GenomeNet

Database: RefSeq
Entry: NC_010129
LinkDB: NC_010129
Original site: NC_010129 
LOCUS       NC_010129             481791 bp    DNA     linear   CON 16-JUN-2017
DEFINITION  Cyanidioschyzon merolae strain 10D DNA, chromosome 3, complete
            genome.
ACCESSION   NC_010129
VERSION     NC_010129.1
DBLINK      BioProject: PRJNA28057
            Assembly: GCF_000091205.1
KEYWORDS    RefSeq.
SOURCE      Cyanidioschyzon merolae strain 10D
  ORGANISM  Cyanidioschyzon merolae strain 10D
            Eukaryota; Rhodophyta; Bangiophyceae; Cyanidiales; Cyanidiaceae;
            Cyanidioschyzon.
REFERENCE   1
  AUTHORS   Nozaki,H., Takano,H., Misumi,O., Terasawa,K., Matsuzaki,M.,
            Maruyama,S., Nishida,K., Yagisawa,F., Yoshida,Y., Fujiwara,T.,
            Takio,S., Tamura,K., Chung,S.J., Nakamura,S., Kuroiwa,H.,
            Tanaka,K., Sato,N. and Kuroiwa,T.
  TITLE     A 100%-complete sequence reveals unusually simple genomic features
            in the hot-spring red alga Cyanidioschyzon merolae
  JOURNAL   BMC Biol. 5, 28 (2007)
   PUBMED   17623057
  REMARK    Publication Status: Online-Only
REFERENCE   2
  AUTHORS   Matsuzaki,M., Misumi,O., Shin-I,T., Maruyama,S., Takahara,M.,
            Miyagishima,S.Y., Mori,T., Nishida,K., Yagisawa,F., Nishida,K.,
            Yoshida,Y., Nishimura,Y., Nakao,S., Kobayashi,T., Momoyama,Y.,
            Higashiyama,T., Minoda,A., Sano,M., Nomoto,H., Oishi,K.,
            Hayashi,H., Ohta,F., Nishizaka,S., Haga,S., Miura,S., Morishita,T.,
            Kabeya,Y., Terasawa,K., Suzuki,Y., Ishii,Y., Asakawa,S., Takano,H.,
            Ohta,N., Kuroiwa,H., Tanaka,K., Shimizu,N., Sugano,S., Sato,N.,
            Nozaki,H., Ogasawara,N., Kohara,Y. and Kuroiwa,T.
  TITLE     Genome sequence of the ultrasmall unicellular red alga
            Cyanidioschyzon merolae 10D
  JOURNAL   Nature 428 (6983), 653-657 (2004)
   PUBMED   15071595
REFERENCE   3  (bases 1 to 481791)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 481791)
  AUTHORS   Kohara,Y., Shin-i,T., Matsuzaki,M., Misumi,O., Ogasawara,N. and
            Kuroiwa,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUN-2003) Contact:Motomichi Matsuzaki Department of
            Parasitology, National Institute of Infectious Diseases; 1-23-1
            Toyama, Shinjuku-ku, Tokyo 162-8640, Japan
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AP006485.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..481791
                     /organism="Cyanidioschyzon merolae strain 10D"
                     /mol_type="genomic DNA"
                     /strain="10D"
                     /db_xref="taxon:280699"
                     /chromosome="3"
     misc_feature    878..3373
                     /note="repetitive element"
     gene            complement(<4016..>6349)
                     /locus_tag="CYME_CMC002C"
                     /db_xref="GeneID:16992555"
     mRNA            complement(<4016..>6349)
                     /locus_tag="CYME_CMC002C"
                     /product="similar to hedgehog protein"
                     /transcript_id="XM_005535184.1"
                     /db_xref="GeneID:16992555"
     CDS             complement(4016..6349)
                     /locus_tag="CYME_CMC002C"
                     /codon_start=1
                     /product="similar to hedgehog protein"
                     /protein_id="XP_005535241.1"
                     /db_xref="GeneID:16992555"
                     /translation="MKGGLRRSSLRRVLWLRVLVVCLWFSARIWVLVGAGAPAYPVRW
                     TWIGGETSVNNYGKYGTLNVASSNNVPGGRHYSSTWVGSPGVLYLFGGFGYANSSGGY
                     LNDLWRLNVTSLEWAWIGGSMDIYVPGNYGTLGVGSALNIPGAREASAFWRADEEHFW
                     LFGGYGLDGNGNIGCLNDMWQYDTVSGNWTWVDGNDTINALPTYGPMGSYDPSYNPGA
                     RLKAAFWLGADGNFWLFGGENCYSYLFSDLWCFNRSLSLWAYMGGSQSVNQPGNYSEP
                     DIANRSNAPGARQGAITWTDSKANLWMFGGFGYGNGSESYPGFLNDLWFYNISTSIWT
                     FVAGNTTISIPGSYIIFGNTDAASYPGSREYGVGFIDASGNLQLFGGEGYGNSSSESG
                     DLNDLWLFNVEQRQWAWINGSAVINAPADYGMFRTFSPSVVPGARYGSALWNTTESGM
                     ILFGGFGYSNTSEGKGELNDIFMLSESMITPSPTPTPTPTPTPTPTPTPTPTSTSTPT
                     ATPTASATPSLSATPSTAANVTKIPINGGTTICFPEDATVLIDRLGSIRPMSELRSGM
                     SVIGADRSGQLLEDTILGWLHKEPGATAEVLLIKTLSGKQLRLTSQHLVYRMHASMRV
                     RDFGMTPFSDLLRHQQTIHQRPELESLALEAVFAEHIRIGDALLDAAAHRADPVVAID
                     TYVTREGVYAPLTRSGRLVVDGLLVSCYGTYASQEVAHAVLWPARVDVLRTMCGSALG
                     SDSTASIMPYAERLYRIYASAAQILEKARVIVIGAAC"
     misc_feature    6927..9687
                     /note="repetitive element"
     misc_feature    complement(10701..12402)
                     /note="pseudo-gene of hedgehog protein"
     gene            complement(<13335..>15206)
                     /locus_tag="CYME_CMC005C"
                     /db_xref="GeneID:16992387"
     mRNA            complement(<13335..>15206)
                     /locus_tag="CYME_CMC005C"
                     /product="similar to trefoil factor"
                     /transcript_id="XM_005535185.1"
                     /db_xref="GeneID:16992387"
     CDS             complement(13335..15206)
                     /locus_tag="CYME_CMC005C"
                     /codon_start=1
                     /product="similar to trefoil factor"
                     /protein_id="XP_005535242.1"
                     /db_xref="GeneID:16992387"
                     /translation="MRPGAGKYRNFGELCKQLFVLVAALSLAVGCATLGAEAQSTMTA
                     TATLSPTSSVAPSVSATMTPTPTMTPTPTPTMTPTTTTSPTIVPTTISTSIAISVQNL
                     SLCLAVATDLQNDLEARFIGLEVNVSVTDNCDTVFGSGTSRRLATTLDKSNPRLERAL
                     VRTSGGSVVTYVIKISGDTSLASELQIVLQTFTDLLSTILPSGATLAIITPTPSATPT
                     PVCTSEICGSPGQYTNQDACEQVGCCFNAQTNACTLKSVSAACSAVPVTQRVPCGWSY
                     IYPDECTAIPGCCWQPTANGILAPWCYYDINHAPQASVALQEVQAPVPLCPSPGAQRQ
                     PCGNAGINQFTCYAQGCCYDSQAQNQWVQNGKQQSDFESNPYCFQPVKTCAVGEFERQ
                     PCTNAVNQNQQLNNNINNNQFVRLLNTLLYGEQHGTQRTSYSPQQCLEAGCCLGLSNE
                     CFQPMTEYVCQTYGYVSNSLSGTTGNVSNSSYIPCGPECCNAETQNCTYNPFSNNNNQ
                     QQQQQLQQQQQQQVLLPSFCVCKDPTKQCGTYLIPSDNLVNKVRCCRADEECINNQCV
                     VISPTPTPSPVAVTATPSATVSATVSATASATASVSVSASASVSASVSTSASAFSTV"
     gene            13666..16610
                     /locus_tag="CYME_CMC006T"
                     /db_xref="GeneID:16992388"
     misc_RNA        13666..16610
                     /locus_tag="CYME_CMC006T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461212.1"
                     /db_xref="GeneID:16992388"
     misc_feature    15865..18135
                     /note="repetitive element"
     gene            <18425..>18847
                     /locus_tag="CYME_CMC008C"
                     /db_xref="GeneID:16992389"
     mRNA            <18425..>18847
                     /locus_tag="CYME_CMC008C"
                     /product="NADH dehydrogenase I alpha subcomplex 7"
                     /transcript_id="XM_005535186.1"
                     /db_xref="GeneID:16992389"
     CDS             18425..18847
                     /locus_tag="CYME_CMC008C"
                     /codon_start=1
                     /product="NADH dehydrogenase I alpha subcomplex 7"
                     /protein_id="XP_005535243.1"
                     /db_xref="GeneID:16992389"
                     /translation="MTTYAENLVSTWTSVAPIVVEAANLAAVPRNSRADQCAIAQVVA
                     KDTELTTEAGAPNRYNTRSQKPALIPQGPPQRIFDITYHTRDDRRRVFRETYLLRVAP
                     SEPIANPTTGEDASPLPPLPGRNLQWQPLGTLKDYTRE"
     gene            complement(<19995..>21878)
                     /locus_tag="CYME_CMC009C"
                     /db_xref="GeneID:16992390"
     mRNA            complement(<19995..>21878)
                     /locus_tag="CYME_CMC009C"
                     /product="similar to 3-hydroxyisobutyryl-Coenzyme A
                     hydrolase"
                     /transcript_id="XM_005535187.1"
                     /db_xref="GeneID:16992390"
     CDS             complement(19995..21878)
                     /locus_tag="CYME_CMC009C"
                     /codon_start=1
                     /product="similar to 3-hydroxyisobutyryl-Coenzyme A
                     hydrolase"
                     /protein_id="XP_005535244.1"
                     /db_xref="GeneID:16992390"
                     /translation="MLFTLAAGRDLALRAGAWRLRAQRSVHCGCTPAAAPEPFPRKRS
                     ALAISTTRSLCQMQTIRGQSSETLQVLAPCRTEILEATGFAAAERLLAAVRDPEHASQ
                     PMVYTEEPGRIEELSEDRAQLLRSSSCALWILNRPAALNALNLPMVQALRRRYLQYAI
                     AKRSSMPATDGKMPHPACTVLFTASVACASLFPRSWQLVPASDAKCWLVQTTEPSPRS
                     SSRVPFFCSGGDIREMYRHGLPDGDRRIQRIYFQEEYRLNYLLAGGLWEEKNMAITQE
                     PLVQISLLDGIVMGGGVGLSIHGRFRVATENTIFAMPECGIGFHPDVGASWVLPRLLD
                     WKREGYPGSRLSMERIPSTESAAVGTWLAVTGARVRGIDAVRLGIATHYCPSHRIHEL
                     VSRVAELAHHMHSREGASISAAALDELDTALQSFQPDVDTSWTAFGHERVATITELFD
                     PKHGKRELRDLWSALQAAKNDPRKASFAQDCLASMERCSPLSMLVAYESVGVRGSTAT
                     TLADCLRREFVTTLRCLDHPDFMEGVRAQLVDKDRNPRWHSAPSLNAWFAAHDDTYTN
                     NVVEKFFMPGADEHPLELDTWSLERNQYQGDSPAQRTTSAVSEPARTLKGSAGGKLPH
                     SSL"
     gene            complement(<25686..>26210)
                     /locus_tag="CYME_CMC010C"
                     /db_xref="GeneID:16992391"
     mRNA            complement(<25686..>26210)
                     /locus_tag="CYME_CMC010C"
                     /product="similar to U3 snoRNP component Imp3p"
                     /transcript_id="XM_005535188.1"
                     /db_xref="GeneID:16992391"
     CDS             complement(25686..26210)
                     /locus_tag="CYME_CMC010C"
                     /codon_start=1
                     /product="similar to U3 snoRNP component Imp3p"
                     /protein_id="XP_005535245.1"
                     /db_xref="GeneID:16992391"
                     /translation="MRKLRYHEYKLLKKDNLYEWKRENHHREYRVVRRYYLPSPEVYH
                     TYNQFVGKVTALVSKLKALEVNNPFRIDRTEKLLNELYDLGLINVKSGLDVCANVTVS
                     ALCRRRLPSVLVRNHFVERLSDAVALIKRGHIRIGPHVVRDPNLLVTRSMEDLITWAD
                     DSKIREVVERHRVE"
     gene            <26689..>29013
                     /locus_tag="CYME_CMC011C"
                     /db_xref="GeneID:16992392"
     mRNA            <26689..>29013
                     /locus_tag="CYME_CMC011C"
                     /product="ATP-binding cassette, sub-family D, member 3"
                     /transcript_id="XM_005535189.1"
                     /db_xref="GeneID:16992392"
     CDS             26689..29013
                     /locus_tag="CYME_CMC011C"
                     /codon_start=1
                     /product="ATP-binding cassette, sub-family D, member 3"
                     /protein_id="XP_005535246.1"
                     /db_xref="GeneID:16992392"
                     /translation="MEFAIGGRGPGGWAGAFQAASRKRRAARVAAAVVAGVAAVGGAT
                     YYWTQQTECDAESSTQLESSVNNDVQALIERQRERSVALTAASPERSLREHRSTGASV
                     RSGTSRSGTSQSAAIAISRAPSMAALKSIPSDAASGRSSVRVDRKFFSQLWRFIRIIV
                     PSIRSREFWVVLGIGVTLVIRTRLDIWVSDNAGDIVKAIVARDREAFMRKCVRDISIM
                     MFPMSFVNNILKLQISLLRVMARKRLTLYFHELYLSQLTFYKATNLDNRIQNIDQLVT
                     QDVEKFCTTLVNLYSNVSKPLLDVVLFSSRLARSLGAKGPAVMIGYFILTSAILRKLQ
                     PPFGRLTADEQRLEGDFRLCHSRLIMHAEEIAFYGGGQREKFFINGTFEKLLQHMQRI
                     FMARFRIGLVDSILVKYLATIVGYCVVSMPIFFTSGFVRTLLAPLGGQKLIDQNKQAD
                     AEDAALVAEMYTRNSRLLISLSAAIGRLVLSGKELTRLAGYTARVGELDSVLGDLRRS
                     QAADSHSSLDAIAKLGLEDVELRAAMVPGRLVDNVDFVRFEHVNIVSPDRILLAKDLT
                     FEVPPGTNVLITGPNGCGKSSLFRVLCGLWPLYGGTLYRPPRSRMFYIPQRPYLAIGS
                     LREQVIYPMTTLEMRSRNIRDEDLQKLLDEVHLGELSRRRNGWDNVCDWSDVLSGGEK
                     QRLAMARLFFHRPQYAVLDECTSAVSLDVEGYLYTHARELGITLITVSHRPSLWRFHE
                     KLLRFDGHGGWTFTDIKPEDIPQLTGINGESVAA"
     misc_feature    complement(29155..29876)
                     /note="possible transcribed region"
     gene            complement(<31135..>32112)
                     /locus_tag="CYME_CMC013C"
                     /db_xref="GeneID:16992394"
     mRNA            complement(<31135..>32112)
                     /locus_tag="CYME_CMC013C"
                     /product="26S proteasome regulatory subunit RPN11"
                     /transcript_id="XM_005535190.1"
                     /db_xref="GeneID:16992394"
     CDS             complement(31135..32112)
                     /locus_tag="CYME_CMC013C"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit RPN11"
                     /protein_id="XP_005535247.1"
                     /db_xref="GeneID:16992394"
                     /translation="MDRANHLFLPIQGADVAAAGADIPQSDTSETVYLSSLALLKILK
                     HARAGVPMEVMGLLLGEFVDDWTINVVDYFAMPQSGTGVSVEAIDAVYQQQFLEALQQ
                     TGRHEVVCGWGHSHPGFGCWLSGVDVNTAQSFEALNARAVSLVVDPIQSVKGKVVADT
                     FRTLNPQLAILGMEPRQTTSNAGSLNKPSIQALIHGLNRHYYSLRMEYKLNDLERKML
                     LNLNRPKWTRSLSSRDQDRQREHSETTLKDMVSLSKLYTDMVKEELRSRSKEELAVSR
                     VGKLDAKRRLADGVKRLCDENCHQMLTMNLLKALVFPKAAGLQSTASSS"
     misc_feature    complement(33355..35056)
                     /note="possible transcribed region"
     gene            <35291..>36346
                     /locus_tag="CYME_CMC015C"
                     /db_xref="GeneID:16992396"
     mRNA            <35291..>36346
                     /locus_tag="CYME_CMC015C"
                     /product="similar to biotin carboxyl carrier protein of
                     acetyl-CoA carboxylase"
                     /transcript_id="XM_005535191.1"
                     /db_xref="GeneID:16992396"
     CDS             35291..36346
                     /locus_tag="CYME_CMC015C"
                     /codon_start=1
                     /product="similar to biotin carboxyl carrier protein of
                     acetyl-CoA carboxylase"
                     /protein_id="XP_005535248.1"
                     /db_xref="GeneID:16992396"
                     /translation="MAYLVFFQKAQRGLGGRVSGVAGPRCAGDYRGRTSLLVPPGMRS
                     RARPHAHSLLMKARRRSLDEVESTRDSVDGAREERSHGGTRATGANDGSGHTRTGESP
                     SLHAASGQPADGVALTHTASQPAAGTHTQGVTADVSAPEQRQPGLSLSEVQEFLEVMR
                     EVTLYCSDARLQIGSTVIEVSRPDGFGFDEHGELRTAEPHPSTHPGDSSPASAYSAPA
                     MPPDAESSVLGSSAAQATVSSSTASTSARAAIEQRSGKTPEPRPRYDDVSQILDTDFK
                     VISNRVGIFRAGPPSRPPYVKVGDRIEVKRPVCIIEQLGNYFVYNSEVSGTVIKVCVE
                     DGAPVEYGKELVIIRPE"
     gene            complement(<37131..>38486)
                     /locus_tag="CYME_CMC016C"
                     /db_xref="GeneID:16992398"
     mRNA            complement(<37131..>38486)
                     /locus_tag="CYME_CMC016C"
                     /product="similar to programmed cell death 2"
                     /transcript_id="XM_005535192.1"
                     /db_xref="GeneID:16992398"
     CDS             complement(37131..38486)
                     /locus_tag="CYME_CMC016C"
                     /codon_start=1
                     /product="similar to programmed cell death 2"
                     /protein_id="XP_005535249.1"
                     /db_xref="GeneID:16992398"
                     /translation="MHCLEPFMDVEVSKSSIILGCVEDGVYERELFRSKQWTPFESRA
                     GGTPAWLVPLPAGLATKRLRCGSCKRQLRFLLQVYAPRGHNAAAFHRVLYLFICAWCA
                     SRSADNSGAARVYRVQLPQHNSWYPDQVEDLEALRRYPANLSAGLSGLDPPPSPHRGA
                     AADTASFDALQAAAAVAPQQTAEQTRVGGTSSRRAHAAYDKSGADATISEEPSLGFPA
                     VEILVDWDSDSEHDSGVIDDQVEESELRVVNVDAEDAAPTKEHACSAAEWISFIETIE
                     TEQNLRCSDLSDALAFEQALGSHRNQVIRYLPLHDRLAMIAVNNPQKLATISNQQILW
                     FGSKSRLEAAQVPPCGLCGMPRVFEVQVMSQLIYYLCRESENELEPAEQCPTQTPATR
                     GVRSEDPRAVLDFGTIAIWTCPRDCVPSSSEICPDVQDKSLPHPYVEEFVYVQPAIGE
                     A"
     gene            <38670..>41018
                     /locus_tag="CYME_CMC017C"
                     /db_xref="GeneID:16992399"
     mRNA            <38670..>41018
                     /locus_tag="CYME_CMC017C"
                     /product="similar to avirulence induced gene 2"
                     /transcript_id="XM_005535193.1"
                     /db_xref="GeneID:16992399"
     CDS             38670..41018
                     /locus_tag="CYME_CMC017C"
                     /codon_start=1
                     /product="similar to avirulence induced gene 2"
                     /protein_id="XP_005535250.1"
                     /db_xref="GeneID:16992399"
                     /translation="MTASEDERAPLDWSLDYVRYLEAKERIDDRAIHCELWERFTGFL
                     HSQLSQGQAAATRLEPLRIIDVGAGIGSLLFRLLASWEHAEALEQVRTYRRGVEYWAV
                     DLKSQLLRALLQRLQSVAASNENPWQLERYHLETNVVDHSNDDELHQCLSGFDLHRAA
                     DRDQRPACSQAIRAAATGQATRAESPAPVMDMKTPLEPGPKTQQTVVVVGGGGGGGAQ
                     KATATAASLEHTRQHRAGETTGDDTRHVAEPQIGPGAASVETRRFEDSDMPAGTPTTD
                     PQTHHASCLGSAKLVLKASSTGFYLNVHCYQGDAETFCTQHPGTAEVLWASSFFDLLL
                     NEAAAGSASNLAYARLRAAMPRLLATLKPYGVFYFPLHYDGMTYWLPNFDPSSAAYEA
                     EQQVLAAFHRSLNPDCTGFCGQALLDVIQDAAIPAPAACDCTFGYVTAGEVSADEPAL
                     SSAGVSPQRVPRSTQQTLASDSLCAIRSGAYVQTAAGQRLAGPHAAMRPMVTGLAPST
                     WCVQPFAGLGVYLPSTDAYFLECILKLIGGAAWSSACTASERARIERWYQQRREQLQQ
                     RLLTYVAHNIDLLGIVIPARIQTRAVARGPVLHSPTVCDSSMAPVLMGMTARARVPAF
                     AKSIEPVGVFSYGTLQSPRVLQTILGRIPRSVAAVLNGYRVHGVRDESYPAVAKSAPE
                     NAPHEAVPGVLLLELTAADHALLDAYEGPQYQKLVEEVQILPLGMRLRAFVYVWKSST
                     DNLVALPNQHWDLDAWTRTHEQSFCQECSEWIRTFKSANAAE"
     gene            complement(<41832..>42656)
                     /locus_tag="CYME_CMC018C"
                     /db_xref="GeneID:16992400"
     mRNA            complement(<41832..>42656)
                     /locus_tag="CYME_CMC018C"
                     /product="similar to vesicle-associated membrane protein
                     7"
                     /transcript_id="XM_005535194.1"
                     /db_xref="GeneID:16992400"
     CDS             complement(41832..42656)
                     /locus_tag="CYME_CMC018C"
                     /codon_start=1
                     /product="similar to vesicle-associated membrane protein
                     7"
                     /protein_id="XP_005535251.1"
                     /db_xref="GeneID:16992400"
                     /translation="MERTTAANTSLSKGTNALSVSNSDDANLSKARSSDDSAGQTERP
                     APAPRRILFVTVGNSSVRLVTYLDRRAIQEGLGAGERPKFEEIADRILNKTPTGTDVR
                     TSYDSGNVGYHVQVHQDLIYLAVCLRGYPRQLAFDFLQQVREQFESRYAPADLRRMTK
                     PDALDAAFRPTLKALTQTYTTRQDKIAQLQGEVRDIHAVMQRNIEDVLERGERLDDLV
                     EQADALRNTAGTFQRQSGTLKKRMCQKNVAAASCIIVLVILIILAIVLGVVLTHRH"
     gene            <42866..>46933
                     /locus_tag="CYME_CMC019C"
                     /db_xref="GeneID:16992401"
     mRNA            <42866..>46933
                     /locus_tag="CYME_CMC019C"
                     /product="vesicle transport protein Rop"
                     /transcript_id="XM_005535195.1"
                     /db_xref="GeneID:16992401"
     CDS             42866..46933
                     /locus_tag="CYME_CMC019C"
                     /codon_start=1
                     /product="vesicle transport protein Rop"
                     /protein_id="XP_005535252.1"
                     /db_xref="GeneID:16992401"
                     /translation="MRGNGLAWSRLLWGLVWLGVVVLAFANRATGQRYPQSTWILEER
                     NLLTLRQTTPLEPVLGNSTAVPSARASVTASASLNPNATLLSVRPSVSETGTPSPSTT
                     TATPTSTVLPSPLPSPSTTATSSPSPTPMASSGPAATPSFPSPSPDTGVVNLLANSGN
                     VSLSLYENRTFQEAFAQTLVSNLQSQCVRCQNASAIQLTMFRYTSGYFRLNHSNSSRN
                     NTSDTSGNGGNGPVTAPVLTNRRRRMLQTWQWLTGKRSTSPPVQNIAGSVVGRASSTA
                     GSGTSDGTDVAVALQVAADPADIPTVENRTSSGLLTAVLATSSNITNASMQVVARTAA
                     FGEGAEDPFKGSGLGSVHSGAVSTGAIVGAVIGSVAGVLLAMIFAFMLWRRCRRQAAK
                     QEALRTKEAAEAAARKYREQQSAMAAAAAAAQRLSSGSGRPIPPTLPQDQSAGGDAAS
                     RARYAGVVTLRELARTRILQGMMRIVQAAEAESNAASAALIRSDNQRKLVFLIVADRR
                     ALAVLSAACRLTDLIQEGAFVVESLESEREPLPRMSAVYFVAPELASFDRLVADFPDT
                     QTAAHPSDGAGQRLADAGPGTSVSRTAPRSAGSGPESGAAGRLAASPANARTPRARWG
                     SGAAPGPPGATTTASGPRYRAAHVFTTARVPDALLDLLRQSSCLVQRLLTFTELNLDF
                     MAIEERIFSLDYPNALEMLFAPGSAAGHDDDHDGAALPGWASAWDARPAALQPPPGAC
                     SDMVQRIAQNLLTLCHLLGEVPTIRYQRSESGVAQSIAEALLDAIRDYEANVPGGMRG
                     AQLEAAAVEQNASTAAAPSEDKSSAGTSTNTMLLILDRSVDMVAPFLHEYTYQAMCND
                     LLAADALDSGTTRYTYVVREGDSTASTTREAFLDEYADQTWARLRHLHIADAISEISE
                     ELQGTTVRSLGAALQGASAARNAPPESTAMPYEQMQKLSKYAVHMDILDCLMHRFNDR
                     YLQRTSLCEQDLACGLVDCHGNLLSSTEAAQRISLILQDAHVPLEDKVRLLAIVLVTM
                     DMSARDVDDLLETMEDVGLGRELVSALLRARLGVHLAKEPGECQALAERALRYFRASR
                     GESYDLSRYVPFLREILEAIARDRLSRSRFPILFSAERESAGRQPPDDALTRGRSRSL
                     SRERDVAGRVPTRNRAASVRRRRSSSVVRRRSDSADDLERGSGRELSSASEDEAATLN
                     GTERISDSKRPRRRVVVFIAGGMCASEMRVSYEVSAELPLNVYLGATHVLTPTRMLEA
                     LRGLNRTLYAGEMQRERRPVSASEQRRGARSTPAVWPPPGEPSTSGNLRLGTGLASEA
                     ATAFDSAATPYPSNDGFAPRRRRSSSLSRFFSRRS"
     gene            complement(<47927..>49753)
                     /locus_tag="CYME_CMC020C"
                     /db_xref="GeneID:16992402"
     mRNA            complement(<47927..>49753)
                     /locus_tag="CYME_CMC020C"
                     /product="probable cytosolic IMP-GMP specific
                     5'-nucleotidase"
                     /transcript_id="XM_005535196.1"
                     /db_xref="GeneID:16992402"
     CDS             complement(47927..49753)
                     /locus_tag="CYME_CMC020C"
                     /codon_start=1
                     /product="probable cytosolic IMP-GMP specific
                     5'-nucleotidase"
                     /protein_id="XP_005535253.1"
                     /db_xref="GeneID:16992402"
                     /translation="MLLETAWASCNRSAWFGWSYRTWAHRWHGAVVVGARPPRARSPV
                     PTWYLAQNRPVVARSKKRRSSPSNDRVSDGSDGSAVPHLNEQHYLGEIFCNRSLKMRS
                     IKAIGFDMDYTLAHYKADTFETLAYEGALRRLVHAGYPREILDELRPYDPQAYIRGLV
                     IDKKRGNILKMDRHKYVKLAFHGFQRLSKQERDALYNPAAVNWAAFNEPDFAVVDTLF
                     SLPDAFLFSKLVEFKDQYPNLIEKPYEQIYRDVRRAVDLCHRDGTIKRRVAEEPAKYI
                     EYDPHLIPTLKRLKRSGRKTFLLTNSLWEYTNVVMNFLMGNPPGLLELDWLDLFDVVI
                     VGANKPAFLTDPRLWMYRVDPRSKEGYLSNTEGVIDGNAEAFLREGKVLQGGNYTHLQ
                     EILSLNSGSEVLYVGDHMFSDILRSKRQLGWRTMLIIPELTDEINEMLRSEVDRQRLR
                     DMRLLRDELDEMIDRAEWELHCEYERSEHEADPHADPSRRQRIEALRQSVETAETELR
                     EVKAALAAETERYHRRFHPVWGQLFKTGYQNSRFAEQVEQYACLYTSRVSNLRFVSPE
                     ITFRCMSDQCPHDRLHESPMRRILERRLQVVQNVSDLDAASS"
     gene            <51024..>53018
                     /locus_tag="CYME_CMC021C"
                     /db_xref="GeneID:16992403"
     mRNA            <51024..>53018
                     /locus_tag="CYME_CMC021C"
                     /product="pyruvate kinase"
                     /transcript_id="XM_005535197.1"
                     /db_xref="GeneID:16992403"
     CDS             51024..53018
                     /locus_tag="CYME_CMC021C"
                     /codon_start=1
                     /product="pyruvate kinase"
                     /protein_id="XP_005535254.1"
                     /db_xref="GeneID:16992403"
                     /translation="MYELCQPTGTAGYPYFLFGSQQDQRLNYRSVIVHRAGLAQETAG
                     DGGVSTSSSAETGNSVSALASAAAGRRVKFRELRRTKIVCTIGPPTASYEMIKALADA
                     GMDVARLNFSHGTYEFHKKVSDAVDRVNEERFEKARRRWTSHDEAREQLTDSAKSVAV
                     SDAGPLRTESTSSSTDSLNSVSGLEYRNDAKSALYVRIGKMMDSKGAEVRSGEINRAE
                     EIAKRMVEHGLVTSDQVTELVSQNTMLMPAGSSLVLRCTHEAFEKQPEPLEGVAVKGS
                     VLPFAPVVGVSYAGFFEDTAEGDCILVDGGLLELQLERKDADKRDLICRVLDGGELSP
                     RRHLNIRGKTASLPSVTESDWKDIEFAVKELNVDFIALSFVNDAETVHMVREFVTKLG
                     SRAAIISKIESMKGVLNLPAIIEASDGVMVARGDLGSELPLEEVPIVQSFMVRLCRAA
                     GKVVITATEMLESMIEKPIPTRAEASDVAHAVEQGADALMLSGETAKGKYPIRACATM
                     RHIIMRQNEQLIADERARQGLDPIAGFAECCRDVERVSDAMARAAVSLAESLDAAAII
                     VFTRTGNMPKRLSKLRSRIPIVAATAVSDIQPKLSLLWNVFCVTIEVQDTFEATFQRF
                     KEEVLAENFLRKGDTVVVVQSGMRGIWREQGHHLLRYVVM"
     gene            complement(<55035..>56612)
                     /locus_tag="CYME_CMC022C"
                     /db_xref="GeneID:16992404"
     mRNA            complement(<55035..>56612)
                     /locus_tag="CYME_CMC022C"
                     /product="probable endoplasmic reticulum oxidoreductin
                     1-Lbeta"
                     /transcript_id="XM_005535198.1"
                     /db_xref="GeneID:16992404"
     CDS             complement(55035..56612)
                     /locus_tag="CYME_CMC022C"
                     /codon_start=1
                     /product="probable endoplasmic reticulum oxidoreductin
                     1-Lbeta"
                     /protein_id="XP_005535255.1"
                     /db_xref="GeneID:16992404"
                     /translation="MRLHATRLTGTLACLLCICVIISPESFQAIGSEHDPASTYRYLY
                     SLKRLGLGTSPSDTKCTYDSLTRYSFLPERESLCHDLTCLTSSLYFRIFKVDLSKACP
                     FWGGTAATCTKPDCSVLVCDPELIPAVWRRDESQVLQTEQTRTFPVADYPRGEQEATL
                     GRVERPRGSQALPPFFSPYALEDESAWTAPDSDELSEYVDLALNPEGFTGYQGQHIWD
                     AVYRENCFRPLPCLSGDAAGSVAEQLLRQGSVSTLAPVRPAGCREERVFYRCISGIHA
                     SINAHIARRYLFGRNRWGYNTRLYRERLRYYPERIENLYFVYALALRAMNQAAPLLLQ
                     RSDYWTGNETEDMQTKELLERVLENPLIRGTVPDCAVPFAENEMFRGCCADCLVQFRA
