GenomeNet

Database: RefSeq
Entry: NC_010132
LinkDB: NC_010132
Original site: NC_010132 
LOCUS       NC_010132             536163 bp    DNA     linear   CON 16-JUN-2017
DEFINITION  Cyanidioschyzon merolae strain 10D DNA, chromosome 6, complete
            genome.
ACCESSION   NC_010132
VERSION     NC_010132.1
DBLINK      BioProject: PRJNA28057
            Assembly: GCF_000091205.1
KEYWORDS    RefSeq.
SOURCE      Cyanidioschyzon merolae strain 10D
  ORGANISM  Cyanidioschyzon merolae strain 10D
            Eukaryota; Rhodophyta; Bangiophyceae; Cyanidiales; Cyanidiaceae;
            Cyanidioschyzon.
REFERENCE   1
  AUTHORS   Nozaki,H., Takano,H., Misumi,O., Terasawa,K., Matsuzaki,M.,
            Maruyama,S., Nishida,K., Yagisawa,F., Yoshida,Y., Fujiwara,T.,
            Takio,S., Tamura,K., Chung,S.J., Nakamura,S., Kuroiwa,H.,
            Tanaka,K., Sato,N. and Kuroiwa,T.
  TITLE     A 100%-complete sequence reveals unusually simple genomic features
            in the hot-spring red alga Cyanidioschyzon merolae
  JOURNAL   BMC Biol. 5, 28 (2007)
   PUBMED   17623057
  REMARK    Publication Status: Online-Only
REFERENCE   2
  AUTHORS   Matsuzaki,M., Misumi,O., Shin-I,T., Maruyama,S., Takahara,M.,
            Miyagishima,S.Y., Mori,T., Nishida,K., Yagisawa,F., Nishida,K.,
            Yoshida,Y., Nishimura,Y., Nakao,S., Kobayashi,T., Momoyama,Y.,
            Higashiyama,T., Minoda,A., Sano,M., Nomoto,H., Oishi,K.,
            Hayashi,H., Ohta,F., Nishizaka,S., Haga,S., Miura,S., Morishita,T.,
            Kabeya,Y., Terasawa,K., Suzuki,Y., Ishii,Y., Asakawa,S., Takano,H.,
            Ohta,N., Kuroiwa,H., Tanaka,K., Shimizu,N., Sugano,S., Sato,N.,
            Nozaki,H., Ogasawara,N., Kohara,Y. and Kuroiwa,T.
  TITLE     Genome sequence of the ultrasmall unicellular red alga
            Cyanidioschyzon merolae 10D
  JOURNAL   Nature 428 (6983), 653-657 (2004)
   PUBMED   15071595
REFERENCE   3  (bases 1 to 536163)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 536163)
  AUTHORS   Kohara,Y., Shin-i,T., Matsuzaki,M., Misumi,O., Ogasawara,N. and
            Kuroiwa,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUN-2003) Contact:Motomichi Matsuzaki Department of
            Parasitology, National Institute of Infectious Diseases; 1-23-1
            Toyama, Shinjuku-ku, Tokyo 162-8640, Japan
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AP006488.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..536163
                     /organism="Cyanidioschyzon merolae strain 10D"
                     /mol_type="genomic DNA"
                     /strain="10D"
                     /db_xref="taxon:280699"
                     /chromosome="6"
     gene            complement(<3337..>5520)
                     /locus_tag="CYME_CMF001C"
                     /db_xref="GeneID:16992954"
     mRNA            complement(<3337..>5520)
                     /locus_tag="CYME_CMF001C"
                     /product="similar to hedgehog protein"
                     /transcript_id="XM_005535633.1"
                     /db_xref="GeneID:16992954"
     CDS             complement(3337..5520)
                     /locus_tag="CYME_CMF001C"
                     /codon_start=1
                     /product="similar to hedgehog protein"
                     /protein_id="XP_005535690.1"
                     /db_xref="GeneID:16992954"
                     /translation="MRKRYFSIVRLLVIVLVVSGTHTVRGVLSSEDTFLWTWIGGSNS
                     TGSSGSYGVQGVRNTSNVPPARYGAVFWTGADGVLWLFGGGSDLRDVFGDLWNYNLST
                     FSWTWVGGSASLNSGGVYGSLGVPNKSNYPPSRTESAAWSDSNGNLWLYGGWNLNSGY
                     SDMWMYNVSSGEWTWVQGSSKTNVPPTYGPLGKSSSSNTPGARFQPATWVGLDGQFYL
                     FGGFYPSGPFYGDLWQYSTVTNEWSWIGGTQQQNPSGSYGTFRQASPSNYPAGRLGAT
                     WWRDLDGNFWLFGGDGQIDGNGGFLNDLWLYNISSKEWTWMSGNHSVGLDGAVYGEKG
                     VPSSSNTPGYRAGSSGFADSTNTLYLFGGSSPGFCNDLWTFNITSLEWTWVDGDNTTD
                     GAYSYGELNKTSNTTLPPPRYGAVLWDTDQNDPVLFGGQGSSGSYNDLFTLYIATPTP
                     MPTPTPTPTASPTPSVTAEPSATTNVTQTAVGEGSAVCFPADASVLIDGLGNHLQISE
                     LRSGMAVMGVNGRGQLVEDSVLGWLHNEAGATAEILAIKTRSGKQLRLTRQHLVYRMI
                     EHSRDFYGMTTAFSCISQKQQQQKHIRRSLELGTTAVVAVFAEDIRVGDALLDVAAHL
                     PDPVVAIETLVTHNGLYAPLTRSGRLAVDGVLVSCYGTYASHAVAHAVLWPARVDALR
                     KVWTSGLGTGGIVGIMPYAERLYHIWTSAARVLTKARVSVISAAC"
     misc_feature    complement(6202..7656)
                     /note="pseudo-gene of trefoil factor"
     misc_feature    6204..7716
                     /note="possible transcribed region"
     misc_feature    complement(7988..9205)
                     /note="pseudo-gene of NADPH:protochlorophyllide
                     oxidoreductase"
     misc_feature    9857..13233
                     /note="repetitive element"
     gene            complement(15916..18121)
                     /locus_tag="CYME_CMF006T"
                     /db_xref="GeneID:16993118"
     misc_RNA        complement(15916..18121)
                     /locus_tag="CYME_CMF006T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461254.1"
                     /db_xref="GeneID:16993118"
     gene            complement(<19518..>20978)
                     /locus_tag="CYME_CMF007C"
                     /db_xref="GeneID:16993117"
     mRNA            complement(<19518..>20978)
                     /locus_tag="CYME_CMF007C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535634.1"
                     /db_xref="GeneID:16993117"
     CDS             complement(19518..20978)
                     /locus_tag="CYME_CMF007C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535691.1"
                     /db_xref="GeneID:16993117"
                     /translation="MPLSSLVPSKRRLFVVAAFATAVPQIVFFAGVAPYFCADKAPRG
                     WSVLAVGIFLAVCAWTCFLVAAFTDPGWVPYSAEHEKELLYREASTGLPMNIRVRDRK
                     TGEEFSLKYCENCRVFRPPRTKHCYVCERCCVRLDHHCVWLGQCVGARNHPYFLGYLI
                     SILLLLVYGVVVCFLEIGFESEQLGSGTSGFRAALVHRPFPAILALLVGVYCLFVGGF
                     IAALYLVQLFFACTGRTTAEACGRAPIKRGSRIGIAGLAEVLCIAPQDSKKICDRNGR
                     NGAKFVWQYEFLGLEYHEQMISSLKEDKSIVSNAVYDERWSEFEKLRHIPVIVSQSPD
                     RGTASDTSVSQKSLAEWLDRYELMLLRRWIMEGMPERCPQDTPEGGELEAASERKHLE
                     LVRAFIRGERASATMSDLEDIRRMLVLWREQICQKRNLPGTVQSGAELATITAATGAR
                     GDPEALPEIAATSLHQSRVVCSSFHGRVEITNTCGA"
     misc_feature    21173..22176
                     /note="repetitive element"
     gene            complement(22182..23085)
                     /locus_tag="CYME_CMF009T"
                     /db_xref="GeneID:16993121"
     misc_RNA        complement(22182..23085)
                     /locus_tag="CYME_CMF009T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461255.1"
