus_tag="OSTLU_25890"
                     /product="predicted protein"
                     /transcript_id="XM_001422567.1"
                     /db_xref="GeneID:5006662"
     CDS             478538..481015
                     /locus_tag="OSTLU_25890"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422604.1"
                     /db_xref="GeneID:5006662"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="JGIDB:Ost9901_3_25890"
                     /translation="MDAPMDGAVEAVETTGWFLALALTHAPMMVFTLYASLTIVERAL
                     GSKRGKVKEKPPAREAPPYVCVQLPMYNEPACAKRAIDAACLLHWPQDLIEIQVLDDS
                     SDGTEDVVDDACAEWRERGVVCNALRASAVLRGKSRQTKAAALEYGRARTSADLIVVL
                     DADAVVEEDYLAKIVPYFYDERGERRSEVAVVQPDVTFKNSSQNFLTMHQAFKMEADA
                     IVGNRAYIRAFGCALRAGSGAIWSAAALRGVGGWDVNMLALEGTDMSMRTRMAGYSGK
                     AAANVIIETELPSTLSAYKSQQLRWMWAWAYLAKRHLASVLFNSFNGVTSDIGIGVLN
                     GNVARLWFALTIVRPAQWLLLAVWLLLLPELIFDGMWLGNAQHVIHGAVWLYFLPLLL
                     ILKADTFAMSDVEGKVRSPPKSTGEAMSTMRTTLRKLSWIGPHACVSLGMIAVYCTGY
                     VRGIFGSTYPSFDAPVSQLRTPKLGNGDVELSEADRGADETSCSKSEIWQIVFEMTFV
                     VATIRASIELMKWAPTGGSGAGTISLVSVIGFGIAACCVYVAAGSWDDKCGPRSSERY
                     RRAKTSSVEERAGLLSSTTAAATLAPPRRINMSLSSKSRRTKASDMYGTSTVPAFDVE
                     SGKRTPEAFSVGDEDDVQPVSLDVPALTNAKEMQKAIKKYKNMRDHNFDLENFSEYAQ
                     SDATSVMSENHAPSHVNFGSHAPSHEDFGSEIGSAFGDGDDDERSVDMDGKDRAALAH
                     AMQAQHDSQQRAKSLRMANLRVNTAPAPNPKRSRPPRSPRSSNATSADNSPRAPLSPP
                     TAESPKPISASDWVDSPIVVDASSTPR"
     gene            <482058..483655
                     /locus_tag="OSTLU_29584"
                     /db_xref="GeneID:5006663"
     mRNA            join(<482058..482112,482299..483655)
                     /locus_tag="OSTLU_29584"
                     /product="predicted protein"
                     /transcript_id="XM_001422568.1"
                     /db_xref="GeneID:5006663"
     CDS             join(482058..482112,482299..483644)
                     /locus_tag="OSTLU_29584"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422605.1"
                     /db_xref="GeneID:5006663"
                     /db_xref="JGIDB:Ost9901_3_29584"
                     /translation="MRGRSVRRALALALACGLAMARDAEGARRASVNASGVFNTNGLR
                     CPEDVECERCAAPLNAAPFRAPVNLTGVRVIGCRYRADVCDALREESKACKRHARSLC
                     GEQDTRAQAKTKCKREMNRAWKTRCKEERTMMVSRADGALKRFLEVLEKLKRARAKRA
                     AGGAGDDLTMLEMELSRLKTSIGHAFEELRSNHGGVAVGLMSDRMEAFVRGPTLLDST
                     SDMLDVVNAMNAVLGELQGLSTEAKSLCSYDANMDTSDGKILCQDMEEKMKLSEKRVN
                     RCAARLSDYLASTAKIDALIVEKKRRFALLDSLDKFTDSISGAWSAVQYEGDDDFVEE
                     PSTRFNLTEHVTTGIVHTLMNHYTTVSARHALATAEIKESALCAHIIPRFQLSLLGTG
                     FKRGDLACPPPHGTFIAGRELPDWSAYFLFLLGIAVGAGATIATNRANEAVDFVRTNS
                     SVVVAVLVVVLAGRFF"
     gene            <483956..>484744
                     /locus_tag="OSTLU_6230"
                     /db_xref="GeneID:5006664"
     mRNA            join(<483956..484341,484393..>484744)
                     /locus_tag="OSTLU_6230"
                     /product="predicted protein"
                     /transcript_id="XM_001422569.1"
                     /db_xref="GeneID:5006664"
     CDS             join(<483956..484341,484393..>484744)
                     /locus_tag="OSTLU_6230"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422606.1"
                     /db_xref="GeneID:5006664"
                     /db_xref="InterPro:IPR006700"
                     /db_xref="JGIDB:Ost9901_3_6230"
                     /translation="LHRFYVDADFARGAAVTLSREETRHATKALRLKPGDRLEVCDGR
                     GTLGIARLCAVDGVGATVEVEEMVADALGSGTAWDVASAFGGLKGGRGDWLVEKCAEL
                     GARTLVPLLTTRSGAIGGGDRDGDKKRGREGRWGRVAHAASKQSLRVYGLQVAPPIGV
                     EALCEEIAKDCGERLTLLAAAGAPPIADVARASGLDLRSGRIVIGPEGDFTDEELKAM
                     IAAGARPVGLGSLRLRVETAAISALAAV"
     gene            complement(<484831..486903)
                     /locus_tag="OSTLU_29586"
                     /db_xref="GeneID:5006665"
     mRNA            complement(join(<484831..486459,486654..486903))
                     /locus_tag="OSTLU_29586"
                     /product="predicted protein"
                     /transcript_id="XM_001422727.1"
                     /db_xref="GeneID:5006665"
     CDS             complement(join(484831..486459,486654..486899))
                     /locus_tag="OSTLU_29586"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422764.1"
                     /db_xref="GeneID:5006665"
                     /db_xref="InterPro:IPR004240"
                     /db_xref="JGIDB:Ost9901_3_29586"
                     /translation="MTARTRPRARPTRKRAFLESCVVLASCAVLCTRASSARAEDLQR
                     GSTSNSIGRSLLAGSKYDRGDDIALFANKVGPFHNPSETYQYYDFPFCRSPEGVKRER
                     TDLGEVLGGDRLAKSPYEIEFGIDKENVDLCTQFLERKEVEKFRRAVKNDYYFQMSFD
                     DLPIWGFIGKVEKIMRGGAAAENRYFLFTHVHFEISYNEDRVIEINLSTDPLKTVDIT
                     ADEAMSMRFSYSVHWKPTTTAFKDRMDKYSRYSFLPEHLEIHWFSIINSCVTVILMMG
                     FLASILLRVLKNDFVKFARDEEMLESQEESGWKYVHGDVFRFPRGRSLFAAIIGTGTQ
                     LFFLVIFVFMLALVGAFYPYSMGAVTAACLIMYSLTAGIAGYVSANTYRQMGGENWVR
                     NVLLTCVLFCGPLGVLFSFLNTVAIAYRSTAALPFGTIVLIVLLWAIVTIPLTIVGGI
                     AGKNAKAEFNAPVRTTKYPRDIPALPWYRATIPQMCIASFLPFSAIYIELFYIFASVW
                     GHKVYTIYSVLFVVFVILILVTAFMTISLTYFQLTAEDHEWWWRSVLCGGSTAIAIFG
                     YAFYYYHLRSDMTGFLQSTYYFGYMAIICYGWFLLLGTVGHKASLLFVRHIYRAIKCD
                     "
     gene            complement(<487011..>488642)
                     /gene="HMGB3506"
                     /locus_tag="OSTLU_19125"
                     /db_xref="GeneID:5006822"
     mRNA            complement(<487011..>488642)
                     /gene="HMGB3506"
                     /locus_tag="OSTLU_19125"
                     /product="predicted protein"
                     /transcript_id="XM_001422728.1"
                     /db_xref="GeneID:5006822"
     CDS             complement(487011..488642)
                     /gene="HMGB3506"
                     /locus_tag="OSTLU_19125"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422765.1"
                     /db_xref="GeneID:5006822"
                     /db_xref="InterPro:IPR000910"
                     /db_xref="JGIDB:Ost9901_3_19125"
                     /translation="MVNVEALETPRGVSPPPPPPLPPPFESEPTAFSREDFQALPSRI
                     EAIRKESDARASEIAHLRTVNQQLRAEIRKEKAAREETEAIAKMRANGEEREYEAQIS