                     HFRNISKIMDCVGCEKCRLWGKLQFLGLGTAFKILFAESLSSVSTRRLEMRITRNEVV
                     ALVNLLKNLCLSIRSIHEMEWMIVQETKKQRLWLCFAAAILCGLGSMLLRHFAGEILA
                     YRGLVHRSASAMRRKRN"
     gene            complement(57262..58953)
                     /locus_tag="CYME_CMC023T"
                     /db_xref="GeneID:16992405"
     misc_RNA        complement(57262..58953)
                     /locus_tag="CYME_CMC023T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461213.1"
                     /db_xref="GeneID:16992405"
     gene            <59091..>60746
                     /locus_tag="CYME_CMC024C"
                     /db_xref="GeneID:16992406"
     mRNA            <59091..>60746
                     /locus_tag="CYME_CMC024C"
                     /product="ribosomal large subunit pseudouridine synthase
                     D"
                     /transcript_id="XM_005535199.1"
                     /db_xref="GeneID:16992406"
     CDS             59091..60746
                     /locus_tag="CYME_CMC024C"
                     /codon_start=1
                     /product="ribosomal large subunit pseudouridine synthase
                     D"
                     /protein_id="XP_005535256.1"
                     /db_xref="GeneID:16992406"
                     /translation="MKRLASHWSQAPRYPTLWIQAAQCSRSAAVWVRVGPVSRTANDP
                     EVMKGHRVPLKAFRALVQRTARPGDAVLGHLPARSCMQARRWYPGPSKPHWATDTPLA
                     AGTGFSWPMRERRSQKRRQRACRYSTVLRNCDERQAIPSSSAKAAENFFRGSAETSAD
                     TDPDEGGVPESSFTVDAFMAPKPTRIDRVLTDRFSEPSRTYFQYLITQRAIQVNGRVV
                     HRKSELVTQDDVVHVRFLLPENSAAQDLVPEHLPIDVLYEDGDILVVNKAADMVIHPA
                     PGNWRGTLANALAYRFGKGAAEASAATVEPSTKPDSIGATVDADNDTVHGDEMVSRDC
                     ALRPGIVHRLDKGTSGVLVVAKHNFAERRLQRAFAQRQVYKEYLAVLAGTPRCLQNGP
                     SLVELPIGRSTHRWIEQRVQSVAQGGRAARSRFEALAMRPSIAPLTLTRVLIETGRTH
                     QIRVHARYGLQAPVLGDDLYGFPAWNQRYRMRARRPLLHAWRLGFRHPCTGKWCVFEA
                     PLPEDFRYFEKLLQVRWAEVPSTEELRARSEAGADNSAPRDRI"
     gene            complement(<60631..>62637)
                     /locus_tag="CYME_CMC025C"
                     /db_xref="GeneID:16992407"
     mRNA            complement(<60631..>62637)
                     /locus_tag="CYME_CMC025C"
                     /product="succinyl-diaminopimelate desuccinylase"
                     /transcript_id="XM_005535200.1"
                     /db_xref="GeneID:16992407"
     CDS             complement(60631..62637)
                     /locus_tag="CYME_CMC025C"
                     /codon_start=1
                     /product="succinyl-diaminopimelate desuccinylase"
                     /protein_id="XP_005535257.1"
                     /db_xref="GeneID:16992407"
                     /translation="MRLDQGRALIRVSLVVGHPLVHTDNPRPGEIRGIPRSSHRSVKT
                     YITIDVLSIILVRLHSTITMLCTRLTLCAFVKHRTPHMNQWRLLFLISLSVLSGLSAW
                     YYVVHLGRVRVGETLSVHAVRALRQAVLDYNADRERFRDWLRELVRYRTVSSQLGNEA
                     EFRACVERLRGIAQNDVGCEVVHVVERHGRRPALLAQCTFGREHALHEVLQSRSSGAL
                     PARGVLFYGHYDVQPADAREDGWTTTADAFQPAELDGRIYARGASDDKAGVVTLLTAL
                     TILRRHLSGEDEAPPLVVKLLFEGEEETGSPGFERLLEDHADFLFGMPCGNQSADACP
                     GKVLDFIVSVDGGQVDERTGALLLGMRGAAAFQIDVHGPQNDVHSGQWGGAVANPLQG
                     IAGLVASLHDSETGAARIAGFYNGIPYSNMSSLPPIYAAALQGAKRKLPSEKAAAQSL
                     GLSTLGGGEHALFPSYLARLWFRPTLEIVGIGGGYVGEGIRGAIPARATAKILMRLVP
                     GQDARGIAIALCDHVQRYAQQHLEDRGLRCRCQNLSFFAEPFVSDPESALVSLVRATL
                     LAAYGSSVVPVYSGASIPALSLLQTHGKRYVARVTNRSTAIPIGVLAFALPSDRNHGP
                     DENFAWARFDRAVHCYLHLLLSVLEAPQSTAPLPSAPAIVSRNI"
     misc_feature    61872..63445
                     /note="possible transcribed region"
     gene            <63801..>65090
                     /locus_tag="CYME_CMC027C"
                     /db_xref="GeneID:16992410"
     mRNA            <63801..>65090
                     /locus_tag="CYME_CMC027C"
                     /product="dihydroorotate oxidase"
                     /transcript_id="XM_005535201.1"
                     /db_xref="GeneID:16992410"
     CDS             63801..65090
                     /locus_tag="CYME_CMC027C"
                     /codon_start=1
                     /product="dihydroorotate oxidase"
                     /protein_id="XP_005535258.1"
                     /db_xref="GeneID:16992410"
                     /translation="MSWSRVGRVVLGFALGGALATAWGSTSSSVDAYKRTLRPLLFRL
                     EPEHAHDLALWALSHGLVAWWCRASSQLERSAHAATCAEQEVRRALQSTCWGKTFASP
                     FGLAAGFDKDGVAVDALFDLGFGFVEVGSVTPRPQSGNPRPRLFRLEPDEAIINRMGF
                     NSAGCEAVRAHLKRLRDRSHEAGQVATARNSVANTTPTQTMPGKKHLGINIGKNRETS
                     EDDALSDYIQVLRTLGAFADYLVVNVSSPNTPGLRLLQRKERLRDLIRQLKRERDDRG
                     PQWQRLPLLVKVAPDLSDEEIRDIAEIVVSEGVDGIVVTNTTVQRPVTLQSPVNLVQQ
                     EGGLSGTPLRDLSTYVLGRFYRYTLGKVPLIGVGGIFSGADAYAKIRAGASLVQLYTA
                     LMYEGPCLVPRLERELVQCLQRDGYRNIVEAIGADHR"
     gene            complement(<67743..>68834)
                     /locus_tag="CYME_CMC028C"
                     /db_xref="GeneID:16992411"
     mRNA            complement(<67743..>68834)
                     /locus_tag="CYME_CMC028C"
                     /product="similar to F-box only protein 9"
                     /transcript_id="XM_005535202.1"
                     /db_xref="GeneID:16992411"
     CDS             complement(67743..68834)
                     /locus_tag="CYME_CMC028C"
                     /codon_start=1
                     /product="similar to F-box only protein 9"
                     /protein_id="XP_005535259.1"
                     /db_xref="GeneID:16992411"
                     /translation="MVSYTGEAGRLLSETLVRPWFALYHQRVPRERHCEDCESTTDAA
                     DNKLSTARVEQPGPAKTNLSPVEQLPGDVLRSVFELLSPADLASVSRVCRTFLSIAFD
                     PALWRRHCLEAWGDRESLTRLTAAACGYGGWRRMLRSRAHLQFHGLYIQKQQYLRIGG
                     DDGTGSRRVFFISFYRYLRFFPGGKVVGMTTPEDPLVSRARLQSTRWEASHQSWHHEN
                     NAGAGAGTDQVVPAVGDYQFDEKTRMVSVTLPIYQPRYAEMQGALACYVLELSDADGR
                     PRGANDMLRLLEHSTLSADGSAPLYHEVKPSQALFYFTPFGSQYRRVAEKLFADPEDV
                     KMFNRVQLMQRPARLQTRRTNCTRTNAVN"
     gene            <70595..>72322
                     /locus_tag="CYME_CMC029C"
                     /db_xref="GeneID:16992412"
     mRNA            <70595..>72322
                     /locus_tag="CYME_CMC029C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535203.1"
                     /db_xref="GeneID:16992412"
     CDS             70595..72322
                     /locus_tag="CYME_CMC029C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535260.1"
                     /db_xref="GeneID:16992412"
                     /translation="MKAHDSLWPLSEQGPSSCRQPGERVRRQLPQSMTLGRATGMKRK
                     PNDSGTQKIAPGAAQDSNELDTLEAASPFTRAGQPLKPTVTAETVASGATCSQQASPD
                     PEYYGESSRDRWSQALDDAVRWTSSDAAWGSEATPALPGASCVSDQSAQTKEPLLPSE
                     RHPLSSRDVSPSSLLETTGSVSGAAPQHDMEPVTVYALAGQRLDAGMAAGTSLSHSTD
                     SSAGTSSQSSGNAATVVTGVKLQLTSNQASWRESAAESAELIVYPSQNDDTRQHASSR
                     GRTLQEESMENRDSWPILQLLSEAGFGARLDSNTENPAGLRAFRQSPFNFYDSPLRQH
                     VFVEWNTGHTGFTPEPCNAWQPMVSDAEAFRDSSPASRVFSPGLTVWATDGSPASGAE
                     LSGRDVFEAPAESPQPLTRAYSSTDAEPSVKSAEALRGPDVKNGGAGESIGERELRIA
                     AERAQIPVSLRERTSEKALQAAADATSDMEALVADLRQRLQELHPSDHWTIWSCMQAL
                     AAGECSASTCAPCSAASSKRRDDADTSTTVRNAAETLAIQLLSRRDTVGHRDASTPPV
                     FDPQGSTLF"
     gene            <74383..>74841
                     /locus_tag="CYME_CMC030C"
                     /db_xref="GeneID:16992413"
     mRNA            <74383..>74841
                     /locus_tag="CYME_CMC030C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535204.1"
                     /db_xref="GeneID:16992413"
     CDS             74383..74841
                     /locus_tag="CYME_CMC030C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535261.1"
                     /db_xref="GeneID:16992413"
                     /translation="MFRLGFSIQRHAPKCPFLHIELPTRQRRTAVCPAAKTAVTASRR
                     PRLAMVIPGDSQAEFVFLSGTVTFLNVYQNLLFARIILSWFPAASQLSLLQPLYVVCD
                     PFLRFFQGILPPVAGIDFSPILGFTLLQLGARLTAALGQECPSRDVAKAP"
     gene            complement(<75784..>76353)
                     /locus_tag="CYME_CMC031C"
                     /db_xref="GeneID:16992414"
     mRNA            complement(<75784..>76353)
                     /locus_tag="CYME_CMC031C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535205.1"
                     /db_xref="GeneID:16992414"
     CDS             complement(75784..76353)
                     /locus_tag="CYME_CMC031C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535262.1"
                     /db_xref="GeneID:16992414"
                     /translation="MNFSPDLVTGVQHCCRRLALQNCPAAVPKAGSGVLHFAPPVPLL
                     LWKKEAAIAVGAAFITVGAYRIVQARRQTEKSGPRRCPDCRGEGRVKCFQCQGKTFFQ
                     VEGERVPHACLRCSATGRVTCGRCNGTGYINPSGVDASASAGREGSGKGGSQRGDDPW
                     KLPDQFRQSAFFFWFDWYRKRRASAFAET"
     gene            <76706..>78694
                     /locus_tag="CYME_CMC032C"
                     /db_xref="GeneID:16992415"
     mRNA            <76706..>78694
                     /locus_tag="CYME_CMC032C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535206.1"
                     /db_xref="GeneID:16992415"
     CDS             76706..78694
                     /locus_tag="CYME_CMC032C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535263.1"
                     /db_xref="GeneID:16992415"
                     /translation="MFAVPTLQSSRKGRFWGTTPAFPGRPPVAHLPLPVCCCSTRTGT
                     GDPADPLESFLGRVQAAPALRGLQAADASWKRLQQTGSAAVGPPEEVVTCCRQPEARH
                     TKPSDFDVVVLGGTLGILIGTALLRRNSRLRVVVVERGALRGRDQEWNTSRRELEVLV
                     ATGVLSHETLEKVIRSEWRSMRVGVEAAASRSLPDLSTFMVQDILNIGVSPRALIDEA
                     LAQFTELGGQVWEWCQFQGAETNGRNVLVRLECVPGTVQRPAVALGAGGDQAILATPL
                     FRTSMTAESRSRERSSEPIRKQIRASLVLDCMGNASPIVRQQRELVYGQKRPDAVCMV
                     VGSCCRAHPGHDPFPDNTSGDLIYSFTTALSSNRLQYLWEAFPSDAGSNRTTYLFTYL
                     DADARRAITLTDLYRDYLGLLPVYQGGHAFHRGDRAFLDRLQPQRALFGFFPAYERYA
                     PLPTALDNVLPIGDASGVQSPLSFGGFGAMLRHLPRLVDAICEALAAEALSAEDLRCI
                     QPYLPSLSVTWLFQRALSYRVPSRASQTLDERVVNEILGWSLLTMQDDESALRPFLQD
                     VIQFPGLVRTLARTTVRVPALVPRILGHIGGPVPLLGWLRHLMALGVYDQASRLFHSE
                     SALSSFIDARLKDPKKRFRWHRQLEAWRYGSGRDLHID"
     gene            complement(<79705..>80427)
                     /locus_tag="CYME_CMC033C"
                     /db_xref="GeneID:16992417"
     mRNA            complement(<79705..>80427)
                     /locus_tag="CYME_CMC033C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535207.1"
                     /db_xref="GeneID:16992417"
     CDS             complement(79705..80427)
                     /locus_tag="CYME_CMC033C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535264.1"
                     /db_xref="GeneID:16992417"
                     /translation="MFVAVIRRRLRPKSASTKAFVDPLKRRKPGVFHLRTCEPLASDD
                     SPDTAKRAEQGRSRTSSRTQRSRASADPEASRRGARAGGSSDDMRAGRGFGPQRQQDR
                     TEQILDAFGLQRERAGRDLDQAAAVSKEEGERLAVRLFRGLRALFGGNYEALDSAEQW
                     LQRLVLSMLALVLCAGIGVVFEASAASGRTALPAAVAAFLRERVEPAFTPLMLTFLGF
                     SSLLGVYKAIQIEGDERTRYRE"
     gene            <82206..>83597
                     /locus_tag="CYME_CMC034C"
                     /db_xref="GeneID:16992418"
     mRNA            <82206..>83597
                     /locus_tag="CYME_CMC034C"
                     /product="probable tyrosine aminotransferase"
                     /transcript_id="XM_005535208.1"
                     /db_xref="GeneID:16992418"
     CDS             82206..83597
                     /locus_tag="CYME_CMC034C"
                     /codon_start=1
                     /product="probable tyrosine aminotransferase"
                     /protein_id="XP_005535265.1"
                     /db_xref="GeneID:16992418"
                     /translation="MEKRGTFKASAAALRTRNPIRELIEGLDLRSHPNKQVIPLSIGD
                     PTIFGNLRAADVVNEAVVDAVRSGRANGYPPAVGTEVAREAVAKAANTAIEEAARVAR
                     RLSSRHTSGGPTPDKPRNGTHRDWAQTAFTSAAHYEKRDVILASGASHALDLCFSALL
                     DPEDNVLLPSLSFPLYETICAYLGAEVRRYPLDPERGWQATGLEPGGATDRLVDERTV
                     CIVVNNPMNPTGSVYERKHLQDIVEFAERHRLVILADEIYGGMVFHRRHADGSGPVGP
                     LDAPPIGCLARNVPVLTVDGLAKRFLVPGWRMGWILIHDPTPDQQFSVIRRALEGLSM
                     KILGPNSLVQAALPVILSKTSREWYEHVRTTLARQAQFAYEKLSSIRGLHVPSPPHGA
                     MYVLVCLRNNHMSGLEFVQRLMAEESVLVLPGECFGAPPGYFRVTFCAPIDKLSEAFS
                     RIANFCDRHLRAA"
     gene            <84198..>84908
                     /locus_tag="CYME_CMC035C"
                     /db_xref="GeneID:16992419"
     mRNA            <84198..>84908
                     /locus_tag="CYME_CMC035C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535209.1"
                     /db_xref="GeneID:16992419"
     CDS             84198..84908
                     /locus_tag="CYME_CMC035C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535266.1"
                     /db_xref="GeneID:16992419"
                     /translation="MLRLFSPLSADEAATFACRALERLENDRTRNQGRREPYPIGCTL
                     GTTNWTDVQRRCQPRSPAYKIQLRRTELSASVSELLVCRDIRDARTLQAPRWVFTYAF
                     RKVKSDRGVTLVSADKREPTVLVVSARHLGGLLWTHMVLERARCSGHSITWRTVRGFH
                     FLDGEESFSVMRDKHTKRLVYCICSVSAASHWLARLASPYVRLCQDRFQVESVRFLQQ
                     RWEDPPDTRKHRRQHRGP"
     gene            complement(<86336..>87979)
                     /locus_tag="CYME_CMC036C"
                     /db_xref="GeneID:16992420"
     mRNA            complement(<86336..>87979)
                     /locus_tag="CYME_CMC036C"
                     /product="similar to ATP-dependent RNA helicase"
                     /transcript_id="XM_005535210.1"
                     /db_xref="GeneID:16992420"
     CDS             complement(86336..87979)
                     /locus_tag="CYME_CMC036C"
                     /codon_start=1
                     /product="similar to ATP-dependent RNA helicase"
                     /protein_id="XP_005535267.1"
                     /db_xref="GeneID:16992420"
                     /translation="MALDQTQTFAGLGLLPSLCEACQALRLQRPTPIQQACIPAVLNE
                     RYRVVIGAAETGSGKTAAFVLPILQLLVRDPCGPFAVILTPTRELAAQIAEQTLALGS
                     RVGVRVETVVGGLDAVHQTTVLERERPHILVATPGRLAAFIRQQQAADQTLLPRRRPE
                     GSQRCRYFCRLRFLVLDEADRLLEEGFAADLATLLGALPVTRRTLLFSATMSRQMERI
                     QQLVVAETDGSQVFAFDANRGLTDQGIYATVASLKHYYLLVPAAIRDVYAAYVLLHVV
                     GSGEDAVLKMLRRRRRQREARTADEDNDDADNDHVGRDETNGSMEATALGAHTRFPNG
                     ETDGSESRSSPTIESSSASMVLAMVFTASCAQCAIFASILDRLGLPVGALHGRLSQPE
                     RIAALQGFKSGRHRILVCTDLAARGLDIPKVHLVLNFDVPRDVSVYVHRVGRTARAGR
                     PGKALSMVTQYDIALVQAIEATCGIRLAAWDGPGEATSDNRVMRILAPVLKARRIARL
                     ELLERGTITQAELSDLGNPPKLARPRTASKIITKLSHTR"
     gene            <88884..>90830
                     /locus_tag="CYME_CMC037C"
                     /db_xref="GeneID:16992423"
     mRNA            <88884..>90830
                     /locus_tag="CYME_CMC037C"
                     /product="glycine--tRNA ligase, class II"
                     /transcript_id="XM_005535211.1"
                     /db_xref="GeneID:16992423"
     CDS             88884..90830
                     /locus_tag="CYME_CMC037C"
                     /codon_start=1
                     /product="glycine--tRNA ligase, class II"
                     /protein_id="XP_005535268.1"
                     /db_xref="GeneID:16992423"
                     /translation="MQRRFDRKSFDRDAFETVLRRRFFLAPAFEIYGGVAGLFDYGPP
                     GCAMKNHLIQLWRDHFVVEEGMLEIDGPTLTPDPVLRASGHVDRFQDYMVRDLDTGAC
                     YRADHLLRETLENRIAAMDRKRTDVQEDRLRSAMETCLQRIDEMNQEQIAAAYQQFDI
                     RAPESDAPLSAPYPFNLMFQTQIGPTGTIPAYLRPETAQGIFVNFRRLLDYNNGRMPF
                     ACAQIGLSFRNEISPRAGILRVREFAQAEIEHFVHPDRKDHPKFNLIADLELILLPRK
                     EQHAARSREQMTTVLLRAAEAVRQGIVDNETLAYFIARTQQYAQMIGILPNHMRFRQH
                     LESEMAHYARDCWDLEVETSYGWVECVGLADRACYDLQAHSAASKVDLVAYEKFDEPR
                     DETFLQITPLKRVIGTKFRGETPQVLEAIEKLGETERAQLQQQLTDQDQVQLGPYVIT
                     REMVTIERVNRKIHGRSYCPSVIEPSFGIGRLLYCVLEHAFYNRTGGDELRTVLALKP
                     AIAPVKSVVLPLSKNEVFEPVIQAVLHALAKCRLTVRLDESNVSIGRRYARADEIGVP
                     FCVTIDFDSLVDHSVTLRERDSMEQVRGSVGDVVRVLVELVTGERSWTELVSTDPSLK
                     PFTGQQSTSAVEDGTVCEKPTQSA"
     gene            complement(91072..94004)
                     /locus_tag="CYME_CMC038T"
                     /db_xref="GeneID:16992424"
     misc_RNA        complement(91072..94004)
                     /locus_tag="CYME_CMC038T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461214.1"
                     /db_xref="GeneID:16992424"
     gene            <94601..>95269
                     /locus_tag="CYME_CMC039C"
                     /db_xref="GeneID:16992425"
     mRNA            <94601..>95269
                     /locus_tag="CYME_CMC039C"
                     /product="probable 1-cys peroxiredoxin"
                     /transcript_id="XM_005535212.1"
                     /db_xref="GeneID:16992425"
     CDS             94601..95269
                     /locus_tag="CYME_CMC039C"
                     /codon_start=1
                     /product="probable 1-cys peroxiredoxin"
                     /protein_id="XP_005535269.1"
                     /db_xref="GeneID:16992425"
                     /translation="MSRALLINDVAPDFEAETQLGPIKFSEYAKDSWVILFSHPRDFT
                     PVCTTELARAAQLQEEFARRGVKMLALSCDDVESHNSWVQDVGAYGKTEVKYPIIADP
                     ERKIAKLYNMLPAADPGRDNMPFTVRSVFIIDSSRRIRAMVTYPAPIGRNFDELLRVV
                     DALQTSDRLHCATPVDWKPGSRVIVPSNVPDALVQKHFADGLEVVDLPSKKSYLRYGS
                     TSPS"
     gene            complement(<95769..>96911)
                     /locus_tag="CYME_CMC040C"
                     /db_xref="GeneID:16992426"
     mRNA            complement(<95769..>96911)
                     /locus_tag="CYME_CMC040C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535213.1"
                     /db_xref="GeneID:16992426"
     CDS             complement(95769..96911)
                     /locus_tag="CYME_CMC040C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535270.1"
                     /db_xref="GeneID:16992426"
                     /translation="MWLFVVPAHQGTSYQRSSSRRSAVRREGFAIGFRCRSRQGKHYA
                     PLFRQTVVGGRHTRHQHAGIRNLRAQGEPSSTPPPQVPFELRGFSLAKVVTGIGALLT
                     VYSLYVYFKSAGSASETSLTLIYGMPILLLGLALWYAELEPVPISTTDDLVVLRERKA
                     TTTLKQIIRDVTRHRYGDEAHLSGALRVLGVIKRGDPAPVLLRLRESREPGEEYGLAL
                     VFECRETPFEAFQAVEDRIDRFFGSGIRHELRKISEDPLIVELKLITCRRETATVLPD
                     TLKQAVGQSNLNPERGATRTPTPDTPDNDSANGASTAAADDGASAGDAAKRDRLNALS
                     SQADSSSTGHAAIGREPHQNPTESLAPFALFGFRPTPLPGPPRQRN"
     gene            <97516..>101262
                     /locus_tag="CYME_CMC041C"
                     /db_xref="GeneID:16992427"
     mRNA            <97516..>101262
                     /locus_tag="CYME_CMC041C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535214.1"
                     /db_xref="GeneID:16992427"
     CDS             97516..101262
                     /locus_tag="CYME_CMC041C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535271.1"
                     /db_xref="GeneID:16992427"
                     /translation="MRTYVRRSFVAVQLALGYFLTTLMVVINPTRVYMACWAPIQFAL
                     LAGVVSEFEYVGSLQQAASAAIVGPSFGATLALIIQLAAGHLLWLRIILNVVFMAILV
                     APRLCPPAVGSVSLSLIAFGVVENYLQLSLDSGPGHHAFMYSHYILSTCFAAFVGFFV
                     ALLVFPVSVRSLFHDSVENVLRESAKRLSRLASLLLADVFQATQIENELQERQKEQIA
                     NTFDGYHSASPRTSVEIIMEQRLSSYARMETLGRSESSFSAEATIFGFAEESALLQGG
                     SLYLHGSLVALQRLLPLGANELTYPALFYHAPITDWSKIIYKSRDLVARIGGLESVIL
                     HRRGTEYRAVAMHRLYRSALADVTRLWARLASACNLLGLLVREKEVRWFHWPENSPHA
                     LTIFRNEKIRKYLDEVIDEKEIEALWRRVTESGLSGYQEFWRDMAIATHVEDFNREVD
                     VTKLVRVSAIVPVESVRVAWFSTVLVHRVLDSVYELRESVYQLLERQAPMSRQSSPWW
                     HWALNRLRDASWNVFMAVTFSTRAMYSFWSDVLRNVLQYRAADYRRFWKNNQWQLIFL
                     IKYYIISTAAIITVVCIPASSNIRQQWEPILGYLSVVVSARPTTESAVSVALSRAAGG
                     IVGAALGYLVLVKPALAVNAFFVDGITVAIVFVMFYCNLVDSMKWLQYTAGIAIFIFT
                     VVCMCQYSAPVDHAVWQAAVGAMVCTAIGVGVIILFTTALSPRMASRESRRTLLRGFA
                     ASVDGAIACWEENLRRHNCDEFLDRFHQALHNIEAAPANPAVETTTEERDKEAEEVQN
                     VRVHAHPWQETMAINKHIEALATSVAILSNALSPSFGGVNQFALWKRGFFRPPQFIVD
                     GNVALCVVLLRLEVLNSIVNRPPIYGVRFSGAMYRLFLLALEPEFSAIFRSLIELTDA
                     LRGCLESRGILEDLFGSAEALHSDAMRRFENRKWLLQLCLSRKRAAQMQSKLNAYEGN
                     GVEVADGGQGFCIMEPSVGLALLNFRRRRAELWFRMRRRALQIVHYIRDRYPELESRL
                     AAHIAKMALDESSSASFAEIYEQLLENEDLDRGPQLAAVFPLLRRLMQLRNPHYHRHV
                     RTREPRLSIAREAQSASEELLRSSLQEDDRRSTSPRGSTSPSRASFAHASESVAAEEA
                     RSCAPDAEFAQTVDHELEKELIILNFRQVVETKLLRSADASASTATLPIAGVPIDDFV
                     HFSTFMYGLRELFGSIDYAARAIGSWTRPHHAEKLSLKRGRPFY"
     misc_feature    103848..106185
                     /note="possible transcribed region"
     gene            complement(<105004..>106680)
                     /locus_tag="CYME_CMC043C"
                     /db_xref="GeneID:16992429"
     mRNA            complement(<105004..>106680)
                     /locus_tag="CYME_CMC043C"
                     /product="glutathione reductase"
                     /transcript_id="XM_005535215.1"
                     /db_xref="GeneID:16992429"
     CDS             complement(105004..106680)
                     /locus_tag="CYME_CMC043C"
                     /codon_start=1
                     /product="glutathione reductase"
                     /protein_id="XP_005535272.1"
                     /db_xref="GeneID:16992429"
                     /translation="MRSSQRLVRTAEVSFATLPSISYFKASCSAYLSEAIGRTYKHRG
                     KFCGAQLCSFSAHRNVRNHVGDDLRLGFGSKVKRALAMHYQPDTSFDFDLFVIGGGSG
                     GVRAARVSANHGARVALAESSRLGGTCVNVGCIPKKLFSYGSHYLHEFEDARAYGWDL
                     PTKSELDPVDWERLIHNKDAEIERLNGVYQRILEKANVRIFHERAEFVDAHKIRLASG
                     ETFSAKYILVAVGGRSNLIADLPGAALCIHSDDCFYLKHLPRSILVLGGGYIGTEFAC
                     IFHGYGSKVTQVHRGKLFLRGFDDDVRHFLAEQMRKDGIDLRFGCNLKAVEAIPDASA
                     PEGRVLKAHLTDGSTLIVDQVLLAVGRHPNTEGLGLERAGIKTDQHRGHILVDEYSRT
                     NVETIYAVGDVTNRMNLTPVAIAEGHCFADTVFGGKARAPGYDMVPTAVFSVPPIGMV
                     GLTEARARELDAEQGGTGIDIYRSMFRPLKHTLTKRDRQTLMKLVVDRRTQRVLGCHL
                     VDDAAPEIIQSVAIALKMGATKADFDNVIGVHPTSAEELVTMREKVSDGK"
     gene            complement(<107063..>107377)
                     /locus_tag="CYME_CMC044C"
                     /db_xref="GeneID:16992430"
     mRNA            complement(<107063..>107377)
                     /locus_tag="CYME_CMC044C"
                     /product="60S ribosomal protein L44"
                     /transcript_id="XM_005535216.1"
                     /db_xref="GeneID:16992430"
     CDS             complement(107063..107377)
                     /locus_tag="CYME_CMC044C"
                     /codon_start=1
                     /product="60S ribosomal protein L44"
                     /protein_id="XP_005535273.1"
                     /db_xref="GeneID:16992430"
                     /translation="MVICPKSRRTFCPGACKKHTLHKQVQYKKGKDSLYAQGKRRYDR
                     KQSGYGGQTKPVFRKKAKTTKKIVVKMQCVECKRIVQRVLKRCKHFELSDVQKTKGGP
                     AF"
     gene            <107708..>108094
                     /locus_tag="CYME_CMC045C"
                     /db_xref="GeneID:16992431"
     mRNA            <107708..>108094
                     /locus_tag="CYME_CMC045C"
                     /product="60S ribosomal protein L40, ubiquitin fusion
                     protein"
                     /transcript_id="XM_005535217.1"
                     /db_xref="GeneID:16992431"
     CDS             107708..108094
                     /locus_tag="CYME_CMC045C"
                     /codon_start=1
                     /product="60S ribosomal protein L40, ubiquitin fusion
                     protein"
                     /protein_id="XP_005535274.1"
                     /db_xref="GeneID:16992431"
                     /translation="MQIFVKTLTGKTITLEVEPSDTIENVKSKIQDKEGIPPDQQRLI
                     FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGLIEPSLAALARQYNCEKMICRRCYAR
                     LPARAHNCRKRKCGHSSNLRPKKKIK"
     gene            complement(<108334..>109707)
                     /locus_tag="CYME_CMC046C"
                     /db_xref="GeneID:16992432"
     mRNA            complement(<108334..>109707)
                     /locus_tag="CYME_CMC046C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535218.1"
                     /db_xref="GeneID:16992432"
     CDS             complement(108334..109707)
                     /locus_tag="CYME_CMC046C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535275.1"
                     /db_xref="GeneID:16992432"
                     /translation="MTMAAGNPWSLQVQEDQVRLRVSVPRRTPEQRLEIQATRTRVSV
                     SVAGNKDRPPTDIILPNHVRIEPQSADVFYKSRTGTLWLHFRRAASVGPAKRAAPNET
                     SQETAGRCERSAPASQQSLANTVEQTPESRKANPKTLSESLVTLHTAAEDTGPESQSA
                     GSTKDETCHSSCEVPEPKRTRLGSSTPKPAVEGAQAGSAASPWPATPAHEPSNQQDFA
                     ELAANFPPLTKNTSELASSGDTSSDVASHGSSELVPGLADFLEHASHPQILRALRQVR
                     RLYLSRTADPGALWRRIATARNNATYARTLLREMMHAVVLQGTGQEIRRKQRLAALIK
                     RAKSGVVKDESHQRADRKWVDKHTEQTVAHRVASMLEQSISDAREKEFAHAAALAAKA