                     /db_xref="GeneID:16993121"
     misc_feature    25782..28366
                     /note="repetitive element"
     gene            28301..31425
                     /locus_tag="CYME_CMF011T"
                     /db_xref="GeneID:16993116"
     misc_RNA        28301..31425
                     /locus_tag="CYME_CMF011T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461256.1"
                     /db_xref="GeneID:16993116"
     gene            complement(<29243..>31642)
                     /locus_tag="CYME_CMF012C"
                     /db_xref="GeneID:16993115"
     mRNA            complement(<29243..>31642)
                     /locus_tag="CYME_CMF012C"
                     /product="phosphoenolpyruvate synthase"
                     /transcript_id="XM_005535635.1"
                     /db_xref="GeneID:16993115"
     CDS             complement(29243..31642)
                     /locus_tag="CYME_CMF012C"
                     /codon_start=1
                     /product="phosphoenolpyruvate synthase"
                     /protein_id="XP_005535692.1"
                     /db_xref="GeneID:16993115"
                     /translation="MVLTNCEENDAGKYVVELQNLRNTDRGLVGGKNASLGELLSLGL
                     LVPRGFAVTVAAYESFIEFNKLDTKIQSILQGLNLESPSSLEEASKAIMALLEDAAYP
                     PPVEQMIRSAYRNLVKTLGAQEPLVAVRSSATAEDSAEASFAGQQETYLCVHGIDAIL
                     QYIKKCYGSLFSPRAIAYREEKGYPHLDMRLSVGVMQMVQSRVSGVCFTLDPVTGKRD
                     LIVIECCWGLGEMVVQGRVRPDRFVVEKASGRVLERHTASKPLMMVRAAVADGVQGID
                     AASADTLTREVPVPADLVEAPCLTDAQIQELLRTALTIEKHYGIPMDIEWAIDEEKNQ
                     LYVLQARPETVWSDRKAASRREVLVRGLGASPGRAHGKVRVLLDVQNISEFQPGEVLV
                     TSMTTPDWVPAMRKAAAIVTDSGGMTAHAAIVSRELGLPCVVGTGKATEILRSGQIVT
                     VDGTLGVILRGVHKAEEDTPPKAGISADAVASMVLPITATRVYMNLGEPEKMQDLRHL
                     PFDGIGLMRVEFILASWVGHHPMYIIENKEEEMLVEKLAEGISMVAQAAYPRPVIVRF
                     SDFKTNEYRSLKGGERYEILESNPMLGWRGVSRYVSAEYEAGFRLECRAMKQVRDEQG
                     LKNVWAMLPFARTTWEVQRALDLMRSEGLQRASDFKVLLMAEVPSVVLLARDFAQLCD
                     GFSIGSNDLTQLLLGADRDSPKLATLGYFDERDPAVKAAMRILIEEAHRANITVSICG
                     QAPSVYPDLTEFLVRCGIDSVSVNPDAVISTRKQIASVEQKILLENARRALLEQHSTG
                     R"
     misc_feature    31728..32538
                     /note="repetitive element"
     gene            <32955..>34745
                     /locus_tag="CYME_CMF014C"
                     /db_xref="GeneID:16993114"
     mRNA            <32955..>34745
                     /locus_tag="CYME_CMF014C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535636.1"
                     /db_xref="GeneID:16993114"
     CDS             32955..34745
                     /locus_tag="CYME_CMF014C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535693.1"
                     /db_xref="GeneID:16993114"
                     /translation="MAANTEGDEVSLPVAKTLRSILELTDPREAADAFAAFIGLHTQR
                     MEDTYGPQNNWGKLKDELYKWQLSLAEVLVATLQQRIFETYPPHGSGATHGLRIPRRN
                     AWLLLSQLVYYVSKRGLLRPHARSVLSAVRYELWKEMGWVYFAELAYFLVRWRQQFVG
                     LLTTRMSSTASGCDRRTSYPTARDYEASHVIVAVLPQVLRYVPAQTWSALGARAPYTG
                     TQSGQIDLQQNAVPATREALLSCFVAHTAWRHPERLVEATLVPNQWRDMVTHAWLDEI
                     LLREQAILRPWMMPAITAMEDDKTALEDAVLRETNREQFEVDALRALASLRICRELFV
                     PGPLHCPPLDMTLAPRVTSETGSGLRELRVWKAIFLERASSLDEERVPRCLRVDGGAA
                     ARLVDVIHGASLSPLEADTILDRLIDADETLIHRLHLSPEDLLRFHENHSVRHTARIL
                     QHLVDTCTNRLPEYMDAFTLLPVTISNLSLVHAVDRELFFRLYTSRVCAQGRTLVSWN
                     DTASERVAELFATFVLRMLDERPTWITNEISVELEAWALCASRVMRPVELYRCLRRRR
                     LSPSARPQTSTAVAASGEYISFQLLSSDAQ"
     gene            <36423..>37097
                     /locus_tag="CYME_CMF015C"
                     /db_xref="GeneID:16993113"
     mRNA            <36423..>37097
                     /locus_tag="CYME_CMF015C"
                     /product="small GTP-binding protein of Sar1/Arf family"
                     /transcript_id="XM_005535637.1"
                     /db_xref="GeneID:16993113"
     CDS             36423..37097
                     /locus_tag="CYME_CMF015C"
                     /codon_start=1
                     /product="small GTP-binding protein of Sar1/Arf family"
                     /protein_id="XP_005535694.1"
                     /db_xref="GeneID:16993113"
                     /translation="MGACFGKPSEAGTSARDASSTRRRGSRGDGGGGGGGGGGGRTNA
                     HRPGQRIELLLLGLDGAGATTILYRLKLQKFIITVPTLGSVEETIRWGSEEILFHDLG
                     GTDKLRPLWPMYQDGIQGVIYVVDAADRRLVDANRRELRRFYRAAVKLHDAPLLIFAT
                     KQDLSDAMTSEELQRELGLEEIPCRCYHVAGCSAVTGEGIHEGIDWIVGEIRRGGSRA
                     ASTLRK"
     gene            <38161..>39027
                     /locus_tag="CYME_CMF016C"
                     /db_xref="GeneID:16993112"
     mRNA            <38161..>39027
                     /locus_tag="CYME_CMF016C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535638.1"
                     /db_xref="GeneID:16993112"
     CDS             38161..39027
                     /locus_tag="CYME_CMF016C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535695.1"
                     /db_xref="GeneID:16993112"
                     /translation="MVCKRSPKRAVSSGFIGISLSVSRIQSVVRQTLQRTSWLPKATN
                     NRFARDDGATTVQRRWRRRGPRPHQPQSPCALITSSFSVVGVSQAAAGQHLAYAFGVS
                     LPPTMLAWFGSTGTSMTTEFDGANSLTPVVWVLGAVAGLVVSHLAQQSPAAVRKAWLR
                     FIRGADAREANPTCPACEGEGSIDCLCQRWRVPDASSDSSESRSEPKGPLQKASRGWN
                     LFSKSRTRVALTKSTCSRCHGTGREPCPRCGGGGMLVHSDEASLRGDTVPVHLEDGYD
                     WERAARLKRDSR"
     gene            complement(<41301..>41642)
                     /locus_tag="CYME_CMF017C"
                     /db_xref="GeneID:16993111"
     mRNA            complement(<41301..>41642)
                     /locus_tag="CYME_CMF017C"
                     /product="similar to glutaredoxin"
                     /transcript_id="XM_005535639.1"
                     /db_xref="GeneID:16993111"
     CDS             complement(41301..41642)
                     /locus_tag="CYME_CMF017C"
                     /codon_start=1
                     /product="similar to glutaredoxin"
                     /protein_id="XP_005535696.1"
                     /db_xref="GeneID:16993111"
                     /translation="MGRSSVDVQAEEQVKGALAERDVVVIFSKTYCGFCAAVKRLFER
                     LGIRYRALELDILPLGSAMQRILYEMTGQRTVPSVWVRGRHLGGNDAVQELHRTGRLL
                     PLLDESGIAHA"
     gene            <41997..>42749
                     /locus_tag="CYME_CMF018C"
                     /db_xref="GeneID:16993110"
     mRNA            <41997..>42749
