GenomeNet

Database: RefSeq
Entry: NC_010130
LinkDB: NC_010130
Original site: NC_010130 
LOCUS       NC_010130             513455 bp    DNA     linear   CON 16-JUN-2017
DEFINITION  Cyanidioschyzon merolae strain 10D DNA, chromosome 4, complete
            genome.
ACCESSION   NC_010130
VERSION     NC_010130.1
DBLINK      BioProject: PRJNA28057
            Assembly: GCF_000091205.1
KEYWORDS    RefSeq.
SOURCE      Cyanidioschyzon merolae strain 10D
  ORGANISM  Cyanidioschyzon merolae strain 10D
            Eukaryota; Rhodophyta; Bangiophyceae; Cyanidiales; Cyanidiaceae;
            Cyanidioschyzon.
REFERENCE   1
  AUTHORS   Nozaki,H., Takano,H., Misumi,O., Terasawa,K., Matsuzaki,M.,
            Maruyama,S., Nishida,K., Yagisawa,F., Yoshida,Y., Fujiwara,T.,
            Takio,S., Tamura,K., Chung,S.J., Nakamura,S., Kuroiwa,H.,
            Tanaka,K., Sato,N. and Kuroiwa,T.
  TITLE     A 100%-complete sequence reveals unusually simple genomic features
            in the hot-spring red alga Cyanidioschyzon merolae
  JOURNAL   BMC Biol. 5, 28 (2007)
   PUBMED   17623057
  REMARK    Publication Status: Online-Only
REFERENCE   2
  AUTHORS   Matsuzaki,M., Misumi,O., Shin-I,T., Maruyama,S., Takahara,M.,
            Miyagishima,S.Y., Mori,T., Nishida,K., Yagisawa,F., Nishida,K.,
            Yoshida,Y., Nishimura,Y., Nakao,S., Kobayashi,T., Momoyama,Y.,
            Higashiyama,T., Minoda,A., Sano,M., Nomoto,H., Oishi,K.,
            Hayashi,H., Ohta,F., Nishizaka,S., Haga,S., Miura,S., Morishita,T.,
            Kabeya,Y., Terasawa,K., Suzuki,Y., Ishii,Y., Asakawa,S., Takano,H.,
            Ohta,N., Kuroiwa,H., Tanaka,K., Shimizu,N., Sugano,S., Sato,N.,
            Nozaki,H., Ogasawara,N., Kohara,Y. and Kuroiwa,T.
  TITLE     Genome sequence of the ultrasmall unicellular red alga
            Cyanidioschyzon merolae 10D
  JOURNAL   Nature 428 (6983), 653-657 (2004)
   PUBMED   15071595
REFERENCE   3  (bases 1 to 513455)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 513455)
  AUTHORS   Kohara,Y., Shin-i,T., Matsuzaki,M., Misumi,O., Ogasawara,N. and
            Kuroiwa,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUN-2003) Contact:Motomichi Matsuzaki Department of
            Parasitology, National Institute of Infectious Diseases; 1-23-1
            Toyama, Shinjuku-ku, Tokyo 162-8640, Japan
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AP006486.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..513455
                     /organism="Cyanidioschyzon merolae strain 10D"
                     /mol_type="genomic DNA"
                     /strain="10D"
                     /db_xref="taxon:280699"
                     /chromosome="4"
     gene            complement(<3380..>6664)
                     /locus_tag="CYME_CMD002C"
                     /db_xref="GeneID:16992740"
     mRNA            complement(<3380..>6664)
                     /locus_tag="CYME_CMD002C"
                     /product="similar to trefoil factor"
                     /transcript_id="XM_005535330.1"
                     /db_xref="GeneID:16992740"
     CDS             complement(3380..6664)
                     /locus_tag="CYME_CMD002C"
                     /codon_start=1
                     /product="similar to trefoil factor"
                     /protein_id="XP_005535387.1"
                     /db_xref="GeneID:16992740"
                     /translation="MFRALSLARALGVAVCLLLAATFSVSLVAALSPVSTVSWTWIGG
                     ETGTGNFGRYGTLNQTSPESVPGGRYYSAAWVGSSSVVYLFGGFGFGNTAKGLLNDLW
                     KFNLTSLEWTWIGGSSELDQPGVYGTVGTGSPNNIPGGRQSSAYWQTDEHHFWLFGGY
                     GFDVNGNAGDLNDMWRYDTETGIWTWFSGNDTFNANPVYGPKDIYSQIYNPGGRDSVA
                     FWLGADGLFWLFGGEDIAGNLLSDLWSFNPVTFEWAYRGGSQLVNHPGNYSAPGVASN
                     SNAPGARGFSHTWTDFEGNLWLFGGYGYGNSTALGQGDLNDLWVYNISQSVWLLIAGN
                     TTINNPGSYGTIGAFSPTSYPGARDSGVSFVDSLGNLLLFGGEGYGNTRESPGDLNDL
                     WVFDITLGQWAWINGSQSVDALSVYGVFNESDPSVVPGGRFGPAFWNTSGTDPILFGG
                     SGYSITSGPGYLNDVFALSETFFTPTSTPTPTSTPTLTPTITPTATATPTPTATPTPT
                     PTPTATPTPTPTLTPTPTPTLTATLTPTITSSPTITVTASPTTVTMTPTMTPTATTSP
                     TIVPTTISTSIAISVQNLSLCLAVATDLQNDLEARFTGQVVNVSVTDNCDTVFGSGTS
                     RRLATTLDKSNLRLERALVRTAGGSVVTYVITISGDTSLASELQSVLQTFTDQVSTIL
                     PSGATLAFITPTPSATPTPVCTSEICGSPGQYTNQDACEQVGCCFNSQTNACTLKSVS
                     AACSAVPVTQRVPCGWSYIYPDECTAIPGCCWQPTANGILAPWCYYDINHAPQASVAL
                     QEVQAPVPVCPSPGAQRQPCGNAGINQFTCYAQGCCYDSQAQNQWVQNGKQQSDFESN
                     PYCFQPEKTCAVGEFERQPCTNAVNQNQQLNNNINNNQFVRLLNTLLYGEQHGTQRTS
                     YAPQQCLEAGCCLGLGNECFQPVTEYVCQTYGYVSNSLSGTTGNVSNSSYTVCGPECC
                     NAETQNCTYIPFSNNNNLQQQQQLQQQQQQQQVLLPSFCVCKDPTKQCGTYLIPSDNL
                     VNKMRCCRADEECINNQCVVISSTPTPSPVAATATPSATVSATASAAVSASASTSVSG
                     SASVSA"
     misc_feature    4001..4808
                     /note="possible transcribed region"
     misc_feature    complement(9456..10624)
                     /note="pseudo-gene of NADPH:protochlorophyllide
                     oxidoreductase"
     misc_feature    11124..14393
                     /note="repetitive element"
     gene            complement(<14440..>20172)
                     /locus_tag="CYME_CMD005C"
                     /db_xref="GeneID:16992559"
     mRNA            complement(<14440..>20172)
                     /locus_tag="CYME_CMD005C"
                     /product="similar to Trithorax protein"
                     /transcript_id="XM_005535331.1"
                     /db_xref="GeneID:16992559"
     CDS             complement(14440..20172)
                     /locus_tag="CYME_CMD005C"
                     /codon_start=1
                     /product="similar to Trithorax protein"
                     /protein_id="XP_005535388.1"
                     /db_xref="GeneID:16992559"
                     /translation="MPRRLCPRSKSELLPANPRRRKDGAHVADSVRCALCGLDQDASG
                     IEGKLLGPLKPKPPAKKPIYVHEECVRFSAECQGRNEIDELLVGSVVRRGNSIRCSVC
                     GQPGGTITCAYRSPRTCWTYYHLRCALKVGAAVCKRRRQVFCCLHRKDAEECGFFRGS
                     ELATLDVPASANLLVQLEAVKGRAVRRDASPNGCIDASVSTAKDRQHLAAKRRDETAS
                     APPESTKASSERSARRAPSQRRLKRGNGAAGVENAQAVSTHSWTSRGRQSGARDWKQI
                     EHNDSRDALQVYNEHGMDTGHAVQTATGRKQYRHRHTGLATATPAVPSPANRGPAWKR
                     HPQRKSRVCREVSHIIGSLAAPASWYSQTPLMQQNTCDDASTKRKRLIMKKIQTDAAL
                     VQRVPEVSPANMEHQGERLRPLATYNPDKQPRSGGDGGKRSDLQLHSPFLAIETVPVR
                     ARRPTKSRKRRPDACPDTHLVNTASRRRLQQQDAVTSPERAHLASALTSSPAASNESA
                     VKDFAELRASCASECTVEPSYGARTGQSRNVSRCSVPVEVYDREVATHTGPSGAGGGA
                     SGDSKNALSSRQGGHSVGQETGASQVSAVMRLNFSRKLQQHGGVRFGRGESANGERAS
                     RQVPQDTALQTPRGSVVAQVQFRGDDALGKRNSVTGRQRKRRHHSEATTEQENYRLWE
                     LTRELQFGDCEPLSWVTFAERTLEALERSRLHSRPDGTKRAKRVSAVTADALMTVSTP
                     SEGTSLVQMSLSAAAATETAPAAGSQVTASESNVPGKPGSLFVAPCRTPSERIDSGCH
                     DRSVVHDERAQLEYQTNAQVMGVLDWEVPPQPQVDPLIPCRILIPLERDVCALCHGTV
                     DESGASALFCWLCGEAYHAECQHQEQQYESSSGRLHLLDLGPIRVIPNCTSCAVSIPL
                     PSVPEAESSCHPADRQGTPTESSIERSEQVLWNTGTEHNDSEVPLEVDHSMQAPCMDN
                     EAVPDSSAFGAVKRRPPVSFAAAGAASFAASRRITGGGGSERVPYPEVDTPGRALPLP
                     RNSYRAGVEQEAGTYAAVASKNTGQDASESNAWKRDSMQVLQRGEPSSVQEPPWLLTL
                     SSVPCVVCGRRLDSGHGGAMPLLLCGDCEAAAAAAAAATSNATSTLPGDQVKRQHVPG
                     TLAATGPACSRSPKVSSSSGQGRVSEAPLLACNADAMESECADPLRDCLAGTRLRDVS
                     CEAQLPLGACALTSVQDGAFASHLASGTRIEGTDRTPLVMKQENSFEAEHLHSQNSVY
                     IDAHMMLANCEAETGVQENTVCLMGNDTSLSQYGTRDPVPEVTVCRPLGQRVSASFGV
                     QAPHATPDALQAEHLVWSRLCAVPDCRRCALCACPERGESAQLGCLVPLRLSESTLRW
                     IHMGCLALSTQTGAGLSRTIQAALSRKCSVCRRTGASVFCSFLGCTQVFHVRCVATHA
                     NAAGADAMWECSDHRSLCWCWKHRSLLGREATAGLAPSGWSFPFSSMGHSLPSDVRGL
                     SLNARPALRVGAWTLLDYGALDCTSLESTEAQWRLPPDCYLARRFWSMIRPFERTLYF
                     ISCTADVAHEPRYSLCALDAPHDRLSGVCITALWHQMISRVLRLWAARLPARLTHLFT
                     KCIAERSTEERQALAERFFCPVPVLVQHLATSMLASVPADTSPDHDVGGASPTARSAG
                     AARCSLYLRPSNESKWSKLAPVHRSLEVFERALAGAAYDPLLAQRSAASDIPGSAERA
                     CSALRSRPEQDRVPPRRDAWRVVSATATDRRLYRQMQLEHRKYCVPLRSRIHGFGLFA
                     RCDLQADQMIVEYAGERIASPVADVRERHYERRGIGCYMFRIDADWVIDATMIGSVAR
                     YINHSCRPNCYSEILRISDEPKQDVIVIRSARAIKRGEELTYNYMFDVDNAMKIPCLC
                     GEPGCVGFMN"
     gene            <20700..>22208
                     /locus_tag="CYME_CMD006C"
                     /db_xref="GeneID:16992560"
     mRNA            <20700..>22208
                     /locus_tag="CYME_CMD006C"
                     /product="probable serine protease"
                     /transcript_id="XM_005535332.1"
                     /db_xref="GeneID:16992560"
     CDS             20700..22208
                     /locus_tag="CYME_CMD006C"
                     /codon_start=1
                     /product="probable serine protease"
                     /protein_id="XP_005535389.1"
                     /db_xref="GeneID:16992560"
                     /translation="MQSTGNTLLGRSCRLLRLRLQLHNHHRPQQQQQQQSIRLIHRTI
                     PSWNRHGGAKSSESYARTPERRGARYSSVTSWQAKCLPSLRGAPGRRNSRWASVLNSA
                     LLFVSGALVVTLPSWCSTEWWRLPLGSFWKRFQAQAAALGDALSAEASAAQPEASAGL
                     PSIRDKPLTRFAIADAAARVAPAVVNITVTVSTGDRWLFGPFAPPTTLAQSTGSGFIF
                     DSNEGLVLTNAHVVAEMRNAPQTSALTVTLQDGRSFSGAVESVDALTDLAIVRILDPG
                     TDLPAAELGESSALRTGEWVIAVGSPLMLANTVTCGIVSATNREGFEIGFPVGAPRLA
                     FIQTDAAINIGNSGGPLVNLDGHVIGINTLKALSSDGISFALPIDLAKEVIRQLRQHG
                     RVVRPFLGLKLLTLTPALAEELRRRSSSGFPPDVNEGVCVPQVLPGGPAERGGLRAGD
                     VIVAIDGQPVRSTREILDLLGNRVGHAIEFTVIRGRRGQRITLQITPEQAKG"
     gene            complement(<23159..>24094)
                     /locus_tag="CYME_CMD007C"
                     /db_xref="GeneID:16992561"
     mRNA            complement(<23159..>24094)
                     /locus_tag="CYME_CMD007C"
                     /product="V-type ATPase V1 subunit D"
                     /transcript_id="XM_005535333.1"
                     /db_xref="GeneID:16992561"
     CDS             complement(23159..24094)
                     /locus_tag="CYME_CMD007C"
                     /codon_start=1
                     /product="V-type ATPase V1 subunit D"
                     /protein_id="XP_005535390.1"
                     /db_xref="GeneID:16992561"
                     /translation="MSQRQVLPVVPSRMTLTQVKARLQGARRGHALLKKKSDALTARF
                     RAILREIVDKKQRAAELLRDASFRFVAVKYVVGDELKHIVQESVERAETRLRVRFDNV
                     AGVSLPCYRCVSGSVSTGPVATSTIATAAAAAAVAVARNDGYAEDMRAAGPVQTGVAS
                     VAQYRGLGRGGQQIAACREAYNEALLALVELASLQTSYLILDEAIKVTNRRVNALENV
                     LIPRLENTIAYILSELDEQEREEFFRLKLVQNRKKRELARTQAQELRARERRAAQALR
                     AFDMNSFEQALEPDAANTPSILEQIAGADADLLPI"
     gene            complement(<25492..>26148)
                     /locus_tag="CYME_CMD008C"
                     /db_xref="GeneID:16992562"
     mRNA            complement(<25492..>26148)
                     /locus_tag="CYME_CMD008C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535334.1"
                     /db_xref="GeneID:16992562"
     CDS             complement(25492..26148)
                     /locus_tag="CYME_CMD008C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535391.1"
                     /db_xref="GeneID:16992562"
                     /translation="MNETDHLVYGSNGVFSTLSMNSTPLGSCCCRQRAFALGFGVCWY
                     RGVPAATATATATAVSTSRYVQQPRLLKPSRSPLLKRVASPRTRAPRLPETDARSGIW
                     QVNTLRANAATDDDTDDDDSNPNPDEPAMAGAAASSSEAEPPPQESTAADSSTFHRRG
                     RPRRSERCPGCLARGKLRCDRCAGSGHMGGVRCEVCFGFGKTRCSQCGGTGFILKEGD
                     "
     gene            28561..30909
                     /locus_tag="CYME_CMD009T"
                     /db_xref="GeneID:16992563"
     misc_RNA        28561..30909
                     /locus_tag="CYME_CMD009T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461223.1"
                     /db_xref="GeneID:16992563"
     gene            complement(<30493..>33654)
                     /locus_tag="CYME_CMD010C"
                     /db_xref="GeneID:16992564"
     mRNA            complement(<30493..>33654)
                     /locus_tag="CYME_CMD010C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535335.1"
                     /db_xref="GeneID:16992564"
     CDS             complement(30493..33654)
                     /locus_tag="CYME_CMD010C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535392.1"
                     /db_xref="GeneID:16992564"
                     /translation="MDVLVASSLPSPSLSSPSLSSSSLSSPSLSSPSLSSLLSSSSLS
                     SLLSSSSLLSSLLSSSSLLSSSSPTAKECTHRVMRAPANDACIASRTHPVRAPGGANA
                     HRTAAASSRSTVREVPVGAAAGAAHQGSPPGSSTTTGQGLNSCLSSWRPGTGSRPVRA
                     RSSVPADSRESSFTSVPDDTRSAPPKRTSATMNAGKKLEGSASPDVQENASSVPSVSG
                     LSEYYPGSPAAALTSPRKVLRKSIHVPGLEAFELRTEWYGERLYATEPRERADLTAER
                     APVVVNGKRTASAGSAAGSAGSETRSMLSRLTSFAASGASIMGLGGHQSQNSAAASSP
                     QSTQLVGGGSTGSSPAAAGELQSTSPLGGFLSIGSSVISRRVNYGWGARGTQVSMILI
                     PHAILSMMLMNAYVENASVMAAYRRTFSADSELLASTALAGSGSDVNGRRATVASQVA
                     ATSADALRSLTPPPSAVGGNGRERRGLFSRRRASSVRLSDGGSSAGNGPLARIGDATA
                     PEASTEGKAQSRSLIAPELMTLDLERVSCETADMRAGQLEHLAAPNAVPSRSMMSWLN
                     RWTGTSRDKAQTHPSSPALSEGGDAYAAAPSEACEVRADICPDRRTVTTSAGGRTSSL
                     PSTGDCAAVDKRLPGDLVPLLLLNFRDQVFIIQGDTSGRVLQKFRFRVLPTCHTLSLS
                     AAEDTVLAIIGFANGEVLVHRDPLRTLDGGYDCIALPSSLASVAEQTKQVMVMALAVT
                     SSRDRLITARGNGSILVHSLPQGLGPDKYHTSLLAQIPSHAGITSISVHENLLACTSR
                     DGMLHVLALPSLDWPVLAETSANLPSATWIAQARSHYGAFLCMAWSPDGQFIAAGGED
                     DTFTIWRAPRSPCEEMRCLVRGRGHSSFVTSVCWLPALELELDGYASSSLSGQGWSSE
                     DAAPAAFYRLATVGQDARLCIWELDLNALPSPRKTRRGLVVPEIEPAVRQTIHHDGLT
                     CVRLASLSNRMVLVTADESGAVRLWEMVATAAAAATASPKSSLDAGERCLSWSEKNGN
                     AAGSPGSPTQRIEYLLSIREKHW"
     gene            <36287..>37357
                     /locus_tag="CYME_CMD011C"
                     /db_xref="GeneID:16992565"
     mRNA            <36287..>37357
                     /locus_tag="CYME_CMD011C"
                     /product="probable MPBQ/MSBQ methyltransferase"
                     /transcript_id="XM_005535336.1"
                     /db_xref="GeneID:16992565"
     CDS             36287..37357
                     /locus_tag="CYME_CMD011C"
                     /codon_start=1
                     /product="probable MPBQ/MSBQ methyltransferase"
                     /protein_id="XP_005535393.1"
                     /db_xref="GeneID:16992565"
                     /translation="MPSDGFCFVSTWSGVHAVRTPQRPVCGSVGHAIPRHRLWRRRAG
                     VLGTQASTVRSEGTVSVTAPRRQQGLIQHKREAFWFYRFLSLVYDTVVNPFHWTTEMR
                     DASLRQAGLEEGRGRPDFKVLDVGGGTGFCTEGIVQYVSPSQVTLLDQSPHQMQVAKR
                     KPSLQGVTFVQGDAEALAFPTDSFDRVVSAGSIEYWPEPQRGIAEAYRVLKPGGLATI
                     IGPVRATNPVSRFFCDLWMLFPMEEEYRVWFTRAGFTDLKVSYIGPPAYKGIRQHGLI
                     MGLTITGRKPAPGEAKIQLGPMRERLDQSKPMSLGERLIFLARWILGCIAGFYYFVLP
                     FAIMLYAAIFIRDSKRANKEAA"
     gene            complement(<38293..>38733)
                     /locus_tag="CYME_CMD012C"
                     /db_xref="GeneID:16992566"
     mRNA            complement(<38293..>38733)
                     /locus_tag="CYME_CMD012C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535337.1"
                     /db_xref="GeneID:16992566"
     CDS             complement(38293..38733)
                     /locus_tag="CYME_CMD012C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535394.1"
                     /db_xref="GeneID:16992566"
                     /translation="MTSAMIYGGSSEVCCLCNKTVYAAERIATDGRIYHANCFRCHTC
                     NKKLALGTYAQISGTLFCKPHFDAQFHAAGRYEVVTPTKNGVGGRAPATDGRRKPLES
                     WNPPASGEPVVRYLDYLLQRIEEQQQHMGELRDALEDLRNQLAQ"
     gene            39529..41457
                     /locus_tag="CYME_CMD013T"
                     /db_xref="GeneID:16992567"
     misc_RNA        39529..41457
                     /locus_tag="CYME_CMD013T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461224.1"
                     /db_xref="GeneID:16992567"
     gene            <43390..>44340
                     /locus_tag="CYME_CMD014C"
                     /db_xref="GeneID:16992568"
     mRNA            <43390..>44340
                     /locus_tag="CYME_CMD014C"
                     /product="coatomer protein complex, subunit epsilon"
                     /transcript_id="XM_005535338.1"
                     /db_xref="GeneID:16992568"
     CDS             43390..44340
                     /locus_tag="CYME_CMD014C"
                     /codon_start=1
                     /product="coatomer protein complex, subunit epsilon"
                     /protein_id="XP_005535395.1"
                     /db_xref="GeneID:16992568"
                     /translation="MEAAVDWYDFWNYYYLGKYQAANDVCTTLLEPNQWPRSVLLAVI
                     RLRLALRDLEGIRALRNLVNDTWTSSVIHELIETLQKNVPPIDDGERLRSVVFGDGSA
                     LDAVDEAGRLLAALALQRAGLYLDALETLPLSRCENDAESRACRICLWLHLNRLDRAQ
                     LEQQALEHWFERQLADGDQRAVGTLVQLSRATLAVASNDAEDVAIEAALRSCRDLAER
                     YGPSTKLLNLTYLCLVRLGRTEASESTLQQAMNLDAQDPDTMANTAASAAKTSMMMMA
                     FPEAATATQRPIEYLRKYAPWHPWIRAQDDFERKLRGLAT"
     gene            complement(<44401..>48741)
                     /locus_tag="CYME_CMD015C"
                     /db_xref="GeneID:16992569"
     mRNA            complement(<44401..>48741)
                     /locus_tag="CYME_CMD015C"
                     /product="Raf-related MAP kinase kinase kinase,
                     theta-type"
                     /transcript_id="XM_005535339.1"
                     /db_xref="GeneID:16992569"
     CDS             complement(44401..48741)
                     /locus_tag="CYME_CMD015C"
                     /codon_start=1
                     /product="Raf-related MAP kinase kinase kinase,
                     theta-type"
                     /protein_id="XP_005535396.1"
                     /db_xref="GeneID:16992569"
                     /translation="MAPSSGHTTTPLDDRGVQQRKRLLRTPNPTDKRPFPIRILTWLA
                     KSYLSGLGNMGATLGPSELGASTALWAQGSTTPERIKTSASATSIAARDRPQSASASK
                     TGKAARPRHRKGAPSTSGSIRAQNSASAAQQVRAKEFQSTDGTCGSLAESPILAESRN
                     VSSRLPTASGSDRSTGSGVSAQPEAPDAAPTGATASTMQIQNGAETAPESSTQRGVAD
                     VVRSTSEDNVATDDTQWSAHDQVQEQGSLSVSSGDHGSAVDTNARVATPYPDAAADSN
                     GDSVPADNTGDSDGARPQTLQEEARAQVSLPPVPLPRQSFNCVQYFTILRGSGRSIVE
                     ISEGSPVSMQPGDAVDLLAICAKSRTQAPAEARAAARPSSIYARHGVLSSTNDALSDE
                     RNGNHADASQNSTLLEAASEGARSAQTAERLESARNPDAGNFASERPCELPSVLDELR
                     SVGLELSDLAAEAKPQRAYRRHYAAWLTNVLHRPRPRGIEFRRILVIDGDRAQSYKRV
                     IQHAFGFLTLLCSGRTGIRSVMFPLCLEYAADAVDVLTYLLDAALRWCSAGLSLPLIR
                     ILVPRGFCTPSVQRLLSSFRECMDEEGRYDPKRSKSEHVASVQTGDGVGDAPPLSGAP
                     GETRSELAPELVSPVADTIATSQAMASSKRRLERDFFVLYHRDDTKVAWEIIHVLRVR
                     FGFKVFDVHSRALDVAATELVERQEWDIAAPSNDGGLRTAHWGFPNLSGASATPATAE
                     PQTVDTTTLTSKGDAQGVTRGSLRERALQRHAADAVTEPLESGPEHSVADDEPGVSAE
                     TPAMDGAEQAPATADLTGASLAAAAAARNDHRGAAPTTHWTASNPGQGQHRSSSDRSE
                     PVASAERIGFVEGTTVALGAAEHSHYAQQSEQGRADGPVSPDQEADIRSAFFMDEWYS
                     SMLHSKRFVALVSDGFFRSPQCATLFSLALCRALERGPETVFMIYWRSTDLPALVHCI
                     PKSSILDCRESNHEALTRSIGELAQIHRRLERVDHLRQQQSRSALAQQMWQQQQSALA
                     SDARGRALEERRTMQGPADAASALSSGWLADKSTRPDRDLHTEAQRALQAARTRDLNA
                     AGEASQQQQQQQQQQAEDGPIDGSTASEMEYYGNAPLLFDREWREKWDIPYEELRFGS
                     KLGAGAFGEVFMAEWRGVIVAVKQLTRDDDGYSLETVEDFQKEMVLLSRLKHPNIVPF
                     IGAVTKSPHLCIVLGFVSGGSLYRLIHARKAAADGPAFSLAEIAQLALGIAQGVQYLH
                     AQQPPVIHRDLKSPNVLIDAETGTPIVTDFGLSRSRVHTMLATGAAGTPEWMAPEVMR
                     QETVDEKSDVWSYGVIVWELITSDKPWSDEHPIQVIYRVAQRGERLRAPPDTDEGLKS
                     LLDGCFRQRRQQRPTFDEIVAFWQAFQRVLRERERTRNAALPTPHLSTIVERYRTQKR
                     AARRGPPSRA"
     gene            <52627..>53295
                     /locus_tag="CYME_CMD016C"
                     /db_xref="GeneID:16992570"
     mRNA            <52627..>53295
                     /locus_tag="CYME_CMD016C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535340.1"
                     /db_xref="GeneID:16992570"
     CDS             52627..53295
                     /locus_tag="CYME_CMD016C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535397.1"
                     /db_xref="GeneID:16992570"
                     /translation="MEPEQPEAVLSGEEQKASGDCDQIRLYMYDFGQCDVHRCTGRKL
                     LRCGLLRTQRLNVPCHGVLLSPDATRVLSAADLPLVAKGGLAVIDCSWNQVEAPLLRR
                     VRCRGPGQRRLLPSLQATNPVNYGRGARLTCAEALAAALYILGQKTAAIRVLAPFRWG
                     DAFWSVNQTALDMYASCADAESLVAAEASWLAQLAQEHEQNKTQWDPFAGLDSSDSDE
                     AEAC"
     gene            complement(<54285..>55103)
                     /locus_tag="CYME_CMD017C"
                     /db_xref="GeneID:16992571"
     mRNA            complement(<54285..>55103)
                     /locus_tag="CYME_CMD017C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535341.1"
                     /db_xref="GeneID:16992571"
     CDS             complement(54285..55103)
                     /locus_tag="CYME_CMD017C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535398.1"
                     /db_xref="GeneID:16992571"
                     /translation="MGSKSASVDIESGNYNTYEYSVKRSASRALGHADLEEYDVGVTV
                     AACMERIRLDFLRKVYTVLAAQLGFTAVLSGAFMISGSLNQWVISASSWLIWVCFLGT
                     LGALVGLFWARSRPKWSLPALSVFTFFEALSVAMICAIYAASGFGFIVFEACFLTALV
                     FGGLTIYCWRSQRDFSFLGGFLGAALLVVLGAAVLNAVLGWMGHFSTTFSFVLSVVSA
                     LVFCGYILFDTSLIIHHLGPDDWSIACVSLYLDVLNLFLNLLQILTRIQASSDN"
     gene            <56374..>58083
                     /locus_tag="CYME_CMD018C"
                     /db_xref="GeneID:16992572"
     mRNA            <56374..>58083
                     /locus_tag="CYME_CMD018C"
                     /product="probable ubiquilin"
                     /transcript_id="XM_005535342.1"
                     /db_xref="GeneID:16992572"
     CDS             56374..58083
                     /locus_tag="CYME_CMD018C"
                     /codon_start=1
                     /product="probable ubiquilin"
                     /protein_id="XP_005535399.1"
                     /db_xref="GeneID:16992572"
                     /translation="MEGEPPRTTSENEMTTSNEAEESAFELHFKSSTGSKFTLPVQDL
                     EEKIEALKQRLAEPSGFAPETMRVIYKGRVLKDAETLRELQEKYGLESGHTMHLVRGV
                     RPAAAPAGAPTGSALPGVGGPVPATPASAASSAPSLGSSAGSAGNLAGSTPTPSSAGF
                     DMFGQARAATWNGTAANASAATGAPLGYAPDAASTGANVGSAGAGGGSSSMQRLQQQM
                     QQALLANPNAMQEILSSPLMESMAENPELMRALMMANPQIREMINQNPEIGHVLNDPG
                     VLRQTLQLMRNPHLMQEMMRTSDRAMANIESMPGGFDALRRLYTDIQGPLESSGPMAP
                     GAGASTFTRATPSNPTSSDTGNGRSSTTLPLPPSWAAGATPATTGNNGSQMPWSSPDL
                     SEEAAVRATRAILDNPELFRLTQEQFIASDTFLLANPMVSAMAAMNPQMMQALQDVQF
                     RRNLFTREFFESTLAMQEAQLRFRRAIHQALLQSGYDPAIATTPQPMASATAGGPRQT
                     RGATFTDPTAQMTREQLEQHFATQLQQMREMGFFDTDACIAALRATGGNVAAALDRLL
                     NGS"
     gene            complement(57730..59263)
                     /locus_tag="CYME_CMD019T"
                     /db_xref="GeneID:16992573"
     misc_RNA        complement(57730..59263)
                     /locus_tag="CYME_CMD019T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461225.1"
                     /db_xref="GeneID:16992573"
     misc_feature    58869..61142
                     /note="possible transcribed region"
     gene            complement(<59992..>62313)
                     /locus_tag="CYME_CMD021C"
                     /db_xref="GeneID:16992575"
     mRNA            complement(<59992..>62313)
                     /locus_tag="CYME_CMD021C"
                     /product="GTP-binding protein of LepA family"
                     /transcript_id="XM_005535343.1"
                     /db_xref="GeneID:16992575"
     CDS             complement(59992..62313)
                     /locus_tag="CYME_CMD021C"
                     /codon_start=1
                     /product="GTP-binding protein of LepA family"