                     QERKTRKLQKLAWQTALARRSLESRRRSEAHENTGRCPAPITQRAGKSRARVSFLLDG
                     KQVHFPA"
     gene            complement(<111326..>112321)
                     /locus_tag="CYME_CMC047C"
                     /db_xref="GeneID:16992433"
     mRNA            complement(<111326..>112321)
                     /locus_tag="CYME_CMC047C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535219.1"
                     /db_xref="GeneID:16992433"
     CDS             complement(111326..112321)
                     /locus_tag="CYME_CMC047C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535276.1"
                     /db_xref="GeneID:16992433"
                     /translation="MILDPVARFSGTEADYGLHDEFSSCTFADDDSGEGGTQVEASST
                     ERYCCYLLVSESTDKRARNRTYIGFTTDPSRRLRQHNGELKGAGAHRTRAFRPWRLLI
                     FVEGFRSQVQALQFEWQWQHPRNSRTQRQHQAGLGSETSIKQPYGIAGRLQVLARLLA
                     MRPWCCIALRVVVPDRHRTSDQQKPRIVSERWLAALPLSVRILRDVSVVEAVAKQPDG
                     IGSLHRRRDLSTLCCVCFTREQFVEKGRRKRYPQATGYCLHCTASFHLQCIVQYACAE
                     RLLPESVHCARCQQLIAWADVLRSVDLATAPSTHLGAELGERPSPSTSASVFSVD"
     gene            <112592..>112990
                     /locus_tag="CYME_CMC048C"
                     /db_xref="GeneID:16992434"
     mRNA            <112592..>112990
                     /locus_tag="CYME_CMC048C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535220.1"
                     /db_xref="GeneID:16992434"
     CDS             112592..112990
                     /locus_tag="CYME_CMC048C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535277.1"
                     /db_xref="GeneID:16992434"
                     /translation="MELDLAQETLERKRVSTLVRCALQRLEAELRAGTDTVAGRDGRF
                     PKLTPTASRALTYYVRLFTLECLQRSILEAEIEAGVGDRAEESLVNLATTETPEDVGS
                     RHVSAVESSRVVRVQPEHVLRVIPQLLLDF"
     gene            complement(<113231..>114313)
                     /locus_tag="CYME_CMC049C"
                     /db_xref="GeneID:16992435"
     mRNA            complement(<113231..>114313)
                     /locus_tag="CYME_CMC049C"
                     /product="similar to dTDP-4-dehydrorhamnose reductase"
                     /transcript_id="XM_005535221.1"
                     /db_xref="GeneID:16992435"
     CDS             complement(113231..114313)
                     /locus_tag="CYME_CMC049C"
                     /codon_start=1
                     /product="similar to dTDP-4-dehydrorhamnose reductase"
                     /protein_id="XP_005535278.1"
                     /db_xref="GeneID:16992435"
                     /translation="MNGSRARAVYRPYDGSAESQRGLLVIGGSGELGSALVRAAAEAA
                     ETPTVSGVRAVWATYRTRRPSVCTPVGSKAPSVRWFYLDTADRRATSDLIQRASTEIG
                     PLLTVVFCAVPKHGGAAGPGGDDIRSGIVDHVLYAAEATKLAGMVEGAERSSCRFVAI
                     STDQVFDGVPPHPPYTTDAPRRPLNPYGHYKVEMEDTLQNIHHPDLVIARTSLILTLG
                     MQPHEDGKAIAFLRSALIETHEKPLVLFTDEIRNMSWSNDLAEALVEVATAIRCERVT
                     MDGDTATVIHLACPETTNRFALAQRLLSTRWSEYRHRAAGRITPGLSAESGLRRPLDL
                     TMDVTSMAETGLVTRTRLRSIFEYLQ"
     misc_feature    complement(115432..118230)
                     /note="repetitive element"
     gene            <118676..>121174
                     /locus_tag="CYME_CMC051C"
                     /db_xref="GeneID:16992436"
     mRNA            <118676..>121174
                     /locus_tag="CYME_CMC051C"
                     /product="similar to programmed cell death 6 interacting
                     protein"
                     /transcript_id="XM_005535222.1"
                     /db_xref="GeneID:16992436"
     CDS             118676..121174
                     /locus_tag="CYME_CMC051C"
                     /codon_start=1
                     /product="similar to programmed cell death 6 interacting
                     protein"
                     /protein_id="XP_005535279.1"
                     /db_xref="GeneID:16992436"
                     /translation="MRTVRVPKKSTERIPVLESVVLRSLFEFRGAVTPARREGVTQRY
                     EHACKHLKALRERVSVISSAPDVERAGDAVQVIRDYYRALRFLETRFVFRRAVAPASV
                     RRGLLQRQNGTSTGQQKTGAGHVDAPNVTLTFTWMDAFQTRQRCSSSSTQLEKAGLLF
                     NLAVCYCTRAHDLVLPEPLTEAALREALQGFQCAAGLFALIQHMSLDSIGADLTQDLH
                     QTSLDTLKLVMLGNAQLCTVDFAIAENRSSSTVSCLAGGAVELYGRAVANAGTRYFPA
                     DFIVELELLRDYAEAVAMQYAAMELDADGTGDIQRLMAMQEEDLVERARRYSEAVVIA
                     ERLLKSELVRRDTPLQRRIEALRDRCRSARERCERENAVVFQVDFSKRRADDRNRHSA
                     PSQLRRRILATTPDLRELAASLGDGQAAERMAALSPAAFLPPSSPLLALQNLVPLEFI
                     PMRNDYDKRVRALVERAVERLREANRVSGSLRRELNLEAILASIPRKFSDLRETETPE
                     ELNRGTVVRFKELHADLNAEEGSDRLASELIRQAKEKVRRAEILLSAEAAEDAEWRAK
                     LRGRAHRPESAEAQQSYHAELHLIQIELQACTAARRSVSTRAQHCQESSVRDALSILE
                     QNGSNGETTSAATSTATITTSAPAQCGSIFDHRSRVITTEHPVAVQLHHAAARLVDME
                     TRRDAVARELEQQRFSDDFGCTLLEDPLPDDDFHASATEIIERIIERRYGALIRRAED
                     LLGSVASSARHELIKAVEDLKSLRAERDRELAAAADLAGRVHRAIEDMQALIQERNRV
                     RERCSRLLERSEALLGSVEGFCEARRLEVSLGSS"
     gene            complement(<121858..>122280)
                     /locus_tag="CYME_CMC052C"
                     /db_xref="GeneID:16992437"
     mRNA            complement(<121858..>122280)
                     /locus_tag="CYME_CMC052C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535223.1"
                     /db_xref="GeneID:16992437"
     CDS             complement(121858..122280)
                     /locus_tag="CYME_CMC052C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535280.1"
                     /db_xref="GeneID:16992437"
                     /translation="MHVALPPLVTACSSRNMTSTSFGASELDQFLADAELRVRLMERR
                     LRKLAAWQKRLQQRNDGDSVRRLRQAAGQRLAAAYVMQALFSLLLMLEGEDPEVHVVK
                     RGMKRCCDWANVLELDASPDDSQPVPTADASASEAAVS"
     gene            <122628..>123195
                     /locus_tag="CYME_CMC053C"
                     /db_xref="GeneID:16992438"
     mRNA            join(<122628..122764,122934..>123195)
                     /locus_tag="CYME_CMC053C"
                     /product="60S ribosomal protein L35"
                     /transcript_id="XM_005535224.1"
                     /db_xref="GeneID:16992438"
     CDS             join(122628..122764,122934..123195)
                     /locus_tag="CYME_CMC053C"
                     /codon_start=1
                     /product="60S ribosomal protein L35"
                     /protein_id="XP_005535281.1"
                     /db_xref="GeneID:16992438"
                     /translation="MVLKAHELRGKSRQELEQQLQALKTELQQLRVLQVSGGGAGKLG
                     KIKEVRKSIARVLTVMSQARRKALREEYMNKKFKPLDLRPKLTRAMRRKLSKTDAARK
                     TLRQQKREQNFPKRRFAILPVPRDSLMQSE"
     gene            complement(<123901..>127617)
                     /locus_tag="CYME_CMC054C"
                     /db_xref="GeneID:16992439"
     mRNA            complement(<123901..>127617)
                     /locus_tag="CYME_CMC054C"
                     /product="glycine--tRNA ligase"
                     /transcript_id="XM_005535225.1"
                     /db_xref="GeneID:16992439"
     CDS             complement(123901..127617)
                     /locus_tag="CYME_CMC054C"
                     /codon_start=1
                     /product="glycine--tRNA ligase"
                     /protein_id="XP_005535282.1"
                     /db_xref="GeneID:16992439"
                     /translation="MVKRLAHEHRSGTPTMLFSAAALQVRACVRTVWRGTGHGVRWSP
                     CGRVASQRLSWSVPRRRHSGPLCTHSASATPPSSGETLRAPGSTENVRASDGMAAESA
                     APAGTGTRTTAKTNVETRPRGAVGANGTGALTFQEAILRLQIYWAERGCLLWRPYNAE
                     VGAGTMNPATFLRALGPEPWNVAYEEPSVRPDDSRYGENPNRIQQHTQFQVILKPAPP
                     NSQELLLGSYAALGIDIDAHDIRFVEDNWESPALGAWGLGYEVWMDGCEITQYTYFQQ
                     VGGFSLDPIALEITYGMERILMTVQGKSHFKDILYAPGITYGEVFLQNEIEMSRYNLE
                     EADVERQRHLFDLSEAEARELLQKRLPIPAYHYVLRTSHTFNILDARGAVGVAERAAY
                     FRRMRSLAREVAALWLERRAELCFPLGQQPAIVAASAAPTSHANEAVHTEQVQRDAAD
                     TVAAPGRQTSGEGATLLIEIGTEELPPADLDAAVEQLREHLLQLLHSSRLLPDAGRVK
                     VHVRATPRRHAILVEGVAHKQPDQWTQIRGPPSRVAIDAQTGKLTAVGQAFAQRHQIR
                     NWEAETERKATKQGEYIFLNRTIQGQRALPLLHERLVDSVLAKIQFRRSMRWNESGVL
                     YSRPVRWLLAMLDDQVIPVAFGGVVSAPVTWGLRASGIAPQLPVSHAQLYDRVLERAN
                     IVAEVSAREQSILRQANALALQQDGVIYDPERTMLHEVARLIESPQVLLGSFDEAYLA
                     LPSPVLITVMQKHQRYFPIEASGSMSTSTEQDSNDLRLRNAFVIVANGRLRNADLVRR
                     GNEAVIQARFADAKFFYEADLKRPLASFVPKLEGLIFEERLGSMLDKTRRIEALVPFV
                     VDALAQRHYRHHEDAGVPAPVPSPCDSPVDTASPRMRAQSPTPDWEQVRQVATEAAAL
                     CKADLATQLVVEFTSLAGIMGEHYARKQGYRDDVARALFEIVLPRSAGDQVPRTPAGV
                     ALALSDRMDSLVGLFGIGLAPKANSDPFGLRRAALGVVQILCRGAFDGVELSALAEAA
                     AAVYAKQHMSIREETLADLLDFMDKRFEQWLLDPDSSLPALDVARGADQSQASATGLH
                     VSAVRAVLQCHRRRPARAYRVLQQLYPLMAEERFRDAVTCYLRPARLVRGQPDLDGSV
                     DPALFQDQVEVALWEALRRGGFDADQPPFTNDDVLGMVQALRTLRPSVDAFLDGVMVM
                     VDEPALRRNRLNLCARIARIPASVLDMEQLQGWF"
     gene            <128091..>129092
                     /locus_tag="CYME_CMC055C"
                     /db_xref="GeneID:16992440"
     mRNA            <128091..>129092
                     /locus_tag="CYME_CMC055C"
                     /product="probable lathosterol oxidase"
                     /transcript_id="XM_005535226.1"
                     /db_xref="GeneID:16992440"
     CDS             128091..129092
                     /locus_tag="CYME_CMC055C"
                     /codon_start=1
                     /product="probable lathosterol oxidase"
                     /protein_id="XP_005535283.1"
                     /db_xref="GeneID:16992440"
                     /translation="MLASSGPQASLYVGWCVFRSTFMDVIGAVGRLNTLSEDVLVRWV
                     DALLQGQFGVVSRSAQPVSMPLYRRLLATWVFLYLGSLVLYYLFASIDYFLVFVAFRK
                     ATVGTKYRANWREIWREVRMSTWSLAVMSLLTTPIELLVQLGYTRVYDDPRKHGILYF
                     ILSPVLFLVFSDTLIYFIHRGLHHRRVYRFLHKPHHSFIDTTPFSAFAFHPLDGFAQG
                     FPYQLFVLIFPFHSLLHLISLAVVGLWTINIHDRVSLSIPGVNGAAHHRIHHTTFRSN
                     YGQYFTFWDRVFGTHKDPKQWHAIRFREEDVYGAAAGKGYLQSKCVVANEVSVEAAK"
     gene            complement(128332..129842)
                     /locus_tag="CYME_CMC056T"
                     /db_xref="GeneID:16992441"
     misc_RNA        complement(128332..129842)
                     /locus_tag="CYME_CMC056T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461215.1"
                     /db_xref="GeneID:16992441"
     gene            <129783..>131057
                     /locus_tag="CYME_CMC057C"
                     /db_xref="GeneID:16992442"
     mRNA            <129783..>131057
                     /locus_tag="CYME_CMC057C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535227.1"
                     /db_xref="GeneID:16992442"
     CDS             129783..131057
                     /locus_tag="CYME_CMC057C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535284.1"
                     /db_xref="GeneID:16992442"
                     /translation="MILFKTRFFWHNLHVTRRLHRAAGLLVSARQLHLRIDMSALRVR
                     ALAVHPLCTMFVLAYAILPGIADVLARRKYDAVVLDQFGVLHDGKRAYPFAIDCVREL
                     HRRHVPCVVASNSSRLREDCLEQLESLGFRREWFAGAVTSGQLTQDALLELRQALRNR
                     QREEPPATRVFHTNWTDRGRATLPSRKPDNLTYDYKPVGMRVEDAELVVTHGTEGVTQ
                     EDGQTVAPLPYATLVSLLRECARRQLPLWCSNPDLVTVVGGVNYVMPGSLAQAYEKML
                     ADEDVDAETIRQLVLRFGKPELPVYETVHRILGLEPVWRKPPTMVHQSTATRAKSVTE
                     DKTGASTRLLAIGDSLLHDILGGHNAGMDTVLVAGGIYAREFFGIPADAESAASIVLQ
                     NKCEIKAAAVEYLLHHFDSPVTPSFVTAYFRW"
     misc_feature    complement(131283..132033)
                     /note="possible transcribed region"
     gene            <132144..>134150
                     /locus_tag="CYME_CMC059C"
                     /db_xref="GeneID:16992444"
     mRNA            <132144..>134150
                     /locus_tag="CYME_CMC059C"
                     /product="GTP-binding protein of engA family"
                     /transcript_id="XM_005535228.1"
                     /db_xref="GeneID:16992444"
     CDS             132144..134150
                     /locus_tag="CYME_CMC059C"
                     /codon_start=1
                     /product="GTP-binding protein of engA family"
                     /protein_id="XP_005535285.1"
                     /db_xref="GeneID:16992444"
                     /translation="MFWTHKFVSDRYTRLPSLPMLRHDSNQSAAGSSSFVCSGDGVRL
                     VAPLRFERFSRKPRGSPQARHHYGVASLRLEPDGVPSRVATARLKASSTHKESNLPSS
                     RQELVPKSSDDPAAASALRNDAQATSPETDTEPSSDAGLSENRTASDGVTEDLSIRGE
                     AVTSAETGLRDETSPAAAERSAATSGVYRKSSLPLVAVIGRPNVGKSMLVNRISGTFR
                     TGAVVEDTPGVTRDRTYQLANWSGRHFRVVDTGGLVFEDTPGDVFIPQIRQQALIALR
                     EADVVVLVVDGQQGVTTLDQDIAVFLRKTCDARGILGRRIPIVVAVNKCESQTMGEAQ
                     AAEFWELGLGQPLAISSIHGSGVAELLDEVCYYLPNHGDDQEEALLSQESGMRRVAII
                     GRPNVGKSSLLNALLGEERVIVSAVPGTTRDAIDELLIQRDPRTGRETCYLLIDTAGI
                     RRKKNVEYGTEFFMINRAFKAIRRADVVLLVLDMEEGITDQDAELAERIVDEGKACVI
                     VGNKWDALGRKDNRLHNEAQLRVRERLPVIHWADMIFVSAKTGQRIPRILALVDAAAA
                     QHARRVSTAVLNEVLLEAVQWQAPPTNRRGQGGKIYYCTQVAVQPPTLALFVNDPELF
                     PDTYKRYLERKFREALGFTGTPIRLLWRARKRRSKAASSRATRK"
     gene            <135893..>136840
                     /locus_tag="CYME_CMC060C"
                     /db_xref="GeneID:16992445"
     mRNA            <135893..>136840
                     /locus_tag="CYME_CMC060C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535229.1"
                     /db_xref="GeneID:16992445"
     CDS             135893..136840
                     /locus_tag="CYME_CMC060C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535286.1"
                     /db_xref="GeneID:16992445"
                     /translation="MVSPVEPGFTGVLVTTATGRVSRACREALESFAELCSENTVCEF
                     AGAQGVHDDSRLLGVQTANDSGTADTASTLSPKQATPQAASWVKVHDTGVRNTFFVRI
                     ELEQAPRPVELVKLLFEQTRKQGYVAVPSCESFFPIDVVCKAYTRHAALALADHVSAW
                     LQAPMSGTHTKPCRFAVRFRSRNNDRVQAHDFIDVICRHAVPLIERGLARVDLTEPDV
                     IIYVHILGKLCCCGAVPRELHHLSSPRLNIHACIPRLAVQEKRAFGEPRIHAEPVADH
                     SASGKRRRVTDSQAERDGKSTGISSCDGVQAESNGVPPP"
     misc_feature    complement(140718..141991)
                     /note="possible transcribed region"
     gene            complement(<143105..>143884)
                     /locus_tag="CYME_CMC062C"
                     /db_xref="GeneID:16992449"
     mRNA            complement(<143105..>143884)
                     /locus_tag="CYME_CMC062C"
                     /product="similar to Tat-interacting protein TIP30"
                     /transcript_id="XM_005535230.1"
                     /db_xref="GeneID:16992449"
     CDS             complement(143105..143884)
                     /locus_tag="CYME_CMC062C"
                     /codon_start=1
                     /product="similar to Tat-interacting protein TIP30"
                     /protein_id="XP_005535287.1"
                     /db_xref="GeneID:16992449"
                     /translation="MSAAASYKVLVAGATGACGQAIVRELVATPRCEEVIALCRRANV
                     RLPFADAGKVRVIVLEDFGELTLTPAERRSKDCPLWSLSGVGAAVCALGTTMKDAGGS
                     KEVFQRVDHDYICGFVRTALACGARKIALISASGASERSLFFYMRVKGETEKHVHALC
                     AEYGAALHILRPGMLLTPPRTSGASRPAERAAQQLVKTLRLSMGGILAVSVEHVAKTV
                     RMALETAPEELLQRFSSLEEQASQTWVYPSRTIFRIGVEAG"
     gene            complement(<145310..>146014)
                     /locus_tag="CYME_CMC063C"
                     /db_xref="GeneID:16992450"
     mRNA            complement(<145310..>146014)
                     /locus_tag="CYME_CMC063C"
                     /product="probable ribosome biogenesis protein NEP1"
                     /transcript_id="XM_005535231.1"
                     /db_xref="GeneID:16992450"
     CDS             complement(145310..146014)
                     /locus_tag="CYME_CMC063C"
                     /codon_start=1
                     /product="probable ribosome biogenesis protein NEP1"
                     /protein_id="XP_005535288.1"
                     /db_xref="GeneID:16992450"
                     /translation="MKRRRTEVSTEDYIGSGKVYVVLEGACLEAARVDKGKRRQGAAE
                     PLVLLSGEEHATFITRSLGSDPAKYRPDITHHCLLNLLDSPLNKAGRLRVFIHTEKNV
                     LIEVHPRVRLPRTFRRFSGLVAQLLEKRRILATNSNEILMRVVPNPIAKHLPVGCRKI
                     LLTDTSEKLRDIRELAVHDIANDEDVAFAIGAISHGDIAPDWTEEHMAISAYACSAAT
                     ICSRVCHAFEGRYGIL"
     gene            <146342..>147325
                     /locus_tag="CYME_CMC064C"
                     /db_xref="GeneID:16992451"
     mRNA            <146342..>147325
                     /locus_tag="CYME_CMC064C"
                     /product="eukaryotic translation initiation factor eIF-3
                     subunit I"
                     /transcript_id="XM_005535232.1"
                     /db_xref="GeneID:16992451"
     CDS             146342..147325
                     /locus_tag="CYME_CMC064C"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor eIF-3
                     subunit I"
                     /protein_id="XP_005535289.1"
                     /db_xref="GeneID:16992451"
                     /translation="MRPLLLKGHERPLTQLKFNPEGDLLFTTAKDTRPTVWWASTGER
                     LGTYDGHTGAVWSCDVFWDSTRLLTGSADNTARLWDVQTGRELFRWSLRSSVRSVGVA
                     PGCRLMHLANSKLLGQESCIHLFRLKSDGNWQEQETEPFLVLRGHTATITGVVWYNTA
                     EYMLSVSEDGTVRKWDVETGKEVDRAKRHKKAITDIKFSKDHQMFLTGSADGTAVLWD
                     THAMQEIRSFVLDRPLNAVDLSPLMPHAVVGGGQEASQVTTTAGKAGKFAATFLHLIY
                     GEEIFSVKGHFGPINCLSFTPDGRGFASGGEDGYVRLHHFDEEYYRRSSEI"
     gene            <148182..>149444
                     /locus_tag="CYME_CMC065C"
                     /db_xref="GeneID:16992452"
     mRNA            <148182..>149444
                     /locus_tag="CYME_CMC065C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535233.1"
                     /db_xref="GeneID:16992452"
     CDS             148182..149444
                     /locus_tag="CYME_CMC065C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535290.1"
                     /db_xref="GeneID:16992452"
                     /translation="MRHVACNCFLFNLQLERLRAGMKVFSNAALPLFLRKDAGSMVKN
                     RTRSFRSRPCAVVTSALTLVLFGVLMWLQRGARFASPAASRQESQARGVDASDAFEQP
                     QDSVSQTGNGLSMRSSCAGEVVFFIRSRSSDFPERVQSVLSTWGQLFPPEDLFFVSGD
                     PVRDKFGAQVIVEPRIGADPLYGRFPVHDPLVLGLAWNVLQQRQQVRFIMIIDPDTFV
                     LPDNLCSYAIPEVSSGRSPYNDYVYSGFGVYMGPPWGANNAGTSCLEKGRAPRELPNQ
                     GPAGIFASGPVGVLLSRALVRDLAPYAEAIWNETQCIDTGDMRLWMGMYFHENDALQG
                     KTVRDAMLCSSLTASGNLMSVYETLPPNHAVVERDFETFYATLPQTSPDHARILMEMF
                     RRHQMSALSAADIMLEFQRLRKWRENVR"
     gene            complement(<150491..>152317)
                     /locus_tag="CYME_CMC066C"
                     /db_xref="GeneID:16992453"
     mRNA            complement(<150491..>152317)
                     /locus_tag="CYME_CMC066C"
                     /product="signal recognition particle SRP54 homolog ffh"
                     /transcript_id="XM_005535234.1"
                     /db_xref="GeneID:16992453"
     CDS             complement(150491..152317)
                     /locus_tag="CYME_CMC066C"
                     /codon_start=1
                     /product="signal recognition particle SRP54 homolog ffh"
                     /protein_id="XP_005535291.1"
                     /db_xref="GeneID:16992453"
                     /translation="MQTAFQVHVCWSRTSRNRQLRAVCPGRNSRGFGPQASTGCSFRH
                     KSAWLGSYDRAGIATARVLHLEREQVAFRRFHALRGSPHGFAGTRMLFEALTENFQRS
                     LAALRGLDKITETNIEPTLKEVRRALIDADVNVKVVDILLAAIKEQALNMKVVKGVTP
                     GQQFVKIVYDELIRLLGGDPATSSSKAGASPLPALAESPTKPTVILMAGLQGAGKTTQ
                     SAKLARLLQTEKRSRKKVLLVAADVQRPAAVEQLQTLGQQIETEVFIPAMVGTGSVTA
                     LEVATRALDYAKQKAFDFMIVDTAGRQVIDERLMEELQQIKRVLSPAEILLVVDGMIG
                     QEAANITRAFHERIGITGAILTKMDGDTRGGAALSIKQISGAPIKFIGVGEKLDKLEK
                     FYPDRMASRILGMGDIITLVERAQEAVDEKEAEQLARKMLEARFDFNDFLRQTRFVRS
                     MGSFAGVLKLLPGVSGMLKEDQLRAGEKRLRLAESVINSMTPRERANPDLLTVDKTAA
                     SRMRRIARGSGRSLEQVESLMRDFVNMRNVMAQMSRRMMGGGSGAGPVPSNASQNPGD
                     LATNLASGDLASNIGNRAARRKLNKKKSDASSSKKSGFGFKQ"
     gene            complement(<154778..>155395)
                     /locus_tag="CYME_CMC067C"
                     /db_xref="GeneID:16992456"
     mRNA            complement(<154778..>155395)
                     /locus_tag="CYME_CMC067C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535235.1"
                     /db_xref="GeneID:16992456"
     CDS             complement(154778..155395)
                     /locus_tag="CYME_CMC067C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535292.1"
                     /db_xref="GeneID:16992456"
                     /translation="MVSPSTLDESLLDSILRDLRVVLKRARLVALPCRCASDRGLSLP
                     EARRRAAELQTELHDWDLWGPLLVCLALSVTLSAVSKSAPSTVFSLVFVIIWVGGAIV
                     TLNASLLGCKLPLFQSICLLGYAVTPLFVGAVLCLIWHAAVASQVIESLLRVVTILVA
                     LGWSVFASSTLLADVGVQAGRKPLAQFPIALLFCGLAWVILLAFE"
     gene            <157239..>158183
                     /locus_tag="CYME_CMC068C"
                     /db_xref="GeneID:16992457"
     mRNA            <157239..>158183
                     /locus_tag="CYME_CMC068C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535236.1"
                     /db_xref="GeneID:16992457"
     CDS             157239..158183
                     /locus_tag="CYME_CMC068C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535293.1"
                     /db_xref="GeneID:16992457"
                     /translation="MVGEKVSTSRRGSAQDVSKNTPEADATAGAYGSPALHGASWGGT
                     SLRQRQRNALGLPRSSPDQDESRQRSPTPGRSCPASPPATRLQGKAEEGRRHSTEQRR
                     SLGDFESLSSRSSQSSGPMSPTLSGLQTELIPEHAPLDPGLPSSLFGLGPTCKEHDSF
                     SVPGQKGARPPHRRTHEYSHEHAAGADMGPSTRIGSLEVIPRLVSDEGIHAQLMDTPR
                     LGSFDASGGSIARSLDSWRPCLPSDEIFCDIDGSQVQKLEKLVGALRALVPSDEERCT
                     ILGNELRNALEHRGLSVQIHTVMRMLEDADQIELTKGH"
     gene            <161051..>161500
                     /locus_tag="CYME_CMC069C"
                     /db_xref="GeneID:16992458"
     mRNA            <161051..>161500
                     /locus_tag="CYME_CMC069C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535237.1"
                     /db_xref="GeneID:16992458"
     CDS             161051..161500
                     /locus_tag="CYME_CMC069C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535294.1"
                     /db_xref="GeneID:16992458"
                     /translation="MLRNTGTSSAWKEKYRCSYCSVWNGHHSLATETHINRENHPKRK
                     IQGALRGCVASDSSRARSASFALTYPVRVRRVGITGAALSAVPKRLEGFDQIVVRQRN
                     GHSGQTMRTVLIVGSVMCIHVSQRTSKFRCACRRFEDLQRRCQYVPT"
     misc_feature    complement(161461..163063)
                     /note="possible transcribed region"
     gene            <163170..>166343
                     /locus_tag="CYME_CMC070C"
                     /db_xref="GeneID:16992513"
     mRNA            <163170..>166343
                     /locus_tag="CYME_CMC070C"
                     /product="similar to ubiquitin-specific processing
                     protease Ubp2p"
                     /transcript_id="XM_005535238.1"
                     /db_xref="GeneID:16992513"
     CDS             163170..166343
                     /locus_tag="CYME_CMC070C"
                     /codon_start=1
                     /product="similar to ubiquitin-specific processing
                     protease Ubp2p"
                     /protein_id="XP_005535295.1"
                     /db_xref="GeneID:16992513"
                     /translation="MRNIFAKTRSENSSQRNSSANVRDRPTAVRETGSSQTKRMEVWK
                     LAAELGFTDAQVAVALKHGCHSTEQILDYILTHKIRPDGSSAGPAAGAQRTSPEPNSG
                     LPPPADRHRDQKEGTNDPNNTEQAELQRAIELSRREYLRPRDALASSTENAVSKPVGS
                     QAPTAESPLALASDTELQRAIEASLEEERKARQRFELSLFRPSEASLDPNTVVRVSPM
                     EPIGLCNVGNTCYLNSLLQVYYHTPSFVRRVFSWREDRVDTEKTPPKAIDVVRELQRL
                     FAYLLLSERRYADPTGFLYALAETLNSAALDLGAQHDLSEFNETFLRSIEAALQTVDN
                     TEPLQRTFTHSFVQELHCRVMEGAHQVAMAVEMNPQCSSDGSGTHGAPQSPGASDTPA
                     LDAMLERLSGLQSATWRLADRVEGTTSALILDVASGNCRDLYAALDEYVLADVEYQPE
                     KLTPGTPIHADSNPSDTQASTSGITTAPTTNTRTATKSVWFQTLAPVLFIYLQRLRFN
                     QETHMPEKVNDFFDFAETIYLDRYLERNREAALLARLQDAQYCREYAQLEQELQRLLH
                     LPGLQEPSDVVYEAVLERLRALDPGNSSHPPVVVDQSETAHREQALESLSYVYVTEKQ
                     QRERLETRMACLAEEMVQNFASLSNEAYRLQAVLVHEGAPEAGHYFVFIRSTRAGDWY
                     EFNDQRVRRVSWEHVHSVGRGGPGTASAYALLYRREEHGEASQLPSIEEAKRLLPASL
                     VAEIAANNAVLREEVEREKLRPVVESISERLRQPEKDETFLERPEWLCLHQGQVADAV
                     LLATCHVYSDQTQGVDLFTALRKHRALRTHTNDETAGNTEANEPVLPPTKASASTFLG
                     AMKSAASGPFSDDIRELATRLECADNETLNQLENAYTRAQQTYRVTILALMLTGIAAE
                     CIRESSWRDAASAITSIYDKASAGISYAGLTASLRNCVEQLVSQTKTSDPELSNWFAH
                     EYLPEKALEKEPADNSTPTSTPAPASGAAPGSEIERCSRRTAPQRPRLPPCDERMVSA
                     RISAFGSQEAAVRWYDGLVRGLGSPQR"
     gene            complement(<166958..>168598)
                     /locus_tag="CYME_CMC071C"
                     /db_xref="GeneID:16992460"
     mRNA            complement(<166958..>168598)
                     /locus_tag="CYME_CMC071C"
                     /product="N-myristoyltransferase"
                     /transcript_id="XM_005535239.1"
                     /db_xref="GeneID:16992460"