                     /locus_tag="CYME_CMF018C"
                     /product="probable nicotinamide mononucleotide adenylyl
                     transferase"
                     /transcript_id="XM_005535640.1"
                     /db_xref="GeneID:16993110"
     CDS             41997..42749
                     /locus_tag="CYME_CMF018C"
                     /codon_start=1
                     /product="probable nicotinamide mononucleotide adenylyl
                     transferase"
                     /protein_id="XP_005535697.1"
                     /db_xref="GeneID:16993110"
                     /translation="MWVSGIALCTVGNMSRGSFNCQRVGVLLSAGSFSPPTLMHLLSL
                     EQAREYVENTLHHPVWKGFLSPVHDAYQKPGLVAAKHRLQMCALAVKDSDWVQVDAWE
                     AQQPCYSPTFQVVQSLRERLEAQRRLPDPGPSVFLVCGADLVASMNNPSIWPVEHLQK
                     LFALCEVVALPRPALDATDEEALERVLRQYPAAIHYWKDAPVQCNISSTLVRERVAHG
                     RSIRYLTPRAVENYIWEHGLYRQTNPSIESAQ"
     gene            44621..46750
                     /locus_tag="CYME_CMF019T"
                     /db_xref="GeneID:16993109"
     misc_RNA        44621..46750
                     /locus_tag="CYME_CMF019T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461257.1"
                     /db_xref="GeneID:16993109"
     gene            complement(<46531..>48258)
                     /locus_tag="CYME_CMF020C"
                     /db_xref="GeneID:16993108"
     mRNA            complement(<46531..>48258)
                     /locus_tag="CYME_CMF020C"
                     /product="probable NADPH-dependent FMN and FAD containing
                     oxidoreductase"
                     /transcript_id="XM_005535641.1"
                     /db_xref="GeneID:16993108"
     CDS             complement(46531..48258)
                     /locus_tag="CYME_CMF020C"
                     /codon_start=1
                     /product="probable NADPH-dependent FMN and FAD containing
                     oxidoreductase"
                     /protein_id="XP_005535698.1"
                     /db_xref="GeneID:16993108"
                     /translation="MDDEFLEHALVVYGSQSGNAADAAATLAEAIGPGADCRSAQFYD
                     PENLPFESVVLFVVSTYGDGEPPDNFAAFWRFLRKRRLPANWLRAVRYAVFGLGDRSY
                     PKFNAVARRLDVRLAQLGATRIQPIGLGDGALWEDAFNEWLTSLLGAQRMEAYRRRQQ
                     QRQQRIAPSRWHLRPVNREAVFLDARELALDDTYPDEKHVVLFRFLVGRSGSAGPIFM
                     PGDVAYLVPQNRPSAVDAFFQLFPSWDPNEVFWIENLTGERVRARSLVQRLFDLNGIP
                     RRRFLRQLACFATEAHEQRRLLEIADSAAAYASYILHEQRTVLLVLRDFPSARFPSLA
                     HALEVMPRMQPRGYSIATDMRDAAKAASPEDNALVEICVRLVRYATPLRRLRIGTMSG
                     CLRNLQSGDSVCLWIQPGTLRLPADPECPMLMVAVGTGIGVFRCMTSHLATISTTRLP
                     SNKILVYGCRNDTADDLFRENWPSSVVQRLPAYSRPRDGRPKCYVQDRIRQDADLIYE
                     TCFKGTDRSQRVHIMVAGSSSTSMPAEVRRAILEAVLCSRAGLSASEAEQMLSLMAMQ
                     GRYMVEVWD"
     gene            <48907..>49857
                     /locus_tag="CYME_CMF021C"
                     /db_xref="GeneID:16993107"
     mRNA            <48907..>49857
                     /locus_tag="CYME_CMF021C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535642.1"
                     /db_xref="GeneID:16993107"
     CDS             48907..49857
                     /locus_tag="CYME_CMF021C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535699.1"
                     /db_xref="GeneID:16993107"
                     /translation="MLKRNGQSRVSATTEPPATTNSVVDVEAGRDSPPNVCLQPALEH
                     WGDHAYAEHNALSERGRAERETSDAGAVALSDCTRGSRQSAGATDAPAACAGTASTHE
                     TSCALSNADRPEGQRTDKQTSHTMRVQASASWTHAVDENPQRSKDSCERQQPASDGRK
                     ASPPNSGPALGSTSPQTDHSKPGGTGAAQTPAPNQNPVDSFRWQQLLQYHASRNVGSR
                     ARDLLALERTFLSMIRTSLSSVALGVAIAKLIGTRLADATGTVFISLGLLTLIIGLWR
                     YYTQILAIERGQFAADTVFPWIVVVLLLTSGVVSLVLIFK"
     gene            complement(<52287..>53390)
                     /locus_tag="CYME_CMF022C"
                     /db_xref="GeneID:16993106"
     mRNA            complement(<52287..>53390)
                     /locus_tag="CYME_CMF022C"
                     /product="tRNA pseudouridine 55 synthase"
                     /transcript_id="XM_005535643.1"
                     /db_xref="GeneID:16993106"
     CDS             complement(52287..53390)
                     /locus_tag="CYME_CMF022C"
                     /codon_start=1
                     /product="tRNA pseudouridine 55 synthase"
                     /protein_id="XP_005535700.1"
                     /db_xref="GeneID:16993106"
                     /translation="MRTQLAFLSLVRPLRTTAPGAAAAVSTTAFAASAVGGSGVSGFA
                     LGPALGSMPGSRKRSRAVSDLRCAARSPKEPSGILIVNKPQNWTSFDVVNKVRATLEK
                     YLRQHEAPTAASPPAGVGKSSSGSGAGRRSRRFRLRVGHGGTLDPLASGVLVLAVGAQ
                     YTRQLWEFQRGRKQYRATFKLGSATDTQDCTGEVIARSSFEHLREYDVEALNRLLQSE
                     AFHGAIVQRVPAFSAVRVQGERLYDLARAGKADAIGELPSRTVYVFEARCEAFDARQG
                     TGTLFVDCSGGTYIRTYIDDLGKALGTHAHMTSLVRLRVGPYALDDVSMPCLQTEKEL
                     SNPEKILSCLQAVSVTAPQPASSPVAKPPSSAA"
     misc_feature    54627..56546
                     /note="repetitive element"
     gene            complement(<57569..>58444)
                     /locus_tag="CYME_CMF024C"
                     /db_xref="GeneID:16993105"
     mRNA            complement(<57569..>58444)
                     /locus_tag="CYME_CMF024C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535644.1"
                     /db_xref="GeneID:16993105"
     CDS             complement(57569..58444)
                     /locus_tag="CYME_CMF024C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535701.1"
                     /db_xref="GeneID:16993105"
                     /translation="MTSAVAQIGTNGAGASGDSPELRAPCTDAASSLEVRVNDRVLRV
                     SAADPEALYEELREQVASAWNFARETVKLIAQGRVLRTGDALLAAVQKQQPLRVIGTA
                     SFALERVQLARPDPLVRPADFDGPGRRPARPFDGELYPRAPVGSCSRWGFSELRVLGN
                     FADAHQAHSLLEQLARDPGVNYVMQKWHWRVGALCEMAPDGRVGVDPVCVLGLNQGRG
                     AAIYLRLRTDDLAGFRRYDAIREVLAHELAHNEHAEHDSRFYKLMREILSEMNRRDWR
                     RLKGFRLGSGNAGAR"
     gene            complement(<58888..>59559)
                     /locus_tag="CYME_CMF025C"
                     /db_xref="GeneID:16993104"
     mRNA            complement(<58888..>59559)
                     /locus_tag="CYME_CMF025C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535645.1"
                     /db_xref="GeneID:16993104"
     CDS             complement(58888..59559)
                     /locus_tag="CYME_CMF025C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535702.1"
                     /db_xref="GeneID:16993104"
                     /translation="MTVNAFAASRLPVVRSALDCRWQARGACLAPGRHWRRAPRTRAT