                     /protein_id="XP_005535400.1"
                     /db_xref="GeneID:16992575"
                     /translation="MHTNAERVPSRGQCAYEPQRIVPERQLPSEARALACAGRVQCLR
                     SGTGTSRSGVLPTNSERDRLSGRWQAPALAFAVMSPTLYNVFRRHMNWRQCALLPAAF
                     ADRARLPLDLKRCARDSGRALSLRAQQSLPQNTTRETPSKPVAPTPPFQTDGEQHAQP
                     QGRLIRVPPSRIRNFSITAHVDAGKSTLADRLLERTGAVSAREMREQYLDSLELERER
                     GITVKLQAARMNYTAHDGQTYVLNLIDTPGHVDFSYEVSRSLQACEGALLLVDATKGV
                     EAQTLANAYLAMENNLEIVPILNKIDLPAAQPEQASQEVEQVIGIDMRDAVRTSAKLG
                     IGIEETLEAIVKRIPPPRVRDENAPLRALIFDSAYDDYRGVVVYFRIVDGTLRKSDRI
                     RFMANGREYDVDEIGVFTPKPLPVEELSVGEVGYLVAGIKTVAHARVGDTITLARHPA
                     SEPLPGYKEVKPMVFSGIFPADASMYNQLRDALEKLKLNDAALYYENENSPALGFGFR
                     CGFLGLLHLDVVIERLETEYDLDLVTTAPSVVYRVHTTSGEVLEIDNPCKLPPPTNIE
                     RIEEPYVRIEMITPAEYVGSLMELAQSRRGEFLDMRFLTESRVVLIYEMALGEMVSDF
                     FDQLKSRSKGFAGLDYRLVGYRASDLVKLDISIHGEVVDAMSVICHQSAAQAIGRSLC
                     QRLLEIVPRQQFKVAIQARIGSKVIASEHLNALRKDVTAKLYGGDVTRKKKLLEKQKR
                     GKKIAAERALASGIRVPKEAFRAILTAKRDAAS"
     gene            62686..64957
                     /locus_tag="CYME_CMD022T"
                     /db_xref="GeneID:16992576"
     misc_RNA        62686..64957
                     /locus_tag="CYME_CMD022T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461226.1"
                     /db_xref="GeneID:16992576"
     gene            <65972..>66517
                     /locus_tag="CYME_CMD023C"
                     /db_xref="GeneID:16992577"
     mRNA            <65972..>66517
                     /locus_tag="CYME_CMD023C"
                     /product="similar to ferripyochelin binding protein"
                     /transcript_id="XM_005535344.1"
                     /db_xref="GeneID:16992577"
     CDS             65972..66517
                     /locus_tag="CYME_CMD023C"
                     /codon_start=1
                     /product="similar to ferripyochelin binding protein"
                     /protein_id="XP_005535401.1"
                     /db_xref="GeneID:16992577"
                     /translation="MSGLRTLVALLNQRVRPFVLPNAHVSPSASVIGNVAIADHVFIK
                     PNAVLRGDSLVPDDLIRLGGYTVIGENTVLNAAVQIGSWCRVGAACSIGRAARIGNVV
                     TLGDGTIVGAGAEIPHEVCTEPRTVIPDGAQLEPNARYAGNPATRVGEWSGFDVEESK
                     KRAQAECALGAQHAYEFLPLE"
     gene            complement(<71770..>73020)
                     /locus_tag="CYME_CMD024C"
                     /db_xref="GeneID:16992578"
     mRNA            complement(<71770..>73020)
                     /locus_tag="CYME_CMD024C"
                     /product="ribosomal large subunit pseudouridine synthase
                     A"
                     /transcript_id="XM_005535345.1"
                     /db_xref="GeneID:16992578"
     CDS             complement(71770..73020)
                     /locus_tag="CYME_CMD024C"
                     /codon_start=1
                     /product="ribosomal large subunit pseudouridine synthase
                     A"
                     /protein_id="XP_005535402.1"
                     /db_xref="GeneID:16992578"
                     /translation="MGFVVVAPLHQRLHGATGTMPYFHGGTSEVLQPRASALDEPLPH
                     GSTARGRAPSSCTRLPVVYASEHLLVVDKPADMRMSGAAFTSTVESLAQKQISERGSA
                     LAERVQPTGWHRVGHLRAPLPPPKIRMIHQLDYATSGVLLLGLQRRATAQITAAFRKR
                     EIRKRYLAIVHGHVVPGDANAHFWIDAPLVEYADDFRVRLATVDDHTAHASTEDSRNS
                     SDTGEIKIDPGCACRAGSVSRKSSTGIRGFAESRVTDSYCAVPECDGDRRHADAVKLR
                     PCRQLQPAPTATTKKIFSALTLGTVLGIGSYQGLPASLLELRPVTGRRHQLRVHLWCV
                     GHGIVGDATYPTLPDEDERFSRMMLHAAELELPAYLQHRLQLPGRFVAPTPSAMAAFQ
                     GAVLKSSSSDVWDHETEGKLGHHL"
     gene            <74801..>78073
                     /locus_tag="CYME_CMD025C"
                     /db_xref="GeneID:16992579"
     mRNA            <74801..>78073
                     /locus_tag="CYME_CMD025C"
                     /product="DNA replication licensing factor MCM2"
                     /transcript_id="XM_005535346.1"
                     /db_xref="GeneID:16992579"
     CDS             74801..78073
                     /locus_tag="CYME_CMD025C"
                     /codon_start=1
                     /product="DNA replication licensing factor MCM2"
                     /protein_id="XP_005535403.1"
                     /db_xref="GeneID:16992579"
                     /translation="MVSSPERQRGRRYESREAGGARATGRTDSQSGSSGYSSSRIENT
                     PLEPNIIGDPETDRRLPGASVAGNASEWGQVLGALESAEEGESSDEGLLDDSAADAAE
                     ADSEVSGEDLLENMERDYLPDPERDRYEIDPEAEYDSEAMEQMDPVTRRLADAAVDRR
                     LREARRERARRRASRTRSRLMHMLWSESAESSSEMHSLRASAADASESGAERTPHSGS
                     SSSPRRRQSQPPLTSSPISTSIMLADGLSSTADPLDDGAEEGSFHLDDHGSDIRSWLC
                     QERAQRALQRRFITFLRQAVDDTTGRAIYVDRIKHMCAENTQSLVLSYHDLMTADPLL
                     AVWVSEAPAEVLRIFDDAAMHFLLSMFPQYRTIHREIHVRIADLPISDPLRDIRQVHL
                     NCLIRTSGVVTKRSAVLPQLKLVTLTCRACSESLGPIATNSLNPEKSVRCCARCGSRG
                     PFEIDAQQTVYGNYQRMLIQEPPGTVPPGRLPRYKEVICTGDLIDVARPGDLIEVTGI
                     YRHSFDASLNLRHGFPVFATVIEANYIRRLDGALAELDALTDEDEKTIQALARDPYLA
                     ERVTATIAPSIYGHENVKRALALALFGGQAKEIGERHRTRGDINVLILGDPGMAKSQF
                     LKYLEKVAPRAVYTTGKGASAVGLTAAVHRDPVSREWTLEGGALVLADQGVCLIDEFD
                     KMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCAVIAAANPTKGRYDPAVSFMENVD
                     LTEPILSRFDVLCVVRDVVDPSADEQLADFVVQSHMQAHPYGVLMTSRNAGAERTHGN
                     DSADETDVGASQPLVPVLPLSQPAEAAPVEARDPPSTTAVSPTRPLAGALDPVSTSGR
                     MCSPGERRFEPIPQDLFRKYIVYARRRVHPRLANVDEEKISQLYIDLRRESLACGGMP
                     IALRHLESVIRLAEAHARMHLRYQVIDEDVNAAIAVMLESFFSSQKYSVMRGLKRTFH
                     KYLAFQRNDDELLLYLINGLVREYASAEAAARSGAETYQLALSQSASQGAAGQGQRAS
                     GSSGATSAALSRTVRVPLVDFENRARALGITNIERFYTSDLLRARRFELDRRHGYIIK
                     HI"
     gene            77934..81413
                     /locus_tag="CYME_CMD027T"
                     /db_xref="GeneID:16992580"
     misc_RNA        77934..81413
                     /locus_tag="CYME_CMD027T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461227.1"
                     /db_xref="GeneID:16992580"
     gene            complement(<78180..>78704)
                     /locus_tag="CYME_CMD026C"
                     /db_xref="GeneID:16992582"
     mRNA            complement(<78180..>78704)
                     /locus_tag="CYME_CMD026C"
                     /product="RNA polymerase II subunit G"
                     /transcript_id="XM_005535347.1"
                     /db_xref="GeneID:16992582"
     CDS             complement(78180..78704)
                     /locus_tag="CYME_CMD026C"
                     /codon_start=1
                     /product="RNA polymerase II subunit G"
                     /protein_id="XP_005535404.1"
                     /db_xref="GeneID:16992582"
                     /translation="MAFFILELTKSVTVHPRHFHAKLPDHVINRLLTLTEGTTSGLYG
                     YLLAVVEVERPLPPGRILPGTGHAIFRLRYKALVYRPFLGEVLDGVIASVTRHGVFVA
                     VGPLSVFVSARNVPSDMEFDDSEQCFASVVQGSEDRLEVGTMVRLRIVGMRRDATEIA
                     AVGTLRADYLGVLG"
     gene            <80401..>81177
                     /locus_tag="CYME_CMD028C"
                     /db_xref="GeneID:16992581"
     mRNA            <80401..>81177
                     /locus_tag="CYME_CMD028C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535348.1"
                     /db_xref="GeneID:16992581"
     CDS             80401..81177
                     /locus_tag="CYME_CMD028C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535405.1"
                     /db_xref="GeneID:16992581"
                     /translation="MFCTLAGYRWLNSGSLLRRLSQRAVRRLPTAPLCHLHNGATESA
                     ASNGALRIVDEKVAYRRYATVFERTVQYPDGRHVTYDILGQPAVQSASVLVFPFDTQS
                     KTCYVIREYCPGPNRVLYGFPAGMVETKHESLEAAARAELSEEAHLRCAQLIDLTAQA
                     AVWERSFEVPNTASDAENCLRGFFADKYSRNVCKMYLALNPEPDGHPGSMDAEELIEQ
                     VGAVRVPQLEAWLWSGQMTMPHMLLAMCALTYLRQRGMLT"
     gene            complement(<82601..>83410)
                     /locus_tag="CYME_CMD029C"
                     /db_xref="GeneID:16992583"
     mRNA            complement(<82601..>83410)
                     /locus_tag="CYME_CMD029C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535349.1"
                     /db_xref="GeneID:16992583"
     CDS             complement(82601..83410)
                     /locus_tag="CYME_CMD029C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535406.1"
                     /db_xref="GeneID:16992583"
                     /translation="MPERPRLEQRKRKNSHDSRAGDDSFQRWRTQLLTRLRAAATGDD
                     DHDDAHSGHFLTLSGAELVNGGFPQTQRPSRGQTALLLSHKTSGTGTSTEYTGAVTLR
                     SVPTRVPATGTSVSALAVGDALYPRLTDTLPAYLEEGLVQSQRAGGKFGAGGNTDRRV
                     GLSSQLGRPLRRLASACRWTLLGAAGLAALILLTRLAAMAWGGIVAGSLLFVVLTLVS
                     WFVVGMIWRKNADVYAIARLTVFMSGFCMWFMWIMCYMDQMNPIIRPIRKV"
     gene            <84392..>85165
                     /locus_tag="CYME_CMD030C"
                     /db_xref="GeneID:16992584"
     mRNA            <84392..>85165
                     /locus_tag="CYME_CMD030C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535350.1"
                     /db_xref="GeneID:16992584"
     CDS             84392..85165
                     /locus_tag="CYME_CMD030C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535407.1"
                     /db_xref="GeneID:16992584"
                     /translation="MLAATSTAVDETGDQHSAVSTSDSDEWVVEAAALGVLQGKKVSE
                     FINDTDALRAVTRELAPSTKDSVDMERSQFAERFQVTVPSVLELPGGTDINQDQELET
                     RFRAIAALGAWIGTEWCAAHGIRTERPADYFAEMLKSDDHMARVRKALLEERQRLHEI
                     QRIRAEALTRLEAKRRQREARVRLQESKRAGFAEVEQWKREQGLSSGQAVGSERYRQR
                     VVQRNHSKAAGRPRGKRREIKKRPGKKRREQLRARRQQS"
     gene            <87010..>88113
                     /locus_tag="CYME_CMD031C"
                     /db_xref="GeneID:16992585"
     mRNA            <87010..>88113
                     /locus_tag="CYME_CMD031C"
                     /product="probable arginine methyltransferase"
                     /transcript_id="XM_005535351.1"
                     /db_xref="GeneID:16992585"
     CDS             87010..88113
                     /locus_tag="CYME_CMD031C"
                     /codon_start=1
                     /product="probable arginine methyltransferase"
                     /protein_id="XP_005535408.1"
                     /db_xref="GeneID:16992585"
                     /translation="MEYPEADSQPQPEPLDVVLPRGAPPDVVGPVVNGLSSSDYYFAS
                     YSHFGIHEEMIKDKTRTKTYMRAILDNRHVFDGKVVLDVGAGTGILSLFAARAGAAKV
                     YAIECADIARQAREIVKANHFDHVVEVITGQIEEVQLPRDPQTGAEPLVDIIVSEWMG
                     YFLFYESMLQSVLFARDRWLKPRDGHLFPDGATLYICGIEDASFRSEKFDFWENVYGF
                     DFSCVKRLALTEPLVDYVDVDQIVTDTCPVLRLDLHRLQPQDLDWSAPFHITAERDDF
                     VHAFVVFFDVHFGGCHRPLTLSTGPYASPTHWKQTVLYLDRALPLRTGERIEGTLACR
                     RNAQNPRDLDIGISYRFRGSQMSAKKILRYQMH"
     gene            <93421..>94446
                     /locus_tag="CYME_CMD032C"
                     /db_xref="GeneID:16992586"
     mRNA            <93421..>94446
                     /locus_tag="CYME_CMD032C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535352.1"
                     /db_xref="GeneID:16992586"
     CDS             93421..94446
                     /locus_tag="CYME_CMD032C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535409.1"
                     /db_xref="GeneID:16992586"
                     /translation="MDDPQKRANGMDWGVARWRSEGSRRDSLGPSSLNLMKSLVLETT
                     FVQPAQAHPFTVRKQRPSACCPWYGASSATRLLRRNLHRRPGAFVLHLSAKKVRELVR
                     IRLYPSDLSFRWNACRFCFWLKCRYGVAMRPPFPEVFNHIDAAMKEAFHGRNLRSVAS
                     IPDDWPDGTIDCSSAIENVRSQEFEVTTHAWVRFTITGRLDGLIRFQDETLGVLDFKV
                     SRAETSKLQETYAMQLHAYAFALEKAANLLDADDTSIAPVPLPPAVPRLALIVFRPDG
                     YELLPSSHESCLRGQTEFIPIERDDEGFYALCQEIAALFERPEPPAPSKHCETCSFYA
                     ARYPFQS"
     gene            complement(<95284..>96762)
                     /locus_tag="CYME_CMD033C"
                     /db_xref="GeneID:16992587"
     mRNA            complement(<95284..>96762)
                     /locus_tag="CYME_CMD033C"
                     /product="similar to periplasmic alpha-amylase precursor"
                     /transcript_id="XM_005535353.1"
                     /db_xref="GeneID:16992587"
     CDS             complement(95284..96762)
                     /locus_tag="CYME_CMD033C"
                     /codon_start=1
                     /product="similar to periplasmic alpha-amylase precursor"
                     /protein_id="XP_005535410.1"
                     /db_xref="GeneID:16992587"
                     /translation="MGGTLVLEIPARAWLYALGVGHSGLDGVPDAALNYLRTFDYVWL
                     QGVWQTGKLGVELDRGLPERRAVYDQVLPGWTEDDVVGSPYAIYDYRVAAELGGDDAL
                     KRFRERLHPTRLLLDFVPNHMARDCPWPERFFLHSMDGAEALPPVTETATRHWQNLQQ
                     GELERFQERHHQRLAGRDPYCGPWPDTAQLNYREPALRQHQCQVLCRIADMADGIRAD
                     MAMMVLNDVFEWSWRDAAAVETAGPAPDNKEFWEEAIAAVRQRRPDFLFLAEVYWDYE
                     ERLQALGFDATYDKKLYDLLHQRHLDRLRGYLRERSAEFHARCVHFVENHDEPRAASH
                     FGDVRVANAAAALSFLLPGIRLEFWGQSEGRRARLDVHLRRAAAEPERSVSSAQTGFY
                     DRLHRILMLPILRKGRFVYSDQGPMQHWRIITWNWYLDNRAPGDCDAIRHLHIAANYS
                     DEAVHYQHAYPCDLLNPDATNLCELSPWTVRVLCEQKVSASS"
     gene            <97415..>98125
                     /locus_tag="CYME_CMD034C"
                     /db_xref="GeneID:16992588"
     mRNA            <97415..>98125
                     /locus_tag="CYME_CMD034C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535354.1"
                     /db_xref="GeneID:16992588"
     CDS             97415..98125
                     /locus_tag="CYME_CMD034C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535411.1"
                     /db_xref="GeneID:16992588"
                     /translation="MFISLVRPVSFRAQNAPGAGNRCVPSTSRLARPCLRLSGEGLGS
                     GAARQAFSGLSRALAGLLASVWLLADPTVTQRSLAFAANPYDLGTDRGVQAVMVCREL
                     LEPIPRYVESGSWDKARSNVNYCTRTLRLHTALRAVTDRLLTPEYDLEKHESAMRVSS
                     DLPNVMTQLDATLYTPIFMASDQGVSPAQRKYGDEALGYLEQAKQMLDHYLSLLPSEV
                     RARNAAAAAQMRVPLERQ"
     misc_feature    complement(99019..100378)
                     /note="possible transcribed region"
     gene            <100471..>100953
                     /locus_tag="CYME_CMD036C"
                     /db_xref="GeneID:16992590"
     mRNA            <100471..>100953
                     /locus_tag="CYME_CMD036C"
                     /product="similar to Membrane transporters of cations and
                     cationic drugs"
                     /transcript_id="XM_005535355.1"
                     /db_xref="GeneID:16992590"
     CDS             100471..100953
                     /locus_tag="CYME_CMD036C"
                     /codon_start=1
                     /product="similar to Membrane transporters of cations and
                     cationic drugs"
                     /protein_id="XP_005535412.1"
                     /db_xref="GeneID:16992590"
                     /translation="MFWSADTIQNLPHYVYWCVLAVAVAFELMGTTFIREAKGFAHPA
                     AALKACLCYSVCTVLCVVAFAAHIDLSVGYTVWCVLGISATALIGKYRFGEQFTWLKV
                     FALLLCALGSMILVFQSEKPLFVTSKAADGRVEAIRAVSNGSLRSTGEPCLATQDALP
                     "
     gene            complement(<101496..>101852)
                     /locus_tag="CYME_CMD037C"
                     /db_xref="GeneID:16992591"
     mRNA            complement(<101496..>101852)
                     /locus_tag="CYME_CMD037C"
                     /product="similar to prefoldin 2"
                     /transcript_id="XM_005535356.1"
                     /db_xref="GeneID:16992591"
     CDS             complement(101496..101852)
                     /locus_tag="CYME_CMD037C"
                     /codon_start=1
                     /product="similar to prefoldin 2"
                     /protein_id="XP_005535413.1"
                     /db_xref="GeneID:16992591"
                     /translation="MESSEQAQGGSGFSPQVVALVRKVAELEAERAEYDLVLETLASL
                     EPEISLHAEADAETPVRIPRRCWQQVGDVLLERRKDEVLPMLESQRERLQHVIHELQR
                     QIHVMTESDRPETRTR"
     gene            complement(102188..105376)
                     /locus_tag="CYME_CMD038T"
                     /db_xref="GeneID:16992592"
     misc_RNA        complement(102188..105376)
                     /locus_tag="CYME_CMD038T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461228.1"
                     /db_xref="GeneID:16992592"
     misc_feature    complement(104945..106779)
                     /note="possible transcribed region"
     gene            <105811..>107247
                     /locus_tag="CYME_CMD040C"
                     /db_xref="GeneID:16992594"
     mRNA            <105811..>107247
                     /locus_tag="CYME_CMD040C"
                     /product="similar to apospory-associated protein C"
                     /transcript_id="XM_005535357.1"
                     /db_xref="GeneID:16992594"
     CDS             105811..107247
                     /locus_tag="CYME_CMD040C"
                     /codon_start=1
                     /product="similar to apospory-associated protein C"
                     /protein_id="XP_005535414.1"
                     /db_xref="GeneID:16992594"
                     /translation="MDHKITVNISKDPIQEVQDRYGTPGRLTFFRGKGGLEMVLLQTA
                     DGACAEVSFFGAQVLSWQPPSCTRSLLFVSKEAIFDRRRAIRGGIPVCWPQFSTYGAL
                     AQQHGYARNMSWELVHADGDHPEGPLVVFQLPTVTPAALAKMMGSSYANAIDGAASAS
                     AADVHGAGTAGAPSSSHQRDTGDAHHTESTAMSSKPMQTPSRLQTPIMTEQTTNGTDA
                     IPAVEDNSGAQPRSARGAEGAVAPPPDTSAAARYAPASSAVPEGATETILPANAVPRS
                     TSTIFETELQHAQVLMMVQLGAALGDLRLRMSVSNRAPNESETLEFTTALHSYLRVNS
                     LTQVRVLGLSGCEYVDRMRPQGMIIDSEPVLMFRDHEVDRIYRRQPGSSNAIRIEHVN
                     AQKGTVVVEASTDDFPEVVVWNPGPQKSHDLVDLDDREWMFMLCIEPAVVLEPVRLAQ
                     NERWCGHVRFTYLAGSSDIASAAKASGT"
     gene            complement(<108057..>109277)
                     /locus_tag="CYME_CMD041C"
                     /db_xref="GeneID:16992595"
     mRNA            complement(<108057..>109277)
                     /locus_tag="CYME_CMD041C"
                     /product="fructose-1,6-bisphosphatase"
                     /transcript_id="XM_005535358.1"
                     /db_xref="GeneID:16992595"
     CDS             complement(108057..109277)
                     /locus_tag="CYME_CMD041C"
                     /codon_start=1
                     /product="fructose-1,6-bisphosphatase"
                     /protein_id="XP_005535415.1"
                     /db_xref="GeneID:16992595"
                     /translation="MGTETSSLIQYLSQLRHALNVLENVECCTGEDHRQFPVYDAWLD
                     LVAVFMAISVAVKRVGVLVRRQGLSAGARPHEKHLSAASLEQAANRVWVEELVASQRS
                     CVLVSEDDPEPLVIDNATQGKFVVVFDPLTGRAQPPCGEMGAIFGIFRQLGQSDTQGD
                     EFNPRDVLQPARQLVGAGYALYGPAVLLYVSLGAGVQAFTLDGAMNEWIRTSPQVRIP
                     ICGHWYSLDEGSESLWDADLRSALHRFKESVSLNGERRSLRRTGSMVADLHRVMLYGG
                     VLLYPPCTAQPQGHLKLLYEAGPLAFLVEQAGGRATDGRLALFDRRPTTLHERVPAYM
                     GSVNDVELLEQLLAKIDRDPMFLLRRSVSVDEWGARSRLSDDVQATQAPWSPLQTVGG
                     VLASVPPFLLEDSD"
     gene            <110343..>111137
                     /locus_tag="CYME_CMD042C"
                     /db_xref="GeneID:16992596"
     mRNA            <110343..>111137
                     /locus_tag="CYME_CMD042C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535359.1"
                     /db_xref="GeneID:16992596"
     CDS             110343..111137
                     /locus_tag="CYME_CMD042C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535416.1"
                     /db_xref="GeneID:16992596"
                     /translation="MNWMWETPALGAAVALVVFAVAVRGLLFKRDPETRVPTRTGAAL
                     REENSSRPQRLVHGPPLQPPVSETSTPQRVLGAPRVVITIVEEVTSKSLWVHGESLDW
                     APWVPEWFRRLALLHFVDVYFILRVRNDQDCSLWYQQVGALCRSPAGQILDERKFLVC
                     DTAAGAAAMVRQLEPSLHLESLRLASECAVRLHRFIPKIIILAHEPEHTGIEPSTVLE
                     QFTRHDTQRAPFRTAVAVLDDPMAMFANPLWQEVELQVRAGIQCPR"
     misc_feature    complement(111146..113073)
                     /note="possible transcribed region"
     gene            complement(<115754..>117814)
                     /locus_tag="CYME_CMD044C"
                     /db_xref="GeneID:16992598"
     mRNA            complement(<115754..>117814)
                     /locus_tag="CYME_CMD044C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535360.1"
                     /db_xref="GeneID:16992598"
     CDS             complement(115754..117814)
                     /locus_tag="CYME_CMD044C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535417.1"
                     /db_xref="GeneID:16992598"
                     /translation="MLRHHPCKPLSTDVTGTHRVQAAADTPSRGRTRATHWYVLLVAL
                     WCFRVVLSLGTGNPYDGHKLRDGAEWVASSLLGVKGWVPVQFRRLGTENSLGAFSDVQ
                     APAIETGSLRVEGALQLLNLEQGAQFGAQQGSEVVGDTLFERSAEKLAAWMLFCWPWL
                     LATCLLRPLYAAAGAALSPRLLHQLPSVAFMQPLIALFEWALWSCLDSIPNASSLRWL
                     YIGTIWSWPSAVLLLQPSKEAFEVLAVLSICMWHNVSRITGKASQSAGNSFRKSAQLL
                     ERLCLFFAIYAACVSPSSMLYTLPLFAVAFSDHQQTATSARVYRRRPATQRSGFVLGF
                     FIVLRTLAALADVLANRIDWQMLADIASHWTAVLSVQTFRMGMLGLWRFQYRYRLDFV
                     WNTLPWMLGPHALSVVYGCFEIAFGERRNRCMLYRSSEQKRPRSSLRRFSRPSPKGGT
                     DWRRPTNIVITMAEPWLWVALVGLACYSVQLERDWPRLVAPCLGLVMFSLLNAQHAGA
                     GALRSFFCMIVVVHHVLVLLFMIFCREAGLALLPMYLFKTGLQPEHVIYVHTDMPPRM
                     LFTGPLASVQVHHLRAPSPAFLHYYTELELASSIAVRAYENATTSLTTDAKMRTSQAS
                     GDIVIAVPRGYPVPTNWSQLYRKSELFPHWSAHLSIQGRRDEALRPWIRSRLALDVYW
                     RSTP"
     misc_feature    118154..119787
                     /note="possible transcribed region"
     gene            <121809..>125627
                     /locus_tag="CYME_CMD046C"
                     /db_xref="GeneID:16992600"
     mRNA            <121809..>125627
                     /locus_tag="CYME_CMD046C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535361.1"
                     /db_xref="GeneID:16992600"
     CDS             121809..125627
                     /locus_tag="CYME_CMD046C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535418.1"
                     /db_xref="GeneID:16992600"
                     /translation="MTMRDEGAERAASEEAALEAHPVQPGPSGGYAKLFLKAFDPDTG
                     QTTSREYVIRKLVVSLGRSTAPDPERAFEAAAEGVDLGAGFSSKLSRRHATIQWNADQ
                     QRFEVVCNGKNGILVVHADTYRQLRPGDAAEPLDSYSTILLGDCLVVFVLPKATHVLP
                     GVAAVTAGVTASPTSDPAVQRLAPSRAGLQRVGAARSSSAPLARDFQRIRVRWNKSDQ
                     EALLRGLMRFGYGRWKEILQHAESGRLDRKPLDELIIMARRMVIMAALHAVGPENRAM
                     LRILASSGEGTRGSGSAAAASQQRELEQEVSSVAAGLSDTKTERRKYVRWARRFRLLH
                     RIERIVQNAAVMQRIEEGDLDISGKPPADCWGPIDDADLLRGVYKLGFGDFHRLWEEP
                     TLHFRERYRAPVTASAPQVEEDTRSDAQAARTGEPFEGSEASSREAEHDEQRNLLPTV
                     GECASPSKKSSVAASTAETPEADVSLSNNEASLTEAASLGGGSPADDLGIFAVDKSQR
                     PESTSRDERTPFPSSVELIRRLRIVVNRVARLIEPRNKEEAQLATPAAFAPEWPGNED
                     AVLARDCTTSVKRLAVSRIARQQALLTPKPDALTKNDLMMDAASLEWARGRLEKAQRF
                     NRRQVKEFERALVNYGLDYLPTERPDDPHGIVHDWLRFVRRCPFVQYMLPETLEEYYI
                     DFVRECYRVLATDPAESPQRKSAEPAGSEDDDDHDDDHDEERTPNESAAAAPEPPSAA
                     VVAEHSTLAPSADTVANASSSSNRYASASPEASIDPAMLERARDFPPSTLFPNLDRKR
                     ARKALVRLHLFRVLRLYVLALPAKSLADLIQSLGSVKLPQSSAGELPVWWRPVHDRAL
                     LYGIDRHGLGQGAFEQIAQDHELGFPQSIESYCAAQTFEGAQVLRMQLGFPRVHAALR
                     RARAVMDWICAALQARPLPTETSLYDDEARDAALARAQRIGTESKWMERLLYQFLAEN
                     NVPVRLQRTAPTGQSNATSGQDAANDSAEVAAATTTKSAAIACADDQALHRLEQPASN
                     VHADSSSEPMSGSVHSSVQHVKGRPRIFETLRILGFITRRMPGAPGQVRELTQPVDLG
                     NGLVLLSLGTLPSPSSMALAPASSASTDDSLQLLVPCGFRSVRQLQASGHWYETQVDL
                     ASTSDAEASYLYRVRQVEFVPPPAIGSSAASVASRDWIAPVEGGFDAMSSNLNTLWIR
                     VLNSTTETGLAAGTASFVTLVSGVERAGLADPLVQRYLQALVPTEEHADPPSSLRDDA
                     LPPQLSTTSD"
     gene            complement(<126672..>128522)
                     /locus_tag="CYME_CMD047C"