     CDS             complement(166958..168598)
                     /locus_tag="CYME_CMC071C"
                     /codon_start=1
                     /product="N-myristoyltransferase"
                     /protein_id="XP_005535296.1"
                     /db_xref="GeneID:16992460"
                     /translation="MRQPGECVQRLELQRNWRLCSVRGPKKSRNACLMEASKSDHEAS
                     GNGEDKAAAVTDEEPCIGTHTERQVGTAGTQPEQTDQNGASSGGSPDTGTPLSAYGLH
                     VPDIAERLAKALSLRSTAAGTDASTALSEQQLRLEHQAPEAPPQQQRHQHRFWSSQPV
                     PQYNETCVTCDGPIDERPRLDPASVPEAPYPLLAGFSWCELDISAESDIQELYELLRS
                     NYVEDDDAQFRFDYSPAFLRWALSPPGWKRVWHVGVRVSTSSKLVAFIAAVPVTMRLR
                     DVKALAVVEVNFLCIHKRLRHKRLAPVLIREITRRAHRQGIYQAVYTAGTLLPRPLVT
                     CRYWHRSLDARKLIECGFSRLRPRMTMKLTERLYALPEKPLHPDVMPLERRHCASARA
                     LLSQYLETHTKFHPCFSETEFEHWFLPRDDVIYSFVRVQRNTSATGTSNERVTDLISF
                     YSLPSSVIHSSKHRTLRAAYSFYNVATSCSFQDLMQDALILAKNAGFDVFNALHLMEN
                     REVFDQLKFAPGDGELHYYVYNWRTSVLRCEENGLVML"
     gene            complement(<169964..>170701)
                     /locus_tag="CYME_CMC072C"
                     /db_xref="GeneID:16992461"
     mRNA            complement(<169964..>170701)
                     /locus_tag="CYME_CMC072C"
                     /product="similar to Transmembrane protein Tmp21
                     precursor"
                     /transcript_id="XM_005535240.1"
                     /db_xref="GeneID:16992461"
     CDS             complement(169964..170701)
                     /locus_tag="CYME_CMC072C"
                     /codon_start=1
                     /product="similar to Transmembrane protein Tmp21
                     precursor"
                     /protein_id="XP_005535297.1"
                     /db_xref="GeneID:16992461"
                     /translation="MSSVSRRLCTLVWCLLVLGVLARVPVTGALQFFLKSGQKKCFSE
                     DVTAGTRVLGEYLVTAGPGKLDVELVVTGPDGKVIFQKDNIDQGKFTFESPAGPQRGQ
                     HPHGNVGEADKEHQEFDENYGDVWPTYNYQFCLSGKNGDGPETKRKITLHVSTGAAAK
                     DYSTVAKVEHLDNLEIALRRMEDEVKSILEELEHMRAREEAMRSINESVSRRVLWYSI
                     ISCLVMIGAGIWQARYLNAFFRAKKLI"
     misc_feature    complement(170826..173465)
                     /note="repetitive element"
     gene            <173643..>175529
                     /locus_tag="CYME_CMC074C"
                     /db_xref="GeneID:16992463"
     mRNA            <173643..>175529
                     /locus_tag="CYME_CMC074C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535241.1"
                     /db_xref="GeneID:16992463"
     CDS             173643..175529
                     /locus_tag="CYME_CMC074C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535298.1"
                     /db_xref="GeneID:16992463"
                     /translation="MNAHHNDWTPDKVLDTVREYVDAGALSECAALDLLERLPLPLLG
                     WTLEEYAVRASLEASDSDAVPSDNIFDSMQVLTKTMEKLVKLSATSARVRHVVPIEQV
                     LQLIHLGLSSRYPLVRTAALRLLCLLLERNDLPEAFCQQVADTIIERFESTNELRPEI
                     EAAQAPGPEVNAPSTTAQHASDILSLVLLSFRDDPSTEAAGICEKILKNLVQLKPFRG
                     AVVLFSEARGAQILVQEMLSGAAGAVAHIRALNLLLEICDYSSVAEIAARRLLPTVLV
                     AKIAAPVRLDEDLLLRLNLLDVLGAFMQRSAIAAELLDQISVFDVLLRQHLAYLLAPD
                     EPASSDLAERWFIWMCGILRFVRTSAGSSRCAFHAWMNASLVEILGRFLLVHVVDGET
                     ETAHWSVQLDQVRRTTLLVHLISAVGALGLCERGMDVLLADVDTLKLTLRFIQTASVC
                     DIRVASLRALSVFLAGLDEPLSSAAVSGYGAAESDLEFRQQRVLHLFTDAIRDADPVK
                     AFTNALPIVLDCARHPSEEERLAAAAVFAALSLSRIGVVALASMAGFVEWLCDPTDAS
                     LEVLEAKMRVARRLVELHASDGEVAFGALKWSRIVAVVSNGSDPRAVRQRRVPAVNIA
                     TLNR"
     gene            complement(<177796..>179058)
                     /locus_tag="CYME_CMC075C"
                     /db_xref="GeneID:16992464"
     mRNA            complement(<177796..>179058)
                     /locus_tag="CYME_CMC075C"
                     /product="probable manganese transporter"
                     /transcript_id="XM_005535242.1"
                     /db_xref="GeneID:16992464"
     CDS             complement(177796..179058)
                     /locus_tag="CYME_CMC075C"
                     /codon_start=1
                     /product="probable manganese transporter"
                     /protein_id="XP_005535299.1"
                     /db_xref="GeneID:16992464"
                     /translation="MDVPSAVQGHQLALQWRRAFFRADATHLENAALRKFYERQNELL
                     DQYVSLPTAPADASCWPAASTPNLSTEAPEEAKHLLTAEPTPSVSYTSCTSTEERPGT
                     AVMPPNKSQHQGVDTEDYARRAILASNGANLLLLLGQAYAYVSMQSLALLANTVDAVL
                     DFFSGVIIGLTWYVRHHRHDRTTRYRYPVGRTRLESVGVILMAVLMTALTLNVLTQSI
                     ESLVLYVSGSERSSTVHPFTRPVLIWIGVALLSKAALFLYCRVSVQDSVAALAMDHWN
                     DCLSNMGALSAAALAQWWPPADPLGGMLISAFILRNWWRLTSRHLDQFLSRSASCRLH
                     SVVTFAALWHDSRIRAIDRVCLYHVGPACFAEIDIVLDPQMPLVVSHDIGESLQARIE
                     CLPYVERCFVHLDFETAHRTEIEHQWPV"
     gene            <179976..>181238
                     /locus_tag="CYME_CMC076C"
                     /db_xref="GeneID:16992465"
     mRNA            <179976..>181238
                     /locus_tag="CYME_CMC076C"
                     /product="similar to Na+-translocating NADH:quinone
                     oxidoreductase, subunit Nqr6"
                     /transcript_id="XM_005535243.1"
                     /db_xref="GeneID:16992465"
     CDS             179976..181238
                     /locus_tag="CYME_CMC076C"
                     /codon_start=1
                     /product="similar to Na+-translocating NADH:quinone
                     oxidoreductase, subunit Nqr6"
                     /protein_id="XP_005535300.1"
                     /db_xref="GeneID:16992465"
                     /translation="MQHVKRGQQQQQQQRIVLSRTAMSMARAPVVRSWGATGQVSELW
                     RDALQRDNRLSGPVMRLLGVRTQVASILSFAAPVLQPSSISETSFPRTLETCRTKAIC
                     WLSVRAAACTASSSFGSKRKNMIQRNCDRSAPLLTVAAGWSMQRNAKIMFLGPRTPFR
                     KLTTVGVVLLKATAPTEQKETQPLWYTGVIRRNRPEAEDLFLLECVVPQEIVTSYHVP
                     GQYVMLRRDSMQAKPGFFSITSPPHHHPDAADCIELLVKQVDRTRWLCALTPGSSVEV
                     TVAQGSGFALRSDTRDAIRHVLLFATGSGIAPIRAVLEDDRFLAHMDSVKLYYGCRNL
                     HRMAYQERFAQWQQERGVQVVPVLSQPDTSWTGERGYVQHALERDGVQTPPEQTLVFL
                     CGLPGMTSAVEAYLLKQGLKKQHILYNF"
     gene            complement(<183185..>184327)
                     /locus_tag="CYME_CMC077C"
                     /db_xref="GeneID:16992466"
     mRNA            complement(<183185..>184327)
                     /locus_tag="CYME_CMC077C"
                     /product="probable 1-aminocyclopropane-1-carboxylate
                     deaminase"
                     /transcript_id="XM_005535244.1"
                     /db_xref="GeneID:16992466"
     CDS             complement(183185..184327)
                     /locus_tag="CYME_CMC077C"
                     /codon_start=1
                     /product="probable 1-aminocyclopropane-1-carboxylate
                     deaminase"
                     /protein_id="XP_005535301.1"
                     /db_xref="GeneID:16992466"
                     /translation="MRSPRTSDSTRLRRAHRKVAAQQPASRAATFIETVLLPPWLFTC
                     AGATPVPLKVFRDDINCLGGDGPLGAVCGNKARKLAAFAEAASNTSMKVERLVSHGGA
                     QSNAMLALAGFSSALGVRFQYVTRPLPRWLRERPCGNLKRALSLGMELWECRTFTEYQ
                     STVSELEQEYQRQSEQIGYPQKLFVPQGVACPEAAVGLRRLAESIAAEDLRDIRMVCV
                     PAGTGTTAWYLQQYLPANVQVLAVACVGDSQYLKAQFRRLEARTHAASRGTAVSLRRS
                     VQVLPNESGGFGTLKSELYRLWRALPSYFDLIYAPPTLLALSAYFADAPERLRDVLYV
                     ATGGSEGNATQLRRYQRKFGQQLESICLDASSMMPVRGTARRSLIR"
     gene            complement(<185968..>186354)
                     /locus_tag="CYME_CMC078C"
                     /db_xref="GeneID:16992467"
     mRNA            complement(<185968..>186354)
                     /locus_tag="CYME_CMC078C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535245.1"
                     /db_xref="GeneID:16992467"
     CDS             complement(185968..186354)
                     /locus_tag="CYME_CMC078C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535302.1"
                     /db_xref="GeneID:16992467"
                     /translation="MPDQAHQRAVLHRWRKRLRVEVASWDRSRLLTLVFYLRLLCALG
                     FALLFGLVPLTGVGALSAYILVTCFLPTTVLRKFIGVQLETYGENTAWLCFTENLWPA
                     FLLFVLVWTLVYTWRTSLLDSGAPPL"
     gene            complement(<191222..>192136)
                     /locus_tag="CYME_CMC079C"
                     /db_xref="GeneID:16992468"
     mRNA            complement(<191222..>192136)
                     /locus_tag="CYME_CMC079C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535246.1"
                     /db_xref="GeneID:16992468"
     CDS             complement(191222..192136)
                     /locus_tag="CYME_CMC079C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535303.1"
                     /db_xref="GeneID:16992468"
                     /translation="MTNDANHLESNCVEEQVQQSLREPWWWLRWRDTPRQQLRGTLFV
                     YTATCPDEKIQRERGFAADHEQVYAFVSFGPEVETDPREHVVEIVKALTSMRSFVETL
                     ERTLFEDEDSEPAARTYTHDEPCSVAHHSADADQQFLVETVRHDRIAAAYSSMSQEMH
                     TAPEGARPDCFSKGTSQDHETDTSQPILRKKDETDTWVVALGPDHLVASHTLAACGCA
                     LFLGLEWDFRACRSRSDDDFRIMELFQEDLKSRVTWLAPRLGLQHKHACSAQCKDQAR
                     NRDSSWDVLLREWLPQAIPGGPRHPQAM"
     gene            <192449..>193546
                     /locus_tag="CYME_CMC080C"
                     /db_xref="GeneID:16992469"
     mRNA            <192449..>193546
                     /locus_tag="CYME_CMC080C"
                     /product="similar to biotin holocarboxylase synthetase"
                     /transcript_id="XM_005535247.1"
                     /db_xref="GeneID:16992469"
     CDS             192449..193546
                     /locus_tag="CYME_CMC080C"
                     /codon_start=1
                     /product="similar to biotin holocarboxylase synthetase"
                     /protein_id="XP_005535304.1"
                     /db_xref="GeneID:16992469"
                     /translation="MTSDKFALPRRLLVYCDSLARRQRLLETHSATLVRLRDAGYLVQ
                     LPQGWKPETTADSTSGVASGNVTAFAVHSFFVELERYRHQQQPGAAWVGHTLVHAPLL
                     ESTQDLIRSFAFPDGTVVVADRQVSGRGRRGATWDSPGGSLAFSLQLELQNGCDQPVQ
                     FIQYIAGLALAESIPNESPEAEQEAARALHIKWPNDLLVDGLKVAGILCESSVFRDRF
                     TVYVGIGVNVANAAPTAALAQFSWASALTRERLLARFLVRFERFLTIFLDKGWVASGL
                     GARYTARWLHQRQLVLLAETNQRGRIIGLSQQGCLLVELDPLSGERGRSGASAIAGQA
                     QCEAGTCSQYIEVEPDVSSFDWQRGIVQRKQ"
     misc_feature    complement(195953..197792)
                     /note="possible transcribed region"
     gene            <195959..>199135
                     /locus_tag="CYME_CMC082C"
                     /db_xref="GeneID:16992471"
     mRNA            <195959..>199135
                     /locus_tag="CYME_CMC082C"
                     /product="CCAAT-box-binding transcription factor"
                     /transcript_id="XM_005535248.1"
                     /db_xref="GeneID:16992471"
     CDS             195959..199135
                     /locus_tag="CYME_CMC082C"
                     /codon_start=1
                     /product="CCAAT-box-binding transcription factor"
                     /protein_id="XP_005535305.1"
                     /db_xref="GeneID:16992471"
                     /translation="MKLNQAHSSQATMAKRRTKSTGHSSSAPSVVVQDNALQQDILAV
                     MQEIGLENPVQDIQTPSVPEVSPTSSAAGSQRRKRQRLAAEVAAGPQSTEGMQRRHHE
                     PAGTTVEHATFETRIPSKPFIATPRLPELPVPVKALLRDEDLQAEHWYEAIPAAVPPL
                     KSSCQPKASEEVAADIIRRLEETGLETLRAVSQLYHERKQRHVPSRTPLSGPELASLP
                     ALGAKQLTLMDRIATLAMDIRRAPLYYLDELTQLIDVATTTCKKRRKERWTAIEALKE
                     LFIEQLLPPSRKLCAFQQRDWATWYAEQGAQVVAVAVTNERTSQAPPSMTATERAQVC
                     SAFRVLMFSAFESAVKAQYARFLVEALTDSAQDPIEFLATRALGAALDLLVACPEQEQ
                     ALLDLLVTKLGSPHRALSSKAYHSLELLIQKHHPAMRLVVARHILQLGIESLPNLTTD
                     RSNRLLYLCVRFLAHVMLHRDRPGDRAFAATLLSFYLGTFRILLERQRFDSRLCTAVL
                     EGLQRVLPFISEGISNNNNRDNSDFAQQQETLKNQIDGLYLLVHRGNLETSIRSLMVL
                     YRLGATDRFYRALYETLASPRLWYAAGSRITALCNICYWSMKADTCVSRLLALVKRLL
                     SLALQAPAATAAGILLMLSELIFRSGQEAFRLDAQKQLLRIRQALGEGSSEERVVAPH
                     QRTAPRTFEATPDQVPSTSLVVAQTVDARASVVRTAARQESASNWTTTTTTTTTTYDM
                     SKREPKFAGAEAAAWCELALLRCHYQPTVAAFAEALIQGQAIHYKGDPLEDHAHAAFL
                     DRLVRKKPKSSPPIARMHSAFAEPRSLPGTPSVLDVATGRTSAAPASTSREGAEVRHL
                     HTADAEVIPSMDKAPNLHALSVPAAERSPRGRTSIMANGMQGAPQEVAHHLRIDSLEA
                     SHRSTSADESSLAHSSEDEEEQAIWAAMEDSLAKQGMLLSDDDDDDDDDDDDELSSSE
                     SESESESAIPPRRAAATRPQRTSPHAAAQGTRALGVVPTTRNGPRGASVASRSKKPST
                     QRKRIREPGRASRRVPDRSKVPRARLLS"
     gene            complement(<200060..>202456)
                     /locus_tag="CYME_CMC083C"
                     /db_xref="GeneID:16992472"
     mRNA            complement(<200060..>202456)
                     /locus_tag="CYME_CMC083C"
                     /product="glutamate--tRNA ligase, cytoplasmic"
                     /transcript_id="XM_005535249.1"
                     /db_xref="GeneID:16992472"
     CDS             complement(200060..202456)
                     /locus_tag="CYME_CMC083C"
                     /codon_start=1
                     /product="glutamate--tRNA ligase, cytoplasmic"
                     /protein_id="XP_005535306.1"
                     /db_xref="GeneID:16992472"
                     /translation="MVPSTDDTSRDHWSLRLPANGELHAASLIVAYVENAQLAWPVDI
                     TVSLSRDVSLPELQNANFITGDYEVSLELARILHMDGSMRALLGWTPVIESLVKACMD
                     ETRSTIKELARTGSLAGAALEAYLAALDERFVLRSFLVDYEPTVADLYLFARLRNRRG
                     LTAGQRAKLEQQAGNPKGHLMDLVEAELCVLPADTLGKARTKFVHLARWMNFMENQPF
                     IASALERAADALSQTVGGWDQVMRLVGAAASFDIQLPDAQFGRVVTRFPPEPSGYLHI
                     GHAKALLLNDYFARIYGGELILRFDDTNPSKEKMEYEESILADCAALDVRPDRIEWTS
                     DYFDVLLEWCEKFIRDGNAYVDRTEVAVMREQRLHCIESAYRNQSVEENLRLWKAMKE
                     GLPEASGCCVRAKIDMQSKNASLRDPVIYRIAGAPADAQTGAGTAVSHHRTGTRYRVY
                     PSYDFACPIVDSLEGVTHALRTSEYQDREAQYIWMCQAAGLRCPRVWTYSRLSFVYTV
                     LSKRKLTWLVDHGYVDGWDDPRMPTVRGILRRGMHVNALRAFILSQGPSRNITFQQWD
                     KIWTTNKRVIDPIAPRHTAIARHEHWAATLTGLESLPDWHQRADSEPLLRSVPRHKKN
                     PELGTKVLVLGTSIILEPDDAESLTIGEIVTLMDLGNARVEEVDRPARRLSLRFMPED
                     RDFKKTKKLTWLTMDPELVLAELVRYGYVLNKEKLEEGDELATYAVPNEVSKRITPVW
                     ADINTRLLSVGSVIQFERRGYYRCDQMWLREGDVMQFIEIPDGRTEQPQVQQRNGLGN
                     "
     gene            202524..203857
                     /locus_tag="CYME_CMC084T"
                     /db_xref="GeneID:16992474"
     misc_RNA        202524..203857
                     /locus_tag="CYME_CMC084T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461216.1"
                     /db_xref="GeneID:16992474"
     gene            <204923..>205342
                     /locus_tag="CYME_CMC085C"
                     /db_xref="GeneID:16992475"
     mRNA            <204923..>205342
                     /locus_tag="CYME_CMC085C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535250.1"
                     /db_xref="GeneID:16992475"
     CDS             204923..205342
                     /locus_tag="CYME_CMC085C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535307.1"
                     /db_xref="GeneID:16992475"
                     /translation="MLRLGFLLGPFAPSHRTCPFSNFQRVYRATSNAERVFLFRTGRA
                     SLSMSGWARGSVVDVVEQRIRDALKPQSIRVEPTYGDPNGTHVSIRVVGDCFRGKRPV
                     ARHQLVYRAIWKEMDAGLIHAVDSLETLTPEEEGEGK"
     misc_feature    complement(205930..206631)
                     /note="possible transcribed region"
     misc_feature    206227..207622
                     /note="possible transcribed region"
     gene            <207013..>207666
                     /locus_tag="CYME_CMC088C"
                     /db_xref="GeneID:16992478"
     mRNA            <207013..>207666
                     /locus_tag="CYME_CMC088C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535251.1"
                     /db_xref="GeneID:16992478"
     CDS             207013..207666
                     /locus_tag="CYME_CMC088C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535308.1"
                     /db_xref="GeneID:16992478"
                     /translation="MPRSQARELLQRIGDWLLSRRLVGTDEAGNRYYEAYRGAGLPLR
                     RYRERPSRSNWFSAASGTDYAGEGADSVNILWWQWLIGARTQPPSAEELVHLERQQAQ
                     VRERVAALAEKERSALETEQLNVLSVHERVAVLSKNSRKSYGRAQVTPVSAEALLATG
                     TVYREWTSAYAEKPVTSDGGVDGVSSREQASSGKTSVEATSTQEPPIWISNRRRPRT"
     gene            complement(<208527..>210893)
                     /locus_tag="CYME_CMC089C"
                     /db_xref="GeneID:16992479"
     mRNA            complement(<208527..>210893)
                     /locus_tag="CYME_CMC089C"
                     /product="unknown DUF21 containing protein"
                     /transcript_id="XM_005535252.1"
                     /db_xref="GeneID:16992479"
     CDS             complement(208527..210893)
                     /locus_tag="CYME_CMC089C"
                     /codon_start=1
                     /product="unknown DUF21 containing protein"
                     /protein_id="XP_005535309.1"
                     /db_xref="GeneID:16992479"
                     /translation="MPLPLLTCSGAKYLLWVCWASKLQRTPDDELAQAASWLEAVPRP
                     LLFVLALSCILLGALMAGLTLGLMSLDLFQLELLAVSGANPEEKSAARAIAPLRAKGN
                     QLLVTLLLTNTLANELLPLVLDTLFPGGYAALVLSVVSVVVFGEVLPQAVCSRYGLKV
                     GAATAGFTRTLMTIFWPVAAPAAWMLDKMLGKELRTGYDRDRLKALIQMHGPAGVTRA
                     ATPAPGAAAAAGSGTVASPDAPDLEWAPVVAAGAERTELRIQEPSPGYASTSSTMPRA
                     SSTQAVRRDSPNVGSNAVADKSFGTSWERAASTGTERAPAVASDGGRPSGFSVLSADE
                     ASMLVGILELSSKTVFQIMTKADDVFCLSVDDCLDRRLLKRILRLGHSRIPIYDGCRD
                     NIIAILLVKQLLLVDPNKALPIRAIIRRKKRSHKKKVVSPVYVSKQCNLLDLLNEFQV
                     GRSHMAIVVESLEPPADHGTRRFLGIVTLEDIVEEMIKEEVLDETDVFVDNEHRQPLL
                     IRGQDKKWHYSIPPELLASRKRNPHLIQYRDIDESAYADAVVFTGGAITKSASVAASG
                     QQRAANVTGTSKVDEARSATSPRPSSWCTEQAVTNATPPGSPHALPETETLQLRTGAA
                     EATMASSSSSSFSETLPERDVRRDASAHAEHGNASVQTREQDETRADSEGNTRAPHGQ
                     LRVQDPDQLQGTEPPLVPGATSSSSESDSSQQPRPETSSQPTTGVPPAEPACDSDSEA
                     ETDLEYDFEAGTYVEPKNLAWRNKPDRSKRASPGSPAAPGATPMAQKQ"
     gene            <212929..>213306
                     /locus_tag="CYME_CMC090C"
                     /db_xref="GeneID:16992421"
     mRNA            <212929..>213306
                     /locus_tag="CYME_CMC090C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535253.1"
                     /db_xref="GeneID:16992421"
     CDS             212929..213306
                     /locus_tag="CYME_CMC090C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535310.1"
                     /db_xref="GeneID:16992421"
                     /translation="MGQLGVALRTLRSNVNLFRAIAKCQVAFDPYDYRSVSAREFLRR
                     VNSPRVRRANPRLVVEATVRDGGGSGGAELVISFLDGRTLTLQPLDVDVKTIEREIAL
                     NIPVLTIYKLFEEETSGSAGFKG"
     gene            <214550..>215638
                     /locus_tag="CYME_CMC091C"
                     /db_xref="GeneID:16992517"
     mRNA            <214550..>215638
                     /locus_tag="CYME_CMC091C"
                     /product="NADH dehydrogenase I alpha subcomplex 9"
                     /transcript_id="XM_005535254.1"
                     /db_xref="GeneID:16992517"
     CDS             214550..215638
                     /locus_tag="CYME_CMC091C"
                     /codon_start=1
                     /product="NADH dehydrogenase I alpha subcomplex 9"
                     /protein_id="XP_005535311.1"
                     /db_xref="GeneID:16992517"
                     /translation="MASRLTDIAVFGGGGFIGRHLLRALLRLAPETSPEALRIRVICR
                     NAVKVRVQLAVDSDQRLQQAVRSSQITFVTADVTQEEQVLQALRPLPQSVANLVGLLY
                     ETPPERTFEKVHVKAAENISKAFKLNEQAEHTASSELERPIMTQVSAIGADFTAVHSA
                     YARSKGLAEQALLSHLGKQVLIIRPSIVFGPGDQFFTRFRDMARFSPALPLIGTGDTR
                     FQPVYVEDLALALARSILPAERKKYVAMESSAESSMDSEHEQIFELGGRDILTFRELM
                     ARMLSVMQMRRLLVPIPLSVANIQAQASELLHRMVPSIPPMLTRDQIALLQRDNVVHT
                     GYRTFRDLGIDQPRGVDAETLTYLAERR"
     gene            complement(<216231..>217046)
                     /locus_tag="CYME_CMC092C"
                     /db_xref="GeneID:16992519"
     mRNA            complement(<216231..>217046)
                     /locus_tag="CYME_CMC092C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535255.1"
                     /db_xref="GeneID:16992519"
     CDS             complement(216231..217046)
                     /locus_tag="CYME_CMC092C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535312.1"
                     /db_xref="GeneID:16992519"
                     /translation="MDAFEHENRYVHAVYEAIGDHFSATRYRTWPRVQAFLEQLAHEA
                     LVLDSGAGNGKYALPVLRQHGYYIAADRCRRLLLRARWQSDALEAQETALLPVECVQA
                     DCLFLPFRSGVFDVALSIAVIHHVATARRRVGAVVELGRVLRPTGHALVYVWALRAIP
                     LKLRSRAQSTMDGYLLPWHHKRSTGADALPQKKSDSPSQTYFRFYHLFEEDELRMLVE
                     EANAVSKEGAATTWTLRITGETFDHQNYVVEFQRQNIHALLEDAADNILHPSI"
     gene            complement(<219974..>221032)
                     /locus_tag="CYME_CMC093C"
                     /db_xref="GeneID:16992530"
     mRNA            complement(<219974..>221032)
                     /locus_tag="CYME_CMC093C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535256.1"
                     /db_xref="GeneID:16992530"
     CDS             complement(219974..221032)
                     /locus_tag="CYME_CMC093C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535313.1"
                     /db_xref="GeneID:16992530"
                     /translation="MQRLPDRSATVADNCDALAASREDWRWTCPALAGHGTKTIFGFN
                     ASRLLNVVRGPSVVPRKLVQCIFIMSRCTRYVWTLTCVCLVFVIVAMVLGIQLAAVPA
                     EALTFDYVPVPRVGLRDARDHNRNPNCFFTTGAKGDLISGHYLVVEPPKGAAVEMIVS
                     KLPRDAIDDESRSVPVLALPAHAGESFSFEVTEDGFPLYRICFAGAYGPPRKILFEWQ
                     GGVVDEVVSGVHADKKEPIKVGHIQDLEAAVDHLQDRVAQVGGAAYYFNHRLGLMLEA
                     LYGSSTALAWTALLKTLAFMAISWWKVSRVKRMLDPSAAAPTGWSFPGVSKLLGQHQK
                     PTKPLLERRISPGGWPRV"
     misc_feature    221257..222957
                     /note="possible transcribed region"
     gene            complement(<221692..>222579)
                     /locus_tag="CYME_CMC095C"
                     /db_xref="GeneID:16992455"
     mRNA            complement(<221692..>222579)
                     /locus_tag="CYME_CMC095C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535257.1"
                     /db_xref="GeneID:16992455"
     CDS             complement(221692..222579)
                     /locus_tag="CYME_CMC095C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535314.1"
                     /db_xref="GeneID:16992455"
                     /translation="MTQQSGRRQHQHQQLLPQRVALASSLGKSGLHGYVYALDAAVGS
                     VLRSRLQDEGVSELVWTPQEPPAELRSAAPMHLQFSAVCSARPLLHTADPSLQISASN
                     ENPRNHHVVAHSAGVVLRPEDLDAPKLVIVCRNDIPMSAGKLAAQAAHAAVGAYRRHC
                     VESTGDTEQALVCNRWKREGEKIVVLSTFKRPASDRASTAAPSVAESGSGARMLEALA
                     REARALGLPLFQVVDAGHTEVPPRTCTCIAIGPAATGRIDAVTGDLQLFTTGRQPEKL
                     ARTGSRNERRNRQRRRGSR"
     gene            <226421..>228379
                     /locus_tag="CYME_CMC096C"
                     /db_xref="GeneID:16992473"
     mRNA            <226421..>228379
                     /locus_tag="CYME_CMC096C"
                     /product="cytoplasmic aminopeptidase P"
                     /transcript_id="XM_005535258.1"
                     /db_xref="GeneID:16992473"
     CDS             226421..228379
                     /locus_tag="CYME_CMC096C"
                     /codon_start=1
                     /product="cytoplasmic aminopeptidase P"
                     /protein_id="XP_005535315.1"
                     /db_xref="GeneID:16992473"
                     /translation="MSLERSSAQRVDALRKLLAARGLDAYLVPSEDAHASEYVAACFQ
                     RRAFLTGFTGSAGTAVVTRDRAFLYTDGRYFVQAERELDPNVWELKKHLIDPPMEEFL
                     GTVLASGSRLGFDPETLSISAFNRLRKALQQHGIHLVPVTNEQDGTESASTRCNLVDL
                     VWGAARPAEPRSVVFPHALCFAGETAASKVSRVLNDMAKNRVDWLVVCALDEITWLLN
                     LRGNDIEYNPVFLAYVLLHRRAVSEAENEPAGDLYLYTEQERLNAEAREALKALKAHL
                     RPYEAIATDLEQLIALGDCVWYDPSHTNCLIGQKLHLAEFSEATLDSNPASAKHARHS
                     ILAKATPIGLFKARKNETELAGMRAAHLRDAVALCRFLALLEHKLVEQGTTINEMEAA
                     QLLDEFRSQQEHFVSPSFPTISSAGPNAAVIHYRPCAESARPITRDAIYLVDSGGQYL
                     DGTTDVTRTLHFGTPTALERECFTRVLKGYIQLEQACFPPGTTGQQLDVLARLPLWLI
                     GRDYRHGTGHGVGCFLNVHEGPQMISPRSSAGETPLEPGMTVTNEPGYYENGRFGMRF
                     ENVLLVVPKLHPDHCMDRKAFLGFENITLVPVERKLLDTKLLTEQEIAWIDSYHQSVW
                     KAVAPLVADDPLATKWLHQQCRSLRATC"
     misc_feature    complement(227829..229684)
                     /note="possible transcribed region"
     gene            <229843..>231240
                     /locus_tag="CYME_CMC098C"
                     /db_xref="GeneID:16992521"
     mRNA            <229843..>231240
                     /locus_tag="CYME_CMC098C"
                     /product="anthranilate phosphoribosyltransferase"
                     /transcript_id="XM_005535259.1"
                     /db_xref="GeneID:16992521"
     CDS             229843..231240
                     /locus_tag="CYME_CMC098C"
                     /codon_start=1