                     ALRKNVERLREDYNRIQAETENVHSHNGACVVLNEEKKSFLTDRDELKRRCDSLQRHL
                     VDALERYEKLDAEKTSLEGENEKLNYDVELLSSAETENVQLKSKIAELQKELASCSDA
                     ELRDEVKRLTVENKSISEMSKSLKSTSEQLRREVEEFRVDAARKMREIPSLKMALERT
                     QSELQASTTELALRNKCLSAKDETIAVLMNKLRDANEDIEQCSLRSEKRNSEPNTGCP
                     KAFQLEATRYRAAFIAARATNETFRVETLKQLEATKKKLLQERLNVKLLETENRTLKE
                     SRELTDKSVENLVEKIKVDLAHDLSEALSAARDLSTASQRCADRCSKEPEAKKEAKDP
                     KAKKAPEPKVEVPGMKKPLTAFLAFATDERPSVKAENPTFNFREVGKALGERWASLDP
                     ERKAKYKSDWKTANEAYTAALAKARGQFGSVQRIV"
     gene            complement(<489080..>489985)
                     /locus_tag="OSTLU_19126"
                     /db_xref="GeneID:5006823"
     mRNA            complement(<489080..>489985)
                     /locus_tag="OSTLU_19126"
                     /product="predicted protein"
                     /transcript_id="XM_001422729.1"
                     /db_xref="GeneID:5006823"
     CDS             complement(489080..489985)
                     /locus_tag="OSTLU_19126"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422766.1"
                     /db_xref="GeneID:5006823"
                     /db_xref="JGIDB:Ost9901_3_19126"
                     /translation="MRDAMRDWTDGVGLNAQVDDARDDARDEEDDDEEDADVDEATGN
                     YFGRAAKAPPAPEGANPFAASAATPSDDVNAMIEQAKAQVEAQRAKREIEEAKDRERE
                     RRAFEDQGREYVARRKPGEASESPASSSGGRRKVVKAKRPGQSPLGGTGDGGKTTSNA
                     FAGFAALTGGAKREDADAGRSSVFSRLSGAPVEADDDDDAREAKAEKTKPAGLFSFPT
                     AAPSTSAEPAKAATFGFFAPPPLTKDTLHTQRTAKIKLTESDDDDDDDAKKSAPAPPP
                     TALTNAPPAKAVKKVKTALAIELGL"
     gene            <490158..>492995
                     /locus_tag="OSTLU_43635"
                     /db_xref="GeneID:5006824"
     mRNA            join(<490158..490316,490449..492262,492425..>492995)
                     /locus_tag="OSTLU_43635"
                     /product="predicted protein"
                     /transcript_id="XM_001422570.1"
                     /db_xref="GeneID:5006824"
     CDS             join(490158..490316,490449..492262,492425..492995)
                     /locus_tag="OSTLU_43635"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422607.1"
                     /db_xref="GeneID:5006824"
                     /db_xref="InterPro:IPR010491"
                     /db_xref="JGIDB:Ost9901_3_43635"
                     /translation="MSNQASRALRAPVAPFGDAPAPAGYVPGLGRGAAGFTTRSDIGP
                     GQVAAAGDKRDEDGGRSGDGGEDGLFGRDASTYDDDDAEADEIWAQIDERMDSRRRDA
                     RERREREQMEKFRDENPKIVETFRDLKRGLKDVSYAEWDAIPDIGDYTIKKKKLNVGF
                     MPAPDTLLAKALAEKETVNTAADAGGEQDLTAVGEGRGTVLGLKLDRLSDSVTGQTTI
                     DPKGYLTDLGSQKITSAAEISDIKKARLLLKSVINTNPKHGPGWIAAARLEELAGKLQ
                     QARVFMQKGCEECPKNEDVWIEAARLNTPENAKAILARGVQTLPNSVKIWMQAAQLEI
                     EDERKRRVLRRALENVPNSVRLWKALVDLSAEDDAKVLLARATECCPQHVELWLALAR
                     LETTENGRKVLNKARETLPREPQIWITAAKLEEANGNEKMVEKIIARAVKSLKSHGVT
                     IDRESWIKEAEIAEKAEPPSIATCRAIVKATIGEGVEEEDKKRTWKADAEECMKRESA
                     ETARAIYAHALDSGFSHKKGLWMKAAMLEKRFGTPDSVDAVLRKAVTFCPNAEILWLM
                     GAKERWLSGDVTRAREILQSAFDANPDSEEIWLAAFKLEFENGEIDRARMLLAKARER
                     LADCARVWMKSALVEREAGDEQAERKLLDEGIENGNASKARIILETARAKNPSNEHLW
                     LAAVRQERESGNIQLAESTIARALQECPTSGLLLAESVRFAPRPQRKSKSVDALRRCD
                     NDPYIIAAIAILFWADRKLDKARSWWNRAVTIAPDIGDHWASYYKFELQTAGEQAAQA
                     VAERCARAAPRHGENWSAMRKRVENWHDPVIEILKKVAAGQDEMAYATK"
     gene            <493145..>493570
                     /locus_tag="OSTLU_8262"
                     /db_xref="GeneID:5006666"
     mRNA            <493145..>493570
                     /locus_tag="OSTLU_8262"
                     /product="predicted protein"
                     /transcript_id="XM_001422571.1"
                     /db_xref="GeneID:5006666"
     CDS             <493145..>493570
                     /locus_tag="OSTLU_8262"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422608.1"
                     /db_xref="GeneID:5006666"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="JGIDB:Ost9901_3_8262"
                     /translation="DEDTQLPLIASIIDRELSEPYSIFTYRYFLNNWPELCFMAIDSS
                     SRECVGVIVCKLEKHREMMRGYVGMLVVDKRARKLKLGSELVSRALAVMQERGADECV
                     LEAETTNEGALRLYQSLGFIRDKALSRYYLSGRDAYRLKL"
     gene            complement(493687..>494222)
                     /gene="RPS18"
                     /locus_tag="OSTLU_29591"
                     /db_xref="GeneID:5006667"
     mRNA            complement(493687..>494222)
                     /gene="RPS18"
                     /locus_tag="OSTLU_29591"
                     /product="Ribosomal protein S18, component of cytosolic
                     80S ribosome and 40S small subunit"
                     /note="Has EST support. CTZ89_C01.x1d_t maybe, this is
                     much larger than this gene model and might be on some
                     other ORF on the opposite strand"
                     /transcript_id="XM_001422730.1"
                     /db_xref="GeneID:5006667"
     CDS             complement(493788..494222)
                     /gene="RPS18"
                     /locus_tag="OSTLU_29591"
                     /note="Cytosolic 80S ribosomal protein S18; Cytosolic 40S
                     small ribosomal subunit protein S18"
                     /codon_start=1
                     /product="Ribosomal protein S18, component of cytosolic
                     80S ribosome and 40S small subunit"
                     /protein_id="XP_001422767.1"
                     /db_xref="GeneID:5006667"
                     /db_xref="InterPro:IPR001892"
                     /db_xref="JGIDB:Ost9901_3_29591"
                     /translation="MSLIVGDDFQHIIRVLNTNVDGREKVMYSLTKIKGIGRRFSNLV
                     CKKAEIDLGKRAGELSAAELESLMVIVSNPRQFRIPDWFLNRKHDFKDGKFSQLVSNQ
                     LDTKLRDDLERLKKMRNHRGLRHYWGIRVRGQHTKTTGRGRR"
     gene            complement(<494752..>495261)
                     /locus_tag="OSTLU_10503"
                     /db_xref="GeneID:5006825"
     mRNA            complement(<494752..>495261)
                     /locus_tag="OSTLU_10503"
                     /product="predicted protein"
                     /transcript_id="XM_001422731.1"
                     /db_xref="GeneID:5006825"
     CDS             complement(<494752..>495261)