                     SRAVIAGLFDAFKPLFGDGENDRAQNKQLESQREREIAEQQRIMREKLEARRAGRHLE
                     GVAERRQAVQEQLNAKEKPKPGEDPLIAWERQREKERTAGTWKEVGYGEEPKRGIILP
                     WPSFGIPRFDYGERFDLRLPYVDEGYVDEDADIMGKVFGRRRKPPESQRSPENGDNGT
                     NAASE"
     gene            <60466..>61446
                     /locus_tag="CYME_CMF026C"
                     /db_xref="GeneID:16993103"
     mRNA            <60466..>61446
                     /locus_tag="CYME_CMF026C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535646.1"
                     /db_xref="GeneID:16993103"
     CDS             60466..61446
                     /locus_tag="CYME_CMF026C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535703.1"
                     /db_xref="GeneID:16993103"
                     /translation="MAAKAEPGHPESGKLHQRWRKAKEAGNLSTFASPAELRALVQAK
                     LTPEEQVRFGMQCAGLAAKALEVLDKSLTSLEQDIENESCDWEIESDAAMDRVARRFL
                     ADLEQLKQTGSARRLTQLSIWRRISRYVVLAERRAAEASRQREHELQAEGSPFVRQVA
                     KIADQASKTPGYRQVVAWEHLEELADAATADGAFGSQSRSMSRILRRPESRFRLLLTK
                     LELGEELCTPEERRLMLALDTSDARLEPERMRSRKRAPGGAQDGASAKRDHGRSASVS
                     SSSSSSSSSLDPEHEDDVHPAAKNASSVRKKRRHHRRRSSNKNETLENPQ"
     misc_feature    complement(61542..65504)
                     /note="pseudo-gene of triacylglycerol lipase"
     misc_feature    65000..66811
                     /note="possible transcribed region"
     gene            complement(66644..68393)
                     /locus_tag="CYME_CMF029T"
                     /db_xref="GeneID:16993100"
     misc_RNA        complement(66644..68393)
                     /locus_tag="CYME_CMF029T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461258.1"
                     /db_xref="GeneID:16993100"
     gene            <68508..>70802
                     /locus_tag="CYME_CMF030C"
                     /db_xref="GeneID:16993099"
     mRNA            <68508..>70802
                     /locus_tag="CYME_CMF030C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535647.1"
                     /db_xref="GeneID:16993099"
     CDS             68508..70802
                     /locus_tag="CYME_CMF030C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535704.1"
                     /db_xref="GeneID:16993099"
                     /translation="MWLQVRGFREASFRLGYSHSASSSTLWPPADYPTLRIAWDLEAW
                     LQQALVAEPLTPALALRPADRAAWQVIDDCALLNAYGWLSPSFIERAIADLERWLSAL
                     GREVQEPPGTGRGPHLQVVLLAPSSHYIHWGAQLQHFRKQEHQQRQALEKAWNLLKIG
                     TSTGDQAALRAGKRRMAAIQRLVYPRSVWWQLQQALLQHDWKGARLDFLDPAIDLDVP
                     EVPTWLVAADLYAAGLVDGVYAPHREALVLANAPWALLLLRNRQKLLENDRFVSLIDI
                     IAGWPLDFGRYGALACAISGLDPFCRPHWSMARSGASSMSFEEAMARAQSMLLSQPDN
                     DSTAQANEHVEDERTALKCVTFVISGSASMWSHTAPMSGEHPRRHAFALESAALESSP
                     VPGEKTVSANVPGTVTAESYATLTPGQAPDVAPEASRDAADTFPTPTAVTSFGETLTG
                     TRLNESTPTRAGCERWTADPVVTPTSAGDASNQGKQQATSNKLGASSPVTTRSSVAET
                     SRTDPEQEALRWHQHIWLPVIDTPYLRRLSEQILGWRRANDTQGSLSLWFQHRRYTWQ
                     ASQGRSLRATLSQLPHWLQRVLVRARLTDKVPLIQGLEKLVLPKAESSSEVSTAVLLW
                     PWALLLLSLALGWFATDADHWHDRVVWWVSPDSVLGGETNASAWTNYLVKNWPPFLAE
                     QIAASEIMNLILGVELPGLHLASCLTLEVYAQLRVAFTESYRSIRCYLDEGTWRALEA
                     LLSETLKPVQKQAPTSEHHAQHAL"
     gene            complement(<72294..>74645)
                     /locus_tag="CYME_CMF031C"
                     /db_xref="GeneID:16993098"
     mRNA            complement(<72294..>74645)
                     /locus_tag="CYME_CMF031C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535648.1"
                     /db_xref="GeneID:16993098"
     CDS             complement(72294..74645)
                     /locus_tag="CYME_CMF031C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535705.1"
                     /db_xref="GeneID:16993098"
                     /translation="MQRLATKCQVEQCTTGRSLPQSRWVRRKHSWRGPRNTVLAWARW
                     WLVALLVLGSVSAVAAGKLLTSFPATSSTSNTLRVVPGSPSVLVHGSQSTFNITFVEP
                     YDVRAKEAFAFAALQWANVFRSSAPVRVVTRYAALAAVSSATNSDLGSTFAYLVFGNG
                     TNGLLNRTWYNTALAGAIAGPQVVAGTPFDMQIDLNSAAPWHFDPYTTIDPLSEPHAI
                     DLATTVMRQIAAGLGFSGTITANPQTKTAHYGLSYDTHYGYPAFSIPGRFDSLLTDAA
                     GCSLIESCRPFGGGGLYQALTTLNNVLIRDRAGNPFMLFSPNPYSAGTNTYQFSPTTW
                     LWDCVAAGFQTQRCSSLVTPYAVPGEQNYEIGANTLAVLELLMSNDTLPSPLPSYCTT
                     ACSSNAVIVTEAIAAFQDDAPGVNAGRVASLDTPAVDQERAHLGSPTERISIGRMDAF
                     STSLLNVPDADVPAWMHLVPSSAPSRGAVSGNQEAGASSLEKGKNVYVPLVPEPLPST
                     SGLPNALLPSCGKVRKALASALQNVLQAYNYSNSAVAPMHCHLNETTERYLLSAAILG
                     LDMSALGSVRATLLDSANTTGVLIAVSMQVALGTSLSLDPVVVVRLYDRTGELAPVMP
                     PPLPLQTALSYAGAYDVHWRVEAAPGTVVNQTAFCAHTSFQSLLQSATLVVLEFSISK
                     ALNTSRFGTAQLSLVPGRSECSLYRASPDSAPPAKYDLFFTIGVARSAANLNRSAAFA
                     AAGATAAQMLSTVDVQEVLQALAPHGLFTNTVFVQTVYSSFAF"
     misc_feature    73886..74407
                     /note="possible transcribed region"
     gene            <77451..>80516
                     /locus_tag="CYME_CMF032C"
                     /db_xref="GeneID:16993096"
     mRNA            <77451..>80516
                     /locus_tag="CYME_CMF032C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535649.1"
                     /db_xref="GeneID:16993096"
     CDS             77451..80516
                     /locus_tag="CYME_CMF032C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535706.1"
                     /db_xref="GeneID:16993096"
                     /translation="MRVSRGPAAYHSPASTNASPLRYGSVQGSLGHQGSLFMERSRSA
                     AVVVAPTGMVYCPRAPRWIMKAVRAIGVAGWGGSGGGRSWTLSGARGPLETAQESGEE
                     QLSEENPEGSERPAERDNGAGSAGSLTAHDVVVSMGGGSLGATVLGNESFIWTLSGWR
                     QSVREAQEREDARQLRSAFDREEMVSGYETPATGTSLLSTSIERRGGAALGSALSLTT
                     RSPWAIIGALASWLEDRFFPLFGAEEAENIMAAAEGEMPRAARTVASSASSITGSMID
                     EETAANRRLQAALLRQSGSTRDRRVDALQYVLDQMIDPFCRAVLASFAAAATDSAASI
                     LGPLLFLYGHAYHMQRGEMQLGSEGDQVLMEEDLANMPRAIMALRTLTELYSELFSTS
                     NAGFGRSRGNSSSTLNQAGTPQHAALISTNASSANIAVVPSSRSRLGRTLSTQSGNKA
                     SAQGSLSDAGEVLDAFATRAELLAGTTEAMDPPLASSLTTEPAVGRARSPADAAAAIA
                     SSSATLPLTGAYGRESEPADSAATSSDTDAALSEAVKSLRHAPATETERPELRAAAGA
                     SAAAAAVGAPDVATMPQAAAAAAAAVSQCAFSENDRTALLEAALARIEALEREVDFLN
                     RELAAFRDDCVSSNRDLHNCVDAWTAIVLSETRSVAATERATIRALARRLRKLERQIF
                     SENVAATAATSPEHSNRGESRRATRASSERAEVQAEGYGTASRSAAQPWPATATATEA