                     /product="anthranilate phosphoribosyltransferase"
                     /protein_id="XP_005535316.1"
                     /db_xref="GeneID:16992521"
                     /translation="MQGTRSLEPWDSDKLAFLHRPFLSARRRLRLQCALNETVRVQVP
                     RGNGTLGVTTHSAKFALQTATGPVEISPGSRGRDGFPVWGFSAAVVAAGLASTWLYRY
                     VGERYSFPLLTGTLQELPAAGDRLLRLVERLIAAEHELSFDEAADAMHCMLETVGEHP
                     ARVAAFLVLLRRNGAETGQVLAGMAAALLERAVLVSTGDLATLDIVGTGGDGSNTVNI
                     STAAAIVAAACGARVAKHGNRSASSKCGSADVLEALGVAIDLGPEQVARCIAETGISF
                     LMAPRFHPQLATVAPLRRSLRVRTVFNNLGPLLNPARSRYQVIGVAAPELMEPMAEAV
                     ARLGTERSWIVHCAGLDEMAPIGATEVIEVRKDVPPCRFRVEPETLGMPLCTVEDLVG
                     DDCAANAATITSILQGAPGPISNAIIMNAGAGLVVYGLAETLQDACDMAANALMSGAA
                     WETLEKWKSLSRQLQ"
     gene            complement(<231953..>232225)
                     /locus_tag="CYME_CMC099C"
                     /db_xref="GeneID:16992525"
     mRNA            complement(<231953..>232225)
                     /locus_tag="CYME_CMC099C"
                     /product="NADH dehydrogenase I beta subcomplex 7"
                     /transcript_id="XM_005535260.1"
                     /db_xref="GeneID:16992525"
     CDS             complement(231953..232225)
                     /locus_tag="CYME_CMC099C"
                     /codon_start=1
                     /product="NADH dehydrogenase I beta subcomplex 7"
                     /protein_id="XP_005535317.1"
                     /db_xref="GeneID:16992525"
                     /translation="MTGRHVESVDTDPKPVDEAFCIANKVPLEWRDGCAHLLVPLNRC
                     RREHFYLPWHCTELRHAYEVCQQKDYIRRKREAQQMSERLEGSSAH"
     misc_feature    complement(234321..235790)
                     /note="possible transcribed region"
     misc_feature    235232..237298
                     /note="possible transcribed region"
     gene            complement(<236373..>239072)
                     /locus_tag="CYME_CMC102C"
                     /db_xref="GeneID:16992454"
     mRNA            complement(<236373..>239072)
                     /locus_tag="CYME_CMC102C"
                     /product="anaphase-promoting complex subunit 2"
                     /transcript_id="XM_005535261.1"
                     /db_xref="GeneID:16992454"
     CDS             complement(236373..239072)
                     /locus_tag="CYME_CMC102C"
                     /codon_start=1
                     /product="anaphase-promoting complex subunit 2"
                     /protein_id="XP_005535318.1"
                     /db_xref="GeneID:16992454"
                     /translation="MQSSQELPETSRSLPDAWETAVHHLQEALLERRHPTQHSTVERQ
                     QLKDALRWLVSTSQRASVPFCRYAVLFLKEFVREQVWEALLEPVLGCTHSTCAPWNDS
                     RKRLTGTADCDTPTSFDPAATRACIAEAAELLEQALQVMDVVAERLDPSRRLYWRGAL
                     SVDAQAVILQQVTQTAMRRLVRSMFVWALQDAEEQVVTGNSDELGHVPSQYDSLRAQQ
                     RHLRSEGDCAQAVPLLLADLERQLAVLGLLDQWRDLVVVQIYESIEERAYRLARDELH
                     EGVLDDLLAWVQKLLQPWVAVMPLDPPDAEISMREGVQSTSGSAFERKVGYFTHETLL
                     HARLSQLFDLIVEYPASKAPLLDIRRCLESTDALQETTQSLCSQLERRLLHPGASTSD
                     ILHHFVNTIQSLLLVDPHGYLLARATTLVRQYLRRQCPEAMTRLVELFTSPEYAELFA
                     LNGQQQQQQQQIDHCPGPRFHAYTHLEDASSDDTDDSRSETDADPASSDGMFSVSGLE
                     TRGQIAHRFAQHDILHILMGVCGGRERFIAEFQFYLARKLTTVMDYEFELLVRNLEVL
                     KVRLGETSLNDADIMLKDISDSRRFMNFIRQEKHMELDSKQQTELVFISYLYWPLLCP
                     EAGTHFGPPERTQSLLAPNLTGSEYFATLKSYAHHLNADLEQFIRLCQESFARQRAPR
                     VLHWIPVAGVCDLELEFADGRHVEFTNVPLLNAMLLELFAEQPRWSRNALRQKLFLLE
                     PGGDATPDAASSLPPYDALLQGALRFWSRHGILRLVDEGDFYEIVEHGGTEPNTREWQ
                     ASPIDATQIDPIADALSAVPGPATEKIQDKDDNTEEVIGNYILGMLANFESLTLERMH
                     QMLTMFCTDPPFRGTLGDVAACLNRLLDAGCVRYERGLYARTG"
     gene            <239748..>240494
                     /locus_tag="CYME_CMC103C"
                     /db_xref="GeneID:16992462"
     mRNA            <239748..>240494
                     /locus_tag="CYME_CMC103C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535262.1"
                     /db_xref="GeneID:16992462"
     CDS             239748..240494
                     /locus_tag="CYME_CMC103C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535319.1"
                     /db_xref="GeneID:16992462"
                     /translation="MEEATDDHVERVVHIPVSPSVTLQAWLFQSRSAGASERGVVLMH
                     PHPKLGGDARSNNVMSVLCTSLASSKNYALTVLSFNSRGHGGSTGTATWRGEAEREDV
                     LGAARWLHARLGDSSAIIIIGYSFGAAVCSSAIGQLCKNAGGVPPWLAALVVISYPAG
                     FLSRLVLGCHLEPTKYVTVPKLFIHGGRDQFCSSGTFEWLFAQVQEPKDRVFFPEADH
                     FWVGMEDELAHTVCMWLQSCLARRNLRNSQ"
     gene            complement(<245570..>247945)
                     /locus_tag="CYME_CMC104C"
                     /db_xref="GeneID:16992506"
     mRNA            complement(<245570..>247945)
                     /locus_tag="CYME_CMC104C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535263.1"
                     /db_xref="GeneID:16992506"
     CDS             complement(245570..247945)
                     /locus_tag="CYME_CMC104C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535320.1"
                     /db_xref="GeneID:16992506"
                     /translation="MLRLRFGEYGRGRFVDEPSVDLRSKATTQASVVQKSSSHRRVMS
                     KSSRAREAALRGLLTCREHSEHKWFRSARYRLCPRRLTGIIMLGLVLWGCLWITMPRQ
                     RQKLAERNALLSLDGKESPKETTENFLEQARTRNRTSVGDEHAQEAQLLPQLVIFTTM
                     RPDAQVSEISRQAQAIASWMDLEPTPKIVFQGCDPGLEQLAHHWNATVDCNIDVNFRG
                     VPLFNAMVHRAFALQPRLALRGLGASARLVVGLLVNADVHLPRNLPQIFAKLLALSPE
                     FFAVAARWDVDVLHPGNSREAFAQEHGTLHSYGGIDLFAWSLRSYQDLLDSDASSSGN
                     RSVIGVRIPSFVFGRGKYDNWLFHEILQTRRWNLTVDITEAATLVHVRHAYPHLQVED
                     ASTSGNFWTNNKRHSWEAFLNVHLALAYGSYESQLGTPLHAPFKLVPCLEHEYCVIQR
                     RFPARCLCEYSNTAPRTQTDPVLRENKWWQCGSRSLEEAGDYRLPLQGKLAHQLDALL
                     KEVVDPMTNLVIMTAATYEYRFLLMNFVCNLRRLRIHKLLVAALDEDLYRYAYARGLA
                     VYLEPALIDSQYRHSLQCAFGSACFRHRSKLKSRHVYEILRRGHDVLWSDVDITWFRD
                     VRPELLRARDAAPPNISGRSVWFQSNEPDPDQAWNGIRRLNSGFYYAVSSASTVTGLS
                     RILEHAASSQLSEQPSFYDVLCGEHGEYRLDNKTCFNGDLYTHFLDPRVFRNGANWTY
                     WVQNRADQGAPAAAILHNNWIKGLAAKQERLEAAGLAYFDPELEICRYDDA"
     gene            <248122..>249288
                     /locus_tag="CYME_CMC105C"
                     /db_xref="GeneID:16992518"
     mRNA            <248122..>249288
                     /locus_tag="CYME_CMC105C"
                     /product="similar to angio-associated migratory cell
                     protein"
                     /transcript_id="XM_005535264.1"
                     /db_xref="GeneID:16992518"
     CDS             248122..249288
                     /locus_tag="CYME_CMC105C"
                     /codon_start=1
                     /product="similar to angio-associated migratory cell
                     protein"
                     /protein_id="XP_005535321.1"
                     /db_xref="GeneID:16992518"
                     /translation="MDSHPQNTSDDDDDVEHVYIVSSPEASSEEEGWNLPAPDANADD
                     AVAVLRGHSSAVYAVAITGQDEVVISGGGDDRALVWVQPFSEAPRLLGDFHDSVSAVA
                     LTGSRLALGTLAGELQVHCTQQLTERTEGEQLAPPLAQVETDVGIECLRGNSEFFAAG
                     TADGALWVLDALSGDCLGVAYNHQGAINSLAFVQDDTNVSTTSLLVTASTDGTVRLWG
                     PPSHGTVPCLYAMDGVFHDAPVLSLASFRDVVLSGDEAGRSFLANWRTGRVLCPLSQQ
                     HQGSVESVVASSEFLVTGGSDGFLHVYTPDARYRMSFQHRDVVVVVRETKRWSQCFVS
                     ASVDQTVCLWDLRSGAEPVRCWRGHCDAILTMDIGTELIVTGSDDATVRCFPLQ"
     gene            complement(<249522..>250292)
                     /locus_tag="CYME_CMC106C"
                     /db_xref="GeneID:16992531"
     mRNA            complement(<249522..>250292)
                     /locus_tag="CYME_CMC106C"
                     /product="probable eukaryotic translation initiation
                     factor eIF-3 subunit K"
                     /transcript_id="XM_005535265.1"
                     /db_xref="GeneID:16992531"
     CDS             complement(249522..250292)
                     /locus_tag="CYME_CMC106C"
                     /codon_start=1
                     /product="probable eukaryotic translation initiation
                     factor eIF-3 subunit K"
                     /protein_id="XP_005535322.1"
                     /db_xref="GeneID:16992531"
                     /translation="MDVTFIEKSQSTYPWGSRYDPQRLEELEARVRLDAAGGLAVHDV
                     ATHLLTLKLYQLYPDRAKDDIKGIILAKSLMVLPSEATTCCRFLLKPLDTRTTEQTTE
                     QSELVRKLVELADLLETGQFHQFWRLRSQEAAHGTPLGQLLDSIVDFDLGVRNFICSI
                     VEMAFQKIRKAELAKLLNSTDVPSEWKVVNQDDGDDIVLVKPVPRDMLRSQSIGAERS
                     VPTERLMLMFSRLARETERPRARRRHQHAPRKNADQRS"
     misc_feature    250482..253457
                     /note="repetitive element"
     gene            <253585..>254247
                     /locus_tag="CYME_CMC108C"
                     /db_xref="GeneID:16992501"
     mRNA            <253585..>254247
                     /locus_tag="CYME_CMC108C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535266.1"
                     /db_xref="GeneID:16992501"
     CDS             253585..254247
                     /locus_tag="CYME_CMC108C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535323.1"
                     /db_xref="GeneID:16992501"
                     /translation="MPRYTIRSLLVLGCASFAIYQTSASKYEPDGRESIRSTRQAPER
                     GHRTRASPEPANHRTGQGAILSALLSTSTEGTLSSATNSVEGLRIGLTNQTEAALASV
                     TPVLQPDAAELENACTFQAPELSALSGTSSLMEDLSTGADSVAGTDNDSDRSEQMTRN
                     KIRDRSWSLYRHLMDPPVASEVGVATPRLRRRIGPNPQAVGVNPLDSSGERNECRAMA
                     PS"
     gene            255332..255424
                     /locus_tag="CYME_CMC109R"
                     /db_xref="GeneID:16992556"
     tRNA            join(255332..255372,255384..255424)
                     /locus_tag="CYME_CMC109R"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:16992556"
     gene            <257816..>259891
                     /locus_tag="CYME_CMC110C"
                     /db_xref="GeneID:16992529"
     mRNA            <257816..>259891
                     /locus_tag="CYME_CMC110C"
                     /product="similar to transcription elongation factor
                     TFIIS.h"
                     /transcript_id="XM_005535267.1"
                     /db_xref="GeneID:16992529"
     CDS             257816..259891
                     /locus_tag="CYME_CMC110C"
                     /codon_start=1
                     /product="similar to transcription elongation factor
                     TFIIS.h"
                     /protein_id="XP_005535324.1"
                     /db_xref="GeneID:16992529"
                     /translation="MANQRRARKNQSKTNQRINRDNKHSRESAEEEETLNCTCQRPYV
                     DGELVVCCDACTEWFHPTCVALSHEEAEALPVFVCPGCLEEAAAATASAEKRKLANKF
                     REAHLRYVQQKRQRRYEHRQSVEAAAAAALQTHQSSSSSSSGLAEDPLVSRCGVSVPP
                     ERVVSETASAPKKRRRPSANEASPASEPGPAPEQESTPVSPKKKRVSGDGKPVEPIRQ
                     KARQMLYEALRSPVAYEIESALFELMDHKVHDDYRARLRNLVANLRDQRNDELREAVI
                     SGSISPSTLCQMNSEELACKELRIKRQEQLTRAEKLRVIESAEQVGLIFKEVPPANAR
                     DSDDPETIHALDANIDTRENSSEAPKVLPSAETAEQGSATRTLSPDAPLSPAQNDMIA
                     HAKDTTEPLSAADCPSTQTDTTTVHETTSATTLQAEQTHLPPRLPADLEPVRCFQENA
                     FTVYEAEPLEAAHTPDDTSTPESDPYMPVTQPAPSYAKLESETPALPSSLQVFQWHGK
                     IATGAAPAFKPVLYVGRNYPASMSELTRLAELLGGHTVQLNEMARIRQRDALAFIRDV
                     RERSSSRRLLLFHVGLNAMDTDAAARCLKAVNEFRKRDRASLLMRNDVLELYLLPVTD
                     DTAAYVDEVCNPDGALLACVVRRDALEAPLRSGMNVDAGGASAEVAQPPGFDISLALQ
                     ILSRQYRPS"
     gene            complement(<260114..>262867)
                     /locus_tag="CYME_CMC111C"
                     /db_xref="GeneID:16992532"
     mRNA            complement(<260114..>262867)
                     /locus_tag="CYME_CMC111C"
                     /product="transcription-repair coupling factor"
                     /transcript_id="XM_005535268.1"
                     /db_xref="GeneID:16992532"
     CDS             complement(260114..262867)
                     /locus_tag="CYME_CMC111C"
                     /codon_start=1
                     /product="transcription-repair coupling factor"
                     /protein_id="XP_005535325.1"
                     /db_xref="GeneID:16992532"
                     /translation="MWLYCALASRKQVSCPKATVVGAWHTRHVSIRRGFVHRLCRGAF
                     SRTGSPALWKRLSVQSALVVPSIHPSQPEESDPEEGKLRAVPLGDIFPNDYVVHNTYG
                     VGKYLGLEFLRRRILNNSTGNATELQEFIVLQYADGILRVPVDQVELLSRLQSGVLDV
                     DEDTDEDSELPYEEVETSRSVRGRKPGSGKASRVKKRALGGKPRLDAISRTRNWEQRR
                     NRAFKAVQKAAIDILQIEALRKSVKRPRYRFDPKDPLYVDFDSAFEYNRAGGLTEDQQ
                     RCVADVFSDLCERDLPMDRLICGDVGVGKTEVAMRAIFLAILNNRQVAVLAPTTTLAA
                     QHLRTLRRRMPEYVRIGALYRDVSTREARQVLEDVASGKIDILVGTHALLNERVRFHL
                     RRRHVNDAQTAADATAAAAARSRSGSPTLTPASGNAPRIARDGLLLVIDEEQRFGVTH
                     KEKIKILDQTRSFYADDIAVDVLTLSATPIPRTLYMALSGIRDVSMIHRAPASRLPVR
                     TFILAQGPESELLVAKAIAHELRRGGQVFYVVPRIADIPAAYERIKASLASKKLEVVH
                     YPILVGHSRTSRLEDVMVSFASGRGRILLSTTIVENGIDIPSAGTMIVESAHKFGLAQ
                     LYQLRGRVGRCANLQAYCLYLFDSRVIEDNQDAQMRLQALRELTQERSAQKRNPRSVG
                     LRIAQRDLEIRGAGDLLGASQSGTQWNLGPELFTKMLREAIKHLQYKQKRERTFADSS
                     APSPSLREYMCVCEFALQGLSPAIPRYLIPDSQQRAQVYRDLTSVGSESELDEEFADV
                     LRGRPMPKPLQHLVLMMKTRLYARQLGVLRISSEGSDTVLQSPAPVHIWKQILDELRQ
                     MSTRSRALSALNIEHISCRSSIQGTQILLRGTGKLPAEKQLSQVLALLRACNVVCTES
                     GFC"
     misc_feature    complement(264591..265547)
                     /note="possible transcribed region"
     gene            <265767..>267506
                     /locus_tag="CYME_CMC113C"
                     /db_xref="GeneID:16992543"
     mRNA            <265767..>267506
                     /locus_tag="CYME_CMC113C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535269.1"
                     /db_xref="GeneID:16992543"
     CDS             265767..267506
                     /locus_tag="CYME_CMC113C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535326.1"
                     /db_xref="GeneID:16992543"
                     /translation="MKTEVVASWPLYLINTNIDEFLEEGSDTSQNLVEPFQIGRQLRH
                     IESLEPNESYTEDLLLEFDFLQGGNATVASQLFPLKAKDSSIAGVRWKVSQQELEIWH
                     RPRTAHYAHPALDSLRYPAAPAQLTAQAERPLATSPLAGDAAKRVHRPEGDHSTSRHQ
                     PSPLSDAAASSSAPRIHYLAAKRERGEYNTVLLRRVVIPGQGTAFVLVPVHAVLHMLP
                     SGLVDPSTSGSLQGGEPLSDHRDVPVEVDIVFRRSEQSKTTNASDLLTSQRRLLAGAD
                     PWVLVRYESTANEVNIEGIRPEQLDALSNAPQARFLQRAELRDRFAPTAAQRCFVSEK
                     YQIDSETLGRGIVLAMDRWTGGLEHLGPSSPQLRKADRLHAISDYIVKLLRHAQVVPF
                     ERLYSVVNARFPCEETELVDILADQTFLVRGALVLDSEIFFNAPAEGSQSFRQLSATS
                     ERDELVMVRNLVLALFDEAQPDGTVTLMELAMLRGRTTPKRLARIMNGLARTGARGAF
                     QFLVKRCNDLGEKFPDTASRLSARLRGAAELARARIFLGNNCSRTHIRTQAKATMTAG
                     DRERRPGAKRRRT"
     gene            complement(<268553..>269746)
                     /locus_tag="CYME_CMC114C"
                     /db_xref="GeneID:16992446"
     mRNA            complement(<268553..>269746)
                     /locus_tag="CYME_CMC114C"
                     /product="26S proteasome ATP-dependent regulatory subunit"
                     /transcript_id="XM_005535270.1"
                     /db_xref="GeneID:16992446"
     CDS             complement(268553..269746)
                     /locus_tag="CYME_CMC114C"
                     /codon_start=1
                     /product="26S proteasome ATP-dependent regulatory subunit"
                     /protein_id="XP_005535327.1"
                     /db_xref="GeneID:16992446"
                     /translation="MATSAGSSGLRLYYQTKIDEFESLIQEKAETVRRLEAQRNELNG
                     RVRGLREELQLLQEPGSYVGEVVKPVGKNKALVKVHPEGKYIVDVEKQVAASSVKPGA
                     RVALRNDSYALHLVLPSKFDPLVSLMKVEKVPDSTYDMIGGLDEQIKQIKEVIELPIK
                     HPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGGELVQKYIGEGS
                     KLIRSVFALAREHAPSIIFMDEVDSIGSARIDNSRGGGDSEVQRTMLELLNQLDGFEP
                     TTNIKVLMATNRIDILDEALLRPGRIDRKIEFPHPNEDARLDILRIHSRRMNLVRSID
                     LRAIAAKMNGASGADLKAVCTEAGMFALRERRTHVTQEDFEMAVAKVMRQDSEKNLSI
                     EKMWK"
     gene            <269915..>271714
                     /locus_tag="CYME_CMC115C"
                     /db_xref="GeneID:16992523"
     mRNA            <269915..>271714
                     /locus_tag="CYME_CMC115C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535271.1"
                     /db_xref="GeneID:16992523"
     CDS             269915..271714
                     /locus_tag="CYME_CMC115C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535328.1"
                     /db_xref="GeneID:16992523"
                     /translation="MDASIIVLSDSEPASDVPEWVSGDDVASTIGADNESVGFRRERP
                     SPVCHEAQVARCSAALRGESSADQEHLREDHPRWLTELSKRLELYLNLDFQRRVEEDE
                     LPSSDLEGEFSALSLDVRPEKSQTDQLALELAQSRTQSASKTQKTYEWETDRYEINTA
                     LRDRSFSSPTRLEHSQYTDTSVAFQLGMCEHASQESVAKRKYAREHYAKGCVQECLAG
                     VRKIGTRTPVSDTSLSTMCRSGSIVMPHTAIRWKTSHMTMIIRCTEPTQKLYKELVPP
                     TGSRLFMEPLPVEMDSSVVAVIQWQANALKSASSSAHGSTKHAIVETLLPFVVICVEG
                     TGFLARGADRTHVRTLVKAVTHMCVEGTKTEILIRYTNPSESLARSVQPPRRGRHAHR
                     QGTSAAPSRGCGMTRQLVEMQFVKLSTYFVEECGIDLTCVTSIDHELEYISALSEALL
                     ELPLELEPQPNGAFRIQYAPEDLDLQAAARSDSLRRKKSVLRERQPSETELECMPNID
                     KRILLQLFLSSIPFVSEDTANAISTAYPSLGALYRAYESCPDDQTRRALLAKIPVQRS
                     IGAGRVRRIGPALSGRIFELIWRKRGESLVSLR"
     misc_feature    complement(272082..273726)
                     /note="possible transcribed region"
     gene            <273455..>274231
                     /locus_tag="CYME_CMC117C"
                     /db_xref="GeneID:16992536"
     mRNA            <273455..>274231
                     /locus_tag="CYME_CMC117C"
                     /product="similar to peptidylprolyl isomerase"
                     /transcript_id="XM_005535272.1"
                     /db_xref="GeneID:16992536"
     CDS             273455..274231
                     /locus_tag="CYME_CMC117C"
                     /codon_start=1
                     /product="similar to peptidylprolyl isomerase"
                     /protein_id="XP_005535329.1"
                     /db_xref="GeneID:16992536"
                     /translation="MEGPAAESATAREKLSFERRLSLSREAKERGNALVHEKSYNEAK
                     RAYDEAFVYMFYSQEEYEYELTQTEKEIYQDFLLTLHLNRGLCKLKLRDFDGAKWDFD
                     EAQRYAKARCVHGGVGHPKALYRRALTLMEMVRVELEKAARREYWDDDRTLQWCSASE
                     TDLRDALSLAPADRAIPLALQELSNLRMQIVELQKAQRARSKALFAKLGSRTMKPDSN
                     ARKSHTCPSTDSGTNASTQPVTNEECIQASLPALERVRIY"
     gene            complement(<274732..>276012)
                     /locus_tag="CYME_CMC118C"
                     /db_xref="GeneID:16992538"
     mRNA            complement(<274732..>276012)
                     /locus_tag="CYME_CMC118C"
                     /product="similar to mitochondrial inner membrane protein
                     OXA1"
                     /transcript_id="XM_005535273.1"
                     /db_xref="GeneID:16992538"
     CDS             complement(274732..276012)
                     /locus_tag="CYME_CMC118C"
                     /codon_start=1
                     /product="similar to mitochondrial inner membrane protein
                     OXA1"
                     /protein_id="XP_005535330.1"
                     /db_xref="GeneID:16992538"
                     /translation="MLRQCLFGVGRLLSGEQGLKNASRFLARGIHARAAHALPVTRAS
                     TPGATLVQRDPFRRLDCIDLGKLQVRRLQSESSRAVGRAESATAVLGAESPKSTGPGT
                     TTVDSEATAKIADDLRASSNAASTDLASEAAEAALSAERNWYDPVVQGIIMFQEYTDL
                     PWWATVAAVTVLARILVLPLTLNTFRNAARMQSIKPDVDAIKERMQAAMHSGDQQRIR
                     ALQQQVFRLLRENQISPLRSLVNPLVQMPLFISFFLGLRKIAKIYPDELRNGGLGWFR
                     DLSLPDPFYGLPALTSATMLFMIQMGTETGGAQLPPFALNLMRIFALILLPLTAQFPA
                     ILFCYWLPNNLFSMLQAFALRHQRVRRWLGCPPLGARSAAATAGAHTNRDAMPDAKTA
                     AIRSYLRSSDANAPVDATRMKILESPPQRSAKAR"
     gene            complement(<279347..>280450)
                     /locus_tag="CYME_CMC119C"
                     /db_xref="GeneID:16992540"
     mRNA            complement(<279347..>280450)
                     /locus_tag="CYME_CMC119C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535274.1"
                     /db_xref="GeneID:16992540"
     CDS             complement(279347..280450)
                     /locus_tag="CYME_CMC119C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535331.1"
                     /db_xref="GeneID:16992540"
                     /translation="MKELQRLCEQLGEDLVGAVLQEAAVPDVNALSFLEEIAAAKAAE
                     SAITCSRPAKETYRAVLSLGPARKMVKEKDKGSGVGILERTAPQTTILQPARSIVSGR
                     LEVPPWRPSGHSCAFIPEPPVAATANREGGEESRFPGQNADLIPSQLWFEVGTARCNG
                     ASQTRALSGLWNRNAFRAHSNSVLAENSDAMLHGTTGAAARANKLRDMHDCFALASRC
                     ARTAAAIGGPTAAQRKYLEAMHGFVEHARAIENELVELTLLEPLDEDLDLHGMTMRAA
                     EMILERRIRAAHQWILDHGGESLQFRVIVGRGCHNRTRKARLAQVVNERMAMLGICGR
                     REAHGGAFYVSLPCCEAHFPSRSFSRARTCTKR"
     gene            <280588..>281526
                     /locus_tag="CYME_CMC120C"
                     /db_xref="GeneID:16992515"
     mRNA            <280588..>281526
                     /locus_tag="CYME_CMC120C"
                     /product="6-Phospho-gluconolactonase"
                     /transcript_id="XM_005535275.1"
                     /db_xref="GeneID:16992515"
     CDS             280588..281526
                     /locus_tag="CYME_CMC120C"
                     /codon_start=1
                     /product="6-Phospho-gluconolactonase"
                     /protein_id="XP_005535332.1"
                     /db_xref="GeneID:16992515"
                     /translation="MIPLSHCTGFLCSTTSIGACRNLFCLGNRVPFLQNRCSGQERRP
                     QRKRASCYRVCSGAVLQLAMATDDELCIYQTKDALAARLSKEILSLVQDSRGLQASEN
                     EQVFVVAVSGGSMPSLLRTALSDQPEAMTRLSRALWILVDERVVPRDHPDSNFRAVRD
                     ALEGLVCSERILGFPPDSIALDTSSIADAYAELLRSKGIKPENIDLVLLGMGEDGHTA
                     SLFPNDEANLRSAPEAKFYIGIDNSPKPPPRRITLSMTAIQAAKRRIFVVTGKGKAKA
                     LSHIFQEGNTKRLPAGLVQNALWLVDADAASEISYR"
     gene            complement(<282168..>284006)
                     /locus_tag="CYME_CMC121C"
                     /db_xref="GeneID:16992522"
     mRNA            complement(<282168..>284006)
                     /locus_tag="CYME_CMC121C"
                     /product="phosphoglucomutase"
                     /transcript_id="XM_005535276.1"
                     /db_xref="GeneID:16992522"
     CDS             complement(282168..284006)
                     /locus_tag="CYME_CMC121C"
                     /codon_start=1
                     /product="phosphoglucomutase"
                     /protein_id="XP_005535333.1"
                     /db_xref="GeneID:16992522"
                     /translation="MFCQNIALTDLHARTSGSFQGGRRKHSRPYEGRAPALLQPRQRA
                     RTAFLRTSRERYVPTDSSPCQCPLGLRSALDTETEEKAIYLELQNGSDVRGVALATEG
                     SRTLVTLTPERAAEIAGAFARWLKASTDRREQHDAVRGGVFRVAVGRDPRLSGPALRD
                     AVILALASEGCDVYDVGLATTPAMFMSTVLEEFKFDGALMLTASHLPPDRNGLKFFTE
                     RGGTDKREVRMLLENAFEHSQSRDAYSIENRQHSGALAKKADLMAAYAAYLRSCIEKG
                     IRNAKNPLKPLDGAHIIVDAGNGSAGFFATDVLAPLGADIQGSQFLEPDGTFPNHVPN
                     PEDQQAMKMASEAVLKSGADLGIVFDTDGDRCGFVNRDGKPMNRNRLIAVLSAIVLRE
                     HPGATILTDSVTSNGLAEFIRKRGGHHFRYRKGYKNIIDKGIELNQSGVDCPLAIETS
                     GHGAMRENYMLDDGAYLAVKIVSELINLQRQGDHRGIDSLLDGLAEPLEEKEFRLNLL
                     TENYKETGKMIVEAFHDFVTSAEAPPNWRLEKENYEGWRVAVDEGNGRAGWLLLRQSL
                     HDPLLPLNVESETQGGVKRIARILYDWAAPRFASVLDLSPLEKVLF"
     gene            <284207..>285316
                     /locus_tag="CYME_CMC122C"
                     /db_xref="GeneID:16992416"
     mRNA            <284207..>285316
                     /locus_tag="CYME_CMC122C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535277.1"
                     /db_xref="GeneID:16992416"
     CDS             284207..285316
                     /locus_tag="CYME_CMC122C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535334.1"
                     /db_xref="GeneID:16992416"
                     /translation="MPLNYYFRVEIDDSSESSQASLQGRVERKAAEIEQRLESVWGSC
                     FCGSFEVSCHKYARSGEIYRHQSDIKDVQRELPALEAFYTLSVQPSGVFADPVIDAFA
                     SASGALDGVRRSSLGTKRNYAVSLIPTSTETAKREGHSFELAVLECAENFPGFMEQYT
                     ASLPQRPHGPGDAQKNLWQIRMTRSASIFEYRIEVEKDALGPLFSREGNPPFRVGHSR
                     PEEACHRSTWGASCDHLQRSDLFIAMIRMILTYERPRESGRASSLFIELEIPSPEQGT
                     SSGAGQKCDDISPAPRLCADGSLEHRFLKAFIDSMLPTRLVEYQSTLQLCSLRRKFAR
                     VLLDFKIVDGSHELPPDVGRPTPLRIAMCWQMLFS"
     gene            complement(<287021..>289012)
                     /locus_tag="CYME_CMC123C"
                     /db_xref="GeneID:16992528"
     mRNA            complement(<287021..>289012)
                     /locus_tag="CYME_CMC123C"
                     /product="probable replication protein A"
                     /transcript_id="XM_005535278.1"
                     /db_xref="GeneID:16992528"
     CDS             complement(287021..289012)
                     /locus_tag="CYME_CMC123C"
                     /codon_start=1
                     /product="probable replication protein A"
                     /protein_id="XP_005535335.1"