                     /locus_tag="OSTLU_10503"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422768.1"
                     /db_xref="GeneID:5006825"
                     /db_xref="InterPro:IPR000623"
                     /db_xref="JGIDB:Ost9901_3_10503"
                     /translation="VANKLADTSLFLIGIMGSGKSTVGASLAKALGYNHLDTDELIKS
                     VTKKTPSELFAEAGESEFRAIESMILAEVAAYKRCVISTGGGIVCEKTNWMHLHNGVT
                     VRLHGDSELLARRVLADGVEKRPLLSGDTSGEEQPTIDSIVAKINALLETRETMYKQA
                     DITVPLGARD"
     gene            complement(<495510..>499061)
                     /locus_tag="OSTLU_29594"
                     /db_xref="GeneID:5006826"
     mRNA            complement(<495510..>499061)
                     /locus_tag="OSTLU_29594"
                     /product="RND family transporter: Patched (Ptc)
                     segmentation polarity protein"
                     /transcript_id="XM_001422732.1"
                     /db_xref="GeneID:5006826"
     CDS             complement(495510..499061)
                     /locus_tag="OSTLU_29594"
                     /codon_start=1
                     /product="RND family transporter: Patched (Ptc)
                     segmentation polarity protein"
                     /protein_id="XP_001422769.1"
                     /db_xref="GeneID:5006826"
                     /db_xref="InterPro:IPR003392"
                     /db_xref="JGIDB:Ost9901_3_29594"
                     /translation="MEKIRACVAACAVRPRCGAVVAACALAGGFGALWGRVEVDALKL
                     WVDARAREEVKTYEDAFGDYRTQAFVVTAKRAPTLASREAFLELKDWHDWMYGLEAPS
                     AAGSYTLHDFCYKYVDSEPHTPCFQITPLDCFAEGAVSAPGGAEKNDAFAASYSVRPS
                     VASFDFEKDFNQSFARGCKQWFNLATPPKVLFSGLREDANGLDAMRVVFQTRDAASLA
                     ARGVVRTTFTPTQASAVDVLGCRAGTPSLEDCSCIETFNLFSVLEYGCVPEGDAEQPP
                     TCCEYMARLREHPCVETLWMSDATLFALGNQVFTTCGIARISFDSQCVRLPNGETLRK
                     SSTSGIEDDYYEDLSASTPVTNVFECGFKLRSLQTKCPLIAEGNYTAASECCASLETF
                     ALSKCHCGDLHCGGRSRPCESLFARDDVGQIVQFCTLSGFSTPSFDVCGRNTSVVTPP
                     AKRASKSASTASTLIWVPAHERRELSKEDAEDLLLGWESLWLSQIDAKIANYEHISIA
                     YMSQRSTEDIIAAASRGAFVLLFIGYFTVAFYVVTYFHLSPNAACGPRAAVEGVSVVA
                     LSTWASLGLSAALSRISGVTFNAITLQVLPFLSLGLGVNDFFVLASHAAAATAELEDS
                     FVDGDSISSNEDILVRTLRDGGTSVTLSSAMNFAAFLLGAISPVPAVRNFGIQIACAV
                     ACNYIVALLVFPGILYRHLERRSASEARRVSEDVECTTPLRRDSSFAKISSAVYEPFV
                     RWRERLIAAPRASTALRLAVLAMYGVFAVYLIAGIPTVRLGLEMRDVIPSDSYMAPFV
                     AEMEHRFATYPVFVFVSNVDFARYAVALRELERDFLDVAHVDVTHGSTNFMIYYTEYA
                     ESRVAGGHSCSLNDTRWYYDATRAAEPYDSCAADALDENQTFTCMVKCLAHVPQTQSK
                     RCEFHKGASRERSRCYCPHRLIYNEDAFVREFPAFLAGGQRGEISRAFTTLGSNASIV
                     TSARLLFYVEDVFDVDDKLAHIRQARSALKNSDIVARGGARAFPFDVALYAMNEQYLN
                     IKSNTWRALIIGLVTSTIIMFVAFRGDVRATMVASATLAFTQAELFGAMGRFNVKLNG
                     ASMANLIISTGVVNEFIAHMSRAFFSSDRRAGAAFASIAPALFNAGVTTFLGVIPSAF
                     ARYEYFRVYFFSQWCVILLFAVANGVVFLPIALSLFA"
     gene            <499386..>499883
                     /locus_tag="OSTLU_19130"
                     /db_xref="GeneID:5006827"
     mRNA            <499386..>499883
                     /locus_tag="OSTLU_19130"
                     /product="predicted protein"
                     /transcript_id="XM_001422572.1"
                     /db_xref="GeneID:5006827"
     CDS             499386..499883
                     /locus_tag="OSTLU_19130"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422609.1"
                     /db_xref="GeneID:5006827"
                     /db_xref="JGIDB:Ost9901_3_19130"
                     /translation="MSGRERDALLGNDAERARRKTAIEGVERSSANADRLEQTARTAM
                     ESAQTGENIMSKLHDQREKILSARASAGHMERDMDKSEKRMTQLGCEKCMQRWAFCVL
                     VLLVLTGLSFLLWYKLKHRDEDKARREAEEDEALAMLASKVTSTVNDSLAHMGRVPRR
                     LLGTR"
     gene            complement(<499960..>500376)
                     /locus_tag="OSTLU_7768"
                     /db_xref="GeneID:5006668"
     mRNA            complement(<499960..>500376)
                     /locus_tag="OSTLU_7768"
                     /product="predicted protein"
                     /transcript_id="XM_001422733.1"
                     /db_xref="GeneID:5006668"
     CDS             complement(<499960..>500376)
                     /locus_tag="OSTLU_7768"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422770.1"
                     /db_xref="GeneID:5006668"
                     /db_xref="InterPro:IPR010865"
                     /db_xref="JGIDB:Ost9901_3_7768"
                     /translation="LALCPSTPNCVGTADEFNDTLHYIPAWTYNDEEKIARGGAAKTT
                     SEAMQELVDVTLTTDCDGFTPTIVERTDDYLRLEYKSKIFGFVDDVEFWFPKDVGNSK
                     SRVDYRSASRLGQSDGDANRKRIKTLRLALSKYGWKS"
     gene            complement(<500728..>501543)
                     /locus_tag="OSTLU_6189"
                     /db_xref="GeneID:5006828"
     mRNA            complement(<500728..>501543)
                     /locus_tag="OSTLU_6189"
                     /product="predicted protein"
                     /transcript_id="XM_001422734.1"
                     /db_xref="GeneID:5006828"
     CDS             complement(<500728..>501543)
                     /locus_tag="OSTLU_6189"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422771.1"
                     /db_xref="GeneID:5006828"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="JGIDB:Ost9901_3_6189"
                     /translation="FEEIPLDHLEFGRQIGRGAFGEVFRGKYRGTDVAIKRLCVLSDV
                     SDERGLAEFKRELSFLTRLRHRHIVQFIGASTAPPNLCIIMDYCDKGSLYAYLHNPNK
                     TLSAFKVLKWMSEAAKGLVYLHASDIIHRDVKSGNLFIDDGGSIKLGDFGLSKFHTGA
                     STSGGMMSLVGTYQFMAPELLEGQPRYTTAVDVYSFAVVMWECLTREDPFSGLSPMQI
                     VAALLRGERPSLDDASKFAVRLPEEYIAVIARCWRADALERPTMEDIAPELERM"
     gene            <503168..>506419
                     /locus_tag="OSTLU_94122"
                     /db_xref="GeneID:5006829"
     mRNA            <503168..>506419
                     /locus_tag="OSTLU_94122"
                     /product="predicted protein"
                     /transcript_id="XM_001422573.1"
                     /db_xref="GeneID:5006829"
     CDS             503168..506419
                     /locus_tag="OSTLU_94122"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422610.1"
                     /db_xref="GeneID:5006829"
                     /db_xref="InterPro:IPR010687"
                     /db_xref="JGIDB:Ost9901_3_94122"