                     TETLEFVAGKQGPPTASPSAQDSRLLYSEISSDDPTEAPSRAMQPGSGAARGAPTVTV
                     RSPSAGPVAALSYLLSEHGSFGSDEDPLLTAFQRAVGLGNALGSGDDTGESASSTPRG
                     GTPRSGGLHGPGAGSLQAPAQQSTYPSVRGAQRAIIGSLPRSTSGSNMVRISSPMLSD
                     PMSGSGALSSSLPVTSSLRTRVAPTVSIATGGLPENPHTSRRILRDGKWVHEEAASSP
                     GAAWGRASASRASRREREAVLRRQIESMQVALEEERQRRQILEERLLRQ"
     gene            complement(<81862..>84108)
                     /locus_tag="CYME_CMF033C"
                     /db_xref="GeneID:16992951"
     mRNA            complement(<81862..>84108)
                     /locus_tag="CYME_CMF033C"
                     /product="nucleolar RNA helicase II/Gu"
                     /transcript_id="XM_005535650.1"
                     /db_xref="GeneID:16992951"
     CDS             complement(81862..84108)
                     /locus_tag="CYME_CMF033C"
                     /codon_start=1
                     /product="nucleolar RNA helicase II/Gu"
                     /protein_id="XP_005535707.1"
                     /db_xref="GeneID:16992951"
                     /translation="MTFISNVISGIQSTCLFSRASCWGDPVTRLCGRPSWFSTTSGFV
                     PRGKLTPVACRFGGASRRHQCSLKMQLSLPSEELESTKQDGVVIEAENATSESKHRDW
                     SLERFPLSEATAAALRKKGITELTEIQAITFNDMRSGRDVIGRSHTGTGKTFAFGVPL
                     VERMVEARVSNGSRRGAPGRSPCALVLTPTRELAKQVTEQLRLIGQPHGLAVDCFYGG
                     ASYTQQEEALRRGFDVLVGTPGRILDHLDRGTLNLSNIRIAVLDEADEMLSLGFAEDV
                     ERIFQKMPPKEERQTVLFSATIPPWVQKIAAQHQRAPVVHDVVGRTETRAAKNVRHVA
                     VRVPDADFARFAMLEDIVFAHAETGNQRCIVFTDTKREADEIAMTASIFRSSVAQVLH
                     GDVSQRQRELTLQQFRDGRFSILVATDVAARGLDIHEVDVIVQMRPPRDVDTYIHRAG
                     RTGRAGRSGTAVIMYSDSERGLLRALERGASIRFEQAGPPTLERVLDVAAQNAARAVG
                     EASTNRVVPYFQRAADELAAAQFEGDARRALAAALAVISGRTHIEHRSLLTGEAGLRT
                     LLLTMNRAGVTPRDVLGIVRRLSQSGKLFTDDIGKVRLCRDPRQAVFDVSVEAADEIL
                     RCMEPQSTTDATSSDAENGTTASHASTGAAAGGGTGDRRTRYPDFTIEVCAALPELRV
                     DDYRFSSGHLERRRGRSLDDDSDRQSLNGRTRDGPGGRTGRRERSSRVRGGRPQRRRS
                     ISYTRDVQ"
     gene            84549..85448
                     /locus_tag="CYME_CMF034T"
                     /db_xref="GeneID:16993095"
     misc_RNA        84549..85448
                     /locus_tag="CYME_CMF034T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461259.1"
                     /db_xref="GeneID:16993095"
     gene            complement(<86675..>89602)
                     /locus_tag="CYME_CMF035C"
                     /db_xref="GeneID:16993094"
     mRNA            complement(<86675..>89602)
                     /locus_tag="CYME_CMF035C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535651.1"
                     /db_xref="GeneID:16993094"
     CDS             complement(86675..89602)
                     /locus_tag="CYME_CMF035C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535708.1"
                     /db_xref="GeneID:16993094"
                     /translation="MNAPRAGVEARSSTVEVAVPEQQLTNWSQWRSRFLNTCAERQWD
                     EAVRLVQSARSTWPQAAAVLEAALGVTLAAEQVELEPSLLAQTDRAAAQLAPVWQGFV
                     HLAQEDTLGAQKLFEASARAVQPQTSPVVLLLTRVGLGRVLLERSVIEPHLAQQAAAW
                     YADALWMYGEASPAEWWCSYAYALAAAGKLLDATRVLSWRLSMECERIDRSVMHYSDA
                     DDAYPHPDTLLGLWVCLRALEAPTHGPSSEAKDTAAARAVAEELLREAFVLYPQELRI
                     RNAIVHEHRERAFRFLGAVEPDTWKAATHRAAARTEYLLGRWRERRGDWIEAETHYGT
                     SIQHWTEMAVARLALAYSLLRRNALDQAMDQIERVRQQGSRALPARLDAYLRALSAVI
                     LQEKAADEQASRKALEQAQQHALELLQGTDLEQLPAEALAVYAELMDRLDPAFALQLY
                     SRLGKHWDDPIVWNNIAALRVRLGQYNEAYIALERALQLVTGDQGLSLRTWLPEVAFI
                     RKRPWHLTLSYNLGRLLESLGDLTRSESIYRTIHEQFPEYEDATLRLGVLAEHLHRNL
                     NTAEDLYRQVLPNPRAVTALAFLAQSRGRVDEAQAWFEYFIRRKKLRKDLETRYQARN
                     YCDLVTAAYYVTLARATARHHQSRRHKFLVAAGNLLLGVLERAHDNVAAMQLLGVYFR
                     EMNLLSEAEEALCAVAQLGAVASAEPKIMECARANLIAVHLSRGSAVVASLRNAIRLL
                     DDRLQSAPYDAGALMALAAAHYGLGQYAACMETLQRALHLQPSALSVWFDLSLTLAQE
                     SSIRLSRPDHGTDPEVATVLLECAGGCFRAMEMSLRQMQRSVSTDVVRQWQPSLAGPT
                     NKVVTAEAAHANSSWCLHRLAYARRLLAEAQERTRRRHEELQQRQQQREAAAARQADA
                     VRQRREVEQREIEELEKLAREQQLEFCRRQEEWEAQRGKSRSKSQVMVELQGDLEDKS
                     GSA"
     misc_feature    complement(89744..93080)
                     /note="repetitive element"
     misc_feature    complement(93081..97236)
                     /note="retroelement, dead"
     gene            complement(<98359..>98859)
                     /locus_tag="CYME_CMF038C"
                     /db_xref="GeneID:16993093"
     mRNA            complement(<98359..>98859)
                     /locus_tag="CYME_CMF038C"
                     /product="similar to sedlin"
                     /transcript_id="XM_005535652.1"
                     /db_xref="GeneID:16993093"
     CDS             complement(98359..98859)
                     /locus_tag="CYME_CMF038C"
                     /codon_start=1
                     /product="similar to sedlin"
                     /protein_id="XP_005535709.1"
                     /db_xref="GeneID:16993093"
                     /translation="MSERLYYFVIVGRDDRVLYDLLYPASLSELDWRTSSELSSPAER
                     GDFEPHHFIPSIQVLLQFVAYSALDHIEEKYWLTSARSLKHIFRFRDWSASVQLTPNA
                     ATRFVLVHGASDDASRNVRAFLHAVYEAYVPHVVCNPFQEEDAPITSKRFHEVAKNLA
                     KRYFSG"
     gene            <99685..>100629
                     /locus_tag="CYME_CMF039C"
                     /db_xref="GeneID:16993092"
     mRNA            <99685..>100629
                     /locus_tag="CYME_CMF039C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535653.1"
                     /db_xref="GeneID:16993092"
     CDS             99685..100629
                     /locus_tag="CYME_CMF039C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535710.1"
                     /db_xref="GeneID:16993092"
                     /translation="MVQDTAWVAWGCRPTWCTRTVSSGQGHSRDAGCCRYAGNRQQRW
                     HPKLPARGFPLVEGKRLWCRKLGALRGRFRATADPPSDDKDGAEESSSDKHEEDAQQP
                     PPGERPLHQIPGTSLPLEELQKRIQQMKQTRASADSPEDAARDQTTRAGNSERSVFEV
                     EATVVEGSQTPYDASKEVCVLVFRSSPRGDGIYSLRLGDEDIILAFERDVEAIRYARL
                     LAAQEFPEPHVEKLQIGEVYAFCEQAGLRMGLVPSGMMVIPPEDNMPGYERYFRDAKD
                     QGPPDREYVGELTERQLNELKNRLGRLVDGDSGPSSLD"
     gene            complement(<101481..>102428)
                     /locus_tag="CYME_CMF040C"
                     /db_xref="GeneID:16993091"
     mRNA            complement(<101481..>102428)
                     /locus_tag="CYME_CMF040C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535654.1"