                     /db_xref="GeneID:16992601"
     mRNA            complement(<126672..>128522)
                     /locus_tag="CYME_CMD047C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535362.1"
                     /db_xref="GeneID:16992601"
     CDS             complement(126672..128522)
                     /locus_tag="CYME_CMD047C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535419.1"
                     /db_xref="GeneID:16992601"
                     /translation="MSSITLPDAIPPSKVRALTQPYRWLARPSFTGEFLGLDESGTTT
                     RTTQRYALRRRRHLHDAEQPASSPDIVELGPEHAALFGWLAPLQSTGHPLRSWQIQLE
                     CQKRELLQRWRERLAQELTDPYTLVLIFGGDRSDVNELLREQVTQRWRWLDLWPCQSV
                     RSVLEDVGNDSVSILVVDLLAVLADTAATQQLRDVLYFVANGARSSSATPSRFILYSA
                     LGPSFVGKSEQSPQFSEAANSAATRRDDQESVNVSSPKTSLMDAFTQSVLDELLTVRE
                     RPHFNTKSMWIPSLMRPLESTIMGNGLFLPGPLLFDATALMMLDKALRCGRLAFPGLL
                     QLIRYAYCWVQARLVEQPNAQAALESSQQMYASWIADLLPAWEMLQETCAILEMSLTP
                     LALQAHLMRSEFKNDHTLQQHFRAALAHASRDQLLVLSRVWKDAVLEGWILEPASVLQ
                     PSCNSNEARDSPPASMPAAAPTSRSSSREQTRTTACPTAAETTTVHLDEAKSLETVLV
                     TSKRRRQQLQAALAATHQRPGSLQRIRMLAVERFLTSRLVQALRPPPAPVAALFAFPG
                     AALAEASIPTSLFSSVTLPVAPGRRKNARNSDSSTSSAFEDSDAAHLSDR"
     gene            <129234..>129521
                     /locus_tag="CYME_CMD048C"
                     /db_xref="GeneID:16992602"
     mRNA            <129234..>129521
                     /locus_tag="CYME_CMD048C"
                     /product="cytochrome c reductase subunit 9(X)"
                     /transcript_id="XM_005535363.1"
                     /db_xref="GeneID:16992602"
     CDS             129234..129521
                     /locus_tag="CYME_CMD048C"
                     /codon_start=1
                     /product="cytochrome c reductase subunit 9(X)"
                     /protein_id="XP_005535420.1"
                     /db_xref="GeneID:16992602"
                     /translation="MSASRAQYAGFAAVRNSVYNLFMRRSSVFAIVIVALGYAGSEAM
                     NNSVERAWERYNKGKLWKHLEAEVRAKQAQEAAAAVAAATASDSETAQTAD"
     gene            <131122..>132657
                     /locus_tag="CYME_CMD049C"
                     /db_xref="GeneID:16992603"
     mRNA            <131122..>132657
                     /locus_tag="CYME_CMD049C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535364.1"
                     /db_xref="GeneID:16992603"
     CDS             131122..132657
                     /locus_tag="CYME_CMD049C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535421.1"
                     /db_xref="GeneID:16992603"
                     /translation="MNVEYGKPNGKVFNDSIHGHIYMPDYCVRVIDTPHYQRLRDLKQ
                     LGVVYWTFPGASHNRFEHGIGTAYLAGSMVTNLLSRSDSIAPQLATRSGPAQPSERAA
                     TRAHPLDPVALTSSTATDSGARQGLQSNWRDLERDLRLVRLAGLCHDLGHGPFSHVFD
                     HQLLPRRGIQSDVYGRFHEQRSAMLLAHMCQQFEVALDAMEEALVTDMILGRLSPQSA
                     RLTNRFLLAVVNNQRSGVDVDKFDYLTRDARYTLPRSAGFDYERFLRFSRVIGDEICY
                     HIKEANNLYDMFSTRMRMHKMVYNHRAVKACEFMITDAMVLADEFLGLSRSIQDPEAF
                     LQLSDWILKRIEFSTEASLGAAKSLIQQLQRRELYRFVGAALVPVSCASVSAGDLTAW
                     QSDGFVQLRPEDLIVHHQVINYGKEGGADPVEQVRFFVDWSTDETVGVRREQVSSLIP
                     SHFEERMLMVYSRRRDPRYVQAARQAFERMLQRQGGWSPPHRQVGAGEQLPQLFPDRK
                     TIA"
     gene            complement(<135089..>136909)
                     /locus_tag="CYME_CMD050C"
                     /db_xref="GeneID:16992604"
     mRNA            complement(<135089..>136909)
                     /locus_tag="CYME_CMD050C"
                     /product="protein phosphatase 2 regulatory subunit A"
                     /transcript_id="XM_005535365.1"
                     /db_xref="GeneID:16992604"
     CDS             complement(135089..136909)
                     /locus_tag="CYME_CMD050C"
                     /codon_start=1
                     /product="protein phosphatase 2 regulatory subunit A"
                     /protein_id="XP_005535422.1"
                     /db_xref="GeneID:16992604"
                     /translation="MEVAADTLNISTRSADATADATPVAALIDELRHDDVSLRIHAIQ
                     ELPRIAKAIGEERTRTELLPFVLETIDDEDEVLLALAGQLDERFLPYVGGKDYLSAML
                     EPLEQLAQVEETVVRERAVESILSLARCCEPGEHWFLDAFYPLLKRLAEGDWFTSRIS
                     ATALFATTYAGLVASETDARAELRSLFLSLAKDDTPMVRRAAASHLAEFAAALEPVHV
                     SGFLLKLFAELAEDDQDSVRLLVVENAEKIVSLLPETDRPTLFALVLRLAADKSWRVR
                     YLVADRLSTIKPDGMVGIFCRLLRDGEAEVRTAAALKLADVVRAASSEATVQELVPVM
                     KELVHDANQHVRTAVAGSILALAPIMGRSHTLQVLFPLVLILLKDDCPDVRLGVISNL
                     DQLSAVVGIERLVSDLLPAIVELAEDRNWRVRLAIIQHMASLAKQLGRQYFDLDRKLG
                     LLCVAWLTDAVYAVREAAIKNLAELVRLFGASWAIEQAIPCVQRIFETSTSYLYRITA
                     LQAMGELATVLDPGTNEKYLLPLLVQKASSDPVPNVRLVTAKTLMRLAPYISKQARMT
                     QLRPALEAHSSASDAETDVDVAYQADKALVHLSAMDQETP"
     gene            <137944..>139305
                     /locus_tag="CYME_CMD051C"
                     /db_xref="GeneID:16992605"
     mRNA            <137944..>139305
                     /locus_tag="CYME_CMD051C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535366.1"
                     /db_xref="GeneID:16992605"
     CDS             137944..139305
                     /locus_tag="CYME_CMD051C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535423.1"
                     /db_xref="GeneID:16992605"
                     /translation="MFVETFAVLAGARLATLWRLRANTVCSGVVSHRPRLASGAVASG
                     ARQRRTPRGGLKAARRNLHMTAEATPIQPSREDVLLGQLVFMQPELLPKFIEENLEEF
                     DAAFYEFLQQKIDTTKDLEERVTLSTLKDAITDLMNELLRKQGSEMKSAKPEERPDDS
                     EMTLQRELEQLYQSLAQHASDEDRLRVAVAANYDRFTAAFLNYVFERAHGEQNNSAEA
                     AKVAQAINDEMKSRMDRAAQRLSEVLRSGAPKAMSMKLREIGANGGIDEAFMLIMQAN
                     IERAKKEGANAQVISILESLRQEASRIIDEAVKDKELRLVRALLRTEDPEQRRQMLFA
                     AFSPRDRVFIAPDANSEAQMEIDGKRFLEILRELIEKYGAIDEKLVSRCREIGDQADE
                     VARELLELVGKSPREIQDEAWMRTLSVFELERMEIQAEMEGRKLPWQERPPGFDEQGR
                     RHL"
     gene            <141248..>143182
                     /locus_tag="CYME_CMD052C"
                     /db_xref="GeneID:16992606"
     mRNA            <141248..>143182
                     /locus_tag="CYME_CMD052C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535367.1"
                     /db_xref="GeneID:16992606"
     CDS             141248..143182
                     /locus_tag="CYME_CMD052C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535424.1"
                     /db_xref="GeneID:16992606"
                     /translation="MKRKRALRRLQPGQQQLKPVPRHESSVWVCCPACHERLAAASLS
                     FHTLYDCSERRSQDVLASANSSTISTWDRLPDETPGSADPARDACLAQTQAQQNSSES
                     AGCHRNTTGAASSSSSTASQPDVSTTNTSLQAAYQTLTADVPYTSSAHSEARNAFRLL
                     MTPQRYLACYWTMQRFYRGNDATGANGTYLRSELLFAGDSRLERLLTEPCWRCLGSTR
                     LADALWRPSNVREQYADASKIRTQVIWLAHKSLFEHDAYVPATKLLEGREPRLPRALL
                     LSALQKSIRRARWPQVVRLSRYLIDRYGLGMVARRLLVITVEDSMAHPAMPILAWFMG
                     TASKGYQPTAADVDAVLRFAAEISSVAVRDLQVSRRYHSIEAFQHDWAVCEEAFGTLV
                     PAPARALVASLLLRALFGGMHGDQLMMREYAVEWLRRFLLDTQRDPLQLEIPAAPLAM
                     LQDSMPSPKIPSVDQAWYAVADAAAATAPSWLQFLEKLYERVRSLLSSQQIRWEADQC
                     VSITDIPPAAVGPFSGLPSPTSERVQRSRFWQRISRTLLDYAPKAAPEDTWASLIWHL
                     RAKLNVRPCWSVVFDDNDEDDNSTFTVALQLADNACEQLQPFFTSAQQRVCWQNIAPQ
                     VEALSMMVLRRYFSEHQTRG"
     gene            complement(<143214..>144218)
                     /locus_tag="CYME_CMD053C"
                     /db_xref="GeneID:16992607"
     mRNA            complement(<143214..>144218)
                     /locus_tag="CYME_CMD053C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535368.1"
                     /db_xref="GeneID:16992607"
     CDS             complement(143214..144218)
                     /locus_tag="CYME_CMD053C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535425.1"
                     /db_xref="GeneID:16992607"
                     /translation="MAFQVFIGSGRRSTSRLGLCRTVVKSRPRSSVCAIKRAARTPRA
                     CAWVTNEASVTAPGTKGVQSIESETVQNKNTRIKWFLGAGVLFCVVVVFYQLGHQPWV
                     HARFSSLVQRLVTLADQHGPGKIAAAFALLHFVAIVLCFPASALIEVAAGYTLGFPLG
                     FLSMHLSKLGAAIACFILGRTVLYGYVQKQCQRFPRFRYWLDIVRREGPSMMLYMRLS
                     PVPSFINNYLLAAVGVRFSDFLWTTTLGIVPGLLPLVGAGVGARDLSLLSMGADGALP
                     KAATVPSWAHTLRLGSTIVGAVLLVGFLVRLYRQRIEARSQVLAKEPVGEDSADRGPR
                     "
     misc_feature    144517..146380
                     /note="possible transcribed region"
     gene            complement(<145661..>146791)
                     /locus_tag="CYME_CMD055C"
                     /db_xref="GeneID:16992609"
     mRNA            complement(<145661..>146791)
                     /locus_tag="CYME_CMD055C"
                     /product="similar to mitotic check point protein BUB2"
                     /transcript_id="XM_005535369.1"
                     /db_xref="GeneID:16992609"
     CDS             complement(145661..146791)
                     /locus_tag="CYME_CMD055C"
                     /codon_start=1
                     /product="similar to mitotic check point protein BUB2"
                     /protein_id="XP_005535426.1"
                     /db_xref="GeneID:16992609"
                     /translation="MSGSALERLSSETTDSSRSSPTCKYDRRGASLGRAVGSTGMAAT
                     ATEQSAGWQDALREANASALRKWLASGRLLPSEASDVLDVSGELCGSNRLEGTQVVAC
                     QSLFPKELRTPRGASWLLLSQRPRNDARSTVPSYVDLLDSIGTSFARYKQLWEKIEQD
                     IPRTFRGCDTVRHRVPPEALARVLLAVAVHNNQTYVQGMNLYAASFLHVLPEPEAFRL
                     LVCLVEDYAPRYLQVNSVAGAYEGCRLAARTIQHVDQELATMLSGDPLGLERALLVHG
                     FPAVLSFSLCIPPFEDAMPLLDWILAFGAHFGVVFVVARLRCAREQLLSRTVTVKEVL
                     NPRKEQDAFRIPPAAIIRESLKIVAQLPAHLWQQLQKHPLDA"
     gene            147123..148728
                     /locus_tag="CYME_CMD056T"
                     /db_xref="GeneID:16992610"
     misc_RNA        147123..148728
                     /locus_tag="CYME_CMD056T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461229.1"
                     /db_xref="GeneID:16992610"
     gene            complement(<150808..>151290)
                     /locus_tag="CYME_CMD057C"
                     /db_xref="GeneID:16992611"
     mRNA            complement(<150808..>151290)
                     /locus_tag="CYME_CMD057C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535370.1"
                     /db_xref="GeneID:16992611"
     CDS             complement(150808..151290)
                     /locus_tag="CYME_CMD057C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535427.1"
                     /db_xref="GeneID:16992611"
                     /translation="MFVGSVNVLRKPRGCCFHGWKYWAIERQERLERRQRHVAFRSPS
                     SKTGRPSLSMELSDEVLTALIVGGLGTIAGIGLLAFTEVQGERGKARGRREPCVECRG
                     DGQVACGYCQGRGKLGFGQYEKECSYCKGRSTVVCLNCGGSGLQPRYLDRIRPEDLMD
                     "
     gene            <151962..>153623
                     /locus_tag="CYME_CMD058C"
                     /db_xref="GeneID:16992612"
     mRNA            <151962..>153623
                     /locus_tag="CYME_CMD058C"
                     /product="fumarate hydratase precursor"
                     /transcript_id="XM_005535371.1"
                     /db_xref="GeneID:16992612"
     CDS             151962..153623
                     /locus_tag="CYME_CMD058C"
                     /codon_start=1
                     /product="fumarate hydratase precursor"
                     /protein_id="XP_005535428.1"
                     /db_xref="GeneID:16992612"
                     /translation="MSAQRARAVSSLWASLRPLEAYLAAGEYQGGPVFQRRPASTGIR
                     GGTSHNAEHALPGGGVRSALQTTPPVASYTRCFGSSVERPAMQGDTRTERDTFGPILV
                     PADRYYGAQTARSLRNFDICRDTDRMPRPIIHAFGELKRAAAKANMALGVLDSRLGEM
                     IVRAAEEVATGKLDEHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGELGSKSPVHP
                     NDHVNMSQSSNDTFPSAMHIAAVLEIERKLLPGLRDLRNALQNKSTAFEDIIKIGRTH
                     LQDAVPLTLGQEFSAYVQQLEFGEQRMLNALERLRYLAIGGTAVGTGLNSRRGFDELV
                     CRELSEHTGTVFRPAPNKFEALAAHDAMVETSGALNTLAVSLTKIANDIRFLGSGPRC
                     GLGELQLPENEPGSSIMPGKVNPTQCEAMTMLCAQVMGNHVAVTIGGSNGHFQLNVYK
                     PLIAYNVLHSTRLLTDGMKSFELHCVHGIEANRERIAFLVERSLMLVTALNPVIGYDK
                     AAAIAKKAHRENLSLREAALASGYITAEAFDQAVDPRRMLAPAET"
     gene            complement(153522..155177)
                     /locus_tag="CYME_CMD059T"
                     /db_xref="GeneID:16992613"
     misc_RNA        complement(153522..155177)
                     /locus_tag="CYME_CMD059T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461230.1"
                     /db_xref="GeneID:16992613"
     gene            <155308..>155976
                     /locus_tag="CYME_CMD060C"
                     /db_xref="GeneID:16992614"
     mRNA            <155308..>155976
                     /locus_tag="CYME_CMD060C"
                     /product="20S core proteasome subunit beta 7"
                     /transcript_id="XM_005535372.1"
                     /db_xref="GeneID:16992614"
     CDS             155308..155976
                     /locus_tag="CYME_CMD060C"
                     /codon_start=1
                     /product="20S core proteasome subunit beta 7"
                     /protein_id="XP_005535429.1"
                     /db_xref="GeneID:16992614"
                     /translation="MIETPTHTTEPIVTGSSVLGVQCVDGVVLACDTLASYGSLARFQ
                     RITRLHQPAPGVVIAGGGEYSDLQQLFRITDNIFRQEFCQEDGYELSPRALHSYLARV
                     LYGRRSRMDPLYNSLAVAGKGRFLGCIDLYGTAFESEAVATGIGALLALPLIRKQWHA
                     ALAMDEGVRLLEECLRVLYYRDCRALRSVQVAKVSDSGEVLISEPYELSNLQWKVAQA
                     AEEV"
     gene            complement(<156389..>157510)
                     /locus_tag="CYME_CMD061C"
                     /db_xref="GeneID:16992615"
     mRNA            complement(<156389..>157510)
                     /locus_tag="CYME_CMD061C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535373.1"
                     /db_xref="GeneID:16992615"
     CDS             complement(156389..157510)
                     /locus_tag="CYME_CMD061C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535430.1"
                     /db_xref="GeneID:16992615"
                     /translation="MKFMDLPSVSALNADLNQVPLPPGGHTVLTCVLETYSCKATNSD
                     KKVAHSLENRLSEQAQVECVSPQGVGARAQRTNPHQRKVLIYLILALNTSFPEYDFSG
                     VASRALECFKPCPPTAVQHDIDLALQEAYRYIDEQHESLRRGLPRNTTSLSAKDHWPS
                     GIGRIPRRRQHASGRCGPQIQSGTSARTLAIASAPYRRKRVLDHERVVASAPCSQRGL
                     AGKSLASSALGQSSCESLTSLLGTRERLWTTVQQVIAFPNCEIYTYVEADDTDGPFHE
                     PGIIWSFNYFFYNHALRRVLFMKATAVQMLHPERVPTLEWLEGESFIQSDSATEDERI
                     AEGTVSPMGETRECEAASGAVGILRKHRSDAQLIFDLNP"
     gene            <160133..>160807
                     /locus_tag="CYME_CMD062C"
                     /db_xref="GeneID:16992616"
     mRNA            <160133..>160807
                     /locus_tag="CYME_CMD062C"
                     /product="small GTP-binding protein of Rab family"
                     /transcript_id="XM_005535374.1"
                     /db_xref="GeneID:16992616"
     CDS             160133..160807
                     /locus_tag="CYME_CMD062C"
                     /codon_start=1
                     /product="small GTP-binding protein of Rab family"
                     /protein_id="XP_005535431.1"
                     /db_xref="GeneID:16992616"
                     /translation="MSVRPDDEYDYLFKIVLIGDSGVGKSNLLSRFTRNEFNLESKST
                     IGVEFATRSVQTDGKVIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDISKRSSFEN
                     AERWLKELRDHADQNIVIMLVGNKSDLKHLRAVTTEEGQQYADARGLSFIETSALDAS
                     HVEEAFVRILTDIYRLVHKRHLASGDPTVAKSASGAVYQAGRGETISVGNLSHDNRSS
                     KRKCCS"
     gene            complement(<161009..>161689)
                     /locus_tag="CYME_CMD063C"
                     /db_xref="GeneID:16992617"
     mRNA            complement(<161009..>161689)
                     /locus_tag="CYME_CMD063C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535375.1"
                     /db_xref="GeneID:16992617"
     CDS             complement(161009..161689)
                     /locus_tag="CYME_CMD063C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535432.1"
                     /db_xref="GeneID:16992617"
                     /translation="MGTGALVHVLGFSTAGNAGGARKLPIRWRRRSGCGCCAPNQWSY
                     SRSATTTVAFAWDWLLAPRSVVENKGVLAALAQSNEQAIVRMVREPARQLWVEDGISL
                     PAPFPETNMPTLPFSEGLTAAPNLRPHWEGIRSSETEDRTLILFENLSDSGVVVEVNW
                     IDFNGQEIPFGWLEPGKSRFQPTYVGHPWIIRDSNTGEVMLLFVTQNAFGTAVVHSGH
                     QVEYSYPL"
     misc_feature    complement(161839..164862)
                     /note="repetitive element"
     misc_feature    164457..167530
                     /note="repetitive element"
     gene            <167564..>168292
                     /locus_tag="CYME_CMD066C"
                     /db_xref="GeneID:16992618"
     mRNA            <167564..>168292
                     /locus_tag="CYME_CMD066C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535376.1"
                     /db_xref="GeneID:16992618"
     CDS             167564..168292
                     /locus_tag="CYME_CMD066C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535433.1"
                     /db_xref="GeneID:16992618"
                     /translation="MPPPNDSQRYFEEGPVLAHRTDWKPIAERSTAQRPEPALQATTE
                     APSWWRQVTRRGARVFLFYALLYPLLVLCVVGGIVGGFIGGFWLDWHAIRLAGNAWLA
                     LVSIPYATGFLALLWLMRAESFRGASAGALSFASNALGNAASRCTARLLLSLSISGSL
                     ALPAFLFLSRRVPADAALICTAGTAVICASLALWAFVLESDWLEPRTWLEPTAPSNVW
                     IRPSYWPRREHYIDLEAAPTRTGG"
     gene            complement(<169285..>170284)
                     /locus_tag="CYME_CMD067C"
                     /db_xref="GeneID:16992619"
     mRNA            complement(join(<169285..170066,170152..>170284))
                     /locus_tag="CYME_CMD067C"
                     /product="probable prohibitin protein"
                     /transcript_id="XM_005535377.1"
                     /db_xref="GeneID:16992619"
     CDS             complement(join(169285..170066,170152..170284))
                     /locus_tag="CYME_CMD067C"
                     /codon_start=1
                     /product="probable prohibitin protein"
                     /protein_id="XP_005535434.1"
                     /db_xref="GeneID:16992619"
                     /translation="MRFPLSSGGFGSGGGGGAVNTRLVGLGVTALVGAAAFYKYALYN
                     VEGGHRAVIFNRLVGVKPTVVPEGTHIRIPWIDVPIIYDVRAKPRSISTLTGSRDLQM
                     VQITIRVLSRPDPRQLPVIYQTLGLDYDERVLPSIVNEVTKAVVAQFNASQLITQREQ
                     VSRLIQRNLIERAKDFNILLDDISITHLAFGKEYTAAVEAKQVAQQEAERGRFLVEKA
                     MQDKKATIIRAQGEARSAKLIGDAMKSNPGFIELRRIEAARDIAQKIAKSSNKVFLDA
                     GILQLQLDSSERDEDLVRALNANPGSKK"
     gene            <170992..>171249
                     /locus_tag="CYME_CMD068C"
                     /db_xref="GeneID:16992620"
     mRNA            <170992..>171249
                     /locus_tag="CYME_CMD068C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535378.1"
                     /db_xref="GeneID:16992620"
     CDS             170992..171249
                     /locus_tag="CYME_CMD068C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535435.1"
                     /db_xref="GeneID:16992620"
                     /translation="MGGTPRYPYPRDVWSPAGGWWPHPRAWRRNTAVAAFGLVLVLTP
                     IFIYSERISERPEDAARQIPWRPWVKVRANSMTSETEPGQH"
     misc_feature    complement(171414..171910)
                     /note="possible transcribed region"
     gene            <172378..>173019
                     /locus_tag="CYME_CMD070C"
                     /db_xref="GeneID:16992622"
     mRNA            <172378..>173019
                     /locus_tag="CYME_CMD070C"
                     /product="probable FKBP-type peptidyl-prolyl cis-trans
                     isomerase"
                     /transcript_id="XM_005535379.1"
                     /db_xref="GeneID:16992622"
     CDS             172378..173019
                     /locus_tag="CYME_CMD070C"
                     /codon_start=1
                     /product="probable FKBP-type peptidyl-prolyl cis-trans
                     isomerase"
                     /protein_id="XP_005535436.1"
                     /db_xref="GeneID:16992622"
                     /translation="MFLSGIGLDGIGVHTRATNAGIKNVRPGCRRRAAGAFRSGSVST
                     SMTLTRRRLLQLGLGQALVWTLSGLAWDKARAANEKDVPELPFPVQVLEKGTGPQPQT
                     GDLVGIRFRAAYNGRVFDDIMDSSEPFYMRVGSGNLVKGVEEAVKRMHVGDLWRLELP
                     PAYAFGSKGRKPSPGKPAIPPNATVVYEVRLDEVPGREQELLEVTGGELREND"
     gene            complement(<174138..>177812)
                     /locus_tag="CYME_CMD071C"
                     /db_xref="GeneID:16992623"
     mRNA            complement(<174138..>177812)
                     /locus_tag="CYME_CMD071C"
                     /product="unknown ribonuclease"
                     /transcript_id="XM_005535380.1"
                     /db_xref="GeneID:16992623"
     CDS             complement(174138..177812)
                     /locus_tag="CYME_CMD071C"
                     /codon_start=1
                     /product="unknown ribonuclease"
                     /protein_id="XP_005535437.1"
                     /db_xref="GeneID:16992623"
                     /translation="MRQKLSSAFAVNVTRLRLRLRVKRSKAWQAPATKCAPAVEPVGP
                     RCCLRDTTASERVARTQFASSSSQAAGSERHLDLSCAQVAAVAGEEQLVHLHEREQAP
                     SCALAMQGAGKSDDDVAGGESVFLRAQATPQKLVRCRQHYRTRCRKCFPLQETAPGSK
                     RVTRPVATKHAPHERDDGSLERWLGELGWLRPTRHRHDDLGMDESGRQAFRLGKKLQQ
                     LLREHPEARTTIVHAVSEVLAQFMAGSVESGRDRVLFIAAWMMQSLVRDAPVTPSSTR
                     PAFSSSMSASRDQFVWTDNTLRGILTAVDAVLCRDSMCPSSAHRWAFDDHPQLDTDVA
                     QDVAPANIRQLHQSLASEVLHWRLLLAPEDDAANAKRFADPRILVNMIRQWQLHTLHP
                     AAAEQAVVLMRACVSRRCWRAAVDLLQMLGRLGVLDGVVWGEERSRLFQELVAQQQWS
                     LARECAESWNGLQGVDTLHFLRGRVVADPPCVSSAGRVADLRPLHGIALMDLDAIPTP
                     ALTAQRTGEPASQVTDSSPTTAAAMDSPPLSVLRLPPHVRIHMVDTPVAVHTLMQFVE
                     SILHQHSDSCTADTPWLDPHCVGLDVEWRPVRTSGLQPRCALLQIAFPADVFLVDLLR
                     IDADALFAMRLNEALRRLFRSPAILKVGFCFSSDFVRLRHSYLGLSCFDAIVALRDLD
                     RIGSEGTDAFCADLATLVGRTSVRRRGRLTVGLAQLVAVFLGRAFDKRPRCSDWEARP
                     LTRAQIEYAALDAWVLLALRRHVPCASASLIRTGWRTAQAALARIERITVAAADASST
                     LGHVSGEDTSHALHYDALQRVCDALQRAPERWRRRPVYRVGETLLAGPFCLVDRLAAL
                     ERAPASLQRAAADRMGKCIALIAGGAEQRPILVVMQGQRRAPLREIAERLGLGSGALR
                     FATPFELETIFGFASGAVSAIGLRCERVDGGHGSWTPVLTFMDAALRRGEVADGGKDA
                     ADDLMFLSGGSPESVVALRASDLQWHRQAVWLTTTATTSHPESNVRAVVSDTAALLTD
                     KRRLRASATWTETYFDDRCRGYFVVDSTMGGLVRRLRALGLDVLHTCGKDLALLFELV
                     WTREEDVRSPSASKPRVILTRDADVLARATRYGVPCYYVSSTKTESQAREVLGKFRLS
                     PAPENFLARCIQCNCARFEQRSREEVQTLLPQRTVNSFHIFYECARCHQLYWKGAHFT
                     RATRQLEELVRQLRCDAQQT"
     misc_feature    177731..178562
                     /note="possible transcribed region"
     gene            <179125..>180774
                     /locus_tag="CYME_CMD072C"
                     /db_xref="GeneID:16992735"
     mRNA            <179125..>180774
                     /locus_tag="CYME_CMD072C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535381.1"
                     /db_xref="GeneID:16992735"
     CDS             179125..180774
                     /locus_tag="CYME_CMD072C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535438.1"
                     /db_xref="GeneID:16992735"
                     /translation="MFVASESFVKTGTSRSSSACSRGFQRTTSRARRCFVFSLARGAD
                     NATPGYASRTPRLLDCQLSRRTLLQLLGCGLLAVSASPAASAPYEKSKVQAQAVLGEP
                     QGKQSWATRLAPYSSDTIYRLATSGEHASVLAVDEEACLDALARSADLVLVGDHPRSQ
                     TDHAMEARIVAALALRVAPNQDYSQERSSLAVASDAFEQAHQSHLDDFIQGRIQEEEL
                     YERTKWDERCMWPYERYLNLLRTCRSLGVNLVALSMQNTHRKALEKQGLRYLQENHAV
                     RRLYFPEREGICDELVQYASSPAYRLFASQVLEPFFMTMRRYGSTDPDVSFASFSEAA
                     LVQDAAMAAVLRRWMTKRKRHPRATASRCRLLACCELPHVAFGQGIRGMLEWWQKLDN
                     EKQRAQHGTAGATVDAARPATLLGADPTDSVIPEEGPTEPMLSIQTLVLNPTVVDVGS