                     /translation="MTTPSPQIATLRRRTMATRDALAAFCAASARDDDATSLADDVAL
                     AEIARAIADGARAVLDVVVDLEGFLTATEPKPRARATEILAHVAEECAMTLDDRAVRT
                     LSAFFASRLSDFASTASAARGAEALVKRANAEAIEATSRALFAECDVQGLRQSDREAC
                     VRLAIEMLRSAHAGACARGAGDGEPNEALARIIGAFDGEKDPRCVLGLCEVWTLLPGA
                     FERFGEGGKAVYEENAEELYDVAASYFPVSFKPPRGDSIKISRRQLAEAVERAMTASP
                     TFAPWAVAHALESLNPELGPGKMADAARAVRAMGERFGASVMEEYMGIVWQAMRAALA
                     HPNATKMEEDDDVQATTPMAVMTTMFASEFTRGTLARAALTDQCVRDAEVTLRRMAND
                     SSSDDVDGACAMETSDEGCCGGGCGGGSKSSGEEAARGKLVVATASRVLGAVAAATPT
                     LAHDVIHGTLKSLLDAAKIPREIDGLHSSKAAYLALILATPALGGALDCCERNAESSV
                     HMSVLDDESERLVGLFADAALGKIESPSFDEGIVLGLAGLHMLCKFPYRFGLASAESR
                     VAVASKLFDAMMAQHVNESEADIEVRIERSIDALVAAASGADAKLVDAMSTGAVALLA
                     DKVTVTNLQTVEATRAIRALCALAAVNQMIRNDVARLFCGVVRDAIEIGSPNAEDLVS
                     AMCRDDDGVLTRFVSSDEAQRACADLTTFCLARDPATTAESTVRVVASAVANCDDATQ
                     ARFAAEAVALSREKPLMACAVICGLRPQAAFEATHMVAALDELTRSRGDRGFSMFVAA
                     AVGSATHKFPSVDFAPPMEDLTDERTTFVLGACLRARAMRRDDSSPSDALVSCLVRAL
                     DDSSSPEASRGAAMALSMAVGFSAAHRDIGLGLKSSTHASEKFLACQRFFTKVAPTLI
                     KGAYEAVGAKRLSRSYAVVKLASGVAPSVALSSQFNLFPLLPDVLHALTVGTLAGDDD
                     AVRAALLLVGARLAEPALYDAGSEGATEQNAVALIDALCAIATATSTMSMECREHALD
                     ALVAASTLKFSAVYPSRRRALDAAVVACDDPKRRVRRAAARARQVWLKLMTST"
     gene            <507400..>507828
                     /locus_tag="OSTLU_8048"
                     /db_xref="GeneID:5006669"
     mRNA            <507400..>507828
                     /locus_tag="OSTLU_8048"
                     /product="predicted protein"
                     /transcript_id="XM_001422574.1"
                     /db_xref="GeneID:5006669"
     CDS             <507400..>507828
                     /locus_tag="OSTLU_8048"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422611.1"
                     /db_xref="GeneID:5006669"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="JGIDB:Ost9901_3_8048"
                     /translation="LEQQIRDVERATTKTTREIKLCAKRNDQKSARALAKEIVQARKA
                     IEKLYTSKARASSVERALTRRAATQTSVKTLERSSEVLKAMNALVKVSAVRDQARELS
                     REMTRAGIMEELVEEALADDLEDEDETERAIEDILKEIAGE"
     gene            <508779..>510032
                     /locus_tag="OSTLU_19134"
                     /db_xref="GeneID:5006670"
     mRNA            <508779..>510032
                     /locus_tag="OSTLU_19134"
                     /product="predicted protein"
                     /transcript_id="XM_001422575.1"
                     /db_xref="GeneID:5006670"
     CDS             508779..510032
                     /locus_tag="OSTLU_19134"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422612.1"
                     /db_xref="GeneID:5006670"
                     /db_xref="JGIDB:Ost9901_3_19134"
                     /translation="MHFVPVGDASGWSAALLRYKAKEGVETRRPIVMVPGCASNGMTF
                     DVDKTVSLPRYLTERGHEVWIVETRGVGYARRWTRPRSDYVEVAPPTDSVGEGSGGGI
                     EIPMMRSVGFGLWDFDTLLNEDLFCSCEYIAEVCRRGDLAGVGHSMGGMLLASLAAVG
                     PKESDIGVNCSWSMTRVCTMASCLECSSESDPESPASVYARFAALAGHLPRGLTANPS
                     TTTVHLPIAPASVATAEAFQFVLGPPPPIDGDGASAPDPAKAFWRNSVSPVTCHPGAT
                     DSEFLRRLLLRGFNNVPLSLLIQMATLFTPGGMRSRDPSMGVDESSSVRARIARDSER
                     LKYLDELQRARVPVLAIAGDVDPIFPPNQVKAYARKVDAEYHVFGDASSPRDDPDTHY
                     SHYDVICGRHAPHKVFPIVAEFLER"
     gene            <510672..>513769
                     /locus_tag="OSTLU_19135"
                     /db_xref="GeneID:5006671"
     mRNA            join(<510672..511448,511604..>513769)
                     /locus_tag="OSTLU_19135"
                     /product="predicted protein"
                     /transcript_id="XM_001422576.1"
                     /db_xref="GeneID:5006671"
     CDS             join(510672..511448,511604..513769)
                     /locus_tag="OSTLU_19135"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422613.1"
                     /db_xref="GeneID:5006671"
                     /db_xref="JGIDB:Ost9901_3_19135"
                     /translation="MKWQWHGGSLGRDGALYAVPCNASSVLRVCTKTEEVSFIGGDVI
                     SPMKNKWYGGIQAPDGSIYGVPYCSDKIIHIVPETQSVEMLELQGATLEPNSYAWHGG
                     ILAPNGCIYCFPSHARRAMKIDCATRTCTLIGDDLGDKRYKFGGGCVGPDGDSVYAFP
                     SDYKAVLKIDTRTDQTSLVGEGLPGMLPDLLNKWQNGVLAGDGYIYGIPCDAPSVIQI
                     DPGTDSVHFLGNLGDLPDKYQGGFLNRDDGVVYCIPENAENTRARDRTCAPARRRRSR
                     ARTMLPSWLAGSSSDEYSGDESEGPRSPSRLKQIGSTVKHEAKDRLTKLARSGTASTA
                     VDGLTDFIADPKSHAAATKIGNLKEKSKTLWTNAMRDDEAKIERTKNATKKALEITEK
                     LCVNADPDGEVAHTFADAARRMKDIVDTGKNREEVLELSKTLGKDVWERLSTRAKGNE
                     HFTGMRGTVERIVNRVKGLMQKLQDEKMKRDEEAAISAVLNSEAAVDEIDSRLKTLAE
                     ESKDVWSDLKADTQLRALIKEEVVPGFERLIRGAVQVSCELMSKLELPRVDGVYDSPI
                     GSVCYHVDNVHFTEFHVSKESLRVINHMDEDELGAGLSTTVEVRDINTVMQNVEFAYC
                     EFPRNWGVVDGEGLCTVTVDGASVGISYEIIINTNQLMKLVNQGVELAKDDGKIAEMR
                     EKIEAKMKERKEAKEREAARAQAAKPAATTPVKIEKCASIDSDREEFGSPTGEVDALG
                     SALDRAFGGGMFSDAHDDVDSPPLSPTSPTFHDATDDARILGAKEKLIRNRKVVSEIL
                     GDDFLGEEPVLELRVHTTHISVGELDVQISGTSAAWLYNMIALVLTQQLRGTIEEKIN
                     NITVKQLARVSGAVSAYSAGLIEVSIYQDDESDDDIGSMLSGVTGSLRENPGVWGEDW
                     RCSHCPGEAPEHVEARRKFGSRSHSKASFEGLDEIVEEADAIERAEAARRSLEDEDVD
                     WHDIASPM"
     gene            513915..>515304
                     /locus_tag="OSTLU_51907"
                     /db_xref="GeneID:5006672"
     mRNA            join(513915..514608,514666..>515304)
                     /locus_tag="OSTLU_51907"
                     /product="predicted protein"
                     /transcript_id="XM_001422577.1"
                     /db_xref="GeneID:5006672"
     CDS             join(513916..514608,514666..515304)
                     /locus_tag="OSTLU_51907"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422614.1"
                     /db_xref="GeneID:5006672"
                     /db_xref="InterPro:IPR008183"
                     /db_xref="JGIDB:Ost9901_3_51907"
                     /translation="MAKRSEPKPANAEDNSQTGKIAIVALAALGLAIKSRVARSKADA
                     KPFVTRLPTATNSTPGASSSVDKSPSGRALRSPLRPRDSSTRDHAAEGLALIELEARG
                     VAVSVSPFGATIVSLRAARRGDADEKDDVVLGFDDCESYDEVEGRPYFGAVCGRVANR
                     IARGEFAVGRRTHTLAKNNGENTLHGGTSGWDRKRWTVEDQTRSSVTLSYVSVDGEEG