                     /db_xref="GeneID:16993091"
     CDS             complement(101481..102428)
                     /locus_tag="CYME_CMF040C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535711.1"
                     /db_xref="GeneID:16993091"
                     /translation="MGELQGAQNVRDSRDPDSADADSPVFGEGADEAVHVPPLTDAKY
                     DARETQMPFVPAERPTLCTKRPPPHQSADIQDCASNRIASDAPSKALASEQETEFSSS
                     NASGGASKELGENTNANGESAVTDMMYRSSRTGRDALPAVASQLPRRKRGRPRKEELL
                     ARKLRPGGEPGYPDGTASHTRWRTSASAVDIPRTVHIMYDYPEPKSRSIDQSRLDSLA
                     QATAAKALASLAHGRTTTKSLPAVSIGEPCPAGTALRVLPLLRRAGQGTTFFADGSVG
                     ALSAEQSAPAIEQRKMSDQVVELVSKSAAPSNPRSPEKS"
     misc_feature    complement(102616..103816)
                     /note="possible transcribed region"
     gene            <103390..>103809
                     /locus_tag="CYME_CMF042C"
                     /db_xref="GeneID:16993089"
     mRNA            <103390..>103809
                     /locus_tag="CYME_CMF042C"
                     /product="similar to programed cell death protein 5"
                     /transcript_id="XM_005535655.1"
                     /db_xref="GeneID:16993089"
     CDS             103390..103809
                     /locus_tag="CYME_CMF042C"
                     /codon_start=1
                     /product="similar to programed cell death protein 5"
                     /protein_id="XP_005535712.1"
                     /db_xref="GeneID:16993089"
                     /translation="MQSSRFGWSSTGSDQTPVPGKAPGLATHLDGSSAEKERADEAAR
                     QAAAAEEERRRSLLRLILSEEASERLARVALVKPDRARAVEDYLLRAARFGELAPGSR
                     VTEEQLIALLQRVHTESEHRPCVTIARRRTWSDDEDE"
     gene            complement(<104298..>106043)
                     /locus_tag="CYME_CMF043C"
                     /db_xref="GeneID:16993088"
     mRNA            complement(<104298..>106043)
                     /locus_tag="CYME_CMF043C"
                     /product="probable glutathione synthetase"
                     /transcript_id="XM_005535656.1"
                     /db_xref="GeneID:16993088"
     CDS             complement(104298..106043)
                     /locus_tag="CYME_CMF043C"
                     /codon_start=1
                     /product="probable glutathione synthetase"
                     /protein_id="XP_005535713.1"
                     /db_xref="GeneID:16993088"
                     /translation="MSSSSSSAVELKLPFLVRVPSPADVHELAEYAQCAAVLYGLVMA
                     LETSSGTECNQVQTWTAVPVPMTLFPTVIPRACYHQARSLVATLHRCIDGLARDTPFL
                     LQSLHSTASQDDFTARLCDLVRQQPLKADVPALSVTRADYFVTANGRLQLVEINTIAS
                     SFGALGSRLRALHTHVLHRADILGLASELRHGSHSDGSGQFDGAMAQLASWRRGQCEN
                     NMPESGALEGIAEALAHAHRWWRAQHERYSSPVGSTVILFVVQPKERNIYDQKWIELT
                     LWKEHNIRVRRATLTEIAQNGQLVGGAEGSRPTLQLRSTSNAETEQAFISVVYYRAGY
                     VPQDYASDREWQARAMIARSNAVECPNASYQLVGTKRMQQILGEPGVLERYLDDTRGS
                     ERMTHGHAAASTIRPSHPKAEALRETFVGMYAFDDPSTRAALVQRVLDQPENYVLKPQ
                     REGGGHNLYGAEMKTFIERTWNAPDMLAHRQDPDHPLCAYVLMDRIHPGISPNVILRN
                     GHTPVQSDCVSELGIFGIFFGSTENAGSPGSIGVIETLNQAVGHLLRTKLARQDDGGV
                     AAGVAALDSPWLDTA"
     misc_feature    105620..107077
                     /note="possible transcribed region"
     gene            complement(<106979..>108964)
                     /locus_tag="CYME_CMF045C"
                     /db_xref="GeneID:16993086"
     mRNA            complement(<106979..>108964)
                     /locus_tag="CYME_CMF045C"
                     /product="probable alpha-1,2-mannosidase, endoplasmic
                     reticulum"
                     /transcript_id="XM_005535657.1"
                     /db_xref="GeneID:16993086"
     CDS             complement(106979..108964)
                     /locus_tag="CYME_CMF045C"
                     /codon_start=1
                     /product="probable alpha-1,2-mannosidase, endoplasmic
                     reticulum"
                     /protein_id="XP_005535714.1"
                     /db_xref="GeneID:16993086"
                     /translation="MQWRPVEQHVPKASYHELDFCGSKTMNTFCGLNPGLTRRTVHRT
                     INSWQRTFSRFRYYRQLLALTVFTLLLWMYRVGRPQALDDENELAGRLQPRLPGLLAK
                     ALSAGSTQRRHQSYSRWPPALRPNLTLGNELFLDDVTRNERRREAVRRAMQHAWRGYR
                     QYAWDHDELRPLSHSYEDSMNGVGLTLIDALDTLYLMGLHDEFRDARAWLARSEHRFA
                     RPKAEPVSIFEMNIRLLGGLLSTYQLSGDPLFLQKAEELGHLFAHAFLGRPPPRMPHP
                     SCRFRVRSQRTGSDDENGTIVTCRAAERVVLSECGTLQLEFRALGAATRDPLLKGLAE
                     RADQVLRDIIARAPLDGLPNNILSSADGSSFVNKSAEIVRFVNLGAAGDSYYEYILKS
                     YIQLGRTDPFWRRESDRIIDALERIVFRRGVLIETLESPSDPARQTERQHQLKQPLKR
                     FVNVSWPVVLSNSEEIHQPDHLSCFASSLFVLAVPPEQWDASVRNDRAERLLRLAGEH
                     ARFCFEMYLVNAGLSSESVEVQPSSPQDSPYADRPLVQIRSYVRGYHQRPETLEALFY
                     LWRATHDPKYRDWGWTIFQAMEWYTRVPSGGYVGCRDPDNGCRIPIDKMESFLLAETL
                     KYAYLLFSDDAALDIKNEWVFNTEAHPLRIMSVSRER"
     gene            complement(<110706..>114062)
                     /locus_tag="CYME_CMF046C"
                     /db_xref="GeneID:16993085"
     mRNA            complement(<110706..>114062)
                     /locus_tag="CYME_CMF046C"
                     /product="similar to beta-tubulin folding cofactor D"
                     /transcript_id="XM_005535658.1"
                     /db_xref="GeneID:16993085"
     CDS             complement(110706..114062)
                     /locus_tag="CYME_CMF046C"
                     /codon_start=1
                     /product="similar to beta-tubulin folding cofactor D"
                     /protein_id="XP_005535715.1"
                     /db_xref="GeneID:16993085"
                     /translation="MADSETSAAVPECAAIERWLRTSCLGESDAYAQLATLIETFQED
                     GTVLDAVLERLVTTLAGVLRSALEKPITCDNIGYLACDAFYRLCKVRGLASVCQLLPV
                     ERPTVLWLFQLMLKEHPIQTPVTTPWQVAYVLFGWAELAAQAPFALDEQLTSGLLGVA
                     RSWLIAASAAAVPASRFMSRLVTRDMRPSTSRLFDEHLRWLASEINRQLAHDAAHALQ
                     NLCYHLALLLKHARNEQDLQSMMPIIQVFLGAGYRILTGHARVKLLKQFGRCLLTLQR
                     GSDVLAQVLEVLENLVKIWLSADTRSRWAAAAAVAGLVRLMPAEAHSDLVVQLLDMIR
                     NTSTSDVIACQSACVLLAELARAQLVPLGDLRGLIDWTSSALTAGLERPDHLRREDQA
                     LRDAACYVFWSFARYLPSTACSEMSRDIASLLLCTALYDREVQCRRAAAAALQECAGR
                     WGDSVPCALFLADRVNFYSVADCDATFGLLTNALCATAGQQYAGEIQCYLLRYKLFVS
                     PDPLIRFRAARALVDVFTGASAAAPPERSVSTAGTSVAAISAADGTERGFARDVSTAL
                     PAVLELCWMYATGKATENTAAAHHGALCFLGALARRTPEPMTLPLDNLPLWMECAVQV
                     HTESEAEHIVRARCDLLLALLEVGHECISCNPLVPDYLLRSLEHHAAALASVARRALF