                     RTVPGTERRDLFSGRRIRRLRLELPRNMMEESPLLVSPKRAFNGILDAEPKELHASAA
                     QTSAPNGDASIGSSESPVSTAPLVIGDYLWISASKKGRIQV"
     gene            complement(<181306..>181665)
                     /locus_tag="CYME_CMD073C"
                     /db_xref="GeneID:16992625"
     mRNA            complement(<181306..>181665)
                     /locus_tag="CYME_CMD073C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535382.1"
                     /db_xref="GeneID:16992625"
     CDS             complement(181306..181665)
                     /locus_tag="CYME_CMD073C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535439.1"
                     /db_xref="GeneID:16992625"
                     /translation="MHLDVHGNALKTMPPATGCCTALLTLNLGRNQLRTLPSELAMCS
                     DLRSLQVYENDLQLPLPEAFQTAYLHLGNLNWRGNPAFAHVPAVVERQGLRALLTYFT
                     RPLAASASHRVTDAGRS"
     gene            complement(<182798..>183769)
                     /locus_tag="CYME_CMD074C"
                     /db_xref="GeneID:16992626"
     mRNA            complement(<182798..>183769)
                     /locus_tag="CYME_CMD074C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535383.1"
                     /db_xref="GeneID:16992626"
     CDS             complement(182798..183769)
                     /locus_tag="CYME_CMD074C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535440.1"
                     /db_xref="GeneID:16992626"
                     /translation="MCSGSFPVRPTLTREELERETSERTRVALAEVLARKRRAVTTTS
                     KHEQVRPFPYELQRSLREEVHELATSDASAHSQRDLRSLDPFRPPRRQRRRKNSAGNN
                     KGSQDLFDSVPIHDDSESAGAGGKAAAASDTDAEPEYQQVSLVRTTNCSMVPVSAAPA
                     LLDSSQLQTSVKHLRVPPVKNGRFGPSARRMWTGSTVDATGGIPAYGYGSTFAAPAFT
                     EFATALARATGDLSKQRNALRSSDGCTREHLQPTEGKHGMGSQKRSQPALESQGSLKS
                     TRSLEMESIPSNETFQNGCNAVDASASPTQTTSTFTNHRRRRTRWDR"
     gene            complement(184028..186777)
                     /locus_tag="CYME_CMD075T"
                     /db_xref="GeneID:16992627"
     misc_RNA        complement(184028..186777)
                     /locus_tag="CYME_CMD075T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461231.1"
                     /db_xref="GeneID:16992627"
     gene            <186812..>187453
                     /locus_tag="CYME_CMD076C"
                     /db_xref="GeneID:16992628"
     mRNA            <186812..>187453
                     /locus_tag="CYME_CMD076C"
                     /product="guanylate kinase 1"
                     /transcript_id="XM_005535384.1"
                     /db_xref="GeneID:16992628"
     CDS             186812..187453
                     /locus_tag="CYME_CMD076C"
                     /codon_start=1
                     /product="guanylate kinase 1"
                     /protein_id="XP_005535441.1"
                     /db_xref="GeneID:16992628"
                     /translation="MGAAAAAPRCLVLAGPSGVGKGTVLARLSQVLPDVFGFSVSHTT
                     RAPRPGECDGREYHFVTEEEFQRARAEGRFLETASVHGQWYGTSWEAIERVRRTGRIC
                     VLDIDVQGVRSIRAAKLPALVVFLRPPSMAELERRLRGRGTEDEAKIQRRLETAAEEL
                     RIAHEEPSLFDAIIENQDLEETCAQLRKLLDEDVQALRGVREAGAASAAQRTS"
     gene            complement(<188578..>189792)
                     /locus_tag="CYME_CMD077C"
                     /db_xref="GeneID:16992629"
     mRNA            complement(<188578..>189792)
                     /locus_tag="CYME_CMD077C"
                     /product="similar to methionine--tRNA ligase, partial"
                     /transcript_id="XM_005535385.1"
                     /db_xref="GeneID:16992629"
     CDS             complement(188578..189792)
                     /locus_tag="CYME_CMD077C"
                     /codon_start=1
                     /product="similar to methionine--tRNA ligase, partial"
                     /protein_id="XP_005535442.1"
                     /db_xref="GeneID:16992629"
                     /translation="MTIVSPNLCPEWVALCRAATARNRFESVSELVTACRQALPTHSE
                     LLGGGSLQSERTKFIERMLERLQRESLETFAGKVLPDVLARGEKTFLCGPVVTALDVA
                     AARATAPVFETWVKDGLDAAQRSNLVQVWRWFDLMQNLLHRYGHADRVELVPLPPKAW
                     FRSTTAQAPMFGVAGLSSTAARSGTESQSGQQEDQETRAGVEAAPAPGSAVASSKTAK
                     TTRVETPKDASGDGRSDLARVDIRVGEILTAKPHPDADALYVEEIDIGRDSGPVTVCS
                     GLRKYIPDAAELLGPCIVVANLKPVKMRGIVSEAMVLCATSADGTQVELVKPPPGAKP
                     GDRVYFPGTDADRDNQPDAQLNPKKKIFEKVAEHFRTSTDPSCEARYGDIPFTTDKGP
                     CRAATIQGGTIR"
     misc_feature    188909..190259
                     /note="possible transcribed region"
     gene            complement(<193068..>193316)
                     /locus_tag="CYME_CMD079C"
                     /db_xref="GeneID:16992631"
     mRNA            complement(<193068..>193316)
                     /locus_tag="CYME_CMD079C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535386.1"
                     /db_xref="GeneID:16992631"
     CDS             complement(193068..193316)
                     /locus_tag="CYME_CMD079C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535443.1"
                     /db_xref="GeneID:16992631"
                     /translation="MQAPEQASIAALEELLLAVRDMNSTVESLQSKTQELSEKLRLVE
                     QLASAIDTSLRAAVYESRTLGPEWKDDSCDASAPHAGG"
     gene            <194968..>197412
                     /locus_tag="CYME_CMD080C"
                     /db_xref="GeneID:16992632"
     mRNA            <194968..>197412
                     /locus_tag="CYME_CMD080C"
                     /product="phosphatidylinositol polyphosphate
                     5-phosphatase"
                     /transcript_id="XM_005535387.1"
                     /db_xref="GeneID:16992632"
     CDS             194968..197412
                     /locus_tag="CYME_CMD080C"
                     /codon_start=1
                     /product="phosphatidylinositol polyphosphate
                     5-phosphatase"
                     /protein_id="XP_005535444.1"
                     /db_xref="GeneID:16992632"
                     /translation="MSGGRISSSDALRLRVPATARLSTASTSLSWSAGTQRSQPQASP
                     AAAAQSVPELDRGAFLRRDYVNREIERRAAEYTRTRELRFFVSTFNVNAKPPVFDLSP
                     LLKDHRATPASRDALWESWAGAHGAALGPPSAGMKAGIPEVAADAGDVLIFGFQEVQK
                     LSGTAAVITDESQGRPWRDSIQALLDSIGSYVCVVQRQLVGILLLVFVRADHANAVQN
                     VQITSAGTGIAGVGGNKGGVAARFQLYDTNICCVCCHLSAHEQNLEKRNAEYRAIMER
                     VVFNPMSDDNGNPAPLLPSYPGSYAVPQTTSILDHDVVFFFGDLNYRIALRPEEVLRC
                     IKAGDWQYMASHDQLNSCRSMGFAFEPFSEAPLQFAPTYKYKPFENEYDSDPDKPGTL
                     KRTPAWCDRILFRGNGMRIRSYRRHEIFASDHRPVSAIFTVPIQQIDRERRQAVCDRL
                     WREISRRENETIPRLAVSENDIVIGTVRFRSPLYVHFTITNVGRVRTRWYLPLQYIKK
                     WMHCVPSSGELEPKQQVRVQIKILVDEHCGYSAMLAEAPRIECTLVAQAENGAACFVA
                     LHGRYAPTIYGCSLELLASRNGGNGFMVPELWLMGDALLHRRILGTNRNLFVENCPDT
                     QAVESLRDALANTTAAVREEALEKAPPLALGQVLVEFLRYLETPIVPFDLYDDFMQAA
                     GSGDARAVLHVMTRAPPIYRNTFVYVLAMVREHLQRLALDLRSERDANPTASLTLRLA
                     HAFGTALLRRRPSEQAAGGDAGDAHLDRARCLLPLLRALETADDTRDSDAASQTTEDA
                     SNGSAFPLYELLFDSV"
     gene            <198745..>199800
                     /locus_tag="CYME_CMD081C"
                     /db_xref="GeneID:16992633"
     mRNA            <198745..>199800
                     /locus_tag="CYME_CMD081C"
                     /product="probable O-sialoglycoprotein endopeptidase"
                     /transcript_id="XM_005535388.1"
                     /db_xref="GeneID:16992633"
     CDS             198745..199800
                     /locus_tag="CYME_CMD081C"
                     /codon_start=1
                     /product="probable O-sialoglycoprotein endopeptidase"
                     /protein_id="XP_005535445.1"
                     /db_xref="GeneID:16992633"
                     /translation="MHSGERLVLGIEGSANKIGVGIVTSDGAILANVRRTFVPKTGSG
                     FQPRETARHHQKHVASLIEEALHTAGVRPTDLCAVAYTKGPGMGAPLQSCAIAARMFA
                     LMHDLPLVPVNHCVAHIEMGRLVTGVDNPAVLYVSGGNTQIISYSEGRYRIFGETIDI
                     AVGNCLDRFCRLVGLSNDPSPGFQVEQEAKKGRHYVPLPYSVKGMDVSFSGILSRIQD
                     LIGSYAIPDLCFSLQETVFAMLVEVTERAMAHCGQRDVLVVGGVGCNERLQEMLTTMC
                     TDRGGRAFCTDERFCVDNGAMIAWTGWLQISSAARLLGSEKLEWPWSDCTVTQRYRTD
                     DVAITWREEGALQLAMD"
     gene            complement(200552..200623)
                     /locus_tag="CYME_CMD082R"
                     /db_xref="GeneID:16992634"
     tRNA            complement(200552..200623)
                     /locus_tag="CYME_CMD082R"
                     /product="tRNA-His"
                     /db_xref="GeneID:16992634"
     gene            <201445..>202356
                     /locus_tag="CYME_CMD083C"
                     /db_xref="GeneID:16992635"
     mRNA            <201445..>202356
                     /locus_tag="CYME_CMD083C"
                     /product="probable serine/threonine protein phosphatase"
                     /transcript_id="XM_005535389.1"
                     /db_xref="GeneID:16992635"
     CDS             201445..202356
                     /locus_tag="CYME_CMD083C"
                     /codon_start=1
                     /product="probable serine/threonine protein phosphatase"
                     /protein_id="XP_005535446.1"
                     /db_xref="GeneID:16992635"
                     /translation="MNLDAWIATLRTGNILPESDLKKLCEYVKELLIEESNVQPVAAP
                     VTVCGDIHGQFYDLLELFRTGGEVPATSYIFMGDFVDRGRDSIETLSFLFCLKARYPS
                     RVTLLRGNHESRQITQVYGFYDECLRKYGSANAWKWCTDVFDYLAVAALIDSRILCVH
                     GGLSPDISTLDQIRLIDRRQEIPHEGPYCDLMWSDPENIETWAVSPRGAGWLFGAKVT
                     HEFNEINDLELICRAHQLVQQGYRYMFDDESLVTVWSAPNYCYRCGNVAAILAFDSDL
                     NREFRIFREVEEEHRREQNRGIIPYFL"
     gene            complement(<204273..>204755)
                     /locus_tag="CYME_CMD084C"
                     /db_xref="GeneID:16992636"
     mRNA            complement(<204273..>204755)
                     /locus_tag="CYME_CMD084C"
                     /product="chloroplast translation initiation factor IF-1"
                     /transcript_id="XM_005535390.1"
                     /db_xref="GeneID:16992636"
     CDS             complement(204273..204755)
                     /locus_tag="CYME_CMD084C"
                     /codon_start=1
                     /product="chloroplast translation initiation factor IF-1"
                     /protein_id="XP_005535447.1"
                     /db_xref="GeneID:16992636"
                     /translation="MGTQSLQAFVSSFAGVQLNVVQSTPAFWGGRVREVSQGHRPASP
                     CWRAGRFSLVAAGDRKKKNPGSKRTPPKSMRREKDTQNGRTDTDPEKEGAIEMEGVIV
                     ESLPNAMFRVQLTNDVVVLAHVSGKIRKNFVRCIVGDRVRVELSPYDLYRGRIVYRLK
                     "
     gene            complement(<206757..>207686)
                     /locus_tag="CYME_CMD085C"
                     /db_xref="GeneID:16992637"
     mRNA            complement(<206757..>207686)
                     /locus_tag="CYME_CMD085C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535391.1"
                     /db_xref="GeneID:16992637"
     CDS             complement(206757..207686)
                     /locus_tag="CYME_CMD085C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535448.1"
                     /db_xref="GeneID:16992637"
                     /translation="MSTCVHVSLTSEFHAQITLASSIRYFCFVANRRRSDSRSFIEQE
                     TKWLSLDDLFTRSFLKFTEIVTYNEQFRPKSNTFLFRGYRQDRIRHQHDPYYRMRCQM
                     LSSLIFRWTRVLDSDCNDPRDRLQSSVRYRFARIKRDESKFPDLLTRLAFPPCNSFMT
                     YKTKLDKACISNRTASTCICSRQSTLPGQHLEQARNGRVRCSTLNRRTASTGAFFARQ
                     GQVPGDAAGVQTPYGDHRRMPYRVNVWEHLATFQCHRCRVPTKAVCTAQERVQPNRNR
                     KFLLYIKCMNNTRNGRNRDLSASISVFSCCQWS"
     misc_feature    complement(209659..211821)
                     /note="possible transcribed region"
     misc_feature    210027..211666
                     /note="repetitive element"
     gene            <212219..>212701
                     /locus_tag="CYME_CMD088C"
                     /db_xref="GeneID:16992639"
     mRNA            <212219..>212701
                     /locus_tag="CYME_CMD088C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535392.1"
                     /db_xref="GeneID:16992639"
     CDS             212219..212701
                     /locus_tag="CYME_CMD088C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535449.1"
                     /db_xref="GeneID:16992639"
                     /translation="MDTGELHDLTVKGAVVTQLERCEVACQRLFQNLALLGLELQNSE
                     SITEGVCDSKAASDLGSSVELLENEERALRLCVDRFVLELRQVENLAKTLDGIREEEE
                     RILSLEQRSIEQAERCFYLWNDAREMLRGTRLTSIKEVLESAARYPRIPSWTPLPTSN
                     "
     misc_feature    213382..213495
                     /note="possible transcribed region"
     gene            <213803..>214873
                     /locus_tag="CYME_CMD090C"
                     /db_xref="GeneID:16992641"
     mRNA            <213803..>214873
                     /locus_tag="CYME_CMD090C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535393.1"
                     /db_xref="GeneID:16992641"
     CDS             213803..214873
                     /locus_tag="CYME_CMD090C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535450.1"
                     /db_xref="GeneID:16992641"
                     /translation="MLSSAVQGLSFLNRQRRLLPLLLLQRWSRCELATAVKPKAETGA
                     ADDAVATEHDSWSRATCQEAESPPQRTAEHASLLVSEIFASIQGEGPFCGSPSIFLRL
                     GLCNLECIWCDTKYTWLFSEQRLARLQSRSRARDGSATTPGSSQQQEQPLASQKANFC
                     TVFDRHKELRRLSIEEVCRCIELAREGTRADAVVVTGGEPLLHLKPLRPLVKHLVQDL
                     ELRVEFETNGTIMPQVLLDVDHEAKQRIHFNVSPKLANSLQSAKQRLRWDILHYYATQ
                     LPHQSIFKFVVDREEDLAEVEMIVNELQLPRTRVWLMPQGTTSESLALAARERVIPWC
                     LRLGFRYSHRVHIAIWNDRRGV"
     gene            complement(<218599..>220332)
                     /locus_tag="CYME_CMD091C"
                     /db_xref="GeneID:16992642"
     mRNA            complement(<218599..>220332)
                     /locus_tag="CYME_CMD091C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535394.1"
                     /db_xref="GeneID:16992642"
     CDS             complement(218599..220332)
                     /locus_tag="CYME_CMD091C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535451.1"
                     /db_xref="GeneID:16992642"
                     /translation="MLLQTLQNYTRTFGYTWRTLQSLGWQGASLFSASQERREKSASS
                     VPADRLHPSQVLAVRVRCTRGLYLAAVPGPELGRDERCLRALKRQRGAVNSTVLLLHL
                     PEVAEGPWKLTDLQGRILRIEAAVESTVPQGANDDEAACPQHLSVAFEAGGTDAQRAV
                     VYIRVGARYLSANPRSGSVVADKVHAKRWECFQLELLPTFGIERSLTLTCRFAAFIRT
                     RNYYGRDTGWLWCGVLFTGQLVALPWHHEHRAKRSSQSVQPSPFFFEYADMSRTALIR
                     DVSGRYLLATHDCGKHVIAHSNLPHAAEYFVVRAYPRNIIQLESRWGFLCADQSRMGP
                     SGFFSVRCDRKQAGPWETFQIIPVMYTGSLADWWQSQLELEDAASERRLQTLDSLEID
                     TVIELSEGTHRRVRASASVPGVSESVAFQTVTDYEHYGKFCRGVEQCRIVESHQGEHG
                     RISLIRTTQSRSLWIFTVKAKMLLRAEEYPSRGAVNFVFISGQGVRRYAANWEIRPVS
                     EVGAAATAAAAAAAPQQQQRPACYMSLTIDFQPVVYIPKKWLDAMAVNAARDAFKDMM
                     LESSARMRARN"
     gene            complement(<221060..>223420)
                     /locus_tag="CYME_CMD092C"
                     /db_xref="GeneID:16992643"
     mRNA            complement(<221060..>223420)
                     /locus_tag="CYME_CMD092C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535395.1"
                     /db_xref="GeneID:16992643"
     CDS             complement(221060..223420)
                     /locus_tag="CYME_CMD092C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535452.1"
                     /db_xref="GeneID:16992643"
                     /translation="MASDLPPLWTPSKTLSKRPSSGHSQHASGEQEPHETGWRANAES
                     EPSSKGPADSRALQWRLALAEACAELLESSLESLRHAYAEYLQHGDLGAPVQGRSRNT
                     VPSRARLLEDLGLNAPRDFVDYVLMRTLRERDALAMQNSRSWTFNLMDRSGEGRAYLA
                     EFVRYAPLMTPVADSAVVELVFQTLSEASSKAATDSMYGGDKTGKFTERQNVSLEQRD
                     MDFTSGTLTEGEPSEAHVSFAVWDEFLIALGKIFSKTKPEWTEAKRLFGIDHAEPLVK
                     AGAAFDHSGTIPIFGKLFLSERYLCFAASLGWGHFLVPLSMIREVKSTELPVLRRDAV
                     VISFTVPKNLEKNVNGPFSKLLPTGAIDKGLVLSFNEFRSTRLRDAWVMYIREMVAAH
                     VASKQHHVDHLDANIVMSVDETSSSVRLRQALDLAETTRFAEEASPGVTQQRGQRLSR
                     MRDCSPNASLAASTTAQTAGVKVPASSFEAIVQCPTPAFARIARLNILRSRALKRVLS
                     GRLPRSLFIFSVASEADVVVEHHPMSVDDLRGRELRRAAFRKYVDAAHRITAGERSWW
                     FVRAMQRVNMNMEANRRRQGDRDTETLDIVSLGNQISTFIELVAPIGCMLDAVCYVIR
                     WDRPAVSAAIFLFLLFVVLLDAVTYLIPLAILGYCGLLLSVRKAVQNPKHESLSESSK
                     MKASYLSGFFVRIHHGLVATQVWLQHMNRHLEKFESIHLWRDPARTRQYIYGLVVSAL
                     LIAVVPFRWIFAALVIYLFTLQFRDPERQDFIDRWYASVPGRPSCT"
     gene            <223614..>225284
                     /locus_tag="CYME_CMD093C"
                     /db_xref="GeneID:16992644"
     mRNA            <223614..>225284
                     /locus_tag="CYME_CMD093C"
                     /product="L-Galactono-1,4-lactone dehydrogenase"
                     /transcript_id="XM_005535396.1"
                     /db_xref="GeneID:16992644"
     CDS             223614..225284
                     /locus_tag="CYME_CMD093C"
                     /codon_start=1
                     /product="L-Galactono-1,4-lactone dehydrogenase"
                     /protein_id="XP_005535453.1"
                     /db_xref="GeneID:16992644"
                     /translation="MVLSLLRRGALLFGTSAALVGAALSPVPVHSEAPAVHGIEESAA
                     DAVTLLNWSATHAVHTNALFVPESVDQVEQLVADRHAKSEKLRPLGSALSPNALAFEA
                     GGMVSLALLDKILWIDEKKAQVRVQSGARIAQVTNELRKRGLVLQNFASISEQQVGGF
                     FQVGAHGTGIRIPPVDEQVVSFRIATPAVGSIEISSGHPLFGLLRVGLGAFGVVTEVT
                     LQATAAHKLVEYTKVMTHEELRDRHEELLSQHQHVRYMWIPYTDSVVVVYSDPLERAS
                     APNSADMQHLTNDYKLAPLRELLLASAGNRLSPQEVQRMSFAEMRDYLIARDPLNTEW
                     IRRVNQAEAAFWKRSEGIRIDWSDRILGFDCGGHQWVSEVAFHAPLGQRRDLEYMTKL
                     LRLIQDHQIPAPAPIEQRWTSGSGSLMSPVYRGPDTLPPDQDVYSWVGIIMYLPTDDE
                     AARQSITREFWRYRHLCAKLWEAYDAAEHWAKIEIPSPSYMGSEDALRYKNFILKRVR
                     EKYPLDNFGRAHRMLDPNRIMTNAFIDEVLLDNVEPSKESNVSQDRVI"
     gene            complement(<225466..>225993)
                     /locus_tag="CYME_CMD094C"
                     /db_xref="GeneID:16992645"
     mRNA            complement(<225466..>225993)
                     /locus_tag="CYME_CMD094C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535397.1"
                     /db_xref="GeneID:16992645"
     CDS             complement(225466..225993)
                     /locus_tag="CYME_CMD094C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535454.1"
                     /db_xref="GeneID:16992645"
                     /translation="MFVETFSLLSRPRLRVYCQSPRRPVQPGLSSVAPARTLNGVLRR
                     LVASLAASPEEKEPGENGPRNSGDSSGEMAVISRKKWPRDNRDKLPFDVYVTTPPPYY
                     LGQFKLDPRVHNGDILEFQNHAYVIKRTRLHYYYRNGEFRVGRKSVDVNTVARSHINS
                     FLDRIYSRSNVHRSP"
     misc_feature    complement(227041..228131)
                     /note="possible transcribed region"
     gene            <228449..>231019
                     /locus_tag="CYME_CMD095C"
                     /db_xref="GeneID:16992736"
     mRNA            <228449..>231019
                     /locus_tag="CYME_CMD095C"
                     /product="V-type ATPase V0 subunit a"
                     /transcript_id="XM_005535398.1"
                     /db_xref="GeneID:16992736"
     CDS             228449..231019
                     /locus_tag="CYME_CMD095C"
                     /codon_start=1
                     /product="V-type ATPase V0 subunit a"
                     /protein_id="XP_005535455.1"
                     /db_xref="GeneID:16992736"
                     /translation="MFRSEDIVLLRVYFQRTAAHDCVEELGRRGLVEFRDLNANTSAL
                     QRTFAAELKLCDELQRKLRFLSEQANKYLPSEKTFTTLAAQSQQLIEAGPGYSRVQAT
                     DTVTLEDLNGQLRRLEADLEEMNLHWDALQSELITIREHGYVLELGEAIFSEARTQRI
                     SVSQYGTLPLLESNVLTGEDVISERRGPPDDSESAGQRVERGQGQGYTPVNAVLNVFA
                     GTIAAKHLEAFSRMVFRVSRGNCFLRWVSIPEPIFDIERNESVAKTVFVLFFPGQHLR
                     SKLTRICEGFGATRYPFPDSTGERDRLKTELVIRRQELEAIIETTQRQRADVLGEVAT
                     NVTFWTEKVAKEKAIYFTLDKLNYDVSERVFVGECWCPRAEIEEARAAIHIGDIRSNA
                     QAPSIMEECATDEAPPTFFRCNRFTAVWQDIVEAYGIAAYKEMNPAPWSIATFPFLFA
                     IMFGDVGHGMLMTVAALYVVFRERQWRYRKLGDLLQTMYDGRYLILMMGVFSMFTGLI
                     YNECFGVPINLFGSTWKWVDGSAVACGIDHCEQPKLGMPPKRTYPFGFDPAWKIAENS
                     LTMLNSFKMKMSIGFAVAQMTLGIILSYSNARYFAQSLDIWHVFVPQILFFLAIFGYL
                     LLLIFLKWSTDWNAPGASSPPDLKAVLIAMFMSPGSLPRSLRLFPGQHVVQLVLLAIA
                     IVTVPWMLLAKPLVLRRRMRTQRPHAYTPLHNGDRRDAPANLNSSEAESRKAEPHESV
                     GNFAEIFVNNMIHTIEFVLGAISNTASYLRLWALSLAHAELTDVFLQKILYTALATEN
                     VIATMIGFVLWFGLTVGVLMLMESLSAFLHALRLHWVEFQNKFYNIHGSGVKFTPLRL
                     "
     gene            <232372..>234060
                     /locus_tag="CYME_CMD096C"
                     /db_xref="GeneID:16992647"
     mRNA            <232372..>234060
                     /locus_tag="CYME_CMD096C"
                     /product="cytochrome P450"
                     /transcript_id="XM_005535399.1"
                     /db_xref="GeneID:16992647"
     CDS             232372..234060
                     /locus_tag="CYME_CMD096C"
                     /codon_start=1
                     /product="cytochrome P450"
                     /protein_id="XP_005535456.1"
                     /db_xref="GeneID:16992647"
                     /translation="MILARNLLHVPRPSLYVVAALGAFSLFQVGSTVAKYALWFWKQK
                     RAGRPVSRGLLEVVTALGPVPVPGFGNALYLSRVGFFRALYESCLERQVTVFWLSSTP
                     LLIVSAPDLVEQVLTSRTFEKPQYFGYRSRTVKTALELHQRAELLREKIETADPDQQQ
                     RVREDPSRAALLDLIDRSLTEIASSTEKFLAELRAEDNVGKDASKLIQRFYVQLNCKV
                     LFGLVVDNAEATRIASAIEKAGAEFSRRMILPQRALYAWFANVSYIYHTSVLLIFGQK
                     ILRHLRISSNSWINGWLGKAGRLRRLAKVLGLLMAATQTVPIAASWALILVSVHEDVR
                     EKLACEARRLLSEDLSVNGGRGVAQQGSQTSQTTPAQKANLTASDIATDVNRLSKLLK
                     KHSYFDAVIAETLRLFPPFPLIQRQAQCDTHLGDVFVPGGTLVAAVPWLQHHHPAYWK
                     QAESFNPERWISPTDNVARHGDAPSDYCYIPFGRGRRMCAGNPLAMVELKCLLLLVAL
                     QEPDLLFDLEPQETSPEPQAGMRFPPLTMRPPRFAVRQEEPIHRKLCQQNSNEL"
     gene            complement(<234307..>235164)
                     /locus_tag="CYME_CMD097C"
                     /db_xref="GeneID:16992648"
     mRNA            complement(<234307..>235164)
                     /locus_tag="CYME_CMD097C"
                     /product="similar to Traf and Tnf receptor associated
                     protein"
                     /transcript_id="XM_005535400.1"
                     /db_xref="GeneID:16992648"
     CDS             complement(234307..235164)
                     /locus_tag="CYME_CMD097C"
                     /codon_start=1
                     /product="similar to Traf and Tnf receptor associated
                     protein"
                     /protein_id="XP_005535457.1"
                     /db_xref="GeneID:16992648"
                     /translation="MSYIRLVTWNVDFDSPFNYERFTAIAEEVLGAKPGVVLFQEVSD
                     LPFSSWQGEKEQSTITSARQHDSCYKVLLRRLEALYEPIVDLGLPSEQAYFVMAFVDR
                     SKYRVHGYEYTEFENSSQGRGLLAIQLEPRDMCGDFKFRVLTSHLESGTACSEVRVQQ
                     MRQIAYEMLEGDTPAIFAGDTNFREKEKAGFEKEIAKAIGSEEMRLFDLFVEVGEPSH
                     LRFTWDTRTNTNKVKELPPRFRPRARFDQVLFTRPFQANAMRLLGRERLGHAVFPSDH
                     YGIYGELRF"
     gene            complement(<236903..>238018)
                     /locus_tag="CYME_CMD098C"
                     /db_xref="GeneID:16992649"
     mRNA            complement(<236903..>238018)
                     /locus_tag="CYME_CMD098C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535401.1"
                     /db_xref="GeneID:16992649"
     CDS             complement(236903..238018)
                     /locus_tag="CYME_CMD098C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535458.1"
                     /db_xref="GeneID:16992649"
                     /translation="MGLLYSRMVFQPPRPPQYSVESENELFWIWTASGSRIPVIYYDG
                     GVARKPTPRNRSEQRTSASPVQELRRYSRPFWKVWPRKSTHVGQEAKVDPREVAALLD
                     LSSRAAHGQKLQDTPLERGQGTSGGTADSRDEMEAGHVLDILNQVPQPRRERRGYPEE
                     FFTILYSHGNAEDLASAGAYVQLLTTVLGCKAIAYDYTGYGLSLPAGVRPSEYRFYKD