                     FPANVKMYVVYSVLCVRNCAEVTTKMTATADAMTPISTVQHTYFNLNGHACGEDCSSH
                     VVEMPNCDRYVPVNEDTLIPTGEGLRKVDGTAFDLRSPTPMFEKSSEGYDNTFVIAGA
                     DATRPTSELPRAAPRLAARVTCEDAGRVLEVLTDAPGVHLYTGNFLSENMVGKKKERA
                     RYRKHGGFCLETGWFPDAVNQHSKIGASYPSVMVNRGDTYSHTLTYRLSNI"
     gene            complement(<515325..>516008)
                     /locus_tag="OSTLU_29604"
                     /db_xref="GeneID:5006673"
     mRNA            complement(<515325..>516008)
                     /locus_tag="OSTLU_29604"
                     /product="predicted protein"
                     /transcript_id="XM_001422735.1"
                     /db_xref="GeneID:5006673"
     CDS             complement(515325..516008)
                     /locus_tag="OSTLU_29604"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422772.1"
                     /db_xref="GeneID:5006673"
                     /db_xref="InterPro:IPR001388"
                     /db_xref="JGIDB:Ost9901_3_29604"
                     /translation="MVKLTLLARANDGLPLAESLDASTSNGDVESRALETCKRQAKAL
                     FKKLGEPAPNPPPSRMTIETGEHLMHYVVDDGVCYLCVCDRTYPKKLAYQYLEELQQE
                     FARQNGREVDAVARPYAFIKFDTFIQRTKALYSDARTQRNLNKLNTDLADIQQIMTRN
                     INDIMAQGEGLDRVSAMSGNLSAASKKYSKRARDLSRQALIQKYMPLAIFVGVVFLTL
                     LLRFYVFSY"
     gene            <516642..>517247
                     /locus_tag="OSTLU_6724"
                     /db_xref="GeneID:5006830"
     mRNA            <516642..>517247
                     /locus_tag="OSTLU_6724"
                     /product="predicted protein"
                     /transcript_id="XM_001422578.1"
                     /db_xref="GeneID:5006830"
     CDS             <516642..>517247
                     /locus_tag="OSTLU_6724"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422615.1"
                     /db_xref="GeneID:5006830"
                     /db_xref="InterPro:IPR006977"
                     /db_xref="JGIDB:Ost9901_3_6724"
                     /translation="GWIFSVSYYQQFFDVDTEEVTKRVSSVFTSPHKGTFLDDVAGNP
                     DLYVPIWGSATLVFFTALGSAWGKFNMRKSEGWSFDAKSVSLSAALIYGYVFLFSLIV
                     HMTLTCYARVDNLRVTDVWCLYGYSILAFIPVCILATVPVELFRWLFTGACAALSTLF
                     LMSNVRKRVLSSSKGTTFAVSFVSFIGAAHFAFALILKLFFF"
     gene            <517542..>518312
                     /locus_tag="OSTLU_13493"
                     /db_xref="GeneID:5006674"
     mRNA            <517542..>518312
                     /locus_tag="OSTLU_13493"
                     /product="predicted protein"
                     /transcript_id="XM_001422579.1"
                     /db_xref="GeneID:5006674"
     CDS             517542..518312
                     /locus_tag="OSTLU_13493"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422616.1"
                     /db_xref="GeneID:5006674"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="JGIDB:Ost9901_3_13493"
                     /translation="MGNRSSSTWDATQTQEDFMRNDRVIVVSAADDVLGSETKENAHK
                     FIEGSSTTPRGTLHRAFSVFLFDDSGRLLLQQRAANKITFPSVWTNTCCSHQLTGQKP
                     DEMDDASAIASGACDGAKRAATRKLKHELGIDAKDVPTESIKFLTRLHYCAADEFAEN
                     ANQPVGGTWGEHEMDYILFAKIARAGESLPMAVNAEEIDDTKWVTASELKAMMDQSSG
                     LRWSPWFRIIAEKFLYAWWTDLDSLDKHVDVETIHKVM"
     gene            complement(<518603..>520429)
                     /locus_tag="OSTLU_19140"
                     /db_xref="GeneID:5006675"
     mRNA            complement(<518603..>520429)
                     /locus_tag="OSTLU_19140"
                     /product="predicted protein"
                     /transcript_id="XM_001422736.1"
                     /db_xref="GeneID:5006675"
     CDS             complement(518603..520429)
                     /locus_tag="OSTLU_19140"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422773.1"
                     /db_xref="GeneID:5006675"
                     /db_xref="InterPro:IPR001345"
                     /db_xref="JGIDB:Ost9901_3_19140"
                     /translation="MKSSWDGLRRSFIERTHALNDALSRTAIADGDDANTTRASASSD
                     DDGTTTRDDDDEGRRATTPGALLKRALRRGTKRATPTRETGRYADADDAAEDATRRRT
                     TAATVTRGTTRGTTANRVFVAMRVIGGDGACRGRRAQTMSRSTRTRAPVWNTTRDLRC
                     EARFGDALCVDLYAGDGARGVERATLIARGQVSVQHALANEGAEVAVPMYDKLERATS
                     PATVHVALRTRDLAETRASKRIFYVRHGESKWNEAQRDINIANMMRFDHPLTLFGVQQ
                     AQALGGRAAVACSQAQAGVLVHANVTSTSPPTMSPPSSPSSPKSRSPSLMVAENEGSE
                     LCESYGRCTTCYVSPLTRAVQTACFMLQSHPLTVQGVMRQVCLQSIREIKGVGGLDTV
                     GIEQGDGVLDRAKKKLAEIVNDQAASRLGAGMAFDPNDAIGQWWTSETDSDNAQDVEA
                     RIYDFLETMRLHDADDAVIVVGHSLFLQQLVAKIIPKADDGAGISGSGATRVSPDPFD
                     AFKASKDPFTPAPATTSSDPFAVPQRSTVGPDDIPFVPSTLAAAPKAARIENSHNKGK
                     VFEKLINQKLCNAGCVALDVTFDAYGRATLENASLLFGSKFV"
     gene            <520834..>520989
                     /locus_tag="OSTLU_29608"
                     /db_xref="GeneID:5006831"
     mRNA            <520834..>520989
                     /locus_tag="OSTLU_29608"
                     /product="predicted protein"
                     /transcript_id="XM_001422580.1"
                     /db_xref="GeneID:5006831"
     CDS             520834..520989
                     /locus_tag="OSTLU_29608"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422617.1"
                     /db_xref="GeneID:5006831"
                     /db_xref="JGIDB:Ost9901_3_29608"
                     /translation="MAWVRDPLVLVQHRMSKPIGIEGERGEEQSGAGRSGAEESAAAR
                     ARTDGLD"
     gene            complement(<521006..522346)
                     /gene="ARP3504"
                     /locus_tag="OSTLU_29609"
                     /db_xref="GeneID:5006676"
     mRNA            complement(<521006..522346)
                     /gene="ARP3504"
                     /locus_tag="OSTLU_29609"
                     /product="predicted protein"
                     /transcript_id="XM_001422737.1"
                     /db_xref="GeneID:5006676"
     CDS             complement(521006..522229)
                     /gene="ARP3504"
                     /locus_tag="OSTLU_29609"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422774.1"
                     /db_xref="GeneID:5006676"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="JGIDB:Ost9901_3_29609"
                     /translation="MTDASGALPARFATSVGLTNRENVVVCDTGTGFVKAGYAGDEEP
                     RTLFPCMVGRPTLRYEEDAFDDEAMKDVYVGDEAARKRANLEISYPVSNGVVRDWEDM