                     LYFEHNRLRSDLVSHWRQQCVHTIHLPRKRRLLVNKLQRSRSSVPDPCRYAACVLLGV
                     LVAVSGHSTDIALLKDTLQRCADAQDHASARAIVESLPLLVETQVCSDTDATRRTEAW
                     YALLETWTASLCFHITSARGDSGCWVREAALEVLPFLWQTALTGPQREALSSALVPSL
                     LFLCFDRVDSVRALARERLAQLFALADGTVPLSRDFRKPLTDAEEHIFSVFEAALAAD
                     ETPAHCVLAILDGMLWASASPGGHERAKLALKSFVQSLALASPERLLVIAAHLNKFWD
                     CPAEASAQLKRLQWPALRAYSLLPRTWRCVEFLDTHCGAKALALASVYAQRSQDPKRL
                     RGAATAAIQLRWYPAHRNIASSVVEALLQRRFSWLDEEILGQLYSCALAVIPRADNMF
                     HECCRTHETIHARCRALIHQLDALDEEPNA"
     gene            complement(<116969..>117913)
                     /locus_tag="CYME_CMF047C"
                     /db_xref="GeneID:16993084"
     mRNA            complement(<116969..>117913)
                     /locus_tag="CYME_CMF047C"
                     /product="probable mercaptopyruvate sulfurtransferase"
                     /transcript_id="XM_005535659.1"
                     /db_xref="GeneID:16993084"
     CDS             complement(116969..117913)
                     /locus_tag="CYME_CMF047C"
                     /codon_start=1
                     /product="probable mercaptopyruvate sulfurtransferase"
                     /protein_id="XP_005535716.1"
                     /db_xref="GeneID:16993084"
                     /translation="MWVSALVSPAWLRAELKRCCVLDATWYMPSAGKDAAAEFTKARI
                     PTSIRFDIDEVADKETPLPHMLPRSAEAFRECLERLRIRPRTPDPADTAIVCYARNGA
                     FIAAARAWWMFRVFGIDRVFVLDGGFRSWINAGYELETGTPSPRSGDSEAAPSSAVFP
                     LRFRRELVCSRTEICDYLAGSRRIRLLDARSRGRFRGEEPEPRPGLRLGHIPGAYNVP
                     YESLVCNEGCSLRPVSELRQIFSSCVQHLAVPSPAADANTQSPQLVASCGSGVTAAII
                     ALALHELGIPECAIYDGSWAEYGACMELPLETIETTST"
     gene            complement(120350..122838)
                     /locus_tag="CYME_CMF049T"
                     /db_xref="GeneID:16993083"
     misc_RNA        complement(120350..122838)
                     /locus_tag="CYME_CMF049T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461260.1"
                     /db_xref="GeneID:16993083"
     gene            <120384..>121466
                     /locus_tag="CYME_CMF048C"
                     /db_xref="GeneID:16993082"
     mRNA            <120384..>121466
                     /locus_tag="CYME_CMF048C"
                     /product="similar to E3 ubiquitin protein ligase Itch"
                     /transcript_id="XM_005535660.1"
                     /db_xref="GeneID:16993082"
     CDS             120384..121466
                     /locus_tag="CYME_CMF048C"
                     /codon_start=1
                     /product="similar to E3 ubiquitin protein ligase Itch"
                     /protein_id="XP_005535717.1"
                     /db_xref="GeneID:16993082"
                     /translation="MTGFLHSAKLFFLSSSQRAGLEKGEFSEVQAEWEAKLRRTMRHA
                     ERLEEGLTQVTPAWKSVIKSVRTTTRNAKVKVAKGTGRRKQVVEDSFHDVDPGYLEFV
                     QLSEEALSALESLCGRELFTGGTTLSHMLSEVRQYIEGCRTLITYIGQDVENARLEFD
                     HYYNKCEALSQRARQRRLTEAESERMIRNRVKLERARDRYVARKRNYVDSARAMYYKY
                     PPLCRAVLAALWSYQMRASEAFQEVSEMVEQHVSNNIELAKTIDVQSMAPAIAEEDKE
                     VKHDDPEIPLTSYEAATKFEKNVSEVPLPPGWEERIDPATGRIFYISHAEKKTSWVPP
                     TPPKYEKALKAPKPHIEKMTPESVRV"
     gene            <123075..>124451
                     /locus_tag="CYME_CMF050C"
                     /db_xref="GeneID:16993080"
     mRNA            <123075..>124451
                     /locus_tag="CYME_CMF050C"
                     /product="similar to ribulose-1,5 bisphosphate
                     carboxylase/oxygenase large subunit N-methyltransferase"
                     /transcript_id="XM_005535661.1"
                     /db_xref="GeneID:16993080"
     CDS             123075..124451
                     /locus_tag="CYME_CMF050C"
                     /codon_start=1
                     /product="similar to ribulose-1,5 bisphosphate
                     carboxylase/oxygenase large subunit N-methyltransferase"
                     /protein_id="XP_005535718.1"
                     /db_xref="GeneID:16993080"
                     /translation="MDWSLNGVGDDADFRARRGRYAGAAGAAVPVVAFAVPPAHLQLR
                     KNLTPNACTVPFRRKGRVLGSRRCFVVAESDYAADDDSETSYSGTTNHGYAQPGTARG
                     FGVFTRSQDSELERGRGRRQQAYRLLSDSRTFRFYDYLREAHFPKVALAEVPVDGASS
                     LKMRGLVATAAIRAGEVICRIPRRLAICLGSEGENPGLPALHLLRMMTDGEAVHKYKA
                     YFDVLPRPEMCQMTTDFYNDEELGQIAHTPTVEETRRRRQQLRDTFLQEFLRTGADYL
                     HPQVAAQNLDHMPEFQRYLWAVHLVVSRALAVRTGDEAQRYLIPLLDMINCRMDSKHE
                     LRYRIATDEFVLIAGESVRRSEEIRIPYGGGFVSNDRLIQDYGFIVERNPADLLLFLP
                     RHCVQRADLLSSEERENVRQECAAVLARQQQVLSVPSERIRAFNRAVVDAARKCIELL
                     ETAEEIQS"
     gene            complement(<125663..>126958)
                     /locus_tag="CYME_CMF051C"
                     /db_xref="GeneID:16993081"
     mRNA            complement(<125663..>126958)
                     /locus_tag="CYME_CMF051C"
                     /product="probable calcium/calmodulin-dependent protein
                     kinase"
                     /transcript_id="XM_005535662.1"
                     /db_xref="GeneID:16993081"
     CDS             complement(125663..126958)
                     /locus_tag="CYME_CMF051C"
                     /codon_start=1
                     /product="probable calcium/calmodulin-dependent protein
                     kinase"
                     /protein_id="XP_005535719.1"
                     /db_xref="GeneID:16993081"
                     /translation="MSAMDNVRQVTMRHGAPAQYRGYVQKKCRTFSSTKRWMVAAGST
                     LSNYTSREAFEPTWRLNILGAQLERVGKRGFRITTTERKLEFVAPSDKEAEDWFVALS
                     QAVSRSFERDYELGSKIGEGAFAVVYDAYDKVTGEQAAVKVIRKASLDPADFALLARE
                     VHILLTVQHPNCVETYDIYDAPDAIYIVMEKMKGGELFDRIAVAGAFSERDAAHVFRQ
                     LMRGVAYLHSRGIAHRDLKPENLLTTDPTAPLSKMHLKIADFGLANVIGKGTEALMRT
                     CIGTPGYVAPEIVKHQPYTSKVDCWSAGVILFIMLSGKMPFYGKDDYEIMRRIVRAQY
                     KFRESEWAQVSDDAKELVRALLQVNPEQRLSAEEALKHPWCTSNTLSVASLSSTAGLR
                     AMQEAKRNKMKAAVKAAAQGTRMAQLAKELETIDMQPKA"
     misc_feature    complement(128324..128517)
                     /note="possible transcribed region"
     gene            complement(<130169..>132601)
                     /locus_tag="CYME_CMF052C"
                     /db_xref="GeneID:16993078"
     mRNA            complement(<130169..>132601)
                     /locus_tag="CYME_CMF052C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535663.1"
                     /db_xref="GeneID:16993078"
     CDS             complement(130169..132601)