                     TYACYRYLINLGVPPERILLIGRSVGSGPTVELASRFPIGGVVLIAPLMSCLRVVYPD
                     IRCTIPCLDMFPSIDRIHLIKAPVLIIHGMQDNVVSICHGRGLYERCKMKTEPLWLEN
                     ASHNDIEVHYLSTVLQRIRVFSRYCAAFFAERNIERA"
     gene            <240513..>241988
                     /locus_tag="CYME_CMD099C"
                     /db_xref="GeneID:16992650"
     mRNA            <240513..>241988
                     /locus_tag="CYME_CMD099C"
                     /product="probable myo-inositol 2-dehydrogenase"
                     /transcript_id="XM_005535402.1"
                     /db_xref="GeneID:16992650"
     CDS             240513..241988
                     /locus_tag="CYME_CMD099C"
                     /codon_start=1
                     /product="probable myo-inositol 2-dehydrogenase"
                     /protein_id="XP_005535459.1"
                     /db_xref="GeneID:16992650"
                     /translation="MLRQELESFVRLTASALRLEDEELVEVDSEDSSEQETALSKDAA
                     EPAHSRVLVGTLSESVLPPVAGTASAQSAASAYNASRLRVGIIGCGRIGQVHANNLAN
                     RVPNAALVAVSDAIEDAARRIAARFHVPIWYTNAEDLVHDPRVDAVVICSPTDTHAPL
                     MKECARYGKHVFCEKPIALGLDVIDDALATLDAANADVKELRLQAKRPSLFVSGETGL
                     DNLSLAQFEHDRRLRRLQRSGIQLMVAFQRRYDQNFQRARLAHDSGFLGRPLKLHLVS
                     RDPAPPPLAYLKVSGGIWLDQAIHDFDMARFLLKSEPVEVFAMGLCCEPSIAEIGDCD
                     HVMTQVRFANDAICVIDNSRSTPHQAYDQRAELFGTEGCITVGNEYPNTAEYMDVIGQ
                     HRDKPLNFFMERYAEAYLQEMLAWVQHLVEIRAGGARTAEAGTDAGTPALPLPSDFDG
                     RIAVVMAMAARRSFELKRPVRITEIDPSLEPIIEAARTRAV"
     gene            <244273..>245418
                     /locus_tag="CYME_CMD100C"
                     /db_xref="GeneID:16992651"
     mRNA            <244273..>245418
                     /locus_tag="CYME_CMD100C"
                     /product="similar to ATP-dependent proteinase BsgA"
                     /transcript_id="XM_005535403.1"
                     /db_xref="GeneID:16992651"
     CDS             244273..245418
                     /locus_tag="CYME_CMD100C"
                     /codon_start=1
                     /product="similar to ATP-dependent proteinase BsgA"
                     /protein_id="XP_005535460.1"
                     /db_xref="GeneID:16992651"
                     /translation="MFLIASWNCNSVTNAFHQKLVVRYSSELSRRNPRKGACGDFWGT
                     TELSRRLPQVDRPTTRFATSKQTRRRNRSELVRSSARGGSGSNDPEEKDATPEPGSFF
                     EEDSTAIEYFSPSEKRDTEVPVSGKLAELPLFPLPLVLSPGQPIPLHIFEMRYRQMFQ
                     RIREGDGRFGIVMYDKDRNAHAAVGTMAEINVYEPLADGRIMTSSIGRERFRVLKYTK
                     DSPYLVALVEYFDDEVCIESVEQILAALKEPLPQSGDQETSRISKQSLTLLERRVWSA
                     LGDVLRLSNKLYNRVVSLSKLVVDNSPETVLSIPEGHLDPEQNFHRQKLFSFAVSSIL
                     DMPVRQQQLLLQTRSTAKRLLKQAQLLEGARQYLAAQVTIKKALGES"
     gene            complement(<245530..>247443)
                     /locus_tag="CYME_CMD101C"
                     /db_xref="GeneID:16992652"
     mRNA            complement(<245530..>247443)
                     /locus_tag="CYME_CMD101C"
                     /product="unknown GTP-binding protein"
                     /transcript_id="XM_005535404.1"
                     /db_xref="GeneID:16992652"
     CDS             complement(245530..247443)
                     /locus_tag="CYME_CMD101C"
                     /codon_start=1
                     /product="unknown GTP-binding protein"
                     /protein_id="XP_005535461.1"
                     /db_xref="GeneID:16992652"
                     /translation="MGVWELYNSSGLHKNVIEALIKENELSDESYSTVAAVGVEGSGK
                     TTFLNEVFGTTFPESKGVSDRFNGPSPSGGRGAPGGARASPPVGRGEQDAPEVRASKG
                     GTVRLSRAEPLARSLILAQPPQELLVLDVDGLSTSTLGAGSVLQVRRQGLSGAVHDGA
                     TAVELGVAMADVLVFNVQYHSLSRSTASGLRGLGSALETYLRLCASGMLHGMGPMPHP
                     SRKRMLLVIVRDFEDEEVSRDEVAAAFQEDLNALWSRMTKPSRLGNSRFSEFYQTEYA
                     FLPSALLRKIDFMRRVGELQRRFLDPTADGYFFQRDNRSGESIARYSCPVPLSELELH
                     IENVFKALSQFRKDRSVGETDGGLEVEGSSELEASYRCDEICSFIFSQYLDSARSWKS
                     RAEDGRIIENFGTEADGLLQNALEEYDRDAAAFRHTKTFIRKRNELRSSILNDLRTIY
                     AKQLLKLREVAFDRFKLALTRIQVTNRVEKDVERQIRENEKYFIEQADLLKCRDAPRG
                     GNASSNAGALPWRHEIERRALVDAMREVATERLQFARLQGAYVPTQRQPVQFSFHYLH
                     PNPFGTDSRQDRLTSTDPIRYDPTVSRVATVLRAGSIRPQTDNVRAPRKSRQEAAKTK
                     VQGTKESAVPARS"
     gene            <247748..>248401
                     /locus_tag="CYME_CMD102C"
                     /db_xref="GeneID:16992653"
     mRNA            <247748..>248401
                     /locus_tag="CYME_CMD102C"
                     /product="adaptor-related protein complex 3, sigma
                     subunit"
                     /transcript_id="XM_005535405.1"
                     /db_xref="GeneID:16992653"
     CDS             247748..248401
                     /locus_tag="CYME_CMD102C"
                     /codon_start=1
                     /product="adaptor-related protein complex 3, sigma
                     subunit"
                     /protein_id="XP_005535462.1"
                     /db_xref="GeneID:16992653"
                     /translation="MILGVLVFNSHGKSRLVRWYDTRLQNLPLSQKRFIVWKCYRAAS
                     TRNAGSSNFLFSTDSEISEILAFPLKSVEPAGLGRTSGGNSDAASVGHDRPRRDASDR
                     PETRLYGRDLRVVFRHYATLFFVFIVDENENELGILDLIQVFVETLDRYFGNVCELDI
                     VFHHEKVNYVLDELISGGLVLETNQADILSALHGISEAITAENTGQGLTSLARKMRR"
     gene            complement(<248910..>249446)
                     /locus_tag="CYME_CMD103C"
                     /db_xref="GeneID:16992654"
     mRNA            complement(<248910..>249446)
                     /locus_tag="CYME_CMD103C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535406.1"
                     /db_xref="GeneID:16992654"
     CDS             complement(248910..249446)
                     /locus_tag="CYME_CMD103C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535463.1"
                     /db_xref="GeneID:16992654"
                     /translation="MQSVKQLSRNTTGALQLLQRSSKSLNLLASNGLRAFCQAPGERL
                     LEKEQKGLDLLQAVKGRARIRWTPPTGLTFPVELASTAEGRPINTGASLGRPSKLPFI
                     VYRTEKGNNIPVYRDFRGHNKVYTVLKRVRGRVDLLAVDMERVCGGRKVTVRPGPRLV
                     VEGDFLFPVREWVRALGF"
     gene            <253439..>254647
                     /locus_tag="CYME_CMD104C"
                     /db_xref="GeneID:16992655"
     mRNA            <253439..>254647
                     /locus_tag="CYME_CMD104C"
                     /product="delta-aminolevulinic acid dehydratase"
                     /transcript_id="XM_005535407.1"
                     /db_xref="GeneID:16992655"
     CDS             253439..254647
                     /locus_tag="CYME_CMD104C"
                     /codon_start=1
                     /product="delta-aminolevulinic acid dehydratase"
                     /protein_id="XP_005535464.1"
                     /db_xref="GeneID:16992655"
                     /translation="MFVAKVPLSIRGQPSLNAIKPSATAPKRRKLSLFAVAAPRRSSE
                     QASTSANSPLLPRNDKGEPWVVQRSRPRRNRKTNAVREMVRENVVSPGNLVYPVFIHD
                     EDHDEDIDVMPGCKRLSIQSLLKHAAQALDLGIGHIILFPKIEEHLKSNTADECYNPK
                     GLVPSAIKALKEKFGSRITVWTDIALDPYSDQGHDGIVSNDSLGDGGCARILNDETVE
                     QLCRQALCHARAGADIVAPSDMMDGRVGAIRDALDEEGFTDVSIVSYAAKYASSFYGP
                     FRGALDSAPRETSRAPRDKKTYQMDPGNAREALREAAADLEEGADMLLVKPGVPYLDI
                     IHLLYDAFPVPIAAYHVSGEYAMIKAAAQRGWIDEKQVVLETLLSLKRAGATSILTYY
                     ALEAAKWMQE"
     gene            <255434..>256381
                     /locus_tag="CYME_CMD105C"
                     /db_xref="GeneID:16992656"
     mRNA            <255434..>256381
                     /locus_tag="CYME_CMD105C"
                     /product="similar to peroxisomal membrane protein PEX2"
                     /transcript_id="XM_005535408.1"
                     /db_xref="GeneID:16992656"
     CDS             255434..256381
                     /locus_tag="CYME_CMD105C"
                     /codon_start=1
                     /product="similar to peroxisomal membrane protein PEX2"
                     /protein_id="XP_005535465.1"
                     /db_xref="GeneID:16992656"
                     /translation="MDQERVLLSLQRLLAPGQHQSETQLVACLDARELNVEVFSTLWE
                     SLAATVSSINPRLLQVLEAELRALLRLLYFAFSVGVGRPFPGDVYQNLTYRVDVGNTV
                     SEGDSVIMTRGRRFLYGCAYVLGHYLLERYQTMRYTGSPWVPSASSAEMIDNLLKSME
                     SLNFFLFFLMRKYRNPLERIFRLRLRRAETGATRALSFEMLNRQLVWEGFTELAISVI
                     PILQSPLLHRILRKAVFHGRFGAASREVVSQEHSGKIRCRLCGKSRPLMPHILIPCRH
                     LFCYVCMAMKIRTNGSEGCPYCGSEFERAESVIPSQMVM"
     gene            complement(<256792..>259323)
                     /locus_tag="CYME_CMD106C"
                     /db_xref="GeneID:16992657"
     mRNA            complement(<256792..>259323)
                     /locus_tag="CYME_CMD106C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535409.1"
                     /db_xref="GeneID:16992657"
     CDS             complement(256792..259323)
                     /locus_tag="CYME_CMD106C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535466.1"
                     /db_xref="GeneID:16992657"
                     /translation="MEPHSSNSAGARGMQQEVPNLLLVYPSVVKAASALEFVARRAHL
                     LCGTLETLQESDRGAAAQTSSRVRCPSSEAVSQQGTPLGTKSDESLAGYGSRENEQLE
                     ARSRGSAEGSVAPFSYRLRRDATWKSLDVQPCHLAATRNPSAAPLDLLAQVQCLRLAR
                     RLLERACSALEDGSWLELVKAHALYVRSKAALGNPVEDTKTATLRSESLIHELRVRLH
                     EQCALLREEIVERARMTACSMCFDSSSIEYPMSERRKRFAALLWLQIDLGMDLGEMLH
                     TLFQSHSRIVCERMRSRGPEVTLTLVRQAFCAVISFLGAFASLEEQSANHEAVTLSIW
                     SAQPLDLVDGYGDHPERSPDCEPLRLRPTIVSTPAPKQESLLDAYTKQIWQMLDTVVE
                     KLADHGANKATAASLTGLLQELDSACRLGRSRTAKGPAAPGFFAALQAEILTMLMRPL
                     EKLVPAVLSQHAEDLVDGYTQILHRLIGECVRDGRALLHEEQVSTALCIPKLADFSSV
                     ARKMRPSRFRSVFSTSIPETLHISLERISPKSGPLLDCQLVQAAYSCEPNQSVAYTVG
                     MPEAESPLWYATCTWNEIESCTQRIMKEFSLICRAFPNMKKHFLRQLKERIRGFTTDI
                     ASGRICSVTSLVQLFERGLRWVPLLLAYAFCHIVDSLRLFYDQEDLGALDKEITEWLF
                     QAARAMLEVWLRGVAEVATALRDRPATLEQQFSDIPKGVSGTEANDAADEPIASFWKG
                     YALYALRFAAPSASWRTVLNELQEREAFRSHYSWTSSCLAPGSAQHTGADAPSDHCSN
                     REAQPQQRQRTRIDIASPVHSRMLVGAQVSHPNPVHSQDSTLKTA"
     gene            <260661..>261824
                     /locus_tag="CYME_CMD107C"
                     /db_xref="GeneID:16992658"
     mRNA            <260661..>261824
                     /locus_tag="CYME_CMD107C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535410.1"
                     /db_xref="GeneID:16992658"
     CDS             260661..261824
                     /locus_tag="CYME_CMD107C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535467.1"
                     /db_xref="GeneID:16992658"
                     /translation="MAFVCYPLFTSAKFRVIPAHGLHSRSSTLWKGTTAGRHAAGRAL
                     VASSTARGALTLRGNAAGAPRRPLQPLLAKGAAVLAALAVAISPLLGDPEAALAAQGG
                     GRVGGSSFRAPATRSAPPRSYRAPSGGIGGYYYSPAPVLPFTPFYFGPVVVPFGFTGI
                     GTFLLAAAFFAFATRALSSNLSGLGVSAAAEDSELAAEQTTLVKLKVGLLSTARELQQ
                     ELEEIALRSKTDSIVGLQQVLQETTLALYRNPDYWSFGSVNVKRTSLSEAEAAFNNES
                     FAERGKLEKETLSNFGGQIDIRKREVAERDSTDMRVPEFIVVTLIVAASGRVPGVPTE
                     IRRSSDIEAALRALSSIPREALQGVEVIWSPQSREDALTESEMLADHPELVRI"
     gene            <262634..>263239
                     /locus_tag="CYME_CMD108C"
                     /db_xref="GeneID:16992659"
     mRNA            <262634..>263239
                     /locus_tag="CYME_CMD108C"
                     /product="probable lactoylglutathione lyase"
                     /transcript_id="XM_005535411.1"
                     /db_xref="GeneID:16992659"
     CDS             262634..263239
                     /locus_tag="CYME_CMD108C"
                     /codon_start=1
                     /product="probable lactoylglutathione lyase"
                     /protein_id="XP_005535468.1"
                     /db_xref="GeneID:16992659"
                     /translation="MFVAGRVESAFFSRKTTRVLSRYKTSKSRISRCKMSFNGGFLGK
                     NAVFAQTMLRIKDPSKSRQFYEALGMNFLTRFDFPELSFSLYFFALEKDPTVPAEDAP
                     QPERAKWLFSRQYPTLELTHNWGTEKDPNFKYANGNTEPGKGYGHIGFLVDDLYASCA
                     AVEKAGYVVSRKPGPFQNVGEIAFVRDPDDYWIELIQKPKS"
     gene            <264453..>265166
                     /locus_tag="CYME_CMD109C"
                     /db_xref="GeneID:16992660"
     mRNA            <264453..>265166
                     /locus_tag="CYME_CMD109C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535412.1"
                     /db_xref="GeneID:16992660"
     CDS             264453..265166
                     /locus_tag="CYME_CMD109C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535469.1"
                     /db_xref="GeneID:16992660"
                     /translation="MSCKGAAFGFATLNGLSVRRHLFCRSSANLRVCGKLFTGSQYPR
                     APRYFLVHTDKSAGNTPSTRGWEEYAGNFTFRPPHVIARPSQRIAYRIGNGTPLPPKA
                     LVHFLGGAFIGAAPQVAYRWFLEQLALKGFVVAATPYRLSFDHLWTMDDVLTRFSAAA
                     GMLALDYDPIPVDGIGRSLGALLHTLGGSLFCNADGYKAADVLIAFNNRRAEDAIPLF
                     RELIAPVIKTVAGLVNSLM"
     gene            <269221..>272067
                     /locus_tag="CYME_CMD110C"
                     /db_xref="GeneID:16992661"
     mRNA            <269221..>272067
                     /locus_tag="CYME_CMD110C"
                     /product="probable telomerase reverse transcriptase"
                     /transcript_id="XM_005535413.1"
                     /db_xref="GeneID:16992661"
     CDS             269221..272067
                     /locus_tag="CYME_CMD110C"
                     /codon_start=1
                     /product="probable telomerase reverse transcriptase"
                     /protein_id="XP_005535470.1"
                     /db_xref="GeneID:16992661"
                     /translation="MFGKPLPEWLAATYPPEPGASLCDSRAYWRSHILNYFQSVGCPL
                     QDWHLGDRPITSARSLLDWIDGIRVGQDPQHRERLRWRPALNTLMEADVPVSRSQEEL
                     LRTALDLLRGDDRYVLIRGHSDSRYAGPNASVARLLAPEWVALTRALGDCVALRLITD
                     FVLLERVGPSCYIQLSGRVGLERLSAKSAKAPQTHREIPCDMRGASHRLHINADPHRT
                     ECPTKARIETSKAHALPISTKSIALGPYGITTRNPYLAMHPSKSNAKRLLALAAAGLC
                     SREEYHGGVCLPLRCSSCIRFLDAFRCILVRAWDIPLKGMLNHYCPSKATTVDQSQPV
                     MKKYASSRRSVFHFLFAIFRSIVPTCVFESFTFEIWVRKAISSFLLSKISSTPYDVRL
                     HVAQLMETVQFQQHQPMSFGDAGVCRNHPLHIQHIFSFLFNAIVIHVFDECFVLSAAD
                     RAEMRRLILRRDSLFVFRTQAIAHLVRSGDFERMRKNLGKRTGHWTSVRILPKANSFR
                     LVQKMSPDTQGKETTLIHAVCLYERLSRPEAFGASIRSLTEMHQRWAAFVQRWRRFGR
                     PPLFALCFDIRQAFDSIPLKRFLWRELSDFFHSEAYALRRFIVTDKQFRFPQRKWFAC
                     PIADVTRGYDAFALQYLQSARSKIIADEGVICSLHTADIISHLRRIIGSNQVHFGDHS
                     SALIQRRGIPQGLPISSILCDFHLGCFERKCLKDFLRVNSTKDPPSLLMRYVDDVFFV
                     TSEVSIFRAFCNRVQQCSKALGVMPSPGKTRKCVAGGRKPRIEWCGMIFDLQSAQVLL
                     RMPRSIPSEAPDAAVFFSKCKTASHPRILRRFISIFASQMQSVFLDLSINGPETVKRN
                     ICTALRLALNRIGEDDLRSSLREKPAQRILLRWLRQTTMNRCCRWEPLSEQTPQTYRS
                     ELNRILCEGFRIILHKCIHNEDCFQGCRAASSCA"
     gene            275249..277609
                     /locus_tag="CYME_CMD111T"
                     /db_xref="GeneID:16992662"
     misc_RNA        275249..277609
                     /locus_tag="CYME_CMD111T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461232.1"
                     /db_xref="GeneID:16992662"
     gene            complement(<283212..>283754)
                     /locus_tag="CYME_CMD112C"
                     /db_xref="GeneID:16992663"
     mRNA            complement(<283212..>283754)
                     /locus_tag="CYME_CMD112C"
                     /product="unknown hydrolase"
                     /transcript_id="XM_005535414.1"
                     /db_xref="GeneID:16992663"
     CDS             complement(283212..283754)
                     /locus_tag="CYME_CMD112C"
                     /codon_start=1
                     /product="unknown hydrolase"
                     /protein_id="XP_005535471.1"
                     /db_xref="GeneID:16992663"
                     /translation="MRPSQVVQFFELVARLKALQRTGWVRSGVCVPETVASHSYGVAM
                     LALLLGDGDAQVLKLALVHDLAESLVGDITPKCGISPREKAVLEDEAFRKIRDDVLSG
                     SEAGCELYALFREYEEANTPAAVFVHQLDKLDMVLQALTYENTQENMELTEFFEACNG
                     IQHEKLREICSFLLQQRQRH"
     gene            <284340..>285413
                     /locus_tag="CYME_CMD113C"
                     /db_xref="GeneID:16992664"
     mRNA            <284340..>285413
                     /locus_tag="CYME_CMD113C"
                     /product="glycerol-3-phosphate dehydrogenase"
                     /transcript_id="XM_005535415.1"
                     /db_xref="GeneID:16992664"
     CDS             284340..285413
                     /locus_tag="CYME_CMD113C"
                     /codon_start=1
                     /product="glycerol-3-phosphate dehydrogenase"
                     /protein_id="XP_005535472.1"
                     /db_xref="GeneID:16992664"
                     /translation="MTEKHKVAILGSGNWGSTVAKIVGSNVKTKTESFDPEVRVWVYE
                     ELVDGRKLTEIINSDHENVKYLPGKKLPENVVAVPDPIEAVAGADILVFVLPHQFVRG
                     LCAKLRGNVREGAFAVSLIKGVEFDENGIVLISDVISKELGVECSVLMGANIANEIAD
                     EQFSEATIGYKNAAHAKLLQIIFQKPYFRIAGAPDIPGVEICGALKNVVALGAGFCDG
                     LGYGNNTKAAVIRFGLLEMVRFAKKFFKNVQYTTFLQSSGVADLITTCYGGRNRKCAE
                     AFARAGGRKSFEELEVELLNGQKLQGTLTAKEVHEVLQRQKLMKEFPFFEVIYDIVYE
                     GRPVEQFLQELSEKELSLEGNIE"
     gene            286696..290155
                     /locus_tag="CYME_CMD114T"
                     /db_xref="GeneID:16992665"
     misc_RNA        286696..290155
                     /locus_tag="CYME_CMD114T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461233.1"
                     /db_xref="GeneID:16992665"
     gene            <292855..>293550
                     /locus_tag="CYME_CMD115C"
                     /db_xref="GeneID:16992666"
     mRNA            <292855..>293550
                     /locus_tag="CYME_CMD115C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535416.1"
                     /db_xref="GeneID:16992666"
     CDS             292855..293550
                     /locus_tag="CYME_CMD115C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535473.1"
                     /db_xref="GeneID:16992666"
                     /translation="MAALESVPSGDAEPRQTLPRSPRGRRSFTEAQRKAAWERAKPVP
                     GRDPERWRYDVYGNPVLRPLHGCLGCFCYEFDHRVPYSLGGATSLDNCDILQTRINRL
                     KSNALEGVNISREQIRQYACEDVSNVIDMDAIEFAVYGDVRREGLHCRAYSLFEKVAS
                     EMLVSTGRVSRFESGSPAVTEHSPMKISRQSNIPSCTEALNRTPQQQGMKPVPSHPEI
                     PIPPAWLFLPSFS"
     gene            complement(<294225..>295094)
                     /locus_tag="CYME_CMD116C"
                     /db_xref="GeneID:16992667"
     mRNA            complement(<294225..>295094)
                     /locus_tag="CYME_CMD116C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535417.1"
                     /db_xref="GeneID:16992667"
     CDS             complement(294225..295094)
                     /locus_tag="CYME_CMD116C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535474.1"
                     /db_xref="GeneID:16992667"
                     /translation="MTLLRVGGVPEPFNEIFMQAQEGALPSTKLQVEFLGVAGGSGAA
                     LEMLAKCELDVAVTLTESAVARTKAAASGLAVHSVYVASPLAWGVAVSSKKTDWTDLN
                     SLDAAVLRGESIRAGFSRRGSGSHLLLSVFASDRGWISTGIQNDILKSFECGSFDGLI
                     QAAVAGDIDMFLWETCFTKECAATRQGLIRLVGEYAPSWPAFVLVCRDDAHVRAAVSE
                     LKREIEPLQRKFCTGEGLDILQNKYGFSLESAKLWLSRLQFAEPDEALSAEQWRSVER
                     ALELTAGSRSSSR"
     gene            complement(<295897..>296592)
                     /locus_tag="CYME_CMD194C"
                     /db_xref="GeneID:16992668"
     mRNA            complement(<295897..>296592)
                     /locus_tag="CYME_CMD194C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535418.1"
                     /db_xref="GeneID:16992668"
     CDS             complement(295897..296592)
                     /locus_tag="CYME_CMD194C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535475.1"
                     /db_xref="GeneID:16992668"
                     /translation="MSWIQKVGGKITLERHGAGFPEEFQMGEDATEGASRVPPPVPIR
                     NANTVTGKGIEWDKPNWPAIFHVVHIDLSELVPLVRANPALYSWFFWYAMVLLVLNWV
                     TWTVLAARGAASNPWAQWVVSLLNVFLGFFVLSAGYFTVFRACAEDDSTYYKASYCIL
                     GIITALCIVMSIVSFPFPFNGWTRLGWIQNNAKNLRTYWRAMTIIESIGWTVAYIAST
                     FLGIKLWRYQHLM"
     gene            complement(<299467..>301386)
                     /locus_tag="CYME_CMD117C"
                     /db_xref="GeneID:16992737"
     mRNA            complement(<299467..>301386)
                     /locus_tag="CYME_CMD117C"
                     /product="similar to enhancer of polycomb"
                     /transcript_id="XM_005535419.1"
                     /db_xref="GeneID:16992737"
     CDS             complement(299467..301386)
                     /locus_tag="CYME_CMD117C"
                     /codon_start=1
                     /product="similar to enhancer of polycomb"
                     /protein_id="XP_005535476.1"
                     /db_xref="GeneID:16992737"
                     /translation="MSRRALFRPRAIDLQRPLLIIRSDADLKSDVEVVSAQRALPEYG
                     TGVEEGELGERHLQEALLASMNLRIKRAETKSTAQEEDAESASCDHIDGRRTVIIPVP
                     VIREIPCYTEALLEQVRNRFQLSDTYVDARADDRALLEREIDYEADDGDKRFAQNELC
                     IDLDTFERAMDALEKEQGTARTLMSPNSAKSQLMKDATLGLNEQHIDALYMHWRRKRE
                     QRGGQPILRYLRDPPDVNNPDPSVAFRPRNDEEQKRRARSNTFDNYKRLRRIRQDMER
                     VRTIMEQVMKRERIKLDLVLFTISSQLATLQLRYPHLELIQKAAKILPLKTPIGADLY
                     RHLTNIAELARKGVLKWNSAHRRRSEEKASSDHSGTSVTKIRATSAAKPPDSGSAGSV
                     VAAPKRDLYGFDEKGFQAFRRLRYFSGGFFRDGINPFDWRVHGIPLWADPSLSHSVQE
                     RSQLGNITAERSIPQGARPAPSMELEASRLRKPLRCASTLIARLTTPMAYAILDAAAS
                     KNHPEEQTSLVVSASRMSSDGMKRIADTPAVGPKRLMCFPDSTPLCDQSTMVRTSFRP
                     TLVRARIGCDDAIYLDRITIRRETDKLSASESPAKLDAWSSREWQRPWPKRLKHSAPP
                     TAESVHKTASLDAKQ"
     gene            complement(<303744..>305393)
                     /locus_tag="CYME_CMD118C"
                     /db_xref="GeneID:16992669"
     mRNA            complement(<303744..>305393)
                     /locus_tag="CYME_CMD118C"
                     /product="beta-ketoacyl-CoA synthase"
                     /transcript_id="XM_005535420.1"
                     /db_xref="GeneID:16992669"
     CDS             complement(303744..305393)
                     /locus_tag="CYME_CMD118C"
                     /codon_start=1
                     /product="beta-ketoacyl-CoA synthase"
                     /protein_id="XP_005535477.1"
                     /db_xref="GeneID:16992669"
                     /translation="MASPDPSLGQGNADIVDAVPNGESAAHSGRPSNPLTALSLSTRA
                     LWQRVQLQYLQERETGAWVNLSYIFSGYRSSEFFQNLSHFFLGVFVVVSFATIYEAYY
                     SAPALSLLGGKYQYNVIELAITFLFLILSGVVYLTWRRKPVYLLDFATFIPPERLKVS
                     KETFLRLTEEANCFTPESIEFQKRLLERASVGDCTYFPEAMFRAKEIGANGGRGDRVL
                     NMASARREAEMVLFTTVGELLRSTKTNPKAIDILIVNCSLFNPTPSLTSMIVNHFKMK
                     SSILTYNLSGMGCSAGLISIDLAKDLLQCHRNALCLVVSTENITQNWYLGQERSMLIT
                     NTLFRLGGAAVLLSNRLSDSRRAKYALLHTVRTHRGADDLAYRCIFQEEDEKGIRGVR
                     LSKHIMEIAGETLRENIFRLGPLVFPLDVHIRFFVNLARRRYLGQKHVKSYVPDFHRA
                     FEHFCIHTGGRAVIDTIEASLRLTPEDVEPSRYALYRFGNTSSASIWYELQFIERSGK
                     MRRGDRTWQIAFGSGFKCNSAVWKCLRNISEREVAAEAVGT"
     gene            <309938..>310981
                     /locus_tag="CYME_CMD119C"
                     /db_xref="GeneID:16992670"
     mRNA            <309938..>310981
                     /locus_tag="CYME_CMD119C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535421.1"
                     /db_xref="GeneID:16992670"
     CDS             309938..310981
                     /locus_tag="CYME_CMD119C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535478.1"
                     /db_xref="GeneID:16992670"
                     /translation="MVSLSSCVRAALRSLYPGLRMLQFTPRRIFGLLPVLTVCLLIAL
                     GYIAIVVVTLVPMLAAKPFWATVLLLLVHCILVLLLWSYAAVVLVDPGHVPATWSFAR
                     LGWPLELRGSPEARDFVAKSDLSDAADGSERGMLVEGLRFVPNDKVKLPAVVLMRNRF