                     /db_xref="GeneID:16992528"
                     /translation="MASTALSRGAVKSIYGMNTVSRPVLQVQEVRKLQPSVAQQAQAT
                     TSGDRYRVVLSDGEHLLHCVLMAQLNSFVLSGDLDKGSIVRLVDYQPNKVQDRVVAII
                     INLEILERNAPTVGNPKAFDPRASTDTALSSHSFDDDSTETARKRQAVSAGVEHKPPP
                     PRVTPGAPPVSVPPPVKSAAAGPVVRFDQGLGSSVETLAPPGGYTKISAANPYQNNVI
                     IRGRVVQKGELRTYSNAKGEGKLFSFEIADETGNMRVTAFREKALEAHQRIELNGIYS
                     IAGASLKPANAQFNHTGHSFEMILDQNSVITQLPDDNMIQRVSFDFVKIRDLMDVPVG
                     KVVDVIGIALDIGEVGEISSKTTGLPVAKREVKLIDDTGCSVALTIWGERARSLFSNE
                     DDRPVLLVKSAKRGDFNGVSLSTTPSSHVEVNPNIREAFELRGWFDSEGHGAEFQDLG
                     GTPLGGARTESRIRNSERKTFAQVQSEHIGEDPHSAPGASYYTVRATISHIKQDEERP
                     PWYLSCPDCKKKVIEESPDMYRCERCDKLVKPTPRYIFSIQAMDATGSHWLNCYDEVG
                     PIIFGGYSAEELKRIKETDSEEYQRILEQAHFGEFLFRVRVRSDTYQDEMTFRHMVVG
                     AEKINYESEMKMLESEIHNYDQAGQRLTKPFQETISALH"
     gene            <290276..>291463
                     /locus_tag="CYME_CMC124C"
                     /db_xref="GeneID:16992524"
     mRNA            <290276..>291463
                     /locus_tag="CYME_CMC124C"
                     /product="Smt3-activating enzyme E1 N subunit"
                     /transcript_id="XM_005535279.1"
                     /db_xref="GeneID:16992524"
     CDS             290276..291463
                     /locus_tag="CYME_CMC124C"
                     /codon_start=1
                     /product="Smt3-activating enzyme E1 N subunit"
                     /protein_id="XP_005535336.1"
                     /db_xref="GeneID:16992524"
                     /translation="MRKRVRETSPKDAPKEDPESALTRHEAEVYDRQLRLWGHGAQWR
                     LSQSCALMVVLSRGTSDLLWFELAKNLVLAGIGHLTVSAWLSNPGKYEGTTESDSCAV
                     CGEGLAPISETQAFRDIKEMNPFVTVEPGPDAGSLLKSVENLVNLNANCVCIVSPDFE
                     EPNPPSSNTSDDMTPCTRLAEFCAELNIPCFIAASIGYCCGFFVSEPEENEHSCIQVA
                     EASNKRTSPGGMRFRRAEQHAKPAAVQDPSQNHPRWKSTYGNILAKLRDVSQDDASLN
                     IANEDAWRPFLRWMTFRRMRMPHPLYKVIGATARSALFAENDDSIPTSGNVVDALGWN
                     FPPLAKVIGGIWSLEVIKMLAGIDHTQYFGNFFFFDGMTACGAFTKLVTSDISIEPSR
                     ADP"
     gene            <293754..>295973
                     /locus_tag="CYME_CMC125C"
                     /db_xref="GeneID:16992537"
     mRNA            <293754..>295973
                     /locus_tag="CYME_CMC125C"
                     /product="heat shock protein 101"
                     /transcript_id="XM_005535280.1"
                     /db_xref="GeneID:16992537"
     CDS             293754..295973
                     /locus_tag="CYME_CMC125C"
                     /codon_start=1
                     /product="heat shock protein 101"
                     /protein_id="XP_005535337.1"
                     /db_xref="GeneID:16992537"
                     /translation="MQGNQDSQQEDPLKVYGRDLVAEAEAGRLDPVIGRDAELRRVIQ
                     ILSRRTKNNPVLIGEPGVGKTAIVEALAQRIVRGDVPEALSGTRVVALDMAALIAGAK
                     YRGEFEERLKGIIKAVKESAGKIILFIDEIHTVLGAGSTSGESMDAANILKPALARGE
                     LRCIGATTVDEYKKHVEKDAAFERRFQQVYVSEPSVEETISILRGLRPVYESFHGVRV
                     TDASLIAAAQLSDRYIRDRFLPDKAIDLLDEACSAIRVQLDSQPEIIDRLERRKLQLE
                     IEETALQREKDKASKQRLESVREEIAKIDEELRPLKKKFEKEMQKVNEVRHIRSKIEE
                     LKRKAELAERRRDLALASDLRFGAIPELQSRLSQLTREIDEERSQRALHASSRLSGTE
                     AESAVLVSETVEPAHIAEVVSRWTGIPVSRLTQGERERLLHLRERLMSRIVGQAQAIS
                     AIADAILRSRAGFGREQQPIGSFLFLGPTGVGKTETAKALAVELFDTEKNIVRIDMSE
                     YMEKHAVARLIGSPPGYVGYEEGGQLTEAIRRRPYSVVLLDEVEKAHPEVLNILLQVL
                     DDGRLTDGHGKVVDFSNCVIIMTSNIGSKYILDLNGSAKDAEPFVMEEVRRTFRPEFL
                     NRLDAIVLYNALGEVQLAAIVRLQLADVGKRLAREQIMLQCTDAAVIRILNEAKANPA
                     YGARPIRRFIEQELVTELSRMHISGELLSGGRVIVDVDQRGDWIFRVENPSLMDDDE"
     gene            <296869..>297501
                     /locus_tag="CYME_CMC126C"
                     /db_xref="GeneID:16992541"
     mRNA            <296869..>297501
                     /locus_tag="CYME_CMC126C"
                     /product="similar to Nedd4 binding protein 2"
                     /transcript_id="XM_005535281.1"
                     /db_xref="GeneID:16992541"
     CDS             296869..297501
                     /locus_tag="CYME_CMC126C"
                     /codon_start=1
                     /product="similar to Nedd4 binding protein 2"
                     /protein_id="XP_005535338.1"
                     /db_xref="GeneID:16992541"
                     /translation="MGGRQSKPHSSSPPGAKQRHTALEQSLVQPRAYTDNEWDEVISR
                     VRAHERQLFSKKQQLFEAASTAYKKGQGAEAKRLSRTAHQTDEKYRRARQEASVTILH
                     LRNHGKPADTLDLHGQYVEEALSFTKQRLKELRNINNAQRTSSLLIITGAGHHSEDGR
                     AKIRPAVLNFLRKKGYSFKEEGPGAFRVHLGAESTEGCFASLLRMLGLKK"
     gene            complement(<297533..>298282)
                     /locus_tag="CYME_CMC127C"
                     /db_xref="GeneID:16992527"
     mRNA            complement(<297533..>298282)
                     /locus_tag="CYME_CMC127C"
                     /product="probable tRNA methyltransferase Trm7"
                     /transcript_id="XM_005535282.1"
                     /db_xref="GeneID:16992527"
     CDS             complement(297533..298282)
                     /locus_tag="CYME_CMC127C"
                     /codon_start=1
                     /product="probable tRNA methyltransferase Trm7"
                     /protein_id="XP_005535339.1"
                     /db_xref="GeneID:16992527"
                     /translation="MTRSKDKRDVYYRKAKEEGFRARSAFKLLQLDDEFGIFTGVRTV
                     ADLCAAPGSWSQVVSQKLRLPESASEGNCAVAVDLQDIAPIPGVCTLQGDITQEDTLE
                     RVRCALGGRRADLVLSDGAPDVTGLHDLDEYVQCELVQAALRFCVAMLAEGGKFVAKI
                     FRGYESALLYARIRPYFRELYIAKPRSSRNSSLESFIVCRGFTVGRSYASSREELTAI
                     PAFVPCGDHESEDPDMAYDLTLNPSVHQDMH"
     misc_feature    301527..303035
                     /note="repetitive element"
     gene            <303571..>306027
                     /locus_tag="CYME_CMC129C"
                     /db_xref="GeneID:16992535"
     mRNA            <303571..>306027
                     /locus_tag="CYME_CMC129C"
                     /product="similar to nuclear pore complex protein NUP107"
                     /transcript_id="XM_005535283.1"
                     /db_xref="GeneID:16992535"
     CDS             303571..306027
                     /locus_tag="CYME_CMC129C"
                     /codon_start=1
                     /product="similar to nuclear pore complex protein NUP107"
                     /protein_id="XP_005535340.1"
                     /db_xref="GeneID:16992535"
                     /translation="MESDDEVITCDGRSALPSLAAYSDVSEHVEPLIRSKALRLYEDL
                     FLACSECPDRFPFNIAMGLHDLYVSIFRALAETASDPGDSSELGKLLADLRSQRNLWL
                     LLHIMDNADCEARRTVSQKRMSPMCTRRERPAAIDQLSRQISIDGSGFLPNPLETLPM
                     VTSCRRVLEWLERTSALDLDSSMGAHYAALAELGSLWDPSYRWGLSLTNGTAFDMDAP
                     FRGDLRLADEDLEADERICRACFGLLRCGRLEHALELLRRTGQHWRAALFQGGHSAAL
                     EAADGSDGSHWILWRKMARDISKLDVQNFWERSILCLLSGGAVPVSLLDAPSMEDRLW
                     VRLWSLLDEFIGSRLAILLRASTNQSTYLESQKPSSITSSEETIFSTASDIPNESLFK
                     AIKESGTRADSSRAAQLFAILPLIVDPSTRSQEEILRTLLKNARDTSESPSDFPDDSS
                     DERIVSDLSHFSLCIATHLHWYLTASKSDGCCSETHLLGDLLLCAFIQRLREFSGKCE
                     SFLDLLARYTLAISAKELRIRAVIRLLWNSPIAEIRDIISAVDEVSRSNEEAEIFADI
                     VLEFWSFAWTHVREQLRSGVGSVDEKDLHRLEYCLDLLKELGDNFASVHASSLMQVIR
                     EFYSKDQISATKSMIRRERESGHPNIRLQEDAEWQCWCALLETEDLYLQWTDYMFDRG
                     PTRRPRRPQSDDISELESYEISLREWLKGVDDLALQALHSCLNLLHAIAYLIHDRNLE
                     SSSSDLSFCVRIWCSNLLSNVYEISQNPTACRVLPRRADVFVDLMSFIPPETLRLLTQ
                     RLGHAWTVVRTRKELSMYDQ"
     gene            <307546..>308415
                     /locus_tag="CYME_CMC130C"
                     /db_xref="GeneID:16992542"
     mRNA            <307546..>308415
                     /locus_tag="CYME_CMC130C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535284.1"
                     /db_xref="GeneID:16992542"
     CDS             307546..308415
                     /locus_tag="CYME_CMC130C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535341.1"
                     /db_xref="GeneID:16992542"
                     /translation="MTPFKNLLAAFLPAVMDFSAASGGDDHLNHLYEKGLLVRPGDLR
                     RVLNETSQCTPNGLYQADGTGIVRSARVQQRRLIVLLPAILQIETVKGTGNDESDKLL
                     TFGWITGMKTATPHLNFLRTDGRHVCLRGRFIRPRNTILILKNMSGFQRKRLLRVEDV
                     IEEVLVFDGQLIETDDQGHPSDRPEHIRAVRRIACATPKIVVTADNAAPGQSGGPSVP
                     ENMQGRHVGQALECTLVCEEMRARGELSRIPAGGLTGHLSEEEQLQLSEQHKRLYTVI
                     EETFAAHAMIDMN"
     gene            complement(<310785..>311699)
                     /locus_tag="CYME_CMC131C"
                     /db_xref="GeneID:16992534"
     mRNA            complement(<310785..>311699)
                     /locus_tag="CYME_CMC131C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535285.1"
                     /db_xref="GeneID:16992534"
     CDS             complement(310785..311699)
                     /locus_tag="CYME_CMC131C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535342.1"
                     /db_xref="GeneID:16992534"
                     /translation="MERDFLASTIGWDKTTAAACGFPSFWWSQYETCTDQSVSRLLVT
                     LLEDEAQCSATPFVVKVLQEATGFSNLEIVVVDTEEIASFFTRDSGRQHGSAAVKVQD
                     SNSRPLSRLRFFRFSCDYSGRDSSTAPVSTPRLVIDSWQSLPDGPQLCTVRTTTEEVR
                     NAKEHWSSIEEFLHFVVGYHQQESVSRTSSTLLVIHSVTGVQRLVDDDTTSVISFLDW
                     VRRESNEIPVPSLAILLAVHKDMEKRANLVQLRSRADRIFCVERFASGHSRHATGILK
                     ILKPTDEAEGDRKYLFKHEKHDIVFHEI"
     gene            <311914..>313149
                     /locus_tag="CYME_CMC132C"
                     /db_xref="GeneID:16992545"
     mRNA            <311914..>313149
                     /locus_tag="CYME_CMC132C"
                     /product="mitochondrial ribosomal protein L15 precursor"
                     /transcript_id="XM_005535286.1"
                     /db_xref="GeneID:16992545"
     CDS             311914..313149
                     /locus_tag="CYME_CMC132C"
                     /codon_start=1
                     /product="mitochondrial ribosomal protein L15 precursor"
                     /protein_id="XP_005535343.1"
                     /db_xref="GeneID:16992545"
                     /translation="MQRAAQIRSLLKREQLTNAGVSCPARGLAECLLGRNSSSFSRQT
                     AVIVGASMRSFSTEDGFCRDGQLSLNNIRDLPGARKPKKRVGRGRGSDSGKTCGRGHK
                     GQHARSGSSLPSRFFEGGQTPLVRRIPKRGGFPLVAQRDPLPLNLSLIQSLLDKGRLR
                     VSKDGTITMKSLYDSGGILRCSRARFKLFNYGVKLLGGGARQFSAPLHFEVTDVSSSA
                     LRRIHECGGSVTLVYYNRLGLRALLKPEKFDHWTVFRSDLTHFQGANIDPNTNQAIVV
                     YEYDDVLENDALWPRGEPLPIEEQFSLDFGATSTDESKTDRFTLPSDERFFRILRKLF
                     HDDEKLMSEFLANTPMDLGSIPSQSTRPVIVKRRVRLLPNHARPPPRLLLRYPEFDAY
                     GRSVNFLKPRVPLEHQGAQ"
     gene            <316055..>316708
                     /locus_tag="CYME_CMC133C"
                     /db_xref="GeneID:16992547"
     mRNA            <316055..>316708
                     /locus_tag="CYME_CMC133C"
                     /product="similar to oxygen-evolving complex component
                     psbQ"
                     /transcript_id="XM_005535287.1"
                     /db_xref="GeneID:16992547"
     CDS             316055..316708
                     /locus_tag="CYME_CMC133C"
                     /codon_start=1
                     /product="similar to oxygen-evolving complex component
                     psbQ"
                     /protein_id="XP_005535344.1"
                     /db_xref="GeneID:16992547"
                     /translation="MFVTSFQLQPKGKGSFLARSAGSRSSLSHCGNSGGTVAKLENAA
                     LDRRQLLQGLLVAAVAVFAGKAQPAHSGSEPKMSFFGADAPSSPFSYNESQKEPLFKG
                     ITPELLEEYRLAISEAKKRIEDSGEAISTKSWEDVRSALRLALGTLRSVCSKVNAYAA
                     AEATKQEKKKIEKAYRDFLKTIEDMDYAARMKDPDRAERLRTASIAALDNWMSTVGI"
     gene            <317876..>318670
                     /locus_tag="CYME_CMC134C"
                     /db_xref="GeneID:16992380"
     mRNA            <317876..>318670
                     /locus_tag="CYME_CMC134C"
                     /product="probable constituent of 66S pre-ribosomal
                     particles Nsa2p"
                     /transcript_id="XM_005535288.1"
                     /db_xref="GeneID:16992380"
     CDS             317876..318670
                     /locus_tag="CYME_CMC134C"
                     /codon_start=1
                     /product="probable constituent of 66S pre-ribosomal
                     particles Nsa2p"
                     /protein_id="XP_005535345.1"
                     /db_xref="GeneID:16992380"
                     /translation="MPQGDYIEEFRRRFGERPDQREKERKRRAREPHKVAVRSKELRG
                     LKAKIFHRERFKEKIRLRKEERALKLKDAVAKKNDTGEDRLKNAIPAYLLDREDSVRA
                     KALTNTIKQKRKEKGGKWDVPLPKVRPLPDDEVFRVIKTGKKAKQKEWKRMVTKVTFV
                     GDGFTRRPPKYERFIRPMALRMRRANVTHPELNVTFSLEILGVKKNPSSPLYSQLGVI
                     TRGTIIEVNVSELGLVTTSGRVVWGKYAQVTNQPELDGTINAVMLV"
     gene            complement(<323740..>324921)
                     /locus_tag="CYME_CMC135C"
                     /db_xref="GeneID:16992378"
     mRNA            complement(<323740..>324921)
                     /locus_tag="CYME_CMC135C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535289.1"
                     /db_xref="GeneID:16992378"
     CDS             complement(323740..324921)
                     /locus_tag="CYME_CMC135C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535346.1"
                     /db_xref="GeneID:16992378"
                     /translation="MPLSTSAFIPTALVKAKKPLATGSLAKATHPLLRGQQARRAQAP
                     RRGLRDVSQHAVATLRAVQVHSKDSRSDRGLSLAADLCREVETYEVKSVYTQEPVRIR
                     VYRDFNAELLEPLGITSWDAVTEEAAEDYPVTYENYEVVYYESGCMKLQCVGRDEPLI
                     LQAGDLAEFSDGVHGDGRVTENLRRRFVFCSPDEWEASLRRAITETLEGRPAQAADAD
                     VLPGRSKYGTKPGATSSETTRPTIEPLAHQAGGEFANKITNSSSKKATRRNRGAKSSL
                     KNADREPGNAARAKMDAELAFPNWVAYALADIIQLGAATTLILFWDSGPGAFIPSKEI
                     NFLLHYIFVPIGTAGAFLSAVARFALEVAPSLKEHPLVRLVPRYEDIDDPRQKYLQKR
                     D"
     gene            <325146..>326132
                     /locus_tag="CYME_CMC136C"
                     /db_xref="GeneID:16992546"
     mRNA            <325146..>326132
                     /locus_tag="CYME_CMC136C"
                     /product="probable nucleotide binding protein"
                     /transcript_id="XM_005535290.1"
                     /db_xref="GeneID:16992546"
     CDS             325146..326132
                     /locus_tag="CYME_CMC136C"
                     /codon_start=1
                     /product="probable nucleotide binding protein"
                     /protein_id="XP_005535347.1"
                     /db_xref="GeneID:16992546"
                     /translation="MTETSVPVSCPGTESEQAGRAAACYGCPNQTACAAGKNTTVDPD
                     RVAIANRLAGVQRVLFVVANKGGCGKSSVAAQLAFAFASGVACEAVDRELEVGLLDAD
                     VTGPSIPHLLSIAEEEVHQSATGWQPVYVRGNLAAMSIGFMLPSKDDAVAWRGARKTG
                     LLKQFLRDVDWGDYLDWLIIDMPPGTSDEHITLTQALAGIANTAALIVATPQEVALLD
                     VRKQVRFCERAGVPIVGIVENMSYYTCRHCGHQEEIFTPTTGGVQALCNDSGVRFLGR
                     IPLDPALMRASDLGEAILNYDCPARDAIFELARHIGKAFSPKTIASLEVESS"
     gene            complement(<328169..>328939)
                     /locus_tag="CYME_CMC137C"
                     /db_xref="GeneID:16992383"
     mRNA            complement(<328169..>328939)
                     /locus_tag="CYME_CMC137C"
                     /product="3-hydroxybutyryl-CoA dehydrogenase"
                     /transcript_id="XM_005535291.1"
                     /db_xref="GeneID:16992383"
     CDS             complement(328169..328939)
                     /locus_tag="CYME_CMC137C"
                     /codon_start=1
                     /product="3-hydroxybutyryl-CoA dehydrogenase"
                     /protein_id="XP_005535348.1"
                     /db_xref="GeneID:16992383"
                     /translation="MQVPRIVGVLGAAGQMGSGIAEVLGQRSGCTVLRYDPVKEPEKD
                     INVLRGAEFLIEAVPEVFETKVAVYKALEEARVWTEHVVLASNTSSLSITRLAATSKF
                     PENFIGMHFFYPVQRMNIVEIVCGLRTSENTVEVTESLARKMGKECARCVSDSPGFVS
                     NRILMPYINEAIETLREGTADAKDIDRIMKLGTNVPMGPLALADFIGLDTCLNILRVL
                     EQGLPGGSVKYRASPLLVKYVDAGWLGRKTKRGFYTYD"
     gene            complement(<328992..>329129)
                     /locus_tag="CYME_CMC191C"
                     /db_xref="GeneID:16992409"
     mRNA            complement(<328992..>329129)
                     /locus_tag="CYME_CMC191C"
                     /product="DNA-directed RNA polymerase subunit CX"
                     /transcript_id="XM_005535292.1"
                     /db_xref="GeneID:16992409"
     CDS             complement(328992..329129)
                     /locus_tag="CYME_CMC191C"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase subunit CX"
                     /protein_id="XP_005535349.1"
                     /db_xref="GeneID:16992409"
                     /translation="MTRYICGECGQIFELDVNETVRCNFCSCRYVYKLRTKKPIQLEA
                     R"
     gene            complement(<330536..>332194)
                     /locus_tag="CYME_CMC138C"
                     /db_xref="GeneID:16992512"
     mRNA            complement(<330536..>332194)
                     /locus_tag="CYME_CMC138C"
                     /product="similar to FUSCA protein FUS6"
                     /transcript_id="XM_005535293.1"
                     /db_xref="GeneID:16992512"
     CDS             complement(330536..332194)
                     /locus_tag="CYME_CMC138C"
                     /codon_start=1
                     /product="similar to FUSCA protein FUS6"
                     /protein_id="XP_005535350.1"
                     /db_xref="GeneID:16992512"
                     /translation="MEKAERQSQQPDISEPEKDTESFPLSRIAFDLEAYALRYIWWQG
                     SDGRCLKRGALTRLLHIATNAPREELRKEAARLGLQILTNNFSEAAGLALMAPCATKP
                     CASGSALEVRRWGDSPPLLSPGRSGRSCAVRGESSLLDMVRQEPVDLGLYAEFKRILD
                     EPIDVAFTCECKDAFAKYRNSLLRGLEISQQKGIDQAVRSSYNELAHFYYEHGYLDES
                     LRYLQMMEARGMQKHELLCWILDILRIHLEKLSSRVHAQENRGPRHDFAAQYPQFDLD
                     ACHGHESTALARIPLQIDLRGDTSRIEQLAHIAETSLEEKDIAEATALQAGLALVALH
                     NGQYRRAVKHFLAVTTAFRDSGFTDMISSDDIALHAVLCAIATLNREEILEWILQNRS
                     FLPILDQNPISKELLNSFFNRKFPDLLRSLRALQHDLSMDLYMHSHTEGLTRLIRHRC
                     YVAYVRPFRRIRLSRMKFELLGSDSFDASSDDSFERDLEWLLRQGCIQGQLHLEEDLL
                     EVNSYDGHALMIASVLDEASSSWAFCEKETLRFAYSTCRMGFPP"
     misc_feature    complement(332553..334165)
                     /note="possible transcribed region"
     gene            complement(<335009..>337003)
                     /locus_tag="CYME_CMC140C"
                     /db_xref="GeneID:16992377"
     mRNA            complement(<335009..>337003)
                     /locus_tag="CYME_CMC140C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535294.1"
                     /db_xref="GeneID:16992377"
     CDS             complement(335009..337003)
                     /locus_tag="CYME_CMC140C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535351.1"
                     /db_xref="GeneID:16992377"
                     /translation="MSMGDAAHETQLIQLCDQQRTEIAGLLAQLRRAPVASLETAAVE
                     RKARTLLATWQQKVEEGEALGLPGLDAQRNLLFQMQRALSAVSTQLRRRRLATTAGAQ
                     PSAAPVSGEERLALERELLIEPQSITTHDVRPSKPAYGEAATTRSAASDQTALGTTEL
                     SAVASQITRRIHRTTLLANQELERSKAISDSITESSANIRRMDQKYDEYQGQMALGNR
                     RIEQLRRAERRRRRYVALAFLALLASVCFIVLRRLGTAKTLGLLSVAMRFALWTMLKV
                     TNFLIGAAGRLWRLIQKLMQKQIPPIDADTRFVADDHVDLGFHRSTPDTHWDPQTRHP
                     HRQMQIQQLKHPFENSGPEENHTWPLDCIQDSTEQSLHSGSQDVELGTSNESPEAAQE
                     KSVEAGSSDAPPEGIASPETTPSVDREAYEASRACSSVVVNTTEYAQNSTRVAVTHEA
                     MPPHDPAHVKKEFTLLQSYTTQKDDSNGRNPATSMESTATLRVGPRASAKTTTLSVLE
                     RKDPGSELETQHSSDATQAIETPAVPLPVENTVMMTRPSYRMGKSATSVKHQISPESL
                     EGDEMVRMTPSNESLLGQHPSFTSEVQLNTIASDQDTELRTSSSIASQYMDEDKDGLG
                     IQTSERVYLSNDTQKNFTDTHSGGIQDPNHPTKQALDTGE"
     gene            <337309..>337791
                     /locus_tag="CYME_CMC141C"
                     /db_xref="GeneID:16992381"
     mRNA            <337309..>337791
                     /locus_tag="CYME_CMC141C"
                     /product="bis(5'-adenosyl)-triphosphatase"
                     /transcript_id="XM_005535295.1"
                     /db_xref="GeneID:16992381"
     CDS             337309..337791
                     /locus_tag="CYME_CMC141C"
                     /codon_start=1
                     /product="bis(5'-adenosyl)-triphosphatase"
                     /protein_id="XP_005535352.1"
                     /db_xref="GeneID:16992381"
                     /translation="MLYPFGPYYISRAVEVFYSTKLTLAVVNLRPVAHHHVLVFPRRP
                     VARFADLVEAEVADLWLSAQRIGSRIEAHGRKRGVSGLQFVIQDGVGSGQTVPHVHVH
                     IVPRTPGDFTPNDAIYGALEKRGFHADETERPDRSRDEMREERDELAALFPEAEYQVP
                     "
     gene            complement(<339018..>340013)
                     /locus_tag="CYME_CMC142C"
                     /db_xref="GeneID:16992551"
     mRNA            complement(<339018..>340013)
                     /locus_tag="CYME_CMC142C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535296.1"
                     /db_xref="GeneID:16992551"
     CDS             complement(339018..340013)
                     /locus_tag="CYME_CMC142C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535353.1"
                     /db_xref="GeneID:16992551"
                     /translation="MYSLFNHRLVFGEACSLNTPEKQQFFVAQAPGQPLVGHARMCDT
                     PQGKDEPRTETLERTLKIRVAAADPLEAEFIDRVLQAWKRESESVLARCDELNRQGWS
                     ALQIFQEIRDTHNFGFTGALGRHRDKYRSQLPAPGIRAVREGAFLDWMEGLDYGTKRH
                     DAKNALSAALQVPALSPQEKARTHLEQRERSKRAQFRVAPSTRAVIAPDNSEISLIIN
                     EDTSDCLDSTAQSDSIALRFHVFSMGRKSIRRLMRDASGRRSSVKHLSIAFVNDPVSS
                     DPANPKIGMTLRSNPQEYFFYLCYDGCEKRKQLETQTRNEESAGIGIEQCDALQP"
     gene            complement(340835..342511)
                     /locus_tag="CYME_CMC143T"
                     /db_xref="GeneID:16992374"
     misc_RNA        complement(340835..342511)
                     /locus_tag="CYME_CMC143T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461217.1"
                     /db_xref="GeneID:16992374"
     gene            <342625..>343476
                     /locus_tag="CYME_CMC144C"
                     /db_xref="GeneID:16992379"
     mRNA            <342625..>343476
                     /locus_tag="CYME_CMC144C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535297.1"
                     /db_xref="GeneID:16992379"
     CDS             342625..343476
                     /locus_tag="CYME_CMC144C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535354.1"
                     /db_xref="GeneID:16992379"
                     /translation="MFLAPNPVVWLRRKGTYTLHETYCSLTSGRHRADSKRDPFLYVE
                     VSGDGDDVWRLQNVFELLRDPSRGVVGILPTDTSYAFVCNLHSRTGVERIYSLKKTPP
                     SVRKPLSLLCRNHAAIQRYALVLDKRTFKVLKALLPGPYTFILPATHEVPRVMIENRV
                     HRKMWKRREIGVRWPRDPYCQAAMDALDGVALLASSVPDDEVEEDGVDRDYLRMLEHW
                     EHEVDFMINAGARTIGLKSTVVDVTRGWRVLREGLGYEELRQVLGRELGAEILMDAPE
                     DRPPIPE"
     gene            complement(<344354..>344956)
                     /locus_tag="CYME_CMC145C"
                     /db_xref="GeneID:16992397"
     mRNA            complement(<344354..>344956)
                     /locus_tag="CYME_CMC145C"
                     /product="60S ribosomal protein L9"
                     /transcript_id="XM_005535298.1"
                     /db_xref="GeneID:16992397"
     CDS             complement(344354..344956)
                     /locus_tag="CYME_CMC145C"
                     /codon_start=1
                     /product="60S ribosomal protein L9"
                     /protein_id="XP_005535355.1"
                     /db_xref="GeneID:16992397"
                     /translation="MRAILASETLKVPEGVTVRVKKREVFVKGPRGELRKSLKHIPAD
                     FTLLEKGRKVRIQVWQGRRKDLATIMTAASVFKNMFTGVIKGYCYELRAVYAHFPLNM
                     TISENDTVLEVRNFLGEKRVRRVRMLGGAKVYRSNTVKDCLLVVGNDINEVSQSAALI
                     HETCLVKNKDIRKFLDGIYVSARTNAVDDDGVAVTATHKC"
     gene            <349048..>351273
                     /locus_tag="CYME_CMC146C"
                     /db_xref="GeneID:16992548"
     mRNA            <349048..>351273
                     /locus_tag="CYME_CMC146C"
                     /product="phospholipase A2-activating protein"
                     /transcript_id="XM_005535299.1"
                     /db_xref="GeneID:16992548"
     CDS             349048..351273
                     /locus_tag="CYME_CMC146C"
                     /codon_start=1
                     /product="phospholipase A2-activating protein"
                     /protein_id="XP_005535356.1"
                     /db_xref="GeneID:16992548"
                     /translation="MDAEQRSGVGDSSPHAATYRLSRTLAGHAADVRAVAAMSRELLI
                     TGSRDGCVRLWRGNELNSYGIRVHAPHYVQALAVLSNEMIVSGSSDKTVAWIDVNTEQ
                     MTHLGKGHGDVVSALAVAPTSTLVASGSWDRTVRLWRDGESLMSLTGHDAAVWALLFL
                     SDTEVLSASADCSIRLWDVRKGECAQVLYGHDEAVRALCRLELSAHSRGSFASAGNDG
                     SVILWSMHGEQIRRYPNVHGSFIYALAAFQDMLISASEDRTVRILDLQQQDVVQTIPH
                     PNTVWSVTMIPNADGDFLTGCADSCARVWTRIPERSAPAEHVAEYEMALAAQKTSMHH
                     QHQIDPSQVPDAETALAQPGFRDGQTRLVRKSGTLDGIEVYMWSMSAGRWMKIGDVTD