                     GLVWDRAFESLGCDTRECKVMLTDPPLNPKSNRERMMSTMFETYGFRGAYVQVQAVLT
                     LYAQGLMTGVVVDSGDGVTHVVPVVDGYSFPHLTKRLNVAGRHVTTRMIDLLTRRGYP
                     LNRTSDVETARLIKEELCYVAYDYKRDLQLARETTATNASYTLPDGRVIKFGPERFMG
                     PECLFQPDLIDVESDGISDLVFKCIQENEIDNRRSLYQHIVLSGGNSMYAGLPSRLER
                     DIKRLYLKNVLNGDKEAMKKFKMKVEAPAHRKHMVFVGGAVLADIMRSKDEFWISKQE
                     YEEQGIERALKKCGM"
     gene            complement(<522693..>523298)
                     /locus_tag="OSTLU_5359"
                     /db_xref="GeneID:5006832"
     mRNA            complement(<522693..>523298)
                     /locus_tag="OSTLU_5359"
                     /product="predicted protein"
                     /transcript_id="XM_001422738.1"
                     /db_xref="GeneID:5006832"
     CDS             complement(<522693..>523298)
                     /locus_tag="OSTLU_5359"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422775.1"
                     /db_xref="GeneID:5006832"
                     /db_xref="JGIDB:Ost9901_3_5359"
                     /translation="FLASTFAYSCYKVFRKATSGRMRRKRTVNKNVEVVERLKNFFPN
                     ERSSVNKGVVRGLALKTGYSSAEIFRKYLRYKLTEEAFTLDFVADVLALKGACGLDSE
                     EMKEILLETGERMFKKYGTLMTNLAGLTQSGMERKIDGAGKFAKLMYLADLDEFIDKA
                     HGAEVQLKLKETFGATDDDYNKLRITALGSDEVDVSSLNSMI"
     gene            <524017..>524778
                     /locus_tag="OSTLU_13495"
                     /db_xref="GeneID:5006833"
     mRNA            <524017..>524778
                     /locus_tag="OSTLU_13495"
                     /product="predicted protein"
                     /transcript_id="XM_001422581.1"
                     /db_xref="GeneID:5006833"
     CDS             524017..524778
                     /locus_tag="OSTLU_13495"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422618.1"
                     /db_xref="GeneID:5006833"
                     /db_xref="JGIDB:Ost9901_3_13495"
                     /translation="MSFMDAREHGSKIGGGGVASASQGAVDRRERLRRLALETIDLAK
                     DPYFMRNHLGSYECKLCLTMHANEGNYLAHTQGKRHQQNLAKRAARDAKDADASFGKS
                     KTATIQPRKTMKIGRPGYRVTKQYDRRTRQRSLLFQVDYPERELGTKPRYRFMSAYEQ
                     KVEAWDKRYQYVLFACEPYETIGFKIPNVDVDKAGRDKFFTHWDEDVKTYTCQLTFRR
                     VDGDGAPRGGGMPRGGIPPPPMVGGLPPPPPPPVR"
     gene            <525082..>525963
                     /locus_tag="OSTLU_19144"
                     /db_xref="GeneID:5006677"
     mRNA            <525082..>525963
                     /locus_tag="OSTLU_19144"
                     /product="predicted protein"
                     /transcript_id="XM_001422582.1"
                     /db_xref="GeneID:5006677"
     CDS             525082..525963
                     /locus_tag="OSTLU_19144"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422619.1"
                     /db_xref="GeneID:5006677"
                     /db_xref="JGIDB:Ost9901_3_19144"
                     /translation="MHARAAIVSASASIARGTESSHSEPFVPSARVVDENAHAELRCA
                     GKTSREELSPSQRARALAGIMDAASALGTRAPLSPLGNGTTPLRRARSLMAEAATTSA
                     ANGLKQIRASRANRASSAGARDAEENLDALEDEAPRRAASDAASVASASALDAANAIA
                     KYADRERQLVAFMKEMASSADARLNDALDALSASEAQREEELAAMALAADAEREALEF
                     SILLENKARVKERERVVELETLLALKQREIDALAAERGGARPSAAAVRYAANVRDEVK
                     AILRAEFKRELADELLK"
     gene            <526235..>526681
                     /locus_tag="OSTLU_8844"
                     /db_xref="GeneID:5006678"
     mRNA            <526235..>526681
                     /locus_tag="OSTLU_8844"
                     /product="predicted protein"
                     /transcript_id="XM_001422583.1"
                     /db_xref="GeneID:5006678"
     CDS             526235..>526681
                     /locus_tag="OSTLU_8844"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422620.1"
                     /db_xref="GeneID:5006678"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="JGIDB:Ost9901_3_8844"
                     /translation="MSTPARKRLMRDFKRLQTDPPAGISGTPSESNIMAWHAVIFGPE
                     GTPWEGGTFKLTIAFSEEYPNKAPVVKFVTKMFHPNVYNDGSICLDILQNQWSPIYDV
                     GAILTSIQSLLCDPNPNSPANSEAAALYNENRRAYNKRVSACVEDSW"
     gene            <527082..>527912
                     /locus_tag="OSTLU_43811"
                     /db_xref="GeneID:5006679"
     mRNA            join(<527082..527266,527363..>527912)
                     /locus_tag="OSTLU_43811"
                     /product="predicted protein"
                     /transcript_id="XM_001422584.1"
                     /db_xref="GeneID:5006679"
     CDS             join(527082..527266,527363..>527912)
                     /locus_tag="OSTLU_43811"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422621.1"
                     /db_xref="GeneID:5006679"
                     /db_xref="InterPro:IPR000445"
                     /db_xref="InterPro:IPR003265"
                     /db_xref="JGIDB:Ost9901_3_43811"
                     /translation="MASEAELVTRVDANEARTTDEDARASLLRWYDANKRSLPWRRRG
                     KQRKWIKIEALAEDAATPDDQYAYGILVSEIMSQQTQIERVAEYWRRWTARWPTAEAL
                     AEATIEEVNEEWAGLGYYRRAKFLLNGAIYVRDALKGKYPRDVEGLSKIPGVGPYTAS
                     AVASIAFGAKTAAVDGNVYRVITRAKMIKGDPLKGDAAKEIRRVADAFVDAERPGDFN
                     QAMMELGAMVCAPQNPKCDSCPISMWC"
     gene            <529887..>530456
                     /locus_tag="OSTLU_7767"
                     /db_xref="GeneID:5006680"
     mRNA            <529887..>530456
                     /locus_tag="OSTLU_7767"
                     /product="predicted protein"
                     /transcript_id="XM_001422585.1"
                     /db_xref="GeneID:5006680"
     CDS             <529887..>530456
                     /locus_tag="OSTLU_7767"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422622.1"
                     /db_xref="GeneID:5006680"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="JGIDB:Ost9901_3_7767"
                     /translation="KGPVLPARDEHDTRNTLVLDLDETLVHSNLENTVERCDFSFPVV
                     FNGDMHRVNVRKRPHLSTFMELVSKQYEIVVFTASQQIYADKLLDILDPSQKWIKHRI
                     FRDSCVQIDGNFMKDLRVLGRDLSRTIIIDNSPQAFGLQVENGIPIESWYDDDADNHL
                     LSLLPILNELAADTDVRVTLDRMFNLRERV"
     gene            complement(530562..>531675)
                     /locus_tag="OSTLU_29616"
                     /db_xref="GeneID:5006681"
     mRNA            complement(530562..>531675)
                     /locus_tag="OSTLU_29616"
                     /product="predicted protein"