                     NRYRYCSKCLIYKPDRAHHCSALERCVLKMDHFCPWTNNTVGFYNHKFFVQFLYYGFM
                     ACLVTAVLSFPAIVQRLSMEISDEQTREFVIVILGLIGWIVCVIFAFALLFFAAFHTY
                     LVLRNRTTIETYEATDPTTALVLEAFDLGPRANWKSVFGEHVWAWILPVWSRHHRGDG
                     ISWETRVHREAFV"
     misc_feature    311700..314022
                     /note="possible transcribed region"
     gene            complement(<313318..>314634)
                     /locus_tag="CYME_CMD121C"
                     /db_xref="GeneID:16992672"
     mRNA            complement(<313318..>314634)
                     /locus_tag="CYME_CMD121C"
                     /product="probable photolyase/blue-light receptor"
                     /transcript_id="XM_005535422.1"
                     /db_xref="GeneID:16992672"
     CDS             complement(313318..314634)
                     /locus_tag="CYME_CMD121C"
                     /codon_start=1
                     /product="probable photolyase/blue-light receptor"
                     /protein_id="XP_005535479.1"
                     /db_xref="GeneID:16992672"
                     /translation="MVLGFAFVSPTTSALTVLRQHQVRHAGGRVRRHFREHRHWELAS
                     RTHQLVMRGCVAERSSEYFGSGAAVRNLQRLSLHPAPQFIGSEYGGNAEFGGKNGGTV
                     LLWFRSDLRLDDNPALCAALEEGASVLPVYCFDPRQFGKTSFGFEKTGRYRAKFLIES
                     VADLRKALKKKGNNLLIRIGKPEEVIPDLCRKYEIKKVFYHQEVTYEELECEEAVARK
                     LEDMKVEVHPFWTNTLYAVEDLPFPVEETPDVYTEYRLAVESKSRVRDPLAAPDEIRA
                     IPRHVEYGTLPTLEDLGLGQVPKTPEYGSASTAGSSLHHFRGGESEAQQRLAQYVQDA
                     KHALSVGGDVERAAAHLGADFSCKISPWLALGCVSPRRIFAEIRDHALNGAEGAQKST
                     TFFELVWRDFFRLITYKYSTSRLRKSERAAGMPHKASVAAAAPQAS"
     gene            complement(<315689..>316423)
                     /locus_tag="CYME_CMD122C"
                     /db_xref="GeneID:16992673"
     mRNA            complement(<315689..>316423)
                     /locus_tag="CYME_CMD122C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535423.1"
                     /db_xref="GeneID:16992673"
     CDS             complement(315689..316423)
                     /locus_tag="CYME_CMD122C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535480.1"
                     /db_xref="GeneID:16992673"
                     /translation="MFTVCLPKQLFRVHRDACFVGGYAPATTPGWCALTRGAARPAAR
                     VANQRASNTLQRRLRSAAEGEASGKPAPGEAQQATWVAVKAAIVIESPRSLVYRLFAD
                     LDRVKDWSASLAQCQRSESEPGVVEWKFSWQSVELEWKTRDTRIIPNQRIEWRSISGL
                     EHYGAALFDDAKDNTFMNIESTPCTRLTMHIRYDAMSPLAAAVLRTGVVRNFVETAIR
                     MDLNRFRDYCLRQQMLERRRARNPSG"
     gene            complement(<321997..>324600)
                     /locus_tag="CYME_CMD123C"
                     /db_xref="GeneID:16992674"
     mRNA            complement(<321997..>324600)
                     /locus_tag="CYME_CMD123C"
                     /product="probable ATP-dependent DNA helicase RecQ"
                     /transcript_id="XM_005535424.1"
                     /db_xref="GeneID:16992674"
     CDS             complement(321997..324600)
                     /locus_tag="CYME_CMD123C"
                     /codon_start=1
                     /product="probable ATP-dependent DNA helicase RecQ"
                     /protein_id="XP_005535481.1"
                     /db_xref="GeneID:16992674"
                     /translation="MWALCKCGGFIHNALVHKWQELAAGERQRARGSNAQRQPLVCRD
                     ATNYDRYKFFPKEYRRAGASKRGTRTPWQSASGARGAPYQRPQPPPPRAPPSQSAGDG
                     SSDMEAQALRAMKCLKEHFGLSEFWPGQLEVILRVLQGHSSLAIFPTGGGKSLCFQVP
                     AMLLDGLTLVVSPLIALMRDHVEMLQNQGIPAMHIHSGMSAPEVRQTYRLLSERAIRI
                     LFVAPERFVNEKFRQVIARLQVSLFVVDEAHCLSEWGHTFRPEYLLLRQFAQGAGARV
                     CLALTATATTRVVDDICRHFHIHSENVIRASVHRPNLTLRCTPVGEFFGTWSPDTDKD
                     GRLERRVFLLVERLLSRPRGSTIVYVTTQKTATAVAELLVTMYSLPAVAYHAGMTTEE
                     RASAQNIFMSGRDTIIVATIAFGMGIHKQEVRYVYLFNISKSIEAYTQSIGRAGRDGE
                     PAICELFLCADDLPALESFVLSSTPSRRAVHTLLESLFGSTVGLAEEHMTASANAPES
                     PNIRYMEKIAVREDQVALSFFNCGRALDIEETTIRVLLAFLDLKGGFIEEQTAYYAHC
                     EVDLLPNTSVEETLHLLRRDVSVPEGVWRAARLILNPSVKVGRRRTSDNNLFMRIDIH
                     DVVRARTAAFAHPVPSGATTRELVYSALELLQSLGIVRSIKFSHLYHVFRIVAKPSDM
                     QQLADDLYRSMLRREQQELFRIRTTAALFLGAEPRPGNKWVASRGSRCFARSLCAHYN
                     EILVHKCGRCELCLAAEGALGETPGMERLRERILNGGSTELESLNAVLADEKWQQLIV
                     QVPVLRTCSRLLARFAWGATSPKILSMKLQAHPLFGCLQGRYRYEQVLEAAEHLLQGD
                     DLLQESPTTVA"
     misc_feature    complement(324900..326649)
                     /note="possible transcribed region"
     gene            <326284..>327354
                     /locus_tag="CYME_CMD125C"
                     /db_xref="GeneID:16992676"
     mRNA            <326284..>327354
                     /locus_tag="CYME_CMD125C"
                     /product="similar to heat shock protein dnaJ"
                     /transcript_id="XM_005535425.1"
                     /db_xref="GeneID:16992676"
     CDS             326284..327354
                     /locus_tag="CYME_CMD125C"
                     /codon_start=1
                     /product="similar to heat shock protein dnaJ"
                     /protein_id="XP_005535482.1"
                     /db_xref="GeneID:16992676"
                     /translation="MFTQANLPLVRRGFALRSEIPEQCCPKRRLIVSRPSRAAWSRKS
                     LLVQQRSGVGTLSARSSVQFDPTEDYYAVLGVESDADLATIKRAYRRLALQNHPDANK
                     DPQAREKFIRILRAYEVLSNEDARKQYDLQRRSPGSGPFWGIGGPGAQRRRSSSTEEY
                     PEDLNDSFGAIFSDLMEQLGRLWQEGTKENGIFADFVEFLESQGANWGSLRNEDLNSV
                     LTSSDEDVLQAELDDARFVREQCEQRLRLLQNSLELTERRRAEQEQRAKDAHLSAGTQ
                     QEARSKVHELSLEARRLQSRIRQVQSLIARQRSREGLLQSRLDAIRRVQEARAASEEK
                     VRNLRSEVEEELEKLKRDLGKL"
     misc_feature    complement(327750..329112)
                     /note="repetitive element"
     gene            <329141..>329803
                     /locus_tag="CYME_CMD127C"
                     /db_xref="GeneID:16992677"
     mRNA            <329141..>329803
                     /locus_tag="CYME_CMD127C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535426.1"
                     /db_xref="GeneID:16992677"
     CDS             329141..329803
                     /locus_tag="CYME_CMD127C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535483.1"
                     /db_xref="GeneID:16992677"
                     /translation="MRDKLGFLTPFGMSSSTVYRLRPPAPQTTRLVLKQADITREAVD
                     AIVNAANERMLGGGGVDGAIHRAAGKELLEACKRVPEKRPGVRCPTGEAVPIKITWPV
                     SEGNLPQVRYIINTVGPIYQNAEKSAPLLRSAYRNSLLTAIEHNCRSIAFPTISCGVY
                     GYPLREAARVALEAVQDTLGESPQQSLQEVRFCLFSEDALKTWTLAAEQLQLERVKEG
                     AS"
     misc_feature    330250..333067
                     /note="repetitive element"
     gene            <333153..>336464
                     /locus_tag="CYME_CMD129C"
                     /db_xref="GeneID:16992678"
     mRNA            <333153..>336464
                     /locus_tag="CYME_CMD129C"
                     /product="similar to BRCA1-binding helicase-like protein
                     BACH1"
                     /transcript_id="XM_005535427.1"
                     /db_xref="GeneID:16992678"
     CDS             333153..336464
                     /locus_tag="CYME_CMD129C"
                     /codon_start=1
                     /product="similar to BRCA1-binding helicase-like protein
                     BACH1"
                     /protein_id="XP_005535484.1"
                     /db_xref="GeneID:16992678"
                     /translation="MSNVERHEEPNGAQTLKTWRTLEIAGLEVKFPTELEPHKPQLII
                     MNQVIRCLQRAQNACIESPTGTGKSLALLCSALAWLEKEKERSEPSLLAVANHADMHS
                     EFKPETEEPADEKQSIPKLLPESRSAADDCGVQDVDDDDDDDDFTSRPAPRVSQLKSA
                     SQRWRQQGAVAGTRHRYPLCGKQVPLNPLCSVAVHLEGTNLAVQQRHPRIFFCSRTHA
                     QLSQVIAEMRRTPYAGKMRSTLLASRKHYCVHEDIQRAPSTLQAEACQRAVQLSFMEE
                     AKSAADASSTVADPLAGISPCFYHHSAAVRRTACSAPQPFQMEDLVQVGRHWHGCPYF
                     ASRFLVHGDIQTEPNQDSVEGSSVPDERSHTGSASSTDGAVSARATSCTTRTRTIIEP
                     ADIIFSPYSYLVDPLIRRRMDIDITGAVLIIDEAHNIEEVCLEAASVDVSLSQVQRVL
                     LQLDHYLGVQMPETEPTLETLMVRRPSLNGTALLRVFRHWLQALASFIETRIPLLDDI
                     HGIPESHRPTSGPCTAAQRLHAQATVFWQDGALLHELEVGFFQNFDFEQWNWSMGQLN
                     RFLDRWRQKQQRTVPALASGMAASTGFGTETATEEHAEQSVQARPTTGDERAETEPRF
                     ASLCGEVLHLLERFHIALQFIYGGQSSKGAAAPAEASLLHATDYRLVLRREMRQGTYG
                     GVEFKLGLWCMNPAIAFRHLRDNARSIVLTSGTLSPMESFRSELATDFLCQTECDHII
                     DPEKHVRVCVVGTSSSGDRLEGSYRTSATWSYQDAIGEALAHCSAQIPDGVLCFMPCY
                     RVLESMLQRWSSTGAIERICGAKRLFIERSSGQVITEYATETAGGYRLQRRGWRDSCF
                     TPAREYGTDASVAALGERPSSLRAASSSILSRDRSKRKRRGAGRAYTSASAYANRDAL
                     QVYYDAVDAARTETTASAPVPAANARCRITADHKNGAIMLAVCRGKISEGLNFADQYG
                     RAVIMVGIPYPNLTDTFVQLKMRYNDERSGAVSGAPINATSTSRLSGKQWYVLQAHRT
                     VNQALGRCIRNPKDYASIILLDVRYRDTRTVNCMCRWIRDPLRDYIARHGQTLTLEAA
                     VREVAEFFFQKYDAK"
     misc_feature    complement(335866..338127)
                     /note="possible transcribed region"
     gene            <338047..>339930
                     /locus_tag="CYME_CMD131C"
                     /db_xref="GeneID:16992680"
     mRNA            <338047..>339930
                     /locus_tag="CYME_CMD131C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535428.1"
                     /db_xref="GeneID:16992680"
     CDS             338047..339930
                     /locus_tag="CYME_CMD131C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535485.1"
                     /db_xref="GeneID:16992680"
                     /translation="MEALRITFWYLRYWNTIITDKGHQLCFGEKHRPRRLGIAQSLVQ
                     GIGAHCRTDLCHYFWRETVSIASVGISILHWVYLLFGACTGAAETLLCTDRVLAPGVD
                     ALGTMPRGTDATASDEREQEEQARATRPRRRAAARYGSQKRSVAVDPAYYLGYADDDE
                     TPEMIMRKFEALERLQAQKAANTQQSSGDANDSQTAKEEVTLTAAEQAELFRQTSFFS
                     VDMLAGSTTQSLPGGVGESTDLIAVGALDDSSFERVLAEYGLDAVLFGAELSDSEPGS
                     EYDDGEDLLWEEALESDRSARFPGRLTRSRPDRSESSRVALELWRARAALLMRLSAGG
                     DALAAAQAAAMIPAALRARRRRLAAEGVLRETIPTEYPLPVSWARTIRPLREAVQEGQ
                     KLERNYECGRLLRFANVFQAAKTLHERIKGRHFRCVVLDPPCWNQPDFRVEQLRSLRI
                     AEIVPFGFVFIWVPKTRIAETLRWFGEEMHQGGGGGFHFVESFCVVLKWTNNRVATLL
                     SEPSDLLCLDQPVAVAEHAPSGVYACSHETCLVLRRPGPHIELAHQRNPDLCFDYVRL
                     HQKRYQRRRPELFYHMIETMLPEVARDGDMLCVWADQSVCKRTCWVSVVEDQSLEAGE
                     SSS"
     gene            complement(<341836..>348003)
                     /locus_tag="CYME_CMD133C"
                     /db_xref="GeneID:16992681"
     mRNA            complement(<341836..>348003)
                     /locus_tag="CYME_CMD133C"
                     /product="ATP-binding cassette, sub-family C, member 2"
                     /transcript_id="XM_005535429.1"
                     /db_xref="GeneID:16992681"
     CDS             complement(341836..348003)
                     /locus_tag="CYME_CMD133C"
                     /codon_start=1
                     /product="ATP-binding cassette, sub-family C, member 2"
                     /protein_id="XP_005535486.1"
                     /db_xref="GeneID:16992681"
                     /translation="MPTGAAATSPAQLPASIDDEETFRLVEEKETFLWTENGPGRAPS
                     SWQFPQERLVCAALRCPEQDAGLWTRITFRWLNALLELGKIKPLELDDLWSLPSIDDP
                     TRISARFQETWKRRCERHQYRPRARDHSQGRATREAPHVPHPRGICGLFSQLRLWILH
                     RSGVAMSPTDPEEEQTNHEAFLASPHTVAKSPRPLSVSTECREDVVPKRPEQGLGAVV
                     LALLDAFGGRCLGSAPLKLCYDLLNFVGPLALERMLQFLSRGAHEESSLEGMLCVLAL
                     FTAPMLQSICLHQYFHMNYRVGMQARAALMDAIYRKTLRLSVCARNHYGAGDIVNLLA
                     VDTQRATVDLTPYLHIIWSGPLQIIIAMVCLYRVVGMAAFAGFLFMAALIPLNGWVAR
                     LIGQQSRALMERKDERIRLLHEILSGIRQIKIMGWEQAFFERVQEARLRETQVLRRKQ
                     LLEAFSNFSWAAAPVATALVTFGCMGVGPSAQRLTPATAFGALTLFNILRFPLSVFPD
                     VLSSLMDAAVSLRRIQAFLCHYEVPERFALDAVETDSASSGTEVSETLAGRPSVARKA
                     TSSFLGGGPANGLDRVANSQSASKAAAADVTHFPVAGTETMRSTDAPAEASLFIDAGS
                     AATRETPGSELLRVPSLPFLSDTSAARSTSLQEHQESRLHQRQTTASRLLPPYGTSFR
                     AGHWNEATPGMEAPGDDVVISLRHMSYAFEPLPMQLDASLLLGVPSVHSSASGQSSMG
                     GSSLLVPRHELAASIQNLDAVSCSFGAKHNDVDRSTYEGSVVQGVHGGLVPDDKAVDQ
                     TTASVHLGQTFRNAAACDPDMDTIMDMDTDTNTGAGPFATNQAGTVPSRKNALKNTPE
                     MTEASPGQGTLSWVLHDITLQIQRGQLVLICGEVGSGKSSLLLAILGELYGYPATVEA
                     AMSTTFEAKTTRSFASSYQGAHHLVRPTTIGYCPQEAYLMNASLRENILFYTPLDEQR
                     YREVLEATALVDDLAQMPAGDRTEIGSKGINLSGGQKARVALARALYSCASLLLLDDP
                     LSAVDATVGRVLFERALCGPLARGRTRILVTHHRQWLSRADLVIELAGGRIQRHSVRP
                     QPLRIPRGKPRDQQASPIQVSLLSDAENDEKQLLASGDKAGAFRVPTSRAAEPLVMEH
                     SNELEVSGSFPLGTIDATAGAGRGAPEDALAAEHAVGDLPLSEVSIAQSSRPGIEQGA
                     TPHAKGNAFDQFADNNDNDKYALRSRATYAVASNHESPADGAAPSADPESMPEAPGTT
                     SHQLVTAENRETGSVKRTVYLAYFAAAGRFLLAVTILASVLAQVFRIGTDSWLGIWSE
                     AGSRAATSAAQRTGADKRNPSTPSGLPTGAPGLGHVPKMSPGVRTRIQNLMTPSGSHL
                     AAEEHQVVSVLTPDQEHRGWQQYQQHRSCADALTSRYQQGRSWKQSIFWGFPNRPSRE
                     RAAETSRSDSQRVLHATSFYLGIYALLNLSTLLMLLARSILAALSTLSAAIGLHTRLL
                     QVVLRAPTMFFDTTPVGRILNRFSKDQDALDEDLPYALLSFLNCILQVLGVVWVTSTV
                     TPVMLLVLIPTGILYYRLSRYYLCTSRELKRLEALSKSPILARMGETAAGIPVIRAFG
                     LVREHVQVFLEAVADHMRPYLYSVACNRWLSFRLEMLSAMTVFATALAVFLFRRSLSP
                     AAAGLSITYSLLVTQTLSWLVRMTTEVENGMSAVERILWEIPSEAPAYIEGSLPAHWP
                     SEGRVEFRDVWMRYRPELPPALRGVSFTILPGQRVGLIGRTGAGKSSIAQVLFRTVGD
                     PLQAGAVIVDGIDISRVGVAQLRERLAMVTQDTILFRGTLRENLDPFHRHTDAELWQA
                     LRYVSLAENDTHSAWAAVDRTATKTAVAGCRHGDTSAHTKTGTDAAVNAADAVAEHGT
                     LAAHGASTAALKQQEEQARSMPALKSSNRFPSLDTHIAEGGSNLSAGQRQLLCLARVL
                     LRRPRVLVLDESTANLDYRTDRAIQRTIRACLQGSTLLIIAHRMDTILDCDLIIGLAA
                     GRVVECGSPASLLQRRDSLFYQLAWEQGVLEQITSGTLS"
     misc_feature    343446..344158
                     /note="possible transcribed region"
     gene            complement(<348844..>351132)
                     /locus_tag="CYME_CMD134C"
                     /db_xref="GeneID:16992682"
     mRNA            complement(<348844..>351132)
                     /locus_tag="CYME_CMD134C"
                     /product="ATP-binding cassette, sub-family G"
                     /transcript_id="XM_005535430.1"
                     /db_xref="GeneID:16992682"
     CDS             complement(348844..351132)
                     /locus_tag="CYME_CMD134C"
                     /codon_start=1
                     /product="ATP-binding cassette, sub-family G"
                     /protein_id="XP_005535487.1"
                     /db_xref="GeneID:16992682"
                     /translation="MATSREYPRRHGDDSVNPRSISEYSISQEQVTSFGQASSFSIDP
                     AALHVERAVLEPQPLIFTWKGISYWVPVPKLKEKRSLQKLVRRKKVKESKAATVKEVE
                     AERDLESGSSTEAPQPPPQTEQVAHVDAHSDAEDGELQLLYDVFGFAQPRRLLALCGA
                     SGAGKSTLLDVLANRKTKGRIAGEICVNGEPVDYSFLTHFMGYVEQRDLHISKQTVHE
                     AVLFAARTRLPPGTPDSVAKQFTEYILEIMNLSVDRNRLVGSEADSEASGVISSDARK
                     RLSIAVEYAANASLYFLDEPTSGLDARSALRVMRAIRALADNDCAVVSVIHQPSFEVF
                     GAFDDLLLMRSGGRTVYFGELGDACTSMTSYFARNGAEPIDDMTNPADYMLRVIGGGI
                     DSKRKAQMRDWADIWQDSQECKAALEKLEELKKTSRGRYTLTYKPPTRRQQWRRAYYV
                     TIRQLISYWRTPTYNFSRMVLAVALGLMIGLFFLKLPRNNTALDSYVSVVYLSLLYGV
                     FLIQNVLGPTFQERAAFYREIASGTYKPIAYAFAIGIAEIPYTIVGSVIFTLLVFFMV
                     GYPAAQYGYFLLMNILFSLFTTSLGQLLAALLSSQVVGVMIVGMLIPLMNVFSGFLQP
                     YPDIPHWLWWAYYADPYRWALEGVVVACVDNVAFHCDPGEFRFFPLPPSFNGDCSDGG
                     TLNYYNETSASVCAAAGVTVANGSVACCRYCPVTNGRQIIEEFGLHANWKWIDIGAVA
                     GFYALFRIANTLALLYIRHLNR"
     gene            <351707..>354184
                     /locus_tag="CYME_CMD135C"
                     /db_xref="GeneID:16992684"
     mRNA            <351707..>354184
                     /locus_tag="CYME_CMD135C"
                     /product="ATP-binding cassette, sub-family G"
                     /transcript_id="XM_005535431.1"
                     /db_xref="GeneID:16992684"
     CDS             351707..354184
                     /locus_tag="CYME_CMD135C"
                     /codon_start=1
                     /product="ATP-binding cassette, sub-family G"
                     /protein_id="XP_005535488.1"
                     /db_xref="GeneID:16992684"
                     /translation="MSGNELEKHVANLAHLHSYRSEVLKKSKLPQPAKGIARRAASHF
                     VNWRQLHNYRKELEEQYAEFATDPRYQVDSDEFDPQAYTEVVSALQSALLLKPPQIAI
                     AWKNLTVKVPVVYGRTGIETVGSKTQEAVLALPRVAIDIGKWIWTDVFRQGLNKDAHL
                     EPIVDDATGVLLPGETLLVLGPPGSGTSTFLNVLAQRSLKDYAAITGTVEYNGCDLHT
                     AEKRTVRPLQHIVQFVEEADTHIASLTVRDTFRFAAECLIPDFFPFAEKVRQDRVELL
                     IKNLGLEHCADTVVGNELLRGVSGGEKKRVTIGEMAVRLSSQIWLLDQWTRGLDAATA
                     MDLQYRVAAVAKQRNITVISVMQQPSQEIYDAYDKVLLMEAGKVLYFGPTNEAERYFF
                     KLGYRRPRKRLIPEFLATLGDPFESKLCIRPGYEDRVPRTPAEFAERYRNSSIARRYR
                     EMVESHSYLTDEQREAFNQERYVEISKLYVRNSLQPRLRQMFICLNREIRMIITAPFS
                     FIVRFARYIILGIVVGALFFGINHDQLSVRVRGGLLFLVLLTVGVAGFSSIQQNAATL
                     QIIRKQRRAGFYEMPPYFFALWLMDIPIQFIEVLIYLTLVTYMTKLQGGPRYGFAILM
                     VWLTGMATNTLLKSIGYAAPYTDIALVLASLVIMLMVLSVGFLATPPNIPVYLRWIYW
                     INPFHYAYEAIMLNEFDGLYFHCTPSELQPAGVPSAYQVCPITNGIKYLHSHYNFASN
                     PSYKWIDFVIIVAYYVGFTIIAAILLVLVRWPPRPMYKNAREVACETDVQTFVESLER
                     EASLSDRRSREVSNPFTDRKISTNSRP"
     gene            354885..356658
                     /locus_tag="CYME_CMD136T"
                     /db_xref="GeneID:16992685"
     misc_RNA        354885..356658
                     /locus_tag="CYME_CMD136T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461234.1"
                     /db_xref="GeneID:16992685"
     gene            complement(<358352..>359737)
                     /locus_tag="CYME_CMD137C"
                     /db_xref="GeneID:16992686"
     mRNA            complement(<358352..>359737)
                     /locus_tag="CYME_CMD137C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535432.1"
                     /db_xref="GeneID:16992686"
     CDS             complement(358352..359737)
                     /locus_tag="CYME_CMD137C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535489.1"
                     /db_xref="GeneID:16992686"
                     /translation="MSVLLRNFIYECLYSPKRGYFNPVKEADLPLRRSSRGGQNVELK
                     FASRAEWDAHVRDLYATAPRTWLTPSELFSPHYGRTIAHFLAVTHDHDTIVEVGAGNG
                     TVALDALNYLRDSFPEKYAKLTYHTVDISAPFVMRQHEQLYEHIDAGRCVVHHRSALE
                     EPIPLEHPEAAAAAAAAAARAHERYESGQPPRVAVLALEVLDNLAHDAIVQNRRTGEW
                     YQLLVDGRGRFLYEPLRDDLILEACRVWGFGPHFEAEETPSKMGDPPEPSMYAGRGSG
                     IVRSIEQIRSLFRRMNDWVIPSSVRAGTSMNTNAGPAEAFDAEDVSWPTYVPTDATLL
                     LRNIARSFPQGHSLLIADFACFTDSLPTASGTTIAPVIQTFGQDQTVDWPAVRPGEHD
                     IMFSVSFPRLLRAHRRLERRIGLQELLPQQEWWRKHAATNPSGYNPILESFANMFMYF
                     GSTFRPGRGHQ"
     gene            360041..361694
                     /locus_tag="CYME_CMD138T"
                     /db_xref="GeneID:16992687"
     misc_RNA        360041..361694
                     /locus_tag="CYME_CMD138T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461235.1"
                     /db_xref="GeneID:16992687"
     gene            <362137..>362967
                     /locus_tag="CYME_CMD139C"
                     /db_xref="GeneID:16992688"
     mRNA            <362137..>362967
                     /locus_tag="CYME_CMD139C"
                     /product="similar to endonuclease III"
                     /transcript_id="XM_005535433.1"
                     /db_xref="GeneID:16992688"
     CDS             362137..362967
                     /locus_tag="CYME_CMD139C"
                     /codon_start=1
                     /product="similar to endonuclease III"
                     /protein_id="XP_005535490.1"
                     /db_xref="GeneID:16992688"
                     /translation="MRLRKRPLTRALTCIKSEDARNERLGKAAGEINEKPAPEDSDAS
                     PSVRQVYQALVQTYGERNRRPTGRSVLEALVRTILSQNTTDKLSGAAYRALRSRYKDW
                     ADVLHAPVGEIEETIRIGGLARTKAQHIQDILRELEHNAATTGTDTDWTQGLEFLRNV
                     PTAQVMEYLTRYPGVGPKTAACVAMFTLERDDSFPVDTHIFRLAKRLGWVPNGHTREQ
                     AQVDLENLIPSTLHYPMHILMIEHGRKVCTARGPRCQHCKLAGLGCPSATQDTESTPV
                     "
     gene            <365724..>366179
                     /locus_tag="CYME_CMD140C"
                     /db_xref="GeneID:16992689"
     mRNA            <365724..>366179
                     /locus_tag="CYME_CMD140C"
                     /product="60S ribosomal protein L27A"
                     /transcript_id="XM_005535434.1"
                     /db_xref="GeneID:16992689"
     CDS             365724..366179
                     /locus_tag="CYME_CMD140C"
                     /codon_start=1
                     /product="60S ribosomal protein L27A"
                     /protein_id="XP_005535491.1"
                     /db_xref="GeneID:16992689"
                     /translation="MATRFKKNRKKRGHVSAGHGRIGKHRKGGARGGRGMAGGMHHHR
                     TLLDKYHPGYFGKVGMRYFNAGADKNAKYTPCINIDKLWTLIPPAEKEKYASNKEAAP
                     VLDVTRAGFFKVLGRGHLPKQPLIVKAKYFSKTAEKRIKAAGGVCVLTA"
     gene            <367938..>368498
                     /locus_tag="CYME_CMD141C"
                     /db_xref="GeneID:16992690"
     mRNA            <367938..>368498
                     /locus_tag="CYME_CMD141C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535435.1"
                     /db_xref="GeneID:16992690"
     CDS             367938..368498
                     /locus_tag="CYME_CMD141C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535492.1"
                     /db_xref="GeneID:16992690"
                     /translation="MPLIETALHARQSVSECLSSAESLFQQVLAARDEAERRCQVQTT
                     WLRVLVRDVCALVDERLGDFADWNCEENTLDAAELRKLLEEDAGPEALAEKAHALIQA
                     QRSRKRERLAEQDEVAGSVGGLGNYKAELEMIHCQLEKRLKEPKSERAYLARSIASVA
                     TELDRCAALLKHARQLACSALQDTHQ"
     gene            complement(<369117..>370382)
                     /locus_tag="CYME_CMD142C"
                     /db_xref="GeneID:16992691"
     mRNA            complement(<369117..>370382)
                     /locus_tag="CYME_CMD142C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535436.1"
                     /db_xref="GeneID:16992691"
     CDS             complement(369117..370382)
                     /locus_tag="CYME_CMD142C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535493.1"
                     /db_xref="GeneID:16992691"
                     /translation="MFLVTRLYRLLWYAVGLVWRLGTWLVGVRAPATLAEGFHGKRPR
                     STVWEREREDAQGAAFGGRSGSPADRASPFAPETESAVLSLPLADGRSGNARNRPLAA
                     STSAELMSGAEYHSKNGRYRAGTPHGDNLYPAVGGERVSSSAAADVYEEQHQRLVRLG
                     EHELMPSAGPRWTEQASDELLDEYYTGNGGVMYPAAHTSVRYLARNDARWTTAPQRLR
                     QFPEEHEPGTSVMGGAPSASGATILTEADNQSKGGAPESAGPSGADAGLTSSSIREAV
                     LEALRQTQQESGKSPVSMQSDSFWHSKEPQEMRRLMRRVYMIMYAFIFSTALLLIFFF
                     QQDGPMTSEHRILLCVVLPIYVLCFAMLHSFGDNFPANLVMLVLLSSCSWFAIGFLSA
                     FYLHRSELAPFTTGGHAAKLSTSLGKFSR"
     gene            <374842..>375687
                     /locus_tag="CYME_CMD143C"
                     /db_xref="GeneID:16992692"
     mRNA            <374842..>375687
                     /locus_tag="CYME_CMD143C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535437.1"
                     /db_xref="GeneID:16992692"
     CDS             374842..375687
                     /locus_tag="CYME_CMD143C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535494.1"
                     /db_xref="GeneID:16992692"
                     /translation="MQAGGAEIWPGAGAGTAAGTGGSDATPVAAAATTTTGASRSFSV
                     RDWEARLRQVRVDKRDINRLVMNYFVVEGYADAAAAFASESGMEPGVDLSATQQRLEA
                     RALVEEGRILEAIQRVNALNPEVLDSNPTLHFRLQKQRLIELIRQGCIEEAITFAQAE
                     LAPLGQTDESYLEELERAMALLIYDTATQHPDTSMVQELLDERQRTRLASELNAAILA
                     NQNQEISHKLPRLIRLMRYAERDLRSRGVVFPELDLETGVLRESSVSATSTQAEPEPM
                     ADPSA"