                     PPGSPERPLKTGFDYVFDVDVDVDGSAHRYRQLGYRRGENPYVAAERFLEEEHLPRTY
                     LEQIVQFLITHVPASDMRADAGALTDPLTGADRYVPPAASSLPQGHSAGNLPDWILFP
                     GTDSYERILEHLPENDRCRSLFQTLKPLTAEKVRMLSALLERTPPAQAVAVIDLARLV
                     VLENDAIQILFGNGQPTVLDSVLRHASSAEASFGIHVSSCRFICNSFVHWQRAPVREA
                     LLRCADLILDTFTIIVHSDTPEKLWRAFAAVLYNYAVLESRCDAGRQSVRSCADRVLQ
                     SACLLGFARPAGVQEASELTDALWMLIHDASRAQLAISAGLLEWEEVPSKIAERIRMF
                     V"
     gene            complement(<351660..>353096)
                     /locus_tag="CYME_CMC147C"
                     /db_xref="GeneID:16992376"
     mRNA            complement(<351660..>353096)
                     /locus_tag="CYME_CMC147C"
                     /product="polypeptide chain releasing factor eRF3"
                     /transcript_id="XM_005535300.1"
                     /db_xref="GeneID:16992376"
     CDS             complement(351660..353096)
                     /locus_tag="CYME_CMC147C"
                     /codon_start=1
                     /product="polypeptide chain releasing factor eRF3"
                     /protein_id="XP_005535357.1"
                     /db_xref="GeneID:16992376"
                     /translation="MAASQVAERVQELHLDDNGRGPGSESPERVRNLNIVFIGHVDAG
                     KSTLCGHLLYLTGNLDERTLEKYEKEAKSKGRESWKFAWALDLTEQERSKGKTTDYGV
                     ASFRTATKHITIIDAPGHKAYVPAMISGTGQADVAILVISARKGEFEAGFERGGQTRE
                     HAMLAKTAGVRQLIVVINKMDEPTVQWSEERFREICDKLAPFLKQIGYRPQEVSWVPV
                     SGFTGENLREPVHPSTCAWYKGGSLLQVLDALKLPPRPLDMPVRMTVVDRFRDMGVCI
                     LGRVEAGTIRSGDRLLLMPPRLVVHVTSITMDAEEVPLAEPGDNVKLLVKGVEEDDIH
                     SGQVLCAENDPVEATTTFDGQVMLVEHKSILTAGYRCIAHIQAAAVEVVFERLLAEVD
                     RRTNQIVKKHPKFVRPGSTFIARLSVAQPVCVTAFKEFAPLGRFMLRDEGTTIGAGVV
                     VRIPTAKQRSEELQSTTESGAKIASSSV"
     gene            <353709..>355115
                     /locus_tag="CYME_CMC148C"
                     /db_xref="GeneID:16992549"
     mRNA            <353709..>355115
                     /locus_tag="CYME_CMC148C"
                     /product="aspartate aminotransferase"
                     /transcript_id="XM_005535301.1"
                     /db_xref="GeneID:16992549"
     CDS             353709..355115
                     /locus_tag="CYME_CMC148C"
                     /codon_start=1
                     /product="aspartate aminotransferase"
                     /protein_id="XP_005535358.1"
                     /db_xref="GeneID:16992549"
                     /translation="MFVGLLTRRNLRPLQSLARKQSQLDTFRSRMSYSTFSGVPEAPK
                     DPILGLNELFREDPSPLKVNLGVGAYRTEENRPYVLGVVKRVEQELANNPNTLHEYLP
                     IEGLPEFRSLSARLVFGERSPALKEQRVVSLQSLSGTGSLRLVAEFLSKFYQRGAVCY
                     LPRPTWGNHWNIFPAAGIKCREYRYYSDETHEVDIIGLLDDLTAAPSGSIVLLHACAH
                     NPTGADPSMTQWQEILDVIRKKQHFPLFDCAYQGFASGSFERDAAAVRLFERATVPAS
                     EADGARERPMEMAVTQSFAKNMGLYGERVGAAHIVCAAPAVTQAVLSQMKQIARGLYS
                     SPPAHGATIAARILKDRALFAEWETEVHVMSSRILRMRRELFEALHENKTPGNWEHIL
                     SQIGMFSFLGLSAEQCLYLREKYHIYMTTNGRISMAGLTSDKVQYLADAIRDAVVREA
                     EKFEHQSGIQAALNSGKI"
     gene            <356292..>358205
                     /locus_tag="CYME_CMC149C"
                     /db_xref="GeneID:16992553"
     mRNA            <356292..>358205
                     /locus_tag="CYME_CMC149C"
                     /product="phosphoglycerate dehydrogenase"
                     /transcript_id="XM_005535302.1"
                     /db_xref="GeneID:16992553"
     CDS             356292..358205
                     /locus_tag="CYME_CMC149C"
                     /codon_start=1
                     /product="phosphoglycerate dehydrogenase"
                     /protein_id="XP_005535359.1"
                     /db_xref="GeneID:16992553"
                     /translation="MVFVPITSVQEAKHIFRHRNSRSTSQLCACRFALARAFVSTQDK
                     TCFVPGRPCVLKEKSAHTGTLRRSRLQRGFCCAQVEATTVHSDSMRKTNSTSVMGNGA
                     VGALTGRVLVPEKLDSDGVALLERAGLEVVCKYDLTEDELSAVLGDFDALIVRSGTKV
                     TRSLLEKANATRLRVIGRAGVGVDNIDLAAASERGIVVVNAPTGNCIAAAEHTVALLL
                     ALARNIAAADATIKGDQWNRNKFVGVSLVDKTLGVCGFGRIGREVARRCRALGMRILA
                     YDPYCAVEVTRAVGAELCSSLDELLRVSDFVTVHMPLTESTENMIDRNALSKCKDGVR
                     ILNVARGGIVDEVALLEALESGKVAGAALDVFVQEPPHKYPGSPSEKVAKHPRVVATP
                     HLGASTVEAQLDVALEVAEAVITALRGDFAPTTVNAPSLPSEMLSTLKPVAELAKDLG
                     KLAAAFSDRIHEVSITYAFRDAEKRNATRFLRASVLQGLLGQTSAVPINYVNADVVAE
                     RRGITWTEVLLSSIETSDAEFLRLEVNRHVYEGRVTSGMPRVTRIDNFDIDICLNGRV
                     LAYEQIDRPGMIGLVGSILGDAGVNISFMTLGRDDKVGRALVLLGVDSEPEPSTLDAI
                     ASKIGYRPRMMFF"
     gene            complement(<359100..>360488)
                     /locus_tag="CYME_CMC150C"
                     /db_xref="GeneID:16992552"
     mRNA            complement(<359100..>360488)
                     /locus_tag="CYME_CMC150C"
                     /product="cytosolic ascorbate hydrogen peroxidase"
                     /transcript_id="XM_005535303.1"
                     /db_xref="GeneID:16992552"
     CDS             complement(359100..360488)
                     /locus_tag="CYME_CMC150C"
                     /codon_start=1
                     /product="cytosolic ascorbate hydrogen peroxidase"
                     /protein_id="XP_005535360.1"
                     /db_xref="GeneID:16992552"
                     /translation="MEKASPLECSSAVSHQEALFRTQEPAFAFTCGNWTRTGSSSASF
                     GQGTGRNSIRLWRASRLRFTGTRQTQRLCWRSAVEPSRRAFLRTLLALSTGCLLAQTE
                     TLRDGQLPIAHAFVDFDVNRYGDKEIRVSTLNRLKQNLRNVLSQSPHLLEPFVRLALA
                     DAFTFDESTQVGGSNASIRYVLAKLQENGPRKTASAPGLSGLQEALKALEPIRPFIKE
                     VSWADTIAYAGVVAMELTGGPRLRVQNGREDAPAERQQLVWQRLQDVPAYWRFLHGIE
                     DNASDNDAALGLEDMRVLLTRSGLVSRNDREQQTRAGLLIIGALGELRRLEESLGSSA
                     PSRGTAARGERSSSTGPILSEDIATVTYGRARSDPAASRTVAVNTSVRSLTLGKDRFS
                     TRFLRELASRLHRHEAQNATEFSIAADADATKAVDTLGNLGDKGFGNAFADLYQKATR
                     LGARYSRIDLQK"
     gene            <360960..>362105
                     /locus_tag="CYME_CMC151C"
                     /db_xref="GeneID:16992550"
     mRNA            <360960..>362105
                     /locus_tag="CYME_CMC151C"
                     /product="probable V-type ATPase V1 subunit C"
                     /transcript_id="XM_005535304.1"
                     /db_xref="GeneID:16992550"
     CDS             360960..362105
                     /locus_tag="CYME_CMC151C"
                     /codon_start=1
                     /product="probable V-type ATPase V1 subunit C"
                     /protein_id="XP_005535361.1"
                     /db_xref="GeneID:16992550"
                     /translation="MAPTGSPNEVCAGLLAVPRTLPTIPIAQIEPFELPGFRVGTLDS
                     LLALSETLCRHDSAASQLAVKIAQEFPAEFSLSTDGLRVPLRAYCPFRWNQAKYGSVE
                     QCPLAQLFQFVWRQVEELEQGFRTRHEQYAAAKQNWQALEQAYSGGLSYRPLSSIVRP
                     EQILETEHLLTVFLLLKARDEDTFLRTYESSTPHVVPRSATLLARDDEEVLYSVVVFR
                     KGLTEFVRAARERRYQVREYQSEADSTQGSLEERLAKARIHWQQLGHAFREWITEAYA
                     ECIDALVHLKVLRLFVEGVLRYGVPVSFAAGWILYDRSKIQKIRKTLQQALHTPEHRQ
                     ILRHVYREAGEQIEMPSIPGLSAADMELPYDEDAFVWLPVDDAIFRQ"
     gene            complement(<364901..>365452)
                     /locus_tag="CYME_CMC152C"
                     /db_xref="GeneID:16992384"
     mRNA            complement(<364901..>365452)
                     /locus_tag="CYME_CMC152C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535305.1"
                     /db_xref="GeneID:16992384"
     CDS             complement(364901..365452)
                     /locus_tag="CYME_CMC152C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535362.1"
                     /db_xref="GeneID:16992384"
                     /translation="MTGALSVRVLRKLLWIERWESICRQSTYFSVIALTQNSAWGRTK
                     QRLRILHGTGALGSSVDVRYAVPKWVRIALERANQRPLLPLFRGGPALVVFGENADVW
                     LRVTKYTEQAIPGALLVGARIGAVPVVTRSVLELLRPSREYVEQLVSLLEQPVVVLTE
                     PLDATVLALEEALSAKQPQSAVQ"
     gene            365554..366988
                     /locus_tag="CYME_CMC153T"
                     /db_xref="GeneID:16992533"
     misc_RNA        365554..366988
                     /locus_tag="CYME_CMC153T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461218.1"
                     /db_xref="GeneID:16992533"
     gene            complement(365974..367672)
                     /locus_tag="CYME_CMC154T"
                     /db_xref="GeneID:16992386"
     misc_RNA        complement(365974..367672)
                     /locus_tag="CYME_CMC154T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461219.1"
                     /db_xref="GeneID:16992386"
     gene            complement(<368489..>375448)
                     /locus_tag="CYME_CMC155C"
                     /db_xref="GeneID:16992375"
     mRNA            complement(<368489..>375448)
                     /locus_tag="CYME_CMC155C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535306.1"
                     /db_xref="GeneID:16992375"
     CDS             complement(368489..375448)
                     /locus_tag="CYME_CMC155C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535363.1"
                     /db_xref="GeneID:16992375"
                     /translation="MTTTSRQSRGSRLGAQRLRAPAPAQDRTTDRGPVVEERASAVLT
                     VATSATMGVDSELGHRSSGREAPEARTERESHAVAIMRRAEQIAAARRAASLERFASS
                     SSSSTLTESQVGRLPVESSETLAARGAAILERIRQRRAEAQRLIEEHERRLRSKANSR
                     TASASTPYMSPSWSGEESQNLSTRIEQGFHVEALSTSATEDNTTMGRNALAAGQLARA
                     QQHTDRPLTPSSHVVERIHTVMERLQCESGTRGERSPEDSNVQRREDDAASGGPVDPP
                     ATRVLNPPRDGDLLQDPTRYPRAPDSLENPVHTIQASESIQAEPGRTRSEIQNVSRSS
                     SYLTGPEKRASSPQLRHMASHETACGPLHHSGLSIGDECDAACAQASMTMKSPPQRAL
                     AEQESRSSAEKSTGTYSMPLVHKDAWNSPDLPRVQSDRSTIQVQSAAQTSPCMDSMRD
                     RESRASPRQGGHEYSGTLSRNELDAESVASNRAPLDASDSLPHPREQQSTLTVTLHPH
                     DADRGWDQVQASHHRAHPAAVAQATMQTIDSWDAIELAQHSENADDTWLAEDATEARQ
                     TMASDAYRANEFDHEEMAPWEHQSTEAAETILHGYPTVARRSELPHVGHSREQGDHLP
                     VLSSLEPVRSRGASPHQRHADDPEQRYPFDSKDGELRAWTIATPLPTVQETEVAPRMS
                     LTDANVSVADTFIALRTSAAGGDTETRATTAPANLSQPRLYQSAIDFSGALPDNEPAD
                     PTPDVVSQHHQLQFEVSYLPQAKAPDRRSGADEAVAKQSFASTSPDEHSGASRSPRSP
                     ETCTDAPRSTDDPLYTSSNAATQLPLSWSSDGGAAAMKMHATCPQAETPPQPTSQRED
                     SSRSWTPSQHKTRASPSTSVHSPGYGRELPLATPEHDASAEAMHRLRLAETYSPELVT
                     DDPVHVDHRQQVQRRERSNADSDVDGTADDDGESTAEHPWGHEAPWASTNVAATATPG
                     TRQALWGTITEGAAFFSAPDAAQPQQMLQALAPSDTAANTDAQTCEEAFTTSMVAFAE
                     QPDTSTQGLRLDTAFETGVWAGPPLKHHSEFAAAPVMRPGADAHSADDRERLIDDANT
                     EDALAGRSTQASWEQHRSQASAVASLKASPASVSPGNAAAHSAVNDGARWDAREATRT
                     LHHVHTHDDDNDDKLVTAISSLQRTSTSPPASAANDAGASVFSGVSPFATNAMMASQA
                     ANWSPVGKPLCPTAAFSSLGYFALSAPRVLCSLPSANDAFSATPIPISIPGTAPWTND
                     SDRGSCSDHADPAEQQLNTDVHVYHTWSLVSELDGIDVDVTALVHWLPETDEPLELSQ
                     VLERFGDRLEATWERHENDDSASRLLCRLLCQVLPNLVHVSEMSHSQSVASFTSGSGE
                     RSLISSRANRASRKHSMLPLSPALCHMLQEHRVDAAAASVVVLGADEGVDASQSHVKQ
                     IERALLFGQYRTAIRLAQQANDWTLALLVSEAQAGLWPPDERSTATSGHLLHSIPDDD
                     VNDDDDDDDDEEEPAPQHWRVQTIRQLLLSGYARDSLLALLLAVMIADEDLIRSATRR
                     LVAPSGGAWPWQALLDCLWILSPWRQQQQQQQQQQQQQQSGSVVESGHQAALSRAFSI
                     VAETLTAADHDWDIDREMLCRMIAAESPWSPAFCDLLLKGIEPGVPATRLSSLTLTST
                     STTLHQHLNEASTSDLYQKATGTSLAACASGAARISMPAPCPVYRLIFWEVYRMLWSK
                     RFDPEAPSGADAVHRERSTRFTAWVHVSLAEALQDVGRCALAQRYQIPVIAGNESAEE
                     RTPIPGKHCIAPEAAATQTPGMQSWRRAKSTAEATAASFSPCREQSVRVSSSSSPSSS
                     ACGVASHGPASTLQLSPTALDAVHTWNGDLSLGHRGSIATGDGDLRCSPRAAEATTQR
                     LVVDATPASARLTSSVDEVVASPQRAVRADFQQLSIVSAGLHDDQQQEQQQERWKPCP
                     YPGSYHSAGASNSNCGEPDAEMQFSSSARDTQRVPVEADAETCSQSWASSPALSAPRP
                     PAAEHSSNAGYGGNENASFSENRSSTTHSGTSQRAQVLANAPAARATSTSPDITDTAA
                     ASSRSDTESRVLPASAMHPHQERVAVHEVPQRAACPAATDTKPPAASASAEAPQAKGL
                     SRLLPLRILGGLFARKQANLGLENKFYYDDKLGRWVCAADDVDAAGGGAVLAPPPSDA
                     ELAHKSAGCNETSAAATKEQVSGAVASESSTRTLPGALPPVAASCPGTTTMSMTTRNQ
                     VSRPRSIRQRYVDVLGAANDTSSACLPAPVPLLSTNELQERSADKSKAHRVPLVPPAA
                     TSANTATRDRTPS"
     gene            complement(<377793..>378998)
                     /locus_tag="CYME_CMC156C"
                     /db_xref="GeneID:16992382"
     mRNA            complement(<377793..>378998)
                     /locus_tag="CYME_CMC156C"
                     /product="similar to trefoil factor"
                     /transcript_id="XM_005535307.1"
                     /db_xref="GeneID:16992382"
     CDS             complement(377793..378998)
                     /locus_tag="CYME_CMC156C"
                     /codon_start=1
                     /product="similar to trefoil factor"
                     /protein_id="XP_005535364.1"
                     /db_xref="GeneID:16992382"
                     /translation="MQRSRLSFILLVTLLAAAVAALFAGSGTVTTVVALPTLARTYGE
                     QLQPQQQQQVIIQQQPQQQQQQQQIFTQQQQYQNQNNQQQQCDTVEICGVNLNQDQCL
                     QYGCCWNGYTCLLPTPAPSCDVAPQNRSACGWPGITPQECTSYGCCWLPPQAGEYAPF
                     CYYKPGQEPVYQPQYPQPNCNVTIQLPCAALGNRQQVTESECVAHGCCFDSNYYWSSQ
                     LQQQHQNNQNGICYEPLGTCYVDANERQNCGFPGISSHECFQRGCCFEPIYPYQGADS
                     QALSQIPWCYYKQPMLSCPSANQTVCGQECCDPTQTCVLSIRQAQLQVQQNKNKQWQS
                     WEATPLPTTLPSNTNCACRAGYQNCGKLSTPLWYGFERLLCCPPEATCGTDTCICPEG
                     TTFTDGICA"
     gene            <380327..>383077
                     /locus_tag="CYME_CMC157C"
                     /db_xref="GeneID:16992480"
     mRNA            <380327..>383077
                     /locus_tag="CYME_CMC157C"
                     /product="kinesin-related protein, BimC subfamily"
                     /transcript_id="XM_005535308.1"
                     /db_xref="GeneID:16992480"
     CDS             380327..383077
                     /locus_tag="CYME_CMC157C"
                     /codon_start=1
                     /product="kinesin-related protein, BimC subfamily"
                     /protein_id="XP_005535365.1"
                     /db_xref="GeneID:16992480"
                     /translation="MPEQSQRIRTGPRSAAVPTTGHARLAAVQRVSAATGERRERLKI
                     EKNVTEREPAQRIAPCVEQRRARHQPWSGISQTRQEPSRPEPVRSSASAAGTHATASS
                     SGVNTPTNSAAERVQVAVRCRPLSVELLQTGGDAPVQAVRVNELLREVRVLQPTYLAS
                     AHLARSTNASALTAAAPGVPLPVSEADFDQVPPYAMRSFTFDKVFPMNAGQEHVYQSL
                     VQPIVSDSILGYNCTIFAYGQTGTGKTYTMEGVLPGHTAEPGASGCSLPPTAGIILRA
                     ANQIFATLKDRSNDIEYTVRCSHLELYNEQLSDLLAVEGAAHPMRILQDPSKGGVFVS
                     GLEEIVVRNEQEIMALLEKSSQRRRTAETSLNRYSSRSHAIFTITIHVREMTPDGEDL
                     LRVGKLNLVDLAGSENIGRSGATHERAREAGSINQSLLTLGRVINALIEGQVHIPYRD
                     SKLTRLLQESLGGRNKTAIVATISPAAADLEETLNTLDYAFRAKNIRNRPTLNQMLMK
                     KTLIREYAEEIARLRLELEATRAKNGIFVPPELYAEMDEARRTHRDRIAALEQRIQDQ
                     AQERDVLERMLDESRDQLAQSQERQQVLEGELRARDAAMHQLQAHLHRLDAQQKESRF
                     LLREQKRVEEQLASEALCLMNNLTQSLVDLDTLYAKLEERDRSHRAFYGHVRELETVC
                     ADTMHQIRSEIHQLEERIETHDHLIRDRFSQCLSSSMTSVPVCKADDAYEPGADKENM
                     SVFASEPHLQPSTDALRDTPKRRHWSYPRKLTRSAPEHELLAAYRGLDVHPARSDGAV
                     ATIEAATTTLPTPDAGSDQGEAPTLPSDATFTHDRTPCDPSIDAIKTSTNTTATTACE
                     QAPQRAETLDTIQTHDPSSRRQHRQTWPGTVPDASRVHRQPPTSASVVHRDRCSTPAH
                     VT"
     gene            complement(<383432..>384538)
                     /locus_tag="CYME_CMC158C"
                     /db_xref="GeneID:16992481"
     mRNA            complement(<383432..>384538)
                     /locus_tag="CYME_CMC158C"
                     /product="unknown WD-repeat protein WDS"
                     /transcript_id="XM_005535309.1"
                     /db_xref="GeneID:16992481"
     CDS             complement(383432..384538)
                     /locus_tag="CYME_CMC158C"
                     /codon_start=1
                     /product="unknown WD-repeat protein WDS"
                     /protein_id="XP_005535366.1"
                     /db_xref="GeneID:16992481"
                     /translation="MSSGVERGPECCEGTCAPVHEFAGSARKEQETSPDLQFVLQYTL
                     EGHRKAISSVKFSPDGRLLASSSADKTVRLWSVADGRLVGVLEGHAQGISDVAWAGAA
                     SAAAAAGSGASRSASLSRWLASASDDRTLRLWDVERGVAVHRFEGHSNYVFCCNFNPQ
                     GNVLASGSFDETICFWDVRMRRCLRTLPAHSEPVSAVHFNRDGTLLVSSSYDGLCRIW
                     DVPDGRCLYTIVGEESLPVSFVKFTPNGGYILANTLDSTIRLWSYRDGQGRVLKTLRG
                     HCNARYCVFSTFVVTHPEHKYVLSGSEDGFVYLWNLHTRKMVQRLEAHTDVVLAVDAH
                     PTDHVIASGALERDRSVKIWSAASADGRLDTNAA"
     gene            <386659..>387612
                     /locus_tag="CYME_CMC159C"
                     /db_xref="GeneID:16992482"
     mRNA            <386659..>387612
                     /locus_tag="CYME_CMC159C"
                     /product="probable mitochrondrial 2-oxoglutarate/malate
                     carrier protein"
                     /transcript_id="XM_005535310.1"
                     /db_xref="GeneID:16992482"
     CDS             386659..387612
                     /locus_tag="CYME_CMC159C"
                     /codon_start=1
                     /product="probable mitochrondrial 2-oxoglutarate/malate
                     carrier protein"
                     /protein_id="XP_005535367.1"
                     /db_xref="GeneID:16992482"
                     /translation="MSAQEAVQRPLPNYLQFVFGGLAGMGATLLVQPFDVVKTRMQLT
                     QSVQGAQAPGPLYVLRAIVVQEGASKLYAGLSAGLFRQITYTTTRLGVYGVLLEELTR
                     IRKAQQASSAHDGESQRQGVALPFSWKAGAGLTAGTIGALVGTPAEVALIRMMADGRL
                     PPERRRNYRSVFDALIRIVREEGIMTLWRGALPTVGRAALLNMAQLGTYSQAKEMILS
                     TGLVGDHLGTHVLASTCSGFAATCISLPLDNAKTKLQHMRDREYAGMLDALLKTSRSE
                     GIPALWRGFMPYFLRLTPHTIGAFVLLEQLKKLYFTWRQVL"
     gene            complement(<388449..>389354)
                     /locus_tag="CYME_CMC160C"
                     /db_xref="GeneID:16992483"
     mRNA            complement(<388449..>389354)
                     /locus_tag="CYME_CMC160C"
                     /product="mitochondrial peptide chain release factor RF-2"
                     /transcript_id="XM_005535311.1"
                     /db_xref="GeneID:16992483"
     CDS             complement(388449..389354)
                     /locus_tag="CYME_CMC160C"
                     /codon_start=1
                     /product="mitochondrial peptide chain release factor RF-2"
                     /protein_id="XP_005535368.1"
                     /db_xref="GeneID:16992483"
                     /translation="MALLHGASTRSESADEPSDLHRSCLVEVRAGAGGTEAMDWCSML
                     VRMYQRWAESAAASRSLRFQEVKLTDSSPGEVAGLRYAALFVRSGTDGLAWATAWLRG
                     EAGIHRLVRHSPFDASQRRHTSFASVSIIPLLDEEEVASEALQALNIHPDDLLIETMR
                     SSGAGGQHVNKTDSAVRITHRPSGIVVTCRSERSQHQNKARALYVLRSKLRERYLQER
                     RQRQASMTHHGGSAGFGSADRLVRSYILSPFTLVKDLRTGLTCSDAESVLDGGDALHE
                     MLRAALALDQTDSAGNGAPAHATKR"
     misc_feature    391366..394539
                     /note="possible transcribed region"
     gene            complement(<392588..>393811)
                     /locus_tag="CYME_CMC162C"
                     /db_xref="GeneID:16992485"
     mRNA            complement(<392588..>393811)
                     /locus_tag="CYME_CMC162C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535312.1"
                     /db_xref="GeneID:16992485"
     CDS             complement(392588..393811)
                     /locus_tag="CYME_CMC162C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535369.1"
                     /db_xref="GeneID:16992485"
                     /translation="MRRAPALSRASLRSAKESRFRRTTERRHLTQFIGSLWGVIVWFL
                     LVVQVLCWYDGTFPRLRMGDWGARTTASGSDAPWLDNQSGALYARCVPRTTLLTTNRS
                     SRPNVLLVVPYPPKQAPQVLETLRQWLRQASACAETAYASDLLLFCSRAETNCLQREQ
                     VQLVLDSVRNETFRSEQVFSRVLLRFANLSDYADAYYFSRWRRRHISRGTANLFYALF
                     DLYHVPGSTSRHEEHRIHPMGLALQYDYFVWLEPDVYALRPCFLPMLHRSVAKRHPFW
                     VMGSAPLYQRHRWCVTWPHDHHLNGNAVYRLGDPCFTHTVLRGMATRFPDEPFDSAMQ
                     RWRMATAHDSWWRVYAHLFVYTDWIQNYGSRAWCPELVSKTSPFTAMVHGGQPYRNEN
                     QDACVAAVTSILRRS"
     gene            <394074..>395507
                     /locus_tag="CYME_CMC163C"
                     /db_xref="GeneID:16992486"
     mRNA            <394074..>395507
                     /locus_tag="CYME_CMC163C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535313.1"
                     /db_xref="GeneID:16992486"
     CDS             394074..395507
                     /locus_tag="CYME_CMC163C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535370.1"
                     /db_xref="GeneID:16992486"
                     /translation="MFVEPEFLCSGRIWSWDSATASVGRPRSCCRWLTSRKQSQFEGV
                     GCQPCRTRSRRVFHDSRCCCCCCWAVGLRPGYRKWSDPDRQHSARLERRFELVAVVDK
                     DAGSSERPVRWNLSGIPPPPPAARQWIAQPKPSSAESDYINRAPLFSKVLRTHCFALP
                     WSALVELRARAADDIDIDNAARLAATASTSVHATLYQGSVPTEPYPRTFTRSGLVLEA
                     GNAGTLKRRRNAPQVPALVTAERQLPLGVLIDPNADDPAIAVFIAARQPRFGKEQNRQ
                     KPAVIAVAAVAASPLGIANGVLDATVDALVDIVRRLDPSLPSTSVHERAIRRSMVAAI
                     GPNPATADYGFVTVRSDVLNAIFLPWEDRPHVGLSRRCYFVHDIQNDVHSVICRSRRT
                     RLSFTFLAQRLTGRHRSLANPLPATSESHGIQFPLQEWYLRLAPLVYERLRCIGVGQV
                     ELTRVLLPRVPITSREDTRHFSYIVLE"
     misc_feature    396233..396689
                     /note="possible transcribed region"
     gene            complement(396681..396803)
                     /locus_tag="CYME_CMC164R"
                     /db_xref="GeneID:16992520"
     tRNA            complement(join(396681..396720,396740..396803))
                     /locus_tag="CYME_CMC164R"
                     /product="tRNA-Met"
                     /db_xref="GeneID:16992520"
     gene            complement(<398751..>399875)
                     /locus_tag="CYME_CMC165C"
                     /db_xref="GeneID:16992488"
     mRNA            complement(<398751..>399875)
                     /locus_tag="CYME_CMC165C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535314.1"
                     /db_xref="GeneID:16992488"
     CDS             complement(398751..399875)
                     /locus_tag="CYME_CMC165C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535371.1"
                     /db_xref="GeneID:16992488"
                     /translation="MTWRKPCIASGALTFLIYALIVIYRATSVLNGRSSGVQRADLPA
                     VDDSCVRSVSRALRRGSSLRNAKTLTEIWDRTLPVTSKDTRALKESLGFWCESDALWA
                     QRRIRSQRQRKRQTVTLEPNPSVFFYNNWEPDIGCTLEERIGNNGDGGKWVCDPPAIL
                     NRGRLFREQLRLPYRCIVYSFGSNDDFSFETKLHERLPDCDFFVFDPTSSPPSAMHSE
                     SFLERVRFFRRPLGPAESNNSLAEIMSGLGHLELPNVVEVLKIDIEGGEFTSFLGAFR
                     AADKLLRQGRSQRELSSEEQYALRTWHALRHVNQVLIEVHAGFASIPELDEFFRGFMH
                     AGFAIFHKEPNLYWCCGSCEEYSFIRMHDSFFEFKDTIHP"
     misc_feature    complement(399879..402816)
                     /note="repetitive element"
     misc_feature    complement(404026..407036)
                     /note="pseudo-gene of GTP-binding protein of Nug1 family"
     gene            <407686..>410295
                     /locus_tag="CYME_CMC168C"
                     /db_xref="GeneID:16992490"
     mRNA            <407686..>410295
                     /locus_tag="CYME_CMC168C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535315.1"
                     /db_xref="GeneID:16992490"
     CDS             407686..410295
                     /locus_tag="CYME_CMC168C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535372.1"
                     /db_xref="GeneID:16992490"
                     /translation="MPCDAQAGQRLVRALSRAETWDTRRALLQTLVSELRDTESVTFF
                     LQETKLRSVLGQLIERALRAAQPHIVDLLDLTMQVIKCLVKSMQREDVVDFLEESKSL
                     VHGLKALRKLGRSKGVSAENFVADASEKAWGERLATLREQAANIIAEMEQVAGREKPS
                     TPSAPEETPEAGESRSLPVAVHAPVQTTDSSHPGTTEASIHANADASNASAKAAASQD
                     DTSEPAQSTVGEHETPLAVGALSSFASADASMKTGRKRPRPRPERDTALPAFTSSSDE
                     ASQSVSARATESVGTQPTVDVSDADASLLPQQASAHVTAARAERMHHSDALETTSPPG
                     ATIPERCANEATHHVPTPTVRDAGHTGDIAEKEASSAESTSFVAPEEAAATCAITNRS
                     AKRAKMEAPRPALRIRTSADASSTKLARKPASKRVHFAPEPVLVQVYAFEYIPDERTH
                     APVNLAGIVSDTDEPALDGESGATSATKERSTHAPGNGFSEVVEEGRLMQKKRQHRQK
                     VLAEMREDATFYPPPHVESSCPLGAAGECEQLSDVLANGSTVGCVPRNADSHQSGTIG
                     VVSPGSLSSGVPDEPMPPSPPRERSLDRQTPPPSLRVIPEYRVEHPAPTSFSYTPAGA
                     LAPAGTPEATVSAPAAATTANLLTSFHGTRGPSTLDPTRLQTKPSDRIQPPHLETSLW
                     SAIPPNTSGTPVSATSQGQHTDLLQRNQIDEAILQHFLLVKDEETRLQLLCDENVLRV
                     VQKYAEEKQREAALQHAHGYRHANAAPGNQWSGYPAPAPAPAPAPLAAAFPALTPQQA
                     PFPVLNGMPSDPIGYHGFVSPALRRETASSAAYAQATGVNNDSAPICKYHLRGYCRRG
                     KWCRFRHISPDKP"
     gene            complement(<414333..>416096)
                     /locus_tag="CYME_CMC169C"
                     /db_xref="GeneID:16992491"
     mRNA            complement(<414333..>416096)
                     /locus_tag="CYME_CMC169C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535316.1"
                     /db_xref="GeneID:16992491"
     CDS             complement(414333..416096)