                     /transcript_id="XM_001422739.1"
                     /db_xref="GeneID:5006681"
     CDS             complement(530590..531675)
                     /locus_tag="OSTLU_29616"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422776.1"
                     /db_xref="GeneID:5006681"
                     /db_xref="InterPro:IPR001804"
                     /db_xref="JGIDB:Ost9901_3_29616"
                     /translation="MHASKRYNVTILPGDGIGPEIMRVARSALEAAGARADVAFAFEE
                     GLVGGSAIDAHGTPLPEETLEMCKASDAVLLAAIGGYKWDNLPSAERPEQGLLGLRAG
                     LGVFANLRPANVLPQLIEASTLRRDVVEGTDIMVVRELTGGIYFGKPKGFGVNDAGER
                     IGFNTMVYSEPEVDRIAKVAFEIARKRKGRLCSVEKANVLEVSQLWKERVIETHKQFS
                     DVELSHMYVDNAAMQLIRNPTQFDTIVTGNIFGDILSDAASMLTGSIGMLPSAAIGLE
                     GPGLYEPVHGSAPDIAGQDKANPLAQVLSAAMMMRYQFGEEGIASALEKAVNDVLDDG
                     YRTGDIMQEGKTLVGCVKMGELLLAKL"
     gene            <532104..>532789
                     /locus_tag="OSTLU_43813"
                     /db_xref="GeneID:5006834"
     mRNA            join(<532104..532124,532574..>532789)
                     /locus_tag="OSTLU_43813"
                     /product="VIC family transporter: potassium ion channel"
                     /transcript_id="XM_001422586.1"
                     /db_xref="GeneID:5006834"
     CDS             join(<532104..532124,532574..>532789)
                     /locus_tag="OSTLU_43813"
                     /codon_start=1
                     /product="VIC family transporter: potassium ion channel"
                     /protein_id="XP_001422623.1"
                     /db_xref="GeneID:5006834"
                     /db_xref="JGIDB:Ost9901_3_43813"
                     /translation="HDVDGWSTFVDAVYFIAITVTTVGYGDISPQTDAGKIFMLFFII
                     VGIALATVVISKITDLIVDAKERSEVKAQEELDRS"
     gene            <534310..536599
                     /locus_tag="OSTLU_29618"
                     /db_xref="GeneID:5006682"
     mRNA            <534310..536599
                     /locus_tag="OSTLU_29618"
                     /product="predicted protein"
                     /transcript_id="XM_001422587.1"
                     /db_xref="GeneID:5006682"
     CDS             534310..536544
                     /locus_tag="OSTLU_29618"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422624.1"
                     /db_xref="GeneID:5006682"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="JGIDB:Ost9901_3_29618"
                     /translation="MVKPKPKERGDREQRNLNEHHARREQQRARHDGAVNGAGGGKRG
                     GARDLEDLIARVEDAEDAAAVERVLRQSVFKPGAPAYTTVIKACGKASQWEKALKAYE
                     MMTKLHGAKPNTITFSALINALGKAKQCDRAFQIFDEMNDRGIEPNIFTYSALLGACA
                     RAKQYQRAMDIFQDLIENHRDVEVDRITYGAAIQCCVQGRRADKAIEIFERMLASGIK
                     GNIITYNAVLMACEKSGDSDGAQEMFERMSAEQVPMDRATFHAMIGACDRARQLSKVM
                     DYYHMMPERGVTPDAGTVSNVLMACSNAKDPLTAIKVYHDARAKFDVHRTPGMFNNLI
                     GALHRGKRYDLVYEQLFHDSMTQSALSVSTYVHLMMACERFGNWEKSFQLFEEFKRHS
                     PSSVDSYVWTRVFYACGRFESDDPVWKNGAIPGYTSPTLQRAQATMRALWAEYKSKLS
                     VFKEISAVAARVSRAGSNHPSAQSDVDASLALASAKHSELAQTHEAAPAAESAVEQEF
                     VQLINAYRSAAAAAARCSDPSTVLDILRTCEYDGIPQDSVIYGAFVAALALNGDRVGA
                     NEKFREMFTLGLQPGVAVYAALARAAARAGDANTALSLAEDVRSMVGSSVGDGAIIDA
                     VVAACEAGGDWTRGASLFTMWAANGVQGANDELRRAIAASSGLDPGPTRRGTSVYNAF
                     RREPPAESQGVAAPRDAKTTTLTAKVQPFVPRGRPSVLRDDAKSSESKSPPDEGENPP
                     DEAL"
     gene            complement(<536714..>537787)
                     /locus_tag="OSTLU_19151"
                     /db_xref="GeneID:5006683"
     mRNA            complement(<536714..>537787)
                     /locus_tag="OSTLU_19151"
                     /product="predicted protein"
                     /transcript_id="XM_001422740.1"
                     /db_xref="GeneID:5006683"
     CDS             complement(536714..537787)
                     /locus_tag="OSTLU_19151"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422777.1"
                     /db_xref="GeneID:5006683"
                     /db_xref="JGIDB:Ost9901_3_19151"
                     /translation="MTRATGRARASEDDATTTRGTYGATRTSRGSASDDARDDARRRG
                     TTRARRWRAAGACACLALAIGTCGTGEGGAIERWGEATRALGARAWTKGVGAALGEGS
                     VSSTVTSSVTSTVNGGTPSPPPPSPPPNPPPNPPPPSPPPNPPPNPPPNPPPTATPDA
                     HPSSTPVESPSPAPEPVSSPPALTPDQAAKLKRDIRRLTRKIGRRKPDHPSMPGLQQQ
                     LAELQRELNGEASPTSSPSPASEPVSSPPALTPDQAAKLKRDIRRLTRKIGRRKPDHP
                     SMPGLQQQLAELQRELNGEASPTSSVSARLGSKASIVVSTRDLDVSRASLFCVVAVTI
                     VGIVIRRLRRAPEFETDEIARLL"
     gene            538023..539355
                     /locus_tag="OSTLU_29620"
                     /db_xref="GeneID:5006835"
     mRNA            538023..539355
                     /locus_tag="OSTLU_29620"
                     /product="predicted protein"
                     /transcript_id="XM_001422588.1"
                     /db_xref="GeneID:5006835"
     CDS             538252..539322
                     /locus_tag="OSTLU_29620"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422625.1"
                     /db_xref="GeneID:5006835"
                     /db_xref="JGIDB:Ost9901_3_29620"
                     /translation="MAFVALCALVGGLALVKAERARGAGRIDRAALGGAARAQNAPGH
                     VPGLAEHVESVTRSTKFRAITFCNKSYWTFAHALLESMKAVAPSIVDFWTVIVPDEAT
                     KEFIEKETAGAGHKIDVYVDDDLRKQVAKFAEASKEELKSMLSWRRVHAVQTLVDNDY
                     TVMFLEPDAVMQKNPLQLIHDQLTTNDLVLGADYGLGTTARKHANTKVIVAKPSVQGK
                     KLLNVWQRAEQTYSGDKAEVGFLLNDVIPHIDALTAKIQILDQTVVGNYLTHHEKAGQ
                     AIVTGMGCDNVDFKINFMAQLLRHVQPDDPNAPKSAIDYEGVSAGCDYAGREKVFKIS
                     NEFAKKKMAAKLGSNKATSSDE"
     gene            complement(<539900..>541153)
                     /locus_tag="OSTLU_4529"
                     /db_xref="GeneID:5006684"
     mRNA            complement(join(<539900..540189,540307..540899,
                     540963..>541153))
                     /locus_tag="OSTLU_4529"
                     /product="predicted protein"
                     /transcript_id="XM_001422741.1"
                     /db_xref="GeneID:5006684"
     CDS             complement(join(<539900..540189,540307..540899,
                     540963..>541153))
                     /locus_tag="OSTLU_4529"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422778.1"
                     /db_xref="GeneID:5006684"
                     /db_xref="InterPro:IPR000210"