     gene            complement(<376618..>377523)
                     /locus_tag="CYME_CMD144C"
                     /db_xref="GeneID:16992693"
     mRNA            complement(<376618..>377523)
                     /locus_tag="CYME_CMD144C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535438.1"
                     /db_xref="GeneID:16992693"
     CDS             complement(376618..377523)
                     /locus_tag="CYME_CMD144C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535495.1"
                     /db_xref="GeneID:16992693"
                     /translation="MRAASTSKPVGAHEETGHLGGAHSTYVSSAQVTNAEHENELQVV
                     DLPRAPPSLSKAVTYFYITGFGRFALMEDNPTERVVLRLREILQDPGRVQMLHERLVR
                     IVDLRILEVSAAAAHETLAEMKTQCLQMRQKPNISSDGRNRTVCFLHLGVDASADGFL
                     VERSAVNEALFRFPDERGWQPTTPIPIVRGAQLGARYELDGEALASLCERTESLLNEW
                     GRTNWTVRVNDDAGRFLCNYLFYLSAFEGLAENGHHLWQTFFLHCPMETVAPLDVQVD
                     VVLAFMVAVAQSNAQQGPLEGILAR"
     misc_feature    377794..379269
                     /note="possible transcribed region"
     gene            <379576..>380352
                     /locus_tag="CYME_CMD195C"
                     /db_xref="GeneID:16992695"
     mRNA            <379576..>380352
                     /locus_tag="CYME_CMD195C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535439.1"
                     /db_xref="GeneID:16992695"
     CDS             379576..380352
                     /locus_tag="CYME_CMD195C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535496.1"
                     /db_xref="GeneID:16992695"
                     /translation="MSADSGKCAACCVEHCLCKREAVFRAHQVHCVEVENEPTHPELF
                     RNEWVRVYAGILAIGNCTLFHRHTRDTLYVTLRDASLLNEYFVDPSLRDAHTKTYRHD
                     ARRFEVFGRWHATDQNPLVHRVCYPSDWAKSLADRSASPTTLFIGIEFLAYPEVSPAL
                     IVADAVRIESVAEYLQEPSSPRMRLWRLRENLEAIRLPFHCVVIEWSSPLDEHWDTTD
                     LATLMKLTASRVRFVPAGVQQLRVLANTLVVELRSRTDPS"
     gene            complement(<380753..>381688)
                     /locus_tag="CYME_CMD146C"
                     /db_xref="GeneID:16992738"
     mRNA            complement(<380753..>381688)
                     /locus_tag="CYME_CMD146C"
                     /product="similar to 3-oxo-5-alpha-steroid
                     4-dehydrogenase"
                     /transcript_id="XM_005535440.1"
                     /db_xref="GeneID:16992738"
     CDS             complement(380753..381688)
                     /locus_tag="CYME_CMD146C"
                     /codon_start=1
                     /product="similar to 3-oxo-5-alpha-steroid
                     4-dehydrogenase"
                     /protein_id="XP_005535497.1"
                     /db_xref="GeneID:16992738"
                     /translation="MSLSIQSRSGRELLRLSLREPGAPQTVDDLQQLLWLQGPRVKPL
                     RQRLTLPTGVASAPKARSLLEAGHKLEEYGIRVDAGAQDFVVHFKDLGPQVSWRGVFL
                     AEYLGPLVLFPIVFTLQLGGLDFSYAWHRALPQQRAALVAWTLHFAKRELETLFVHRF
                     SNATMPWRNLVKNCAYYWGFATYVAYFVCHPRYTPVASHIQFWIGVLCFGIGELGNLV
                     CHWRLRQLRPAGTRLRQIPYGFLFELVSCPNYTFEVLAWVGFNLMTQTIAGILFMLVG
                     TLQMMIWAQAKHRQYLKEFGTLYPRSRKRMFPFIW"
     misc_feature    381830..383144
                     /note="possible transcribed region"
     gene            complement(<386617..>388707)
                     /locus_tag="CYME_CMD148C"
                     /db_xref="GeneID:16992697"
     mRNA            complement(<386617..>388707)
                     /locus_tag="CYME_CMD148C"
                     /product="ATP-binding cassette, sub-family B, member 1"
                     /transcript_id="XM_005535441.1"
                     /db_xref="GeneID:16992697"
     CDS             complement(386617..388707)
                     /locus_tag="CYME_CMD148C"
                     /codon_start=1
                     /product="ATP-binding cassette, sub-family B, member 1"
                     /protein_id="XP_005535498.1"
                     /db_xref="GeneID:16992697"
                     /translation="MNAHAAQSFETANYSSVGENHRERTLSSSIYETDPVSPDTAVSS
                     EATAFQESFPSLKLKEKDTPNRRWWRFWARPSAAGEDPEAGDPKKAAKASGPESAYTT
                     GVTARRIFALAWSSSATMIVIGFIASILEGATLPAFAIVFGRMFQVFTKSKSQIEGET
                     WKYSVGFVGIGVFEFIVAGSRTALFGIASERLARDLRVAAFSNLVEQDVTYFDRRKAG
                     ELGGKLNNDVQVIQYSFSKLGAVLFNLAQCVVGIIVAFIFAPALTGVLIALSPLVVLA
                     GAAQMIEMSGNTKRSSEAYASAGSVAAEVFSNIRTTKAFEAERYETQRYGSKLDPLYR
                     LGRRRYISDGLFFGLSMLVIFCVYALALWWGGQLIARGSLNLGNLLTAFFSAILGFMG
                     VGQAAQVWPDVTRGLGAGGELFAMIDRVPQYRRPDPGAEVVTQPLVLKQGIVFENVHF
                     RYPTRMNVEVLRGISLTIPNGKTVAIVGGSGAGKSTIIQLLMRFYDIEPQGGGLLLFD
                     GTPAWNYDFHALRSQIGLVSQEPVLFSGTIRDNILYGKRDATDEEVIQALREANAYSF
                     VMALPDGLDTEVGERGLALSGGQKQRIAIARAILKHPTLLCLDESTSALDAESEALVQ
                     EALDRMMASDGVTSVVIAHRLSTVARADLILVMQDGVVVEQGNHSELMALGPSGFYYQ
                     LVEKQLASGDMSAA"
     misc_feature    389093..391664
                     /note="repetitive element"
     gene            complement(392779..395028)
                     /locus_tag="CYME_CMD150T"
                     /db_xref="GeneID:16992698"
     misc_RNA        complement(392779..395028)
                     /locus_tag="CYME_CMD150T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461236.1"
                     /db_xref="GeneID:16992698"
     gene            <395206..>400407
                     /locus_tag="CYME_CMD151C"
                     /db_xref="GeneID:16992699"
     mRNA            <395206..>400407
                     /locus_tag="CYME_CMD151C"
                     /product="similar to transcription initiation protein
                     SPT5"
                     /transcript_id="XM_005535442.1"
                     /db_xref="GeneID:16992699"
     CDS             395206..400407
                     /locus_tag="CYME_CMD151C"
                     /codon_start=1
                     /product="similar to transcription initiation protein
                     SPT5"
                     /protein_id="XP_005535499.1"
                     /db_xref="GeneID:16992699"
                     /translation="MSKQEKSSETRSADDKSPTAATGNSMTPSAGTADTETPLVSSSQ
                     VTDQGSGSVSSRMRDEATLSSTGNDSANASVQPASDASDSLQQVSASSMPNVTGSNDD
                     KNPAHVQQTTSGAGQMSSGLEGCNTSGSAAGSSALPPPPDSPVPVEEAASQVLSAGQA
                     VPESGKRTQASEVQSTATLSAGRARGVKRGLESAEPDTKSTVEEEPPVKTLRHDAHER
                     YEIHRDQESSTKAADESSSPSSRLEIPNAPVPAATGVPPVLPGGTSGEDVPAFTPSKP
                     SQASPPLSTPQPATAAGSSETLRPEDSTESGYSTRDTTERHPLRRQEEALARAPRQNV
                     KSTIQHRMQEEAEGNDGDEYPSAEIKDGIDDEDDEEERADDDDDDADEEADEDEDEDE
                     DDEEDEDEEEHSSRRRRGAAQFLELEAEVDEGDEEEEEDDDIQDLVADEDEESADEEE
                     LAAEEREAIARREQRRRAEAALLQRAQTAEELEKFVQERYGGLDDEDEESDLITRAFL
                     EGAAGAADGSTARRRHGAASDLDVLPVPAAMARGKPPTDIEQQSLLPTVHDPRLFLVK
                     CRTGKEKEMTICLLQKCVDRANQGQPLAITGIVAPDHLRGCLYIEAPRENDVRDAIKG
                     LHHLYQTKITLVPLKEMVEVVSVRPTTERQKLIPGQWVRLRRGLYAGDLAQVYQIRED
                     QVIVRLVPRLDLTALARKPRYGAVDAVDRDDMENVDDAATKGAPSRQVGEAAAARRGG
                     SRTSGVRPPRKLFDRDQVARILHVNVFARRDSRTGEWFDEFENDQFRYGLLYKRVSRK
                     NIIHGAAMTPPSIDELEPFQEAERQAQVAAAAAAAAADDDNDNDSDDDDNDDAGAGIS
                     DKASDDSLAAAATVQRFTSGIDAIASGTSTPAADMEAFRASSALVAATQAVTATAADA
                     NRHRFRKGDRVRVRRGDLRNLIGIVDSVLPDARVLIQPTPATGEHDASTTPASVQVLA
                     ADLEKYFAIGDHVRISAGKHAGLTGLVVATAYQDQDTDKSTDNADNDNDAQASVTVLA
                     DVTNEVVRVSAHLLSESSGEQSAATAAKLIAGGLYHLFDLVTLHSEPRHAWLILRSLL
                     GHASSTDLMANGANGTMLSARGAVALAQAAVERVQVMNEVGEIKTVSVQDIRGRRDGS
                     TARTSQLRTLDAAQQPVGAGDAVRIVGARHPHRNREALVMYVFGNRLFLRIREHLDNA
                     GMVVASGSEVQRLTQAPAAEVNASGAGTVSTSLPFVAPTSGWRPSMGTAFGRGGIGSG
                     GLGNSTAPLSSSRAPFGGSDSGRKPTPGAVRGGGRGGGGGDPLLHRWVAVTRGPHKGL
                     SGRVLDASDTSVRLELESSMKTITVARDAVRLRAEASSAATSAALGRASVIGGLYGPG
                     LVTGLAGQSAYGLGMATGAYGQASLVTGTPGATSSLAAVGAGVASARTPLQGWQPNNQ
                     VAGMQRTPAMDASYATVPVTPYASALTATPLHPSVPMTPAHEFGGTAAGGASARGGGA
                     SDVWRPMTPAHVPEAFASVRPSTPMHPAVDAQRPTSVKAAVDDGASEAGAGAGAGAGA
                     GAGAGAGAAAAGPGPVAMSSECNPATPDTPDAVTPAPPTTTTIRKVPESVPGAFTVSS
                     VPSYWLGAVMRDKRAGNRLVVVCGLPSEESGSWLVKAYDQQQDAASKHTEQEASKAEA
                     RARTELEPVAPDPGDTLVVYQGDLEGVLGVCIHVDEDGDCMFKEHGTQELRVVGVNQA
                     IRRISTA"
     gene            complement(<400637..>401080)
                     /locus_tag="CYME_CMD152C"
                     /db_xref="GeneID:16992700"
     mRNA            complement(<400637..>401080)
                     /locus_tag="CYME_CMD152C"
                     /product="probable ubiquitin-conjugating enzyme E2"
                     /transcript_id="XM_005535443.1"
                     /db_xref="GeneID:16992700"
     CDS             complement(400637..401080)
                     /locus_tag="CYME_CMD152C"
                     /codon_start=1
                     /product="probable ubiquitin-conjugating enzyme E2"
                     /protein_id="XP_005535500.1"
                     /db_xref="GeneID:16992700"
                     /translation="MALKRISKELVDLGKDPPANCSAGPVGDDLFHWQATIIGPPDSP
                     YAGGVYFLNIHFPTDYPFKPPKVQFTTKIYHPNINSNGSICLDILREQWSPALTISKV
                     LLSICSLLTDPNPDDPLVPDIAHKYKTNRAKYEEEAREWTRRYAM"
     misc_feature    401885..405832
                     /note="possible transcribed region"
     gene            complement(<402932..>407158)
                     /locus_tag="CYME_CMD154C"
                     /db_xref="GeneID:16992702"
     mRNA            complement(<402932..>407158)
                     /locus_tag="CYME_CMD154C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535444.1"
                     /db_xref="GeneID:16992702"
     CDS             complement(402932..407158)
                     /locus_tag="CYME_CMD154C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535501.1"
                     /db_xref="GeneID:16992702"
                     /translation="MAPCSGGSVEPNDRSVRDAAPASVASALVQSEGQVRVDAELQRQ
                     LGTEKRSPQPPTPVRAVVDKVSKILSFCECLYDFELQVKTFSTLGSWAAFREHLCEQP
                     DILYVPVDEVDRETATDALPVFLIEYVFDATLAYWRQRETGTAPGATAGQTSPAAGMT
                     RAFWTFWADTLELIARQTQRSMPVAVVKCLLRWIPAIVRAFGQADEPRDPRCGVALRC
                     ALQSLGRLLSHALCRVPNGEVARQVCTAIAKVVVRMLWPSQQETAQAALEWALDRLHA
                     LLDGVDTAVVAHSAAPESIMVLVRELQRRLGSAIETMNARFAVPDQKIALPGILATME
                     RALHLVHDLEKRLAAHVQEPAAATDHSSEALDAERNCSTERRRALRRASHAVGASDAG
                     NGAGVQSAAAAAATVDAMEAIETTVVVAAAAQQQSECRLKDTMDSTATTEVVLWSQLE
                     NAVQVLHIKPAADWEKRVEALVFIEERAQRLSRADLAEFLRQSSLRYALVEQIQDLRS
                     QVVRHACATSATLARALGDAFADTLGLVLVPSLLRASIVTIAVIADSARQALRCIVEH
                     ARLGRSVIFLFQGLQDQKSATSLREITAELLYVALARQPAFDIERHAEEWRRALRTGL
                     EDASACVRARMRHAFWRYVAFLCWQALRASARSDAHSSRYRGASGMPRLVAFVNQSLE
                     RDVLQALRQCTRRTLMEHCPRENSESIALRSPSRAASGDEHQHALFSELYAAVCESLS
                     HPEQTTQRHVMNKENQSPFEAAATRKSAHGASLGSCAQSDDWSGVGRVPTRALGGALR
                     VGVGRESADENVDRVRRHARLLSGHPPAATSPERPCEQAWVPSREYQRAGRAPAAAAA
                     AAEPMLPLAAKWRPARRTVAAQSPLGEPALAPVCQREHDNDDNDDADEYAVPAAEAMA
                     QDGDGCCRGTALQLLVTRIEDAGADWRRRLDALIALEEEFCRQRSASAAASAAAAAAA
                     TPGQATCDTVPFELIQELIACLHRCLAEKQHSVLQQTERVLLAILALVPDMLAATDLE
                     QALHAYPLLGRLLNQWPRTQPILVAFIPRLALDAGLRLFLRHCSMEPLRNAAENAHPR
                     LAERTLLFLDACFRATEPELVAWQRALLGCNAPTGRDALSALVARLHVLHDRTQIKQP
                     LVRRAAAQLLETLRSRADPILWAPLVKTATTTTTTPTPCSPETMLDSNNAAHLPRSPA
                     IANRHRLHCQLALASTDAVSPVRLRSPAPRQRSPARTQLQLLNPESLEALRQVRVSWR
                     NRAAPTAPATATATGAGGVGHHEACAQAHLLLDCAAQRANDLAWQESALRTAIELVRH
                     IGAALLATVPDPGDAVAADADAVLRALLCWALTTREQAKPGSLLRVSANRLARAIQVT
                     FQSAGRSLVEPCEAPTSAATSTNSPSDVHR"
     misc_feature    407623..407979
                     /note="possible transcribed region"
     gene            complement(<409353..>409673)
                     /locus_tag="CYME_CMD155C"
                     /db_xref="GeneID:16992739"
     mRNA            complement(<409353..>409673)
                     /locus_tag="CYME_CMD155C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535445.1"
                     /db_xref="GeneID:16992739"
     CDS             complement(409353..409673)
                     /locus_tag="CYME_CMD155C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535502.1"
                     /db_xref="GeneID:16992739"
                     /translation="MGATGGQASAEDTRFSLRSLEPFGQPTRLVNKMHPALKHNRRFS
                     EGLYGEKRKRQQVPAETKVKRLYRSLSRATSACLRLALGMAVQSSIRPGAELPADAVQ
                     RRNG"
     gene            complement(<410511..>414800)
                     /locus_tag="CYME_CMD156C"
                     /db_xref="GeneID:16992704"
     mRNA            complement(<410511..>414800)
                     /locus_tag="CYME_CMD156C"
                     /product="coatomer protein complex, subunit alpha"
                     /transcript_id="XM_005535446.1"
                     /db_xref="GeneID:16992704"
     CDS             complement(410511..414800)
                     /locus_tag="CYME_CMD156C"
                     /codon_start=1
                     /product="coatomer protein complex, subunit alpha"
                     /protein_id="XP_005535503.1"
                     /db_xref="GeneID:16992704"
                     /translation="MLVSFESKSSRVKGLSFHPKRPWLLASLHSGAIQLLDYRLATVI
                     DTYHEHEGPVRGIAFHPSQPLFVSGGDDAKIKVFHYGLRRCLFTLTGHADYIRTVQFH
                     HELPWIVSASDDQTVRVWNWQNRTCLAVLSGHNHYVMCASFHPAEDLVVSASLDQTIR
                     VWDISGLGGGSANAAQAIAAVTAAGLWGSSANANALAPGRDQGTGFGTGSAPWSALAP
                     QSTGGGMGAPSMSGFGGSSGSTLGSGAYGGGTGGISGVIERLGGGLDVAVKFTLEGHT
                     RGVNWVSFHPSLPLIASGADDRTIKLWRYTESRAWEVDTLRGHVNNVSCVLFHPHLDV
                     LVSNSEDKTIRVWDLSRRSCIAIYRREMDRFWILAVHPRLSAMAAGHDSGCMIFKLHR
                     ERPPFTMLENGVLVYVRDRFVRALELDTGREWPVCMARGRQPANDTGSSWPGMSGEGT
                     TGLSALGGSNGISAPGVLFGLSTGNAVLTPPPRSLQYQPLDRALLLQYDADGGFAELY
                     QLPQRIEEPRNVSGDSPDLQVEPRRVPALSSVLLGQGRWLTLEEDALLLRDLSQGSER
                     RIPLPATGIRFMFPATAGLVLFASRDQVHLWDWQRQKLLATLDAPLIRYAVWSEDRTY
                     LALLAKHTLWIVNRQMERLALLHETMRIKSAAWDESGVLVYTTTSHLKYCLPNGDAGI
                     ICSLKEPLYLTWVRGPAVAALDRRAQPQTLAIDPTEYTFKLLLWRKQYDRVRQALAES
                     RLPGKSMIGYLQQKGYLDIALWFTEETQTRFVLALSAGYLQTALDMAGQMDDDEAWSS
                     LAEKAMEYGQVQLAELCFQRLRNLERLLFLYVLTGNWEKLERLYDIADAQKDIPAQLQ
                     IALVLGDPESRVQTLKKAGLDALASLLSATYEPEDATAGSYVAGVEKLQTPLAPVDAT
                     LAQENWPLMPTSESVDAHHASEGVAAGAFDGAARQAASIAPANDLYEASVSQHSSTGY
                     LASDWTAAAGRLGDAMHTGDYTERSNSMTMGDADAHVANEAGFLGFAANAATDAADGW
                     ADTLDLELPPDAVTSPSSSQDRHAMAAGDALHPSAALDAAAAAAPAASVTTSSLSHSL
                     ADIPVEPGPLTQEIWRAQARVPGEWVIAGEPQRALALLVEQICLADPVVLHPVLRALH
                     AAAWHAVPSPSCASLSLSRIDQTPCVASADETPAPAAFVMIDRLEQQMEHIFGLVTRG
                     AFGEADRLLLSLLWVMPFAIVRSAADDAKLRSLISTCREYRLGMRLMLEQKTCRARGL
                     DSDADRARLMQLSALFTHCNLEPPHLLLALRAAMKLAYELQFDALAVRFAQRVLETEP
                     APELVAAANKVIALAERRRRSEQRSSTSKQEAVSRVLPLDMYDEQRIFAIDAELLVPI
                     HDRGAVRSCPYCTATYTSATRCVVCQLSSLDASQRTASGLIFWTQGVTSST"
     gene            complement(<416628..>417605)
                     /locus_tag="CYME_CMD157C"
                     /db_xref="GeneID:16992705"
     mRNA            complement(<416628..>417605)
                     /locus_tag="CYME_CMD157C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535447.1"
                     /db_xref="GeneID:16992705"
     CDS             complement(416628..417605)
                     /locus_tag="CYME_CMD157C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535504.1"
                     /db_xref="GeneID:16992705"
                     /translation="MVSGARRTACGTAAWRGAAGDTGVEVGVIGTPARCKQFACTQAV
                     AELSLQPALISRQAQVTRAFALGWALCATGRPLPRTRLAICCSAGRLGRRVRAAHVLA
                     QPGTWVLAQRSVTLPADAGDAVRVSGFWQTVPTQVRKCAARHRHVVRRRLECAWVQHR
                     AAIQVDAPRELVFAHYRDLDAMPRWSPWLRSVRVDARDPQLTHWTLAAKGLEFTWQAR
                     MVRVEPPTEIAWESVRGLRNRGRVAFREHTNKSSPSSSSSSSLSSSSVPSTMLEIELA
                     FELPAWVALWLKSAPLLQGFVERTLLADLERFRAYVHEQVAQERRLEAS"
     gene            complement(<418153..>425109)
                     /locus_tag="CYME_CMD159C"
                     /db_xref="GeneID:16992706"
     mRNA            complement(<418153..>425109)
                     /locus_tag="CYME_CMD159C"
                     /product="similar to separin"
                     /transcript_id="XM_005535448.1"
                     /db_xref="GeneID:16992706"
     CDS             complement(418153..425109)
                     /locus_tag="CYME_CMD159C"
                     /codon_start=1
                     /product="similar to separin"
                     /protein_id="XP_005535505.1"
                     /db_xref="GeneID:16992706"
                     /translation="MRKHRMICSEKGTQTEQNKQVLKCFESKCLLDDRRRSSSRTRPC
                     KDSTWALCYLKTLSETLAEHHCQQAETTQQVGCVASRDRTENAGIRCAFRRQRLQQPL
                     QPAVTCADTPAELEFLLEFLQQLARALTRLREAHAYVCCDACMRFLWFGGIFALRCLD
                     ACAASVHATKLSLDAVHWYTWILAVHLVFIEKRFCSIAEPRDDAALQASDAMGTPRGD
                     TTIHDEAATSRVTAGATGSMAVPWLRQVGVVLASDALAALESGLSNGQNWKLPECFEL
                     EMLNATASSLQAGRWVPVVLWALERCEDLPGQGHDENDAPTALRMNHDVDADTDAQLT
                     ALGLRIFLATHALAPVSVEEIHTMARDAAVASLYIRFGRWLADTVMSKLTRIYAELQN
                     DAGTSPSSHALVTTRSCFETIRDALLSNLHHWQTLMHDYWNREPALLRAMLWISARLH
                     ALRFGERTRTQVRCLGRLVCEIGRSEACDENDRNALFGWFVEQLLPLDGAMLASCVLE
                     DEWMLHWLLEDWANSESANACQQLARRIERDALVQRHDASCEQQQQQHTVLQATEVLH
                     LSELLLRDPATLRGGTIPERQPGDCWRALKPPSTLRVLVRRAHRQPLVQEYLVHVVVQ
                     AASQEKITMDPRLAQWCLTQLQQKLRAAVCRLRTNAVEEHAPATHTSTLSSVAESITS
                     TTDQLQQLTQSSMRQAADTCERERLRAWAAAVLHNTAADLYEHIRTVSASATSNADAN
                     SQDASVQSAYAAAAHCWQHTLMLSWPRDAPSAGSDSDHHSTLPAQWIRTGLQRLAYAL
                     QAWVRAQRPDSARLLWDECSQFLWRLHESNAPPEASLRATAIAQSCTVAPPSPLPSPP
                     PWELCAALFRLVQAGLRGCPKSDAAQPFLDSFSTEALCLLGVAMERVWRRSVRAATTT
                     TTNINTMNSMDARGASSQLDDTYVIYEAVRRTMARRLGATGAGEAAPEPALSASPLPR
                     CTSAAVETLHQQLCVARALLPGAVLRRCVRAPTPATTSPDLSAAAPLETTTPPSSTEE
                     AESYPADTDDAFTRDLAALYDALERMLQHLLRCPGSSDDSSAPADKPTDAIDEHSTQA
                     SSAVDESPSHAARHLFHLVQSWRHSWLQVRSPACIAHCWFVWWQRELAWDAFEVAARL
                     FQLADHTLPALYCLDAMHRCARGDRWRQALCAARAMLLAEQLGWTHQVMRQRHRLRQL
                     VESDILEAPAAAHATLSTWGQRMLAYTAAAAAAAAAPDSVEDADRFEAPVARSTLADA
                     NASLADMLALHDSEMRSAKQLASSHLLVEAIEHANRALGCALQAQQLLLPCKSTPSPA
                     IPVLGAGTSVLARSTAAIVGDLVIATQSRPVEAAELRPVDAVVEYPTRALCRSLDLLA
                     NLSICLGAWKDGLYYHERIQALCAGPPAPVLLDAARSRSLMQLSLLRTRAGQAELAEQ
                     CRRQAVALCRAWNGCMNAAYSLWTLPLAVQQIQQQVFRLYWLRRNATSPRDTTFYQRF
                     LAALQQAAERAQQLVAQQLHSRVHSESDQVGALPWDALLQLQQHRALLVSTTGDQHNS
                     TSSAAAMLQEAAQRLRALLAASTAGQCLPAYLEALGLYLGLASSHTRYTMAKRPDARQ
                     LHDHVAHCWQLCKAYLLPLQNGMSRSRSGIPAPDLGGSPWLVASAIYAEVAFAMLRVA
                     AIDRNVPASRPLRVCGTATLLRSFAPRWRQRCALLRRRAKAADANAEADAAPAPSVWD
                     TLPPLQYLERLGRLLPLGWMIIALRYDATSGQSARVALWRSGAAPEPPADLVDQLGSI
                     SLQQQQQQQQQQRQDAPHDVADESLSWTPCNEHAECSCTKAARGSVLHLHAQRLVHDD
                     QRPDAQQLARELAQLLQAGTQTHLASESEALSLSAPERRAWWDTRTRLDQQLGRWLDQ
                     RLETLLCGLPLAASVSNAASASQLQQLDGAGSVPDATSSDSGVAPVVLLLLDAEHDLL
                     PLESTPTLRHAAAMRFPASAAIEQALERYHHLTRSAVPGWQRGAFLLNPAGDLRRTER
                     FLRPLLEHHPGFRLRYGWTDLAATAAASANADSAAGADDSQRASITQALAAVQPCVLL
                     YCGHGTGEAYLQPRRLVRQTTTLPQAVFLMGCRSGLLEHAEALDAHGAALDWLAAGAH
                     GVVAQLWDVTDGDLDRLTVATWEHLSAATSPQCVGAKSSPVDAMAPRGSDSNAQPPAT
                     MPGKPWTSTSSEELCPLEATRSEPHQRSATTQAVLSSSISLHEREQADAQRLGREQPV
                     EYPRRRRHHHQHHQRQEQFYADSDCRCVVEDARSTAAPLLVASALQAGRAACRLRWVN
                     AAASVVYGAPFR"
     gene            <419146..>419862
                     /locus_tag="CYME_CMD158C"
                     /db_xref="GeneID:16992708"
     mRNA            <419146..>419862
                     /locus_tag="CYME_CMD158C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535449.1"
                     /db_xref="GeneID:16992708"
     CDS             419146..419862
                     /locus_tag="CYME_CMD158C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535506.1"
                     /db_xref="GeneID:16992708"
                     /translation="MVALQGLLDRRTSRETHRSRVAQRRCRLERQQVVLRVQEQQHNR
                     SDTGIRAGRIWHATGTIELLQLRCRRGVRHRSRQWQSAQERLETLVEPAAQLLIEAGA
                     GVPPGTSLRSGKRERLRLRGKMCLRAGLQQLGKLARQLLRVWPLVVVYQPLGVQVQHG
                     TPCGLGTAAFRVLIARRPRKRLVCHVMWGILSLLLLLLLLLLQGNAAQLIDQVRGWFR
                     CRATAPQSDAGALAARCIVP"
     misc_feature    complement(426762..428469)
                     /note="possible transcribed region"
     gene            <428718..>429665
                     /locus_tag="CYME_CMD161C"
                     /db_xref="GeneID:16992709"
     mRNA            <428718..>429665
                     /locus_tag="CYME_CMD161C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535450.1"
                     /db_xref="GeneID:16992709"
     CDS             428718..429665
                     /locus_tag="CYME_CMD161C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535507.1"
                     /db_xref="GeneID:16992709"
                     /translation="MDERENYPPAGRLNRLQLDDIDDENSDYYEQLWNEKLRAREPET
                     SGKYLREESLSAAAAATGEPLGAGAQIFRRRQLQRLPVAERAALVADDISRQPEETPS
                     GSSQPFPELYAIPGALWAAWKSFMNAQCGRPRFAASGLSLEALWQTAQRYNFVLALAA
                     LLAALQLFGLLGEFVAFAYYIGMPLHRTWRVIASDGSSPRHYERLRQHLCFWNLACML
                     WAVRFAAVRSILPAWQMLFAALGLGNGVASVCEKALNLGFHLTLNTLMWWQPQSRSPG
                     TVEEYRGAEQLWYQAVHQWIMPRLIRLVERIREQMQRAG"
     gene            complement(<430299..>430634)
                     /locus_tag="CYME_CMD162C"
                     /db_xref="GeneID:16992710"
     mRNA            complement(<430299..>430634)
                     /locus_tag="CYME_CMD162C"
                     /product="similar to DnaJ protein"
                     /transcript_id="XM_005535451.1"
                     /db_xref="GeneID:16992710"
     CDS             complement(430299..430634)
                     /locus_tag="CYME_CMD162C"
                     /codon_start=1
                     /product="similar to DnaJ protein"
                     /protein_id="XP_005535508.1"
                     /db_xref="GeneID:16992710"
                     /translation="METSGTPEGTRDLYQCLGVPRDASLTELRAAFRERARALHPDRQ
                     AGDAGAFARVEHAYRVLTHPEKRRLYDLLLDAGIVSSTSESEPVTPSALRDAGSLSDA
                     SVEAEAAAK"
     gene            <432430..>432693
                     /locus_tag="CYME_CMD163C"
                     /db_xref="GeneID:16992711"
     mRNA            <432430..>432693
                     /locus_tag="CYME_CMD163C"
                     /product="probable molybdopterin converting factor small
                     subunit MoaD"
                     /transcript_id="XM_005535452.1"
                     /db_xref="GeneID:16992711"
     CDS             432430..432693
                     /locus_tag="CYME_CMD163C"
                     /codon_start=1
                     /product="probable molybdopterin converting factor small
                     subunit MoaD"
                     /protein_id="XP_005535509.1"
                     /db_xref="GeneID:16992711"
                     /translation="MLVRVLLFAACRRAVENKDSIVVEVPAELDNDGREYCTVETLRK
                     RLPEVLQKLAAHSAVAVNLEYAEAWQRVYSQDEVALIPPVSGG"
     gene            <437040..>440132
                     /locus_tag="CYME_CMD164C"
                     /db_xref="GeneID:16992712"
     mRNA            <437040..>440132
                     /locus_tag="CYME_CMD164C"
                     /product="similar to syntaxin binding protein Unc-18"
                     /transcript_id="XM_005535453.1"
                     /db_xref="GeneID:16992712"