                     /locus_tag="CYME_CMC169C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535373.1"
                     /db_xref="GeneID:16992491"
                     /translation="MAPRRQARNRKETDQRRRRHSDKTETMTPPNDTNGEETPLDCSS
                     DSWNASYSSNASASSLRGTGTSENMLVSILDRGCVLTSESEALDECIDSLTDKRRWLR
                     EAALHRARQLTDLGLRTDLWSETRCEQLVEQALRGPLRRGSLWEKREVCRLIGTSVLT
                     LVASTTDTETVEALLQRTRFEQVLLEASERSAPRPDPEWVQWQVCVIETVSLLRFLAS
                     SDSVALVALMQRLESWFGQDTSPSDLSTGETKQRLGESSAFDQVVAAAIRGWSLLASA
                     CPSEVIRTQLKARPLRQWLELHAVQGDWKSTSTPKETCLAATEAIALLLEHSQGTDSG
                     VFGSNIPAHHMDNDHTDDDVDAVAAFAEADREARLHVDAAEGSFQAGESSASSECRDS
                     PPCSSSSSSSSSSSSSSSSSSSTITSAGIDKLDRALERVAFTVGAQRYRLGKRNRSLL
                     RLVERAATQRSGIETLSLRRGRAQERLQARTWAQRRQLDALRRACGRALTVQLEGNPF
                     LRDLFGLAFMGSAQSTSRDASPLVANSNELALSSGTSVSRKSRRPGMRSEQLRRQARQ
                     EARRLKQQRQLQLQNDQDSIL"
     gene            416299..417980
                     /locus_tag="CYME_CMC170T"
                     /db_xref="GeneID:16992492"
     misc_RNA        416299..417980
                     /locus_tag="CYME_CMC170T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461220.1"
                     /db_xref="GeneID:16992492"
     gene            complement(<417140..>423136)
                     /locus_tag="CYME_CMC171C"
                     /db_xref="GeneID:16992493"
     mRNA            complement(<417140..>423136)
                     /locus_tag="CYME_CMC171C"
                     /product="similar to ATP-dependent RNA helicase A"
                     /transcript_id="XM_005535317.1"
                     /db_xref="GeneID:16992493"
     CDS             complement(417140..423136)
                     /locus_tag="CYME_CMC171C"
                     /codon_start=1
                     /product="similar to ATP-dependent RNA helicase A"
                     /protein_id="XP_005535374.1"
                     /db_xref="GeneID:16992493"
                     /translation="MGGSGRHRRRTRVGPGGAVVSSLSTRAGGVVRSTGDVASSAGPA
                     AGLGAGLTTTETNLDPVQAYKERKAAARRLRAQRLDADSTSTEMGASVCRTQSSAAFS
                     AASLGQGRAQGSPASTNEEQTITKRTWVGATPQLLLQEWMQRAGLRGQPRLAKQPSSG
                     WLIRLGKGHHSQQQQQQQQQQRGSYHQVASVYSWNGEALSPADAHMVDTDEKAAKLAA
                     LWVLASVDRQRNHALRLEPSLRPFWARFVAAHEAKEKQIAAQAAEAANARARARAEAK
                     KAYREQQLLVPLRLEDRTRAAVEEALVCLLELDASASLESMWMQASRALGAEQHWLWQ
                     QLRELGFDAEAAAEAAARCVVEPAGSGMRSAEQQRSQALDWLCLHLDEDELPPSFRPE
                     QATEVVAFRAEHAKQALEAANNRAKAVDPKASLDPSPACSTVRTPGATQKGAGIAKSN
                     SGAYSESERLRALEWLVNTMALMNRAQGERLLLANRDRVLDAAHDWIRELLIFTPTES
                     IAFLLERVRMPSKIRTGRLQHRELSGDKNSLRHSEGTLYNGNRDSGDCMFRYASSANA
                     TATEDMLGDPLSEETELFEETEHVLDPRSRSLADTQSSVEKEQRLDTVDFRRSCWALE
                     RQELEARFGRAFRWTREVLPSSSLPQPLSSIDDHVDAEGFEIDLQMDLSRTAPKLDTP
                     SARTGAGAPTTPTATRWGLSRLCGHLYGYPETLPILWFEDSTTTTTTLETVRATRRPP
                     RRVRRAWLRSLHGAVLLAMDRSRQAPECVPARGAVLAPTIYDWLTEWQSKQGATPTLP
                     SCRAFDPDSRPTHLRPGPAGASRSLTARKSSSRKAGPSSSFSSAGIEPDPALDRELQQ
                     RERERLERIERRHSPPALTRLPARQYQQAFLSLLAAGTNPVLIQAETGSGKTTQCPAM
                     ILENALLQGRASQTRILVTQPRRIAAITVAKRVADERGERLTADSETPQRQRTRTDDN
                     AHEAGLVGYQVRLQGRISPHTRLAFCTTGIVLRMLQQDPSLTNISHLILDEVHERSAE
                     MDMLLCCVRRLLASRSDLQVVFMSATANAASLERYLGAAAAAAAAAGDASTPRTLRVL
                     QIPGRTFPVMIRWLEDLPSWRNGSAHGTASVERSATTIAHPILHVCDDAQVVSLCEQD
                     EHHELDTGAKDAASWQAFQLAKRCAHQHPTDDADHRAGRAGAAHTKPLSMKQLAATDA
                     RSLEQIRCLEATAASAQRTPEMDLALDAGANTETKLSPMLDALQLEETANAASNNAAD
                     VFGRHPERSAERQASGSTAAGTWGENVDPADEESCAASDAQQWTPLGFSSVKGASLAL
                     VEFVVRRLDEELSAQEARCGSGKRGAILVFLPGVVETEQLCRRLHRLGGRSSAHRPDA
                     ELSSTFQARGVASFWALPLHANQTAVEQERVFAEAPDPLQQRKVICATNVAESSITVP
                     DVVAVIDTCRVRSLQMQPATRGALQLRESWCSKASAAQRAGRAGRVTAGICWRLIPRD
                     PFWLKHLPEDTEPELVRTPLERWILWLLGWSTAERGARHSLEQVVQLLQREMMTAPPQ
                     AHTEAAIVRLWQMGALQLSSGDMLAASGLAWTANGIKVAAQKTRRDAVVVHDEASGDV
                     PAGASSATQHLPRTLNGETGPSAELWSLSSLSSSLKDLECTPLGCILSALPLDPTVGK
                     LLLYGAIFGCLSWSLTAAAVLIEGSPFARITGGGSSLIQRHRLEAYSSFDSDIASAVY
                     VWQQWQTLCAQAASAGKGALAAFLAQNALSERVMEQIQQTRLSLERTLDDIGLEPGPI
                     DWHENEQHQRIHRAVLYAALVPQLLRATPVSGKQQKDTSSAKHGNGATPNSTTWQLFD
                     ETNTPVWLHPSSLVRLERSEEQRQQLSSHAVRWFTYAQRVTTSRAFVQQVSAVPVFAV
                     LLFSGRDIRIEHEAQRVIVDGWIRFRCAARTAVLLRSFRQQTEKVLSAYFASLMGPGR
                     DTSTSTSTSTSTSTSTTADPHWPVRCRTLRSILKRLVAYD"
     gene            <423550..>424347
                     /locus_tag="CYME_CMC194C"
                     /db_xref="GeneID:16992494"
     mRNA            <423550..>424347
                     /locus_tag="CYME_CMC194C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535318.1"
                     /db_xref="GeneID:16992494"
     CDS             423550..424347
                     /locus_tag="CYME_CMC194C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535375.1"
                     /db_xref="GeneID:16992494"
                     /translation="MFSAQGAVELGRLDRESRRDLSAHRCPPRVPGTLLKASKRRRAA
                     QLTLERLPCIVLRTSEEENGQGAGPVRLEQGATGENARPGHLPAMPAQKRAVSPQSRR
                     SNGEQPAPRTDKHPRASMLDYRTRLDLRQFQLRFQIFVEDIVAFPLTWYNMLRNRKSE
                     FAKLPRNPTTAPPELDCRGCHGLGFETCRYCEGVGHRYFWGSSRRQEYDRMRRAGEAR
                     HWRTIVYGLFHIERREVRCRHCRGFGWVSCRVCHGHQLPKEWETMYR"
     gene            complement(<426694..>428202)
                     /locus_tag="CYME_CMC172C"
                     /db_xref="GeneID:16992514"
     mRNA            complement(<426694..>428202)
                     /locus_tag="CYME_CMC172C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535319.1"
                     /db_xref="GeneID:16992514"
     CDS             complement(426694..428202)
                     /locus_tag="CYME_CMC172C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535376.1"
                     /db_xref="GeneID:16992514"
                     /translation="MSPGAFRASRQSDGEKVHGADWYRRFKQLGLNEEQDVLKPNSLE
                     HSEERTPVSAVAATAAATAEETAPEPEAESVASALAVPCTAVVQSDKAARCPQPGAAR
                     ENATSQGPGTPLTVEDVLDEERTEHRKELRQWYDVLFEGPYELKYPAPPTGPVRAPGR
                     THPDMARSNPHTRHLLADLDSDLGIGGSLRGTYYQASRQRRKQLYQGSSADSEENSVR
                     GGHAGYGGRAQAAGAVGTSSPAYSEHSHAPSSRCSLAEENEEREGICISPTQGSVAGS
                     FRASLYPIRSEPSLFRREHSDPHQTSPLWHELDSVEQVASATTAADSAAAMSSTTASP
                     ASLNMSNLQRWLAARSMGSHEPIKHRPHWVFVYGTLKRGYPNHPLLHHAIFEGCYVTI
                     ERYPLIIGGPHFTPFLLNRTGVGKHVRGEVYRVDDEELAMLDVLENVGENYHRERTLV
                     RALADPNFILEVFVYLKCNYTEEMLHGEFLEEYTDTRYVPRFRRKVVTPNST"
     misc_feature    428404..429268
                     /note="possible transcribed region"
     gene            <430135..>431649
                     /locus_tag="CYME_CMC174C"
                     /db_xref="GeneID:16992496"
     mRNA            <430135..>431649
                     /locus_tag="CYME_CMC174C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535320.1"
                     /db_xref="GeneID:16992496"
     CDS             430135..431649
                     /locus_tag="CYME_CMC174C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535377.1"
                     /db_xref="GeneID:16992496"
                     /translation="MEQRRSDHRRWGPREHLRRLDWQFAALLNRHARWVHLLEEALHL
                     VAVLGAPGGNVELRAEAVSVLAGALEWYRRRRRTPLREAAALPATLNSLRWAETLVSM
                     LRVIEHTELLLEMLSQSDVPESLDGTDRWRHDADPSGATNDSAMDWMRIRQNHWFYSW
                     IGTRVRAANLGNALESAHARTHYSRGFRRSYNMVLVLETLKAVLRTAVPEQTNNLSST
                     RGAYDCAQNERAQIKKMLLDWERQGALQLRIVPRRGERSGRSFFTSIRPTTTTTTTVL
                     GDITPTEPPPLRRPSQATVADEQACAEQTCSKYANMDQRHPTAAASVPIEDIFMFVAD
                     RRGLVMAERLWAATERYLQSIHEQNAQRNRRSAAGAAPFVWVPGDDLRSKIATWIRVW
                     RPVIYLAFVPRVAPWSSWLISFMLDVISRRWLLQGGGDGSPAGDISHREGVRIPPPSP
                     LLLYLLREPVYSNVIVRCVLLPWMRRGRMHRFVGSLALGLTQAATKYYFLTAAS"
     gene            complement(430588..432769)
                     /locus_tag="CYME_CMC175T"
                     /db_xref="GeneID:16992497"
     misc_RNA        complement(430588..432769)
                     /locus_tag="CYME_CMC175T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461221.1"
                     /db_xref="GeneID:16992497"
     gene            complement(<434905..>436533)
                     /locus_tag="CYME_CMC176C"
                     /db_xref="GeneID:16992498"
     mRNA            complement(<434905..>436533)
                     /locus_tag="CYME_CMC176C"
                     /product="similar to HERC2"
                     /transcript_id="XM_005535321.1"
                     /db_xref="GeneID:16992498"
     CDS             complement(434905..436533)
                     /locus_tag="CYME_CMC176C"
                     /codon_start=1
                     /product="similar to HERC2"
                     /protein_id="XP_005535378.1"
                     /db_xref="GeneID:16992498"
                     /translation="MQLRYAFKLGRGFTGLHPFAGFQVIERCPSDLQRALSTALGFIA
                     PKLGARRFSVKAQDLGATEESHSKPKGVVWFWGNADDGRLGVPLSRTELDRDFGAGRR
                     CTRPEALDNLPSSIKRVALGAAHSIVLLENGDAYSFGLGSEGQLGLPSEALVPRAPLQ
                     SLLTAWLHQQQHQQQQVGFSRWPWRWMRWSRWTPLAVRWAPQQQPHLSDVAAGAAHSV
                     WVSSDGHVYTCGRGTHGQLGHVSTGRSARGIASVPKTIERPLLVEALARSNVHAVQAV
                     CGDQFTLIRAADGSVYGSGSIEYGQLGLGHPATVDQTLSGPGGQRFVGTFRRLRALHG
                     EPVAKLFAGFNAAGAILKKSGELVVWGKFSDRIFWEPTPLPSIRGRVQKVAFGFNHVL
                     VLVELAPDGLRRRMVYSWGSNENGCLGLGYGTQASHAVQSPQPIEAFMDAQSDASIID
                     IAAGYRTSYAIRVGIQNSHVDLYSWGSGLCGALGLGDRMVPDAGAGTIDFWEPVHVFR
                     ASPADGAEFANSTFHIVSGFQHAALYSTRVSEVA"
     gene            <437066..>438049
                     /locus_tag="CYME_CMC177C"
                     /db_xref="GeneID:16992499"
     mRNA            <437066..>438049
                     /locus_tag="CYME_CMC177C"
                     /product="similar to calcium binding mitochondrial carrier
                     ARALAR1"
                     /transcript_id="XM_005535322.1"
                     /db_xref="GeneID:16992499"
     CDS             437066..438049
                     /locus_tag="CYME_CMC177C"
                     /codon_start=1
                     /product="similar to calcium binding mitochondrial carrier
                     ARALAR1"
                     /protein_id="XP_005535379.1"
                     /db_xref="GeneID:16992499"
                     /translation="MLEFVNRDSGRGINLLVDTLAGGLAGALADLLMHPVDTIKARLQ
                     VQQSSRVKRSGESRWSSRDELAHGRPYRGMLDCAVRIVREQGVRGGLYAGLSAVLLGS
                     VPSHAITFASYKYLKSWTPGGGYGADGIPNWWSDVVSASAADLLALSTYVPAEVVAKR
                     LQVAGMGPARDYSSPFHALRVIARTEGIRKGLYAGATATMFRDVPFTALQFAIFEQMK
                     SLLGDFAQTSGGMLLCGLTAGAGAGAATTPLDVVKTRLQTQHIGADRAYRGVLHCLRT
                     ILAEEGPAALFKGVFPRIVWVAPASAVTLAAYEQLIRWIQPNRQTLTPASE"
     gene            <440175..>441602
                     /locus_tag="CYME_CMC178C"
                     /db_xref="GeneID:16992500"
     mRNA            <440175..>441602
                     /locus_tag="CYME_CMC178C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535323.1"
                     /db_xref="GeneID:16992500"
     CDS             440175..441602
                     /locus_tag="CYME_CMC178C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535380.1"
                     /db_xref="GeneID:16992500"
                     /translation="MEDDGTRQSLLKLGASQRKPSSRTACVASGNASEEFAGSRRRAK
                     VRAKHLIALTFCLLFVGVTAWCELRFALLQYVINGGYPEDTAPVTDKNPRYHIQMSLQ
                     RQLGNFCTFLDLYYGRCDGDYDCYAKLLPRRRRVWYRGRLRPVFERPVTVSPLPRGSR
                     LDPAYCLTSNSLMPLSAEQIERVRLARNCPVRPRYLWFVYIVRDEARLLVQNILHHLG
                     QGVEHFLVYDNESSDNLSNALEPFQKLGLVSLYNISGQGVQLRAYDDALSRARRAGVS
                     WLGAIDADEFFISTRAPCIPSVLEKLQREKNATMAALAVNWRFPGRYPKLLNATTFPA
                     ESAVFSIGSPNKHVKSIVYAPRTRFFRSPHHARYDPGMKALSVSGEVVEGPFQEPPSA
                     ENTALFHFHSKNVNEWIQKRIRGRADVSWAFMKTQPEIFFNDDLVSFFTEWLGYTKAT
                     GPKGHPLALALRNHTIALKRAIWGW"
     misc_feature    complement(441668..442189)
                     /note="possible transcribed region"
     gene            <442525..>444111
                     /locus_tag="CYME_CMC180C"
                     /db_xref="GeneID:16992503"
     mRNA            <442525..>444111
                     /locus_tag="CYME_CMC180C"
                     /product="probable protein disulfide-isomerase"
                     /transcript_id="XM_005535324.1"
                     /db_xref="GeneID:16992503"
     CDS             442525..444111
                     /locus_tag="CYME_CMC180C"
                     /codon_start=1
                     /product="probable protein disulfide-isomerase"
                     /protein_id="XP_005535381.1"
                     /db_xref="GeneID:16992503"
                     /translation="MRLSRISRAVAFCLLPLLFAAAVLAAKSGASASVSLNEKTFDKQ
                     INAHRIALVKFIAPWCGHCKRMKEDWDAAAVDLSGQKDLLVAEVDATVETKLRDRFEI
                     RGFPTIKLFVNGKPVADYNGERTKDALVNFVRRQMTPPVVVVNSSAQVSALNVDKERA
                     RVVAYLPETLSATERAARLTQLEQAARTLRELFPDLMFYQTSDVEAAHALGADAHPAL
                     AKDTAAIVVARPHTESESVQERVHIKAWDAPGAAGTRQDKTEDTTEPLQQFIRLHAVP
                     LVGEISQATAELYQDIGNPLFIMFDDAPHKPEQKGVSIMKQMAKKYRSRISFVLADAE
                     KLARFREYIGCTDGRRFAIHVLGEDSNFIYDGATDEASIEKFISDYLDGKLQPTLRSE
                     EPPAENTGPVQVVVGKTWDQIVMDPEKDVFVEQYAPWCGHCRNLEPAYEELARKLAPV
                     KTVVIAKMDATKNDAPGEYKARGFPTLLFFPAGSTKKSIRYEGDRSVADMLSFIQKHA
                     THKFTLPSSADSIETEKDEL"
     gene            complement(<448132..>450141)
                     /locus_tag="CYME_CMC181C"
                     /db_xref="GeneID:16992504"
     mRNA            complement(<448132..>450141)
                     /locus_tag="CYME_CMC181C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535325.1"
                     /db_xref="GeneID:16992504"
     CDS             complement(448132..450141)
                     /locus_tag="CYME_CMC181C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535382.1"
                     /db_xref="GeneID:16992504"
                     /translation="MVESDASDGSVHSVEQSCSPGRAVSLESSLRSIESLRQQGNTFL
                     KRGASGKAVRCYTRALDSIERLRSTVHGADTSKLEETEALLLSNRAAALYNLLRFQEA
                     LDDANRCVALRPQWAKAHRRRGQSLLHLGNLEAAADALQTAQQLAQEQWKKELLRDGC
                     DADAIIAAYEKLENNASALANSKPPVPESLPPKPPALQEIETVAVFAALLCDLQAAMF
                     VLPPEPALGLLRNCPVFTITDELGQPFFLTDEDGEQVCSFYFDVDDVKETLEWIRSED
                     EQLGMRAQIVSVDLPRALRLVADTQRERFERTLRRGLKDGAAAGISACYRSTHTFQFR
                     PSLEAVKTAVHLWRAQEKALRENPESDDHTGNNELDEITVENFNGIPIFQAKGLTVLQ
                     NYRQRVPLFFDKNDLDFAWRELRLTAEEAMQSGRQIEHPDVEFNVGVPVPPDEVPEEC
                     EVDVGTLEDVLHRMAQAANEGSDEFSVILFVPSRRSTEYLGLPYPLDELHKTDTDAED
                     SQLSSTDAEENELQSSFAALGAPGSTRTEPEACAPKERSTEASSSLTPAQRKLLLQRL
                     ATQRIAKSTLRMRNRTTGTRAAASGASKTSSTMNAANTSAAAAAAAAAPASDGQSAST
                     TLASEPLTAREIVLRGGDRETVRAYLEARFAQRRKQHQESNSASQ"
     gene            complement(<452701..>463152)
                     /locus_tag="CYME_CMC182C"
                     /db_xref="GeneID:16992505"
     mRNA            complement(<452701..>463152)
                     /locus_tag="CYME_CMC182C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535326.1"
                     /db_xref="GeneID:16992505"
     CDS             complement(452701..463152)
                     /locus_tag="CYME_CMC182C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535383.1"
                     /db_xref="GeneID:16992505"
                     /translation="MLEEALYRFLASKVGTFIRGGLDREQVLIALGQRGYFEVHDLEL
                     ETGAVERYWRQDLGIKELQLQRAGLGTLSIQARWNGIISISIADVYLELCWYPGEAPS
                     NNADSFQTTRAELLRLDDEEQRQSLESWARTLATREQQLSQETLPASSKHNGASTGGA
                     RDGGWLQTFAGRATAFLLRRLQLQIERVHIHVDFIAVEPETNLLEGRRSQGTRKSSCG
                     LMLRQLSLIDSNAAASDKSTDPDYRHEWRPHLDHPTQNEAATSPRMRLILDRQLRVHG
                     LACYLTPMRSQHRSQSTPADAAFTALAGESLSEHYERFAKIMEPFLLCRPSYGYVGLR
                     IERPYPSTLATDTEAPHDSSGQSTSDSTTRVSLCLGVERWCLQLQQSQVETVTALKSY
                     ATWLGWRRRSDLLVLMNAPEPYLWMFGNRYRSRYLNWMPPPEERQSAELPRDIQALEA
                     TEQQHPSRARNRWKFALLCVRAFVSSLYRPFVLEDLGAWHRRKERYISLYTRVKLETD
                     DRTQASTGTREALALSLANDPADLEEAVAALEQQLSIDEIRYFRSLAIQRYHRALERD
                     PSRRAPLQPNAERPQYTPGANTKRSIVDQGRAVSAVVGSAEDASGTAETARTGATAST
                     GWLGWISTTLGWSSAPPATKDSASGVDVTSGIPTPTARSTAAPAAREERHTAVERIWP
                     ATTDTLCQPSEHQPQADARSARLDSEQREESKIVVEPASLAQELGERFQGFVQEHVDE
                     QVTDLESTLQQIQWKPDAAGLRIELRIDDTQMSLQLSDRRPFADIQLRHLHLLLERTP
                     NRTCISLQTGDVVVQAREHLHDDLYPVVFVDASTDASSGALLRLAYEHQHPIRNTSWS
                     GDATALTAPARSHVETRHRMSVRSRPLVLLLSPALVRHVLAFGRRQNIPWRVWMQEAK
                     AQFAAYRTSIAAALPDSETLLEAASTLDLDIMVSAPRIYVVANLAKGLGLIRERASPT
                     SSEATAPVTSPRHRWIHVIERLRRGTRLDAFAVQVQLGRLSLRSGTCCQLRDPLRLFS
                     DLDRVQQRLALKHRSGGCAAASSTGTSSRAMPENLAASHQPPLLYDIAVQQLSMSLEL
                     DADAAALFGCASVPILLPCGGSAHLALAYAAPAGSVWGSAAATAEASSSYSTHFSSST
                     TASVRLGCLIEISDIELHLTAALWQYAACWQRWWSLHQAARRVGRGAVAVSPKVSTLS
                     TGAEMPTRSRASQRDEKVPGRSSRKPICPGNKSPAAGTTDATAATAAADAADDAADAA
                     ADAAADDAADDAAAATSTRTWQETSPADAPRSVSWTKTETSLLLEMHWRGAHTKVVLC
                     SPTDPPAQLVLASAGLDAALGLAYAGTAPIQWRLSFAADAPEAFVRQRIADHKPLVLL
                     SPCSVGVRIHGHYTAVAASRGAPLLSVQVELQTSAFDAIFCRQDMDLWRSWLHRWSTR
                     LNAPAYPELGDVLCDEAGAGTGSASAPKGHREATAVTSTAAAPGHTPASHTLVPDTNA
                     AEGTGTGSFSAMPAGSGAFRLRSSAQAGVSSVPLLWDALAAVLGGALGAPAPSALSHR
                     RRSGTQRHLSRAVPGQQQQQQQQRSSFGNQRPVFSPRKCPAPGMSPQPGTLITLWDSA
                     TQLPCVLQADASIPIYVLALASTDAPPYSAASTAYSTFLVKRTDPDDETLFSLLAWCP
                     DDSEGPSGVLRPVSVLPYPATEASALQRQANPIPAGVPGSSAEPPGRRRSTSSLRRAG
                     TSVESARASAGDSTPRIGCLGRFSGHPDNTAPPTSMSDAGVSVGEPIIWRACFVSPDG
                     FCLMNAHTGKFLSWNLQGQAIETSLPETVLLLGAPWQANASARKAEMTPETAPAAFSQ
                     TGMETAVSLQVRVTSAGVLVRLTDSPLTGNGNGNGNGNGSSSGGVLPLVALTMSQLAL
                     VYQVTDTYQELQTQCTFAVDAYDGGQDRYEPRLHPFRLQLRLHEHRPSGLLRIWLSPL
                     HREPVRIQGSEQDALELALLWEYLTGRRAHLPTVYQRAYRFSNETDADLEIIIPSNNG
                     ALMPASGNQKSGDKAHGPDAVHQMPSAPAAGKKSAPERPATSTTPEEHPARLGASGFC
                     VAAGTVHAVLPVQSSWAPNALRRIQSRAQGSTQVTSSSASMKTLQLGVRALSIEGDTP
                     TWFSWTRAGDALVASEASATETSARSLIGNRPSVAAALPGTRSAAAVTSTASSSTSSS
                     KSGDARTVAQLSATSAHPLDAQQCTTVPPCSAQLLWERLHWRVTRCRTGWHFCLQAPI
                     TVHNACAHTTLRLRCLGQTSSRMPRTTTTTRSSSSSSGSSVGGRGSSGRDLSLVLETF
                     HRLPPQKSIRIGALADIRALAVAFEETLTDSGANPASADATVWCESFSVQAAAMRALY
                     GEAVTVAHMVHWCDNRVLRVSRHIHEDGSLEVWLAPVLEFRNLLPVPALITINEQIVC
                     LEPRSRQELFRFPADGRCELAASIGEALLLEQRQPVARFQLSDREHVEPLRQTPTAST
                     VALFSQLLDTRYGYVEASCYLGRLTRNATLLITAVYTVFNMVPGLTVQIQESGQMPEF
                     ERYQPHPVMLEPQQAGFLRTPCCRLFGWREPVRLELVTAQGYFLRLQGIPLVLSFASS
                     YEAEQLERARWYEDVEGVPVKAPRNRRSTFDNTSGIGRARVFALRPELVLVNELTDTK
                     LLVRRSHSPVDTDDAASTLEIAPGGLQPFLFPVYAGRDIEGNAITREKAPADSAALQI
                     RLARKPLERQQQQRCTDAGVSPAGSKSLESSPRVETPLVWSGVLPLAITGSFVVDVAD
                     GLPGYLTVQAFLERNGCQVIRFQKTPANAVPFRLVNETPGLLCFTQAKDRVQALQLLA
                     DQRQRLTWAPPRTSVGFAFCEPLAEHTLCVMRIDADPVQCFFLPSLEAAFLDASEEDP
                     DTMAVPVPVPVPDPAADVHDNASDNEDAWIGSQRSMLQPELQQQAWQRRLVADTTGTG
                     APPAVLWVQMRATPTQRVLVFRADSTADAAEVPISEAFGGEEAPVLAPVGIQRLHLFV
                     LVPELAIQVHATAAAGGARCQILLNNLQLAADVDVGMHTRTHVQVSLQRIELRNEEPT
                     TPFPVVLHSGATAATGEDKSAASAELMALEAELVLRQRFGERECAPLRVLVAGVQLQL
                     DAVLMAQLAALATACAHDWAVHHDAASESTSGDTADAASDRSGRSPIDDLVWMPKAGA
                     GSPPRDGSRGISWLVLAYLQLTPVEVLLSFQRGRQTQISEAQLEAASLLARAAYLSTL
                     ERFASIPSIDQASLQLAGLELRRHALASPDELSAMVWTRWTRSILNQWYKLLGSLDVI
                     GAPLTATRSPVTHLKEMYSNLMAGRSTARRFSYGAYSAVSAAERVSVETGKRVVAQPA
                     AGAMARTAGALGLRLLARGLRRLGSGKTASPRARHLVRTQTHPGGIATEPSKASTETT
                     LLDDEPVAATISATIDATVPAADSDSLIQWDDDESGTEEAATLALQSFAHNAVEALSS
                     PSCVDADLRKLLLYPDS"
     gene            complement(<464223..>465851)
                     /locus_tag="CYME_CMC183C"
                     /db_xref="GeneID:16992507"
     mRNA            complement(<464223..>465851)
                     /locus_tag="CYME_CMC183C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535327.1"
                     /db_xref="GeneID:16992507"
     CDS             complement(464223..465851)
                     /locus_tag="CYME_CMC183C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535384.1"
                     /db_xref="GeneID:16992507"
                     /translation="MPLSIYGDVRCWRNDLQTGHKRILLDNLSKSIYMRKNGSRRWWP
                     VQKNGEASARQLETPCLGRVRHYCTRPGATFVFGKMFCVGASVHPGYVSEVCTGERFG
                     HCRLAPVLLHSKSNERPRRSLLSARRRQLPRPGGTGAVMGVKADVNEGNGHSVNSALR
                     ATGRRDFDSTLSADPTTNVGGVFEECLRSVQPLLPLPPGFRQEDYLFERFRCTYWAKP
                     AAPPASPARPAVICIHGFGAGAFHWQKMLNIISEAGYDAYALDLLGFGDADMPPPLFT
                     TQGDGKVGSPTFSYTFESWAQQILHFINTVVVTASDTGISQQRDVVLVANSIGCVAAL
                     QAACDMLRQSVEHPGMQGTRIRAVMCLNPSLRQLHYKKRRGLRVWTTPLALRVLGFRP
                     VAKFFFSLVSRPATLRRLLCSAYAVDGPEADQIISTELVERIRAPSRRPGALDVFLAF
                     TSYDRGPLAEELVESIAQMAATARKDPPAIWVLWGERDPWEPFALGRELFARNPHVDR
                     FVALKAVGHCPHDQDPNTVWRYVSEMLESVERER"
     misc_feature    complement(465869..468409)
                     /note="repetitive element"
     gene            complement(468742..470845)
                     /locus_tag="CYME_CMC185T"
                     /db_xref="GeneID:16992508"
     misc_RNA        complement(468742..470845)
                     /locus_tag="CYME_CMC185T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461222.1"
                     /db_xref="GeneID:16992508"
     gene            <468757..>471207
                     /locus_tag="CYME_CMC186C"
                     /db_xref="GeneID:16992509"
     mRNA            <468757..>471207
                     /locus_tag="CYME_CMC186C"
                     /product="similar to trefoil factor"
                     /transcript_id="XM_005535328.1"
                     /db_xref="GeneID:16992509"
     CDS             468757..471207
                     /locus_tag="CYME_CMC186C"
                     /codon_start=1
                     /product="similar to trefoil factor"
                     /protein_id="XP_005535385.1"
                     /db_xref="GeneID:16992509"
                     /translation="MVFLESNIRRGRPGGQGFRMKPSLFIICFILCSVFASLVRAATV
                     TPTPTATATPTATPTPTPTPTPTPPSATTPTPTPTPPSATTPTPTPTPTPTPPSATTT
                     TTTPTPTPTPTPPSATTTTTTPTATPTATPTATPTATPTATPTATPTATPTPTPTATP
                     TATPTATPTATPTATPTATPTATPTATPTATPTATPTPTPTATPTATATATATATATA
                     TSTATPTPIATMTPTITSSPTITVTASPTTVTMTPTMTPTATTSPTIVPTTIATSIAI
                     SVQNLSLCLAVATDLQNDLEARFTGLVVNVSVTDNCDTVFGSGTSRRLATTLDKSNPR
                     LERALVRTSGGSVVTYVIKISGDTSLASDAQSVLQTFTDQLSTILPSGATLAIITPTP
                     SATPTPVCTSEICGSPGQYTNRDACEQVGCCFNSQTNACTLKSVSAACSAVPVTQRVP
                     CGWSYIYPDECTAIPGCCWQPTANGILAPWCYYDINHAPQASVALQEVQAPVPLCPSP
                     GAQRQPCGNAGINQFTCYAQGCCYDSQAQNQWVQNGKQQSDFASNPYCFQPEKTCAVG
                     EFERQPCTNAVNQNQQLNNNINNNQFVRLLNTLLYGEQHGTQRTSYSPQQCLEAGCCL
                     GLSNECFQPMTEYVCQTYGYVSNSLSGTTGNVSNSSYIPCGPECCNAETQNCTYNPFS
                     NNNNQQQQQQQQLQQLQQQQVLLPSFCVCKDPTKQCGTYLIPSDNLVNKVRCCRADEE
                     CINNQCVVISPTPTPSPVAVTATPSATVSATVSATASATVSASASTSASASASVSASV
                     STSASASESATSSAPPTA"
     misc_feature    complement(472409..475833)
                     /note="repetitive element"
     gene            <476222..>477286
                     /locus_tag="CYME_CMC188C"
                     /db_xref="GeneID:16992510"
     mRNA            <476222..>477286
                     /locus_tag="CYME_CMC188C"
                     /product="L-lactate dehydrogenase"
                     /transcript_id="XM_005535329.1"
                     /db_xref="GeneID:16992510"
     CDS             476222..477286
                     /locus_tag="CYME_CMC188C"
                     /codon_start=1
                     /product="L-lactate dehydrogenase"
                     /protein_id="XP_005535386.1"
                     /db_xref="GeneID:16992510"
                     /translation="MTSGIDEAAAELQGSLFGEVSPAIDSPGAALARSYPVRITVVGA
                     GDVGVACAYNILTRDICSELVLVDVLKDKLKGQVMDLQHGGAFYSTRIRAAESYEDTA
                     HSAVCIITAGVRQRPGESRLELMDRNAALFKGIIPPLVQYSPNTILLIVSNPVDLLTH
                     LAWQMSGLPRERVIGSGTYLDSSRFRTLLAQRLGIDTASVQAMVLGEHGDSSFVYRSG
                     ITVGGVPLRTCFERMTDAASASTAFYDLVKGVHQQVVAAAYEVIKLKGYTNWAIGSAV
                     GSIVTTIVHDRRKVLPITTHAGSMRGLESADVFLSLPCVLGRNGVVEVLQILPFMESD
                     EKEDLQSSIEALQSTPKKAS"
     misc_feature    complement(477065..478503)
                     /note="possible transcribed region"
     misc_feature    complement(478446..481640)
                     /note="repetitive element"
CONTIG      join(AP006485.2:1..481791)
//
DBGET integrated database retrieval system