                     /db_xref="InterPro:IPR002083"
                     /db_xref="JGIDB:Ost9901_3_4529"
                     /translation="TTTVIGRHEHTISGYSLLKGLGDGEPIASDRFMVGGHEWVLLFY
                     PDGKRSMSDGNAPSAPQDDPGQGRVVRAFHRFTLVDQSGNGRHITKGRQREQGAVKIS
                     CARQDPQARNCHGYRKFVRRSVLEGSGTGYLLNDVVVIRYEIELVVTSGGALNKNMKL
                     LPAASVNVPSYPTIGKHLVRLLHDPDSDFDCTFDVEGEKFRAHKLILSSRSSVFAAML
                     RTGAAMREGREGVCTLLDIKPSVFRLLLHFVYADEIPREGSGVINLDVPMTQHLLVAA
                     DRFDLSRLRAMCEARLCESVDVDTVANTLMLAELNHADALKRACMSFIAANLSDVMST
                     EGYEAMNISCPHLAGEILSSVAEM"
     gene            <541806..>542960
                     /locus_tag="OSTLU_19153"
                     /db_xref="GeneID:5006836"
     mRNA            <541806..>542960
                     /locus_tag="OSTLU_19153"
                     /product="predicted protein"
                     /transcript_id="XM_001422589.1"
                     /db_xref="GeneID:5006836"
     CDS             541806..542960
                     /locus_tag="OSTLU_19153"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422626.1"
                     /db_xref="GeneID:5006836"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="JGIDB:Ost9901_3_19153"
                     /translation="MVRGKGCALFDASGKEFLDFTSGIAVNCLGHADEGVARVIAEQA
                     RTLTHTSNLYHTEPGATLARKLTATSFADRVFFCNSGTEANEGALKFARKYAKTRAQA
                     LGKNAGDAAWETVSFENGFHGRTFGALSLTWKEGYRAPFAPGLPGNTFTPYGDLEKAR
                     QVIVKGRTCAVFVEPVQGEGGIYPADAEFLRGLRAICDEADALLVYDEVQCGLGRTGK
                     LWGHQLIKDAEPDMMSVAKPLANGLPIGAVLMKEKVAAVMAAGDHGSTFAGGPLVCAV
                     ANEVFDRVSDPAFLANVTERGNELKSSLTEKLAGHPRLREVRGAGLLVGVQFDCPTAP
                     LVAACRARGLLTITAGKGDILRLVPPLIVSSAQVQKATDIVKECAFEALR"
     gene            <543387..>544618
                     /locus_tag="OSTLU_29623"
                     /db_xref="GeneID:5006685"
     mRNA            join(<543387..543650,543896..>544618)
                     /locus_tag="OSTLU_29623"
                     /product="predicted protein"
                     /transcript_id="XM_001422590.1"
                     /db_xref="GeneID:5006685"
     CDS             join(543387..543650,543896..544618)
                     /locus_tag="OSTLU_29623"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422627.1"
                     /db_xref="GeneID:5006685"
                     /db_xref="InterPro:IPR006734"
                     /db_xref="JGIDB:Ost9901_3_29623"
                     /translation="MRPSARGDGGLTTRARATTARERSQGAKAQLPKELSWIPDLVHG
                     AFFAPCDVHSTGSKGEQVNLFSLSSRRSMCPACAAERDVFDTIQIRRSSYHNVVRVQD
                     VCKLMDVTGIQTYIINSARVVFLNERPHPRSTNKKDGEKLMNHSSSSGRGAGSGERYR
                     AGAGAQAQMHSECSYCARILQSDNNKYCSISCKMNGGEDMSAKGGIDMSYAEETIKPT
                     PRKSTQAKNAAKAEKANSDRRSPARNKSPASDTSTKRARGYSPVSVKSEDEYSPSSEG
                     ATPMRAVAAATTGKRKYSSKDRNGDAPVTPTLLIVTPAVPHRRKSKPKKSPH"
     gene            544873..546207
                     /locus_tag="OSTLU_25904"
                     /db_xref="GeneID:5006686"
     mRNA            join(544873..544956,545132..546207)
                     /locus_tag="OSTLU_25904"
                     /product="predicted protein"
                     /transcript_id="XM_001422591.1"
                     /db_xref="GeneID:5006686"
     CDS             join(544900..544956,545132..546100)
                     /locus_tag="OSTLU_25904"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422628.1"
                     /db_xref="GeneID:5006686"
                     /db_xref="JGIDB:Ost9901_3_25904"
                     /translation="MFKDEKRTQYSPLMTREEQAEAVNDMEDAIDEAPAARRRHVGSS
                     SSTYTAYDNPMTSSANVDDDFESVPLRGAGRSLAQRAQAHLKSLKKTLKDAFKDAGSA
                     SRTPAPTSTYGNETYVDDASFVGSPPAGQMLSRHHARARSVDLRHVLGDLDDTLEGAH
                     TAATLLRELRDSGGDPDADAATNDALDLELSDVCEAHRAHLTQVAEMTDSAVSLSEEQ
                     LGKLLFTLEELNAAVLSIRSDGRPKTSTTMPDPDSSCAAVPPSGPPSLGTSRIECATT
                     EEEEAAMIAQAIAASLSVSQQSDVEKSAEDALPPPLPAPAETASTAAAPPRKQTTEEL
                     LANLIDI"
     gene            complement(546327..547558)
                     /locus_tag="OSTLU_25905"
                     /db_xref="GeneID:5006687"
     mRNA            complement(546327..547558)
                     /locus_tag="OSTLU_25905"
                     /product="predicted protein"
                     /transcript_id="XM_001422742.1"
                     /db_xref="GeneID:5006687"
     CDS             complement(546348..547538)
                     /locus_tag="OSTLU_25905"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422779.1"
                     /db_xref="GeneID:5006687"
                     /db_xref="JGIDB:Ost9901_3_25905"
                     /translation="MTSERDARSDTERIARAFTSYVDDYRADARRFGVGVDEDDESFD
                     VRALTALLEGDDEGGLAGLRALIAEMVRALTTEDDGGDVEDALRETASLLRQAAAGKL
                     REFADATIDARTTVRNTIALTPAFVVKTRDASGMKVFVNVCASHDVAAPAAGNDEWRR
                     GLMPKRVIAALEHKKHSVRDGDDDALVFPLREGRARADVDSNANPCTVFDVAFNDVVL
                     RHAEVYKPLKRLIAELSLRRCRETYGIALDTEYRLPARKFIGADPPPPLRLLAETRPS
                     LVETRTVVQNTPSVSRAEIRSGIDHSIEFLGRPVTSVKLRVGVPRGKSARDVGVHVVR
                     EALTVDVTGLPSERIELPFMLDAESARGSCVDGGHTIEYNVAYLPYDVAVDAARARLA
                     KPTN"
     gene            <547836..>548858
                     /locus_tag="OSTLU_19157"
                     /db_xref="GeneID:5006837"
     mRNA            <547836..>548858
                     /locus_tag="OSTLU_19157"
                     /product="predicted protein"
                     /transcript_id="XM_001422592.1"
                     /db_xref="GeneID:5006837"
     CDS             547836..548858
                     /locus_tag="OSTLU_19157"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001422629.1"
                     /db_xref="GeneID:5006837"
                     /db_xref="JGIDB:Ost9901_3_19157"
                     /translation="MMTRARGERRGAKMMALIVASLATLVRGDEYSVNIERAIVNSKG
                     LQAVGALDALSARLLEALCESDETSCEAYETTRKSLWLTFGNDYICQVGSDADATWNA
                     IDTTSTQGGIAVLLSKCSRAWLGDLEQAVLNLAPRFLAQASLQRADVAAVIAANDAAA
                     GRAATQAGDNLDDLHPSYIANLAPIATELTSFSESRPVVVTATATADESTYYSGFSTD
                     VKSAIAASRARGAKSVAGSTEAFPDAYVKRVETAQVSLDLYRGRYLEHPYAKAHYDKA
                     IKCAGQSTNDALCYNRVVPEIGYTHSADGTRLLSSYGEPLATNFVDYNQPATYVAGVR
                     LSSQTR"
CONTIG      join(CP000600.1:1..549133)
//
DBGET integrated database retrieval system