     CDS             437040..440132
                     /locus_tag="CYME_CMD164C"
                     /codon_start=1
                     /product="similar to syntaxin binding protein Unc-18"
                     /protein_id="XP_005535510.1"
                     /db_xref="GeneID:16992712"
                     /translation="MGNVCSWSAGDPAERHLKHVVKQLEDEYPWARKQWLRKQVRAVD
                     GDLEQARIAIEQKIGGARPFVEAHVSDVYGKGGDISHGPVIERGKAYRRSEGAAKRSS
                     RASHAQQADAGPDMQLVPPSMPLPGTWPAAGTPDPSERVITTLFNWNGSGEASHPIAG
                     LMLRQLTRMRFIDGIRKARMALSVSNIHVETCAEPLEDAPRAADAIALEEDARSRTSA
                     RVTRAVSSQRRRRSTSVRRRTTVGLDQRYRGSGGAIPAAVSPEQASAAASSDSTGMVL
                     VLDMVTLSIVTSLCRLQQLRQLGIDTVQVLNDRKSPVGRNGSTPATTAASVMTFTCTD
                     ASRNAHRGDAIKPHIYFVTSVPASVEAMALHLETTAKARLSEGADSIQDAVLISGHLP
                     NEALGLVRQQLAHTSLLQRLGCFMEIRLDYVAIEEGLFHFCHPSALIDLFPASRSKTE
                     RLRQERCLAIEAQQLASVCEVMAGVEDGSPWLGNVYFVRGAGTEDPASRLASESLVGG
                     AAPAEQLAQLLAHELRRRWASNMPHATQAAEASVSKTETGPALTSRLAELAPGKRPGP
                     VDVLICDRTVDLATLFMHDFHYAAMAMDLCEGSQNACARVRIPLTEIGLEWDLHEPIS
                     AAEVDLDEELDTIWREVRHRHIADAVDALSATFDAYLDAEPGVAAVIRQPQRRNLDAE
                     SAQRPEWYRIPQARAACATAQEALDTFLAHFALIEVLLTRFSDWSLDRVAAMEQDLAC
                     CRTSRGRRFRHALRRALAVAEHPNVRVMDKLRVALLYLVTQDVGAGDLERLLEVLRGY
                     TIPSSFTNDFIDGGVGDARRAPASIRADIALRTVWDYLSVALGTEMRKSRAERRERRE
                     RSRSRSRSRTRRDSWSNLSTRGPGDEGSADEASDDFELCRYNNRLAVILRQFAENVFR
                     PECAYPLATDLGAAPSPKYTSPVTPRSGAPSGLKPSPVVSQTPLHAAGQSGNGALAGA
                     TCEPTLIVYVAGGIMPSEARDVYRFAQRTGRVAVAGGSCMLTPREVLALLCRREAVAP
                     "
     gene            complement(<440864..>441286)
                     /locus_tag="CYME_CMD165C"
                     /db_xref="GeneID:16992713"
     mRNA            complement(<440864..>441286)
                     /locus_tag="CYME_CMD165C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535454.1"
                     /db_xref="GeneID:16992713"
     CDS             complement(440864..441286)
                     /locus_tag="CYME_CMD165C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535511.1"
                     /db_xref="GeneID:16992713"
                     /translation="MFISSLKPLSFSKDSSYAFLSSSKKLTAVETRQRSSAPYPSAGT
                     AALSVFMRQRRDLREEKRLRNLEYARLHRKRVPRGPPGRRVNLSGNAAASAAERESVY
                     SLYFTMMNAKQHSRPGKRDRQQQKQANDGAGASGLDEQ"
     misc_feature    complement(441385..445003)
                     /note="repetitive element"
     gene            <445829..>447586
                     /locus_tag="CYME_CMD167C"
                     /db_xref="GeneID:16992714"
     mRNA            <445829..>447586
                     /locus_tag="CYME_CMD167C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535455.1"
                     /db_xref="GeneID:16992714"
     CDS             445829..447586
                     /locus_tag="CYME_CMD167C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535512.1"
                     /db_xref="GeneID:16992714"
                     /translation="MQLRENAAGSGLLTDNACMEIHRPVPGTAGRASPTFHILVPLTD
                     PRYADADPGGSKQMRLPLVVDEATALPTPPPKSAITSPATPHSLQQETSDVVDARYQS
                     GPLRRSLRLSPSGSLHGDELLDKILRHAEWLQALGAGAVGLVLLSRWFPQVAIKVSLY
                     ETGFRTALFMHPTRSEPAMMRLLMRTLLVGRATPHLPVLFGERHDVPLSTLRIPEAFW
                     RSSTAATELRQWIERRQNCDPERCSILCMERFTGGTLFHALCRGTAPGIDISAVRELT
                     FQIVFTLAVLLRFHPNWKHNDLSLANVMLRRRGSLTTACLGTCQVLVGLAGAGARTPA
                     STLQLVRPSSAPEAGPVRYRRYAFEGHTWYLGLRPEQPYEAVIADFDFACIEPLISNA
                     KVDFFERQSRYHCYRINSERDWYGDIQMLLSNLREVVQHLIRRRWETQRPSGTSALST
                     SVERGAQDMLLPEERDAMEFFERCVHPSCRDTADRSLRGRLPPNTVDLDERYNPIHML
                     LFDPYFDPFLRTPEWGSGAMLEASYAWPIECAASIDANGASHVEGAGLRTHASLWSAS
                     SPIRCDWEHIHGSWAADGA"
     misc_feature    448247..450274
                     /note="possible transcribed region"
     gene            complement(<448339..>448641)
                     /locus_tag="CYME_CMD168C"
                     /db_xref="GeneID:16992717"
     mRNA            complement(<448339..>448641)
                     /locus_tag="CYME_CMD168C"
                     /product="elongin C"
                     /transcript_id="XM_005535456.1"
                     /db_xref="GeneID:16992717"
     CDS             complement(448339..448641)
                     /locus_tag="CYME_CMD168C"
                     /codon_start=1
                     /product="elongin C"
                     /protein_id="XP_005535513.1"
                     /db_xref="GeneID:16992717"
                     /translation="MQPTDYVKIVGASGRCFYVHYHCATVSETLRSMLESGFREERER
                     CITFNDIEEELLEWCLDYVYYYRQCECNWYGTELPRFPVPEEKSLQLLSVANYLNL"
     gene            <450062..>450889
                     /locus_tag="CYME_CMD170C"
                     /db_xref="GeneID:16992716"
     mRNA            <450062..>450889
                     /locus_tag="CYME_CMD170C"
                     /product="similar to methylthioadenosine phosphorylase
                     mtaP"
                     /transcript_id="XM_005535457.1"
                     /db_xref="GeneID:16992716"
     CDS             450062..450889
                     /locus_tag="CYME_CMD170C"
                     /codon_start=1
                     /product="similar to methylthioadenosine phosphorylase
                     mtaP"
                     /protein_id="XP_005535514.1"
                     /db_xref="GeneID:16992716"
                     /translation="MLGVIGGTSLFHSQRFAGFDRRHVHTPYGEVVCYCDSTEPSLVF
                     LQRHHADAHRGVDAYTPPHRINHRANLYALKQVGVDRCVGVYSVGSLNPAIRVGTCVL
                     THDFCSLAQLCRAETFYDEDMRGHAVIRFDQMLRDRVLTSLKDLSAASQIGDSKTAET
                     SSKQSFVMASTASAAMSFHDGGVYVQTAGPRFETPAEVRMLRTFGDVVGMTGASEAVC
                     CGELGIPYMQVCFVDNLANGLISGAEQTEIAEFHDNVKANLKRVEVIIDRVIETLRH"
     gene            complement(<452454..>453944)
                     /locus_tag="CYME_CMD171C"
                     /db_xref="GeneID:16992718"
     mRNA            complement(<452454..>453944)
                     /locus_tag="CYME_CMD171C"
                     /product="probable N-ethylammeline chlorohydrolase"
                     /transcript_id="XM_005535458.1"
                     /db_xref="GeneID:16992718"
     CDS             complement(452454..453944)
                     /locus_tag="CYME_CMD171C"
                     /codon_start=1
                     /product="probable N-ethylammeline chlorohydrolase"
                     /protein_id="XP_005535515.1"
                     /db_xref="GeneID:16992718"
                     /translation="MALVRGSARSVAQQVVAARWLLPVWDETHANEPLWLEDHALVLE
                     GDRIAAVLPREEAWKRYPSAERVCLSEHALLPGLINAHTHAAMSLFRGLGDDQALDTW
                     LRSVIWPLERELVDEHFVRDGSMLAVAELLRSGCTTLNDMYWYPEVTAQVCREAGMRA
                     VLGMVVVDFPSRYGSGPEEYFQKASRLTQIIAEGTLKDSPENPHREIPLMESSYAPHA
                     TYSVSEEILREVGKRAMDEGRRVHIHMHETAAEVKASQTLDRGVLVCHRSEFAGAPLD
                     NLERLGLLAANWTLVHMVHVTDAHIELVRRRGASVVHCPASNLKLGSGVFPLTKMLDA
                     GINVALGTDSAASNNRLDMWAEMRLAALLAKGSTGRSDCLTAYQVLRMATIQGARALG
                     LDHLLGSLEPGKAADFIAVRVADGLSTMPVHDVCSALVYGAGPDQVTDVWIGARRVVH
                     DGVLQTISQAKLVERIRHWHQRIRTLGSQRGEDGSYAATTRHASRN"
     misc_feature    458104..459679
                     /note="possible transcribed region"
     gene            complement(<458186..>460450)
                     /locus_tag="CYME_CMD173C"
                     /db_xref="GeneID:16992720"
     mRNA            complement(<458186..>460450)
                     /locus_tag="CYME_CMD173C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535459.1"
                     /db_xref="GeneID:16992720"
     CDS             complement(458186..460450)
                     /locus_tag="CYME_CMD173C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535516.1"
                     /db_xref="GeneID:16992720"
                     /translation="MNLFDRFINRGVRKRERTLDAKRNALGNSLPSRENAAFRGTRDS
                     NKPSRLGRVSQYSRDRKRFQLDSVEGSDDSPVELEEDRGVPTTLTHHGKPLLDAAKSG
                     RTLDRKRHKTDLTLDSFDALPDDRSDSSGDVGGAVDLLAATETNDSGGDSETSRSKPR
                     FRDLMENWALQRERVKKERQLERLLHEQQTERLDAVFRELSDQLVRRKSTNKNDAANA
                     DAHPTVPVATLDEYDLMLQQLAEEPRSKPAEPESIKETRRQERALGLLAAKELTNDTF
                     SVESTPMSQKLLSEDANGTPLLPMDPDSLSSDADPDESHSDSLAQHAAGADAHSALAH
                     QLHALEQLWQQMPPIRENPALDTCLAKIDEEAARFLGGRWRPRSASPAKASPPGLVSV
                     GAGNAASDMEISDHGSHVAATLGQWALHQLRRLEELLRIAPDQWMHWTCEEAGWRRLW
                     SAALVMQALCRLFPKQQSRHPVTAPLALLLSEFFGSMTLALDAQTGSHPVTAEMPPST
                     WRSLALLIVLAHLWIDGLVLASGRLHPDAYAFLRALLDLLRLFRQSTKSFADRHGLIE
                     NSVTRDTSASEALDHLYQCAVPASTAVVDPALLSLATGTLCEQLEQNAQMQRYLQLPL
                     GVALQSSLRELFLVMDTDLPPWCKRYTAALQKAERSLPTAPRHRYRANEPKLLNPRLD
                     MDRAGRSSSQQTDEDKKLRQQFRRELRATGRVLRRRQEVFAAQRLQAEHSRRVQLQRR
                     ARQATGLIGSEQLR"
     gene            complement(<462151..>462360)
                     /locus_tag="CYME_CMD174C"
                     /db_xref="GeneID:16992721"
     mRNA            complement(<462151..>462360)
                     /locus_tag="CYME_CMD174C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535460.1"
                     /db_xref="GeneID:16992721"
     CDS             complement(462151..462360)
                     /locus_tag="CYME_CMD174C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535517.1"
                     /db_xref="GeneID:16992721"
                     /translation="MELTKNKNRVPELMAEIQKAKREGRFTHQVRPGDRYVNLLMVGV
                     ALVGVVALGNGMYSLVTGTGKKEGF"
     gene            <462754..>463848
                     /locus_tag="CYME_CMD175C"
                     /db_xref="GeneID:16992722"
     mRNA            <462754..>463848
                     /locus_tag="CYME_CMD175C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535461.1"
                     /db_xref="GeneID:16992722"
     CDS             462754..463848
                     /locus_tag="CYME_CMD175C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535518.1"
                     /db_xref="GeneID:16992722"
                     /translation="MDAKWSPVDLNRGPQMMRPVQSAFLSTATPTVPVRLLPNLTLVQ
                     RSRSRALDALHLITLRTRCIWPWNMSAAPGANEGDPATKSNSANRFNSKRTEPSLLNL
                     FSWGELDDSRAGTENDDEDDGYDDISSDSDVDPVLDRGRVFGAWLDNQVLRLDRIQSA
                     AMQAPGQTLQERAERAFARGVQALTDGHYATASDAIFQASALPGQQTRLGGEYLLWLA
                     QALDAQGKNARAQEVLRRLQYHKDRDVRQVAESLLFILQAPRLRLGPESFVKIDLDAL
                     LNQNRARDIPGWKKRQRRYRFGSGSSAALAGTGKRRREPTKYSLEWFTSQESVSAEEL
                     ERANQASRAAMLASSGVMLLILFMLRFLGR"
     misc_feature    complement(463494..464852)
                     /note="possible transcribed region"
     misc_feature    complement(464808..468053)
                     /note="repetitive element"
     misc_feature    467895..471838
                     /note="repetitive element"
     gene            complement(470232..471908)
                     /locus_tag="CYME_CMD179T"
                     /db_xref="GeneID:16992724"
     misc_RNA        complement(470232..471908)
                     /locus_tag="CYME_CMD179T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461237.1"
                     /db_xref="GeneID:16992724"
     gene            <472252..>473328
                     /locus_tag="CYME_CMD180C"
                     /db_xref="GeneID:16992725"
     mRNA            <472252..>473328
                     /locus_tag="CYME_CMD180C"
                     /product="GATA transcription factor"
                     /transcript_id="XM_005535462.1"
                     /db_xref="GeneID:16992725"
     CDS             472252..473328
                     /locus_tag="CYME_CMD180C"
                     /codon_start=1
                     /product="GATA transcription factor"
                     /protein_id="XP_005535519.1"
                     /db_xref="GeneID:16992725"
                     /translation="MLRCDFCETTETPLWRAGPRGPKTLCNACGVKWKKGKLDGFGPG
                     ACNVPRTHTGKRHPRAVYGRPRRAGAVADALELPSPERSLSKFRGSVRPGWYVPSELE
                     YSGRIQHPRRSSSPPETRCAYVDVDREDSAPVVREQFAPSVFAPSIPCRGESAPLNIV
                     RKDAGRGPGTQHTTLPADHLIRESLFVRVDSERALASDPIGYPAAIPSWDDVSIESLS
                     EDGDGADNYHDLELNLPEQMPLPDAAHTSTHVLGGEHDWRHAQGAASGETALPLPLPL
                     APAKGSLTKTMEREPVDAATKGVRLLLDAARYVEYASSPLSSQWSPLRSASSSAPPYH
                     QAGTSSPNRLTPSYLTPMVLEKDW"
     gene            complement(<475642..>477183)
                     /locus_tag="CYME_CMD181C"
                     /db_xref="GeneID:16992726"
     mRNA            complement(<475642..>477183)
                     /locus_tag="CYME_CMD181C"
                     /product="similar to RNA polymerase III transcription
                     factor IIIB chain B''"
                     /transcript_id="XM_005535463.1"
                     /db_xref="GeneID:16992726"
     CDS             complement(475642..477183)
                     /locus_tag="CYME_CMD181C"
                     /codon_start=1
                     /product="similar to RNA polymerase III transcription
                     factor IIIB chain B''"
                     /protein_id="XP_005535520.1"
                     /db_xref="GeneID:16992726"
                     /translation="MSTSPTENIELVASLPPEGASRKRQRRVPRQTPRSPNTHPSSGT
                     VGVNEAPHSEVASHVVPGQRSVPEVDVGSDDYLDAEAVSEQGGMTRLLVSPPLSRFVQ
                     DVERTRMTGGSSLGHSRPSDASAVDAEKSYTGAMSVDPLSLGIRELVRSRQRPVNRTP
                     TVDRRRRQADNRTGTAHCSPGSEETVAEASAKDIGLQIPAETEGPSPRQGGVSGAPAT
                     RDVLVPERLYESPAIVEDTQSDRLDRRIPGADTVVLAPQVRLDNRGNLVLDERSLVVT
                     ASHVADAHADAGQESVHPEQHSDHAGAVGGNASMASAASGPASVECDLQRRVQRHRRA
                     IRAEQQRLLRTAITSEQRPAENENISVETHTGAPRRGAATIASFTNRASCERWPPEET
                     ALFYRALRAFGQNYSMIEQLFPNRNRKQIKNKFKKEERSNPALIEAALREHGARRHHL
                     SLGRHTCATDTTLSDNSEHAVPEAGIGSSKATAEREQIFQGFDNDYIQRVFGAASPVL
                     PEEIP"
     gene            <479658..>481004
                     /locus_tag="CYME_CMD182C"
                     /db_xref="GeneID:16992727"
     mRNA            <479658..>481004
                     /locus_tag="CYME_CMD182C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535464.1"
                     /db_xref="GeneID:16992727"
     CDS             479658..481004
                     /locus_tag="CYME_CMD182C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535521.1"
                     /db_xref="GeneID:16992727"
                     /translation="MASPPVTDWAEDEVEGFGRSYEERRGLWMGVGAKSRGETVAGRS
                     GVATDVHLAPERSSQSHGEHASVHAAESTEIKHSTVRSTLPGSAKVASARKDPGSAHQ
                     REGRAASSCPQEGRKTRSPARTGMRQGLDEAFGRISVRAESLNPQPAATKNETTNGAQ
                     QGAPPEPDVTEVDALNARIVKNARDEAEGTEQLLREDRERETRSRRLFPTEPPYRAYV
                     GHVPAGVQEDQIRQLFHGCQISRIRFLRRAPLAPESGSKDPGGNASELDSGTSTKHTV
                     VRAAFVDFANAESLSDALKRHGTLIDECAVVVDIAQYAGNPATADASGSTRTAHRGRH
                     SYRTPSAAPSERVDSRFAGQHRRGNAPTIPLKGAALGHHVNGTGRTGASAQGSRRARA
                     SRQGWVHVTDGLRPQILREQDGKASAAPDKSSGSILARNDFAVLASLDSSLSDDDE"
     gene            <482715..>483464
                     /locus_tag="CYME_CMD183C"
                     /db_xref="GeneID:16992728"
     mRNA            <482715..>483464
                     /locus_tag="CYME_CMD183C"
                     /product="small GTP-binding protein of Rab family"
                     /transcript_id="XM_005535465.1"
                     /db_xref="GeneID:16992728"
     CDS             482715..483464
                     /locus_tag="CYME_CMD183C"
                     /codon_start=1
                     /product="small GTP-binding protein of Rab family"
                     /protein_id="XP_005535522.1"
                     /db_xref="GeneID:16992728"
                     /translation="MSTSPILLKLVILGDSGVGKTSCLERFVNRRFSLQYKATIGADF
                     LTKELELFDDSPCDEGVTAPKEKTGTSEPGGAGVATCEFSTEACGRRRQVCLQIWDTA
                     GQERYQSLGAAFYRGADGCALMFDFSEASSLASVTSWREEFLLLAAPPAASTFPFVLL
                     GNKVDLVRSQTSVYEATREHALSWCAAHHAIPFFETSALENTGIDRAMTTLARTALLY
                     HEQVHKAAGYEPDAILDSLQNNRAAANNCAC"
     gene            <487128..>489863
                     /locus_tag="CYME_CMD184C"
                     /db_xref="GeneID:16992729"
     mRNA            <487128..>489863
                     /locus_tag="CYME_CMD184C"
                     /product="glycogen phosphorylase"
                     /transcript_id="XM_005535466.1"
                     /db_xref="GeneID:16992729"
     CDS             487128..489863
                     /locus_tag="CYME_CMD184C"
                     /codon_start=1
                     /product="glycogen phosphorylase"
                     /protein_id="XP_005535523.1"
                     /db_xref="GeneID:16992729"
                     /translation="MPFERKHRTASFQDLAVGVVSPPEMRPQPLAVSGSTTPVGVESL
                     SKVLGTIELSPEEEERRRQLLWSLMSSYLARDVSSIQKYIVNHLEYSLARTRYNFDRS
                     GAYYATALSVRDRLIEAWNDTQQYFTEKDCRRMYYLSLEFLMGRFLDNALINLGLREQ
                     YREALIELGFDLDEVEAEEREPGLGNGGLGRLAACFLDSVATLNYPGWGYGIRYRYGM
                     FEQRIKNGYQIELPDFWLTRGNPFEIERLDVTYPVYFGGSVSQFTDNKGNLRFKWEPA
                     EAVLAVAFDVPVPGYDTYNCINLRLWDSKPAREFDLSSFNVGDYYKILEMRQTSETLS
                     AVLYPNDSTEAGKELRLKQQYFFVSATLQDIIRRFLKKDRPLTQLAEKVCIQLNDTHP
                     TIGIVEMMRLLLDEYALGWTDAWKTVKAVFSYTNHTVLPEALEKWPVPLMERLLPRHM
                     QLIFEINFRHLQEYARLSNNDGHLLERVSIIEEGFPKMVRMAQLAVVGSHTVNGVAEI
                     HSELVRTRLFPDFNRFEPKKFVNITNGVTPRRWILEANPALSAVFSRWTESDEWILDL
                     NQIRQLEQYAENPDLQREFFEAKKENKRRLAEYIREKNGVHVDVNALFDIQVKRIHEY
                     KRQLLNILGVIARYNLIKSGKRDLVPRVFIFGGKAAAGYAQAKRIIRLINGVADVVNN
                     DPDVGDLLKVVFLENYSVSLAEIIIPASDISEHISTAGMEASGTSNMKFVMNGGLIIG
                     TMDGANIEIREEIGPENIFIFGLLAQEVDQARNELKYHGWKCTDGRFQNALGQLSRGM
                     YCGQDTFQEIVRALDPANDYYLISRDFTSYMEAQDRVDAAYRDQRSWLAKCIVSTARM
                     GKFSSDRSIHEYAERIWRIEPCAYTPSSITYKEPVEGVSEPTADGTAPKTTLRGT"
     gene            complement(<489896..>490264)
                     /locus_tag="CYME_CMD185C"
                     /db_xref="GeneID:16992730"
     mRNA            complement(<489896..>490264)
                     /locus_tag="CYME_CMD185C"
                     /product="TATA-box binding protein-associated factor 13"
                     /transcript_id="XM_005535467.1"
                     /db_xref="GeneID:16992730"
     CDS             complement(489896..490264)
                     /locus_tag="CYME_CMD185C"
                     /codon_start=1
                     /product="TATA-box binding protein-associated factor 13"
                     /protein_id="XP_005535524.1"
                     /db_xref="GeneID:16992730"
                     /translation="MQSSDGNDWDAFFANDPEEDASKRLFQNEIRQMLYGFGDARQPR
                     RDTAELVEDLLRTYLTAVVQRCVEVANTRGRKYPDVSDLRFLLRKDLRKLRRVNYLVA
                     MKEVIDETTRRGGELESLGR"
     gene            <490907..>491698
                     /locus_tag="CYME_CMD186C"
                     /db_xref="GeneID:16992731"
     mRNA            <490907..>491698
                     /locus_tag="CYME_CMD186C"
                     /product="similar to small multidrug export protein qacE"
                     /transcript_id="XM_005535468.1"
                     /db_xref="GeneID:16992731"
     CDS             490907..491698
                     /locus_tag="CYME_CMD186C"
                     /codon_start=1
                     /product="similar to small multidrug export protein qacE"
                     /protein_id="XP_005535525.1"
                     /db_xref="GeneID:16992731"
                     /translation="MVFVAPVLRHVSKHRARSKRLVRASVSTTEWYVPATLAPRVSVN
                     NTQNLRNWSAPVRTVRVPVATVGVGSVEQHQKHLGHRIAFWLRRETRLPDWATLMLVS
                     ALPVVELRGGVPVGLWLGLSPAETFLFCVIGNMLPIPFLVFGLRHERMRRLARPLLDS
                     VARRLPSHANTPSSQALALALFVGVPLPGTGAWSGAIAAFLLQMDIWLALVSIAAGVA
                     IAGCIMIALVLMGRIGGLIVAFALLGVGASALWRMLKPPSSAENS"
     gene            <496317..>496730
                     /locus_tag="CYME_CMD187C"
                     /db_xref="GeneID:16992732"
     mRNA            <496317..>496730
                     /locus_tag="CYME_CMD187C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535469.1"
                     /db_xref="GeneID:16992732"
     CDS             496317..496730
                     /locus_tag="CYME_CMD187C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535526.1"
                     /db_xref="GeneID:16992732"
                     /translation="MHPQRVQSVPERDEEQYELRKSVKQGLVQLERHHGGFSQGARAH
                     ERKEREVHKGGHGRGGAPGSLDEEISRVLKKSGGKAEEALRIAQEDEEPYAEGEAEDD
                     AEDAHAAEATGTEPLENGSLDASAPSSATPGESVP"
     gene            498621..498701
                     /locus_tag="CYME_CMD188R"
                     /db_xref="GeneID:16992741"
     tRNA            join(498621..498657,498673..498701)
                     /locus_tag="CYME_CMD188R"
                     /product="tRNA-Tyr"
                     /db_xref="GeneID:16992741"
     misc_feature    complement(499388..502727)
                     /note="repetitive element"
     gene            <503480..>504535
                     /locus_tag="CYME_CMD190C"
                     /db_xref="GeneID:16992733"
     mRNA            <503480..>504535
                     /locus_tag="CYME_CMD190C"
                     /product="NADPH:protochlorophyllide oxidoreductase"
                     /transcript_id="XM_005535470.1"
                     /db_xref="GeneID:16992733"
     CDS             503480..504535
                     /locus_tag="CYME_CMD190C"
                     /codon_start=1
                     /product="NADPH:protochlorophyllide oxidoreductase"
                     /protein_id="XP_005535527.1"
                     /db_xref="GeneID:16992733"
                     /translation="MQRSPVARRHRMLHLRMGPKQSQIAVVTGASSGVGLYAAHALIN
                     KGNWHIVMACRDVDRAERAANSVNLPKDAYTVLHCDLADFASVLKFVKGLSSVARVDH
                     LDALICNAAIWHPRVKKPRFTVDGIEKTMQVCHLSHLLLCRELLPKLKISRGRIVFLT
                     TQTHSPDSLPGKIPPQARLGDLSGLAAGLDPQTTDMVESGPFQPTKAFKDAKAENVLT
                     MKALSDRYGRDGVTSVAIFPGCVAESNLFREKRGWFRYVFFPILQKYITRQYVPNDEA
                     GRRVAEVATQGQFSDAGSYCQWRGKYTEGREKTKSQVIEPTYEIDKADQLYELSLDLI
                     DQALRRRGLKSTILAPV"
     gene            <507324..>510080
                     /locus_tag="CYME_CMD191C"
                     /db_xref="GeneID:16992734"
     mRNA            <507324..>510080
                     /locus_tag="CYME_CMD191C"
                     /product="similar to trefoil factor"
                     /transcript_id="XM_005535471.1"
                     /db_xref="GeneID:16992734"
     CDS             507324..510080
                     /locus_tag="CYME_CMD191C"
                     /codon_start=1
                     /product="similar to trefoil factor"
                     /protein_id="XP_005535528.1"
                     /db_xref="GeneID:16992734"
                     /translation="MFRARSLARGLGVAGCLLLAATFSVSVVAALSPVSTVSWTWIGG
                     ETGTGKYGKYGTLNETSPESVPGGRQNPAAWVGSSSLVYLFGGFGNGNTTGGYLNDFW
                     SFNLTSLEWMWIGGSSDVNKQGVYGTLGISSPANIPGSRYASAYWQADEQHFWLFGGF
                     GSDVNGNEGELNDMWRYDTETGIWTWFSGNDTINANPVYGPKDIYSQIYNPGGRYSAA
                     FWLGTDGLFWIFGGVGIAGDFLSDLWSFNPVTFVWAYRGGSQLVNQPGNYSAPGVASN
                     SNAPGARGASYTWTDFEGNLWLFGGAGYGNSTARGPGDLNDLWVYNISQSVWIFITGN
                     TTISNPGSYGTLGAFSPTSYPGARDSGVSFVDSFGNLQLFGGEGFANTSESFGNLNDL
                     WVFDITLGQWAWINGSQSADALSVYGVLNESSSSVVPGGRYGPAFWNTSGTDPILFGG
                     FGYSNTSRPGYLNDVFALRETFFTPTSTPTPTSTPTATSTPTFSATASSTATSTITAT
                     VTSTFTLTPTPTSTPVCTNEICGSPGQYTNQDACEQVGCCFNAQTNACTLKSVAAACS
                     AVPVTQRVPCGWSYIYPDECTAIPGCCWQPTANGILAPWCYYDIDHAPQASVALQEVQ
                     APVPVCPSPGAQRQPCGNAGINQFTCYEQGCCYDSQAQNQWVQNGKQQSDFTSNPYCF
                     QPEKTCAVGEFERQPCTNAVNQNQQLTNNNINNNQFVRLLNTLLYGEQHGTQRTSYAP
                     QQCLEAGCCLGLGNECFQPVTEYVCQTYGYVSNSLSGTTGNVSNSSYIPCGPECCNAE
                     TQNCTYIPFSNNNNQQQQQLQLQQQQQQQQVLLPSFCVCKDPTKQCGTYLIPSDNLVN
                     KMRCCRADEECINNQCVVISSTPTPSPVAATATPSATVSATASAAVSASASTSVSGSA
                     SVSA"
CONTIG      join(AP006486.2:1..513455)
//
DBGET integrated database retrieval system