                     /locus_tag="CYME_CMF052C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535720.1"
                     /db_xref="GeneID:16993078"
                     /translation="MERQVPCAVGSVQVGTNAPMERHSHSQVSVCFCTGLGPMYEAVS
                     RGRGTRKPQFSVHGKRRPQSRRRGPFTWLRGALPLDALLPHQELQHRQQHFRRHSFST
                     CQGMKRTVSVPRQSEQCTRLPSVVADATGQRTRATWTRPQRSSHKSIVVCFLDGKRTF
                     RKASRTGFFNPSLMFSQTESRIKTWWTQTLIQIRSFTDEVSKRFADARRRQPVDPAAA
                     NRPPLYPDGLYVLLGMWILTYLVVRLGQFVCDLLAFIVAIVVSVFYVPGQARQRRAKK
                     TAELQVDAATSADGGRGAIPEDSASMNTLGSSSAARERQRLQAIAARETTEAESAEWI
                     NAAIRKMWRLYNTELSVTGKMILQDLIDANLKNNRPPFVQSVTVERLELHERALRLPS
                     VEKLPTRSDGDLVLLVGVRYDGDAQLHLRVNFGVTQRASFAVPVVVSGLDIDSQLWIR
                     ARMIPEAPYLGDVNVALLRRPLIDLQLRPFKVVDVMEIPGLRPFLRKLLTCDIPDLFV
                     LPRRMPILRLSSLEQLQRYARMGAWDGSRNDPCMGALTKARFRRRSESAAPGRDDLST
                     DDLSDAGESEPDILDDPSLDDGLLIVMLYGARNLSGTTSLGLSNPFCYISVDGITVRS
                     KPDKSTSARSVRGQPIWNQLFELPVRNPNTARLHIEVADRYGLKHRIIGAFSMAVSAL
                     RDGQRRDMWVPLRGSVAAESRLHIGVQYQAYVDADNDDLLLLSSSSSSQALRSKAPNI
                     DSIVSMTSLTRMFPLGVPRSSSTSAASAHTVDRDVHVDEANEQGVQASNHTTEENVTP
                     VQVEVIQPPEKR"
     gene            <133229..>136498
                     /locus_tag="CYME_CMF053C"
                     /db_xref="GeneID:16992950"
     mRNA            <133229..>136498
                     /locus_tag="CYME_CMF053C"
                     /product="similar to hormone-sensitive lipase"
                     /transcript_id="XM_005535664.1"
                     /db_xref="GeneID:16992950"
     CDS             133229..136498
                     /locus_tag="CYME_CMF053C"
                     /codon_start=1
                     /product="similar to hormone-sensitive lipase"
                     /protein_id="XP_005535721.1"
                     /db_xref="GeneID:16992950"
                     /translation="MANRESSDGPFVAYTLALTQSVRSSLVLVRDAAAELAVRIGCLL
                     CEPSDGASGNANSGLSPLKKHSRNYATAQRVQREAESLKLTCDAIFPEVEQLLAVVAG
                     EPSLSLSDAALSVDAKDFANCSVLHATGNVEAAGCGCCGARRRSPLVGRGWGGAYGCP
                     GNGYESLLCILWRLLQRLEVETALTNQEAAERRARQRSLRRSPRLVANSGYGLSGGAD
                     ERPSQATAPSVNWRELERRWLAPHSSANQLTPLGRLTGHHLQLKQFYAMIHLACRCVR
                     QSDVGRTLFVPMSAEFDHRVWAPVVKLDSFQGVHFGFQYSREMRTVLRIVQVIRSAVR
                     RAVASEYFRRSAFARKLAFFSWGWFYIHMALLENYGYSTSMAQQIVEKLASAFGASLS
                     TVERPAGRREAADTPEVAARSPVVSLDEARMFFNLSEDPLFLGFALIRDKDVALDQFF
                     EIDDAADALKRAPHKNAQHRVQRSVDHSTSLSRGDAEMSPEAAASGTRLKLPAALHGP
                     LKARLLSSVVRCVQIKSQRTTAPNTAEHSASGTATCASAAESFSPAPMTDCWQRPHEM
                     DETIDASADATAAAMSPDRFCQHADDPWRASNLTVSATEPVAATDASPRRAGAAATGP
                     DSESGSSVWAADSAALQRDTADADGALGNAAAAAAAAAAAAAAASNGIDRSPRALSTT
                     PAEADAGDPPQSSSRAARSLRRERSGSLLASAISSSMRSIGARIDSLLRHQADEGLAR
                     SLIVFFHGGGFIGQSSLTHTSLLKQIAHDIPDAMVVSMDYRLAPEYPYPTAVNECFHF
                     YIWALENAHLLGTHAERIVVAGDSAGGNLAVVLTILLIQHGLRLPDGLVLAYPALNLT
                     LQWSPSRLLSAFDPLLSIDLLELILQSYVPADVDASRDPYLSPCIAASDTLLEAFPPV
                     YMVCGAYDPLLDDTVEFAHRLRLVKRDTHCDRDAVRLRVYEGMPHGFLSMSSAIHEAS
                     AAVSQVTLWMSELLQVSWAGDHERSCRSAPSSPRLPLPAPSGADASLSTSTDSLQHTE
                     RSGVDLQASMDTTKAAAAPATTAAALRQAMRELSVAFSVSESSDSDSDEDRAEQTPRF
                     A"
     gene            complement(137443..137523)
                     /locus_tag="CYME_CMF054R"
                     /db_xref="GeneID:16992942"
     tRNA            complement(join(137443..137501,137510..137523))
                     /locus_tag="CYME_CMF054R"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:16992942"
     gene            complement(<138958..>139812)
                     /locus_tag="CYME_CMF055C"
                     /db_xref="GeneID:16993076"
     mRNA            complement(<138958..>139812)
                     /locus_tag="CYME_CMF055C"
                     /product="GTP cyclohydrolase I"
                     /transcript_id="XM_005535665.1"
                     /db_xref="GeneID:16993076"
     CDS             complement(138958..139812)
                     /locus_tag="CYME_CMF055C"
                     /codon_start=1
                     /product="GTP cyclohydrolase I"
                     /protein_id="XP_005535722.1"
                     /db_xref="GeneID:16993076"
                     /translation="MPSCQSPKENCDLSVVQRVASASVDWRRVPQASAPADAVNGDEH
                     ASMKPAGVFPRSRDSGSAVENGPDVAPENATENVRARKLGGSGSYVTSANHGSDEARC
                     QRIAEAVTVIMQELGVDPVRSNLRDTPERYARALLEFTSGYALSPEETLSDAVFSETY
                     SDMILERDIDIWSLCEHHMVPFFGKCHIAYIPQGRILGLSKLARVAEMYARRLQVQER
                     LTRQIADCIEEYLQPRGVAVYIEATHLCMSMRGIRKTDARTTTITTRGVFATDRSLQE
                     QFLDLVKR"
     gene            complement(<141619..>143505)
                     /locus_tag="CYME_CMF056C"
                     /db_xref="GeneID:16993075"
     mRNA            complement(<141619..>143505)
                     /locus_tag="CYME_CMF056C"
                     /product="NADH dehydrogenase type II"
                     /transcript_id="XM_005535666.1"
                     /db_xref="GeneID:16993075"
     CDS             complement(141619..143505)
                     /locus_tag="CYME_CMF056C"
                     /codon_start=1
                     /product="NADH dehydrogenase type II"
                     /protein_id="XP_005535723.1"
                     /db_xref="GeneID:16993075"
                     /translation="MPLLYGASCSDMDEGYLITGFVSSVHALGRQRQVPLVSRKPNTP
                     NFRPQRSARVVQRTHKLRGLRLCEGERLVKTDEKPAVQPDTQPLKPGDGKESPAPPSP
                     PPPVETRGRRRTYLGLVWDRTLDTFEDALLHLRRQFFWQGEFLSSSGRPKPRLVILGT
                     GWVGHAMVKIIDIDKYEVIVISPRNYFLFQPMLPSSALGIVEFRSCCEPILRANPFII
                     YYEAEAVGVDIQRRVVKCRAKVRRRGALSVGSESDVGAPSLAETSQDVHALQPRFSTK
                     SNTDEIIGIREFEVPYTYCVVGVGSAVNTFNTPGAKENCFFLKEIPDARKIRSEVVRI
                     FEEANLPETSDEERSRLLHFVVVGGGPTGVEFAGELHDFLVEDAVKYYKKLLKYVQVT
                     LLQSGQSILTQFDKSLQDRALQNLRDAEINVRTGSRVVRITETEIYLQDGAVIPYGMC
                     VWAAGVGPQKLVTDLIESIPAQTTFKKRQLVVDDWLRVIGAEGVFAAGDCATNLHEPL
                     PATAQVAGQQGAYLARLLNREYCLDCDIPERTEYTRTWIDRARFAKPFQFLSFGLLAY
                     IGRERAMAQIEMGDTSVKLSGTLTYLIWRSVYAVKQVSMRNRILITFDWIKAAIFGRD
                     ISQF"
     gene            complement(<145107..>146489)
                     /locus_tag="CYME_CMF057C"
                     /db_xref="GeneID:16993074"
     mRNA            complement(<145107..>146489)
                     /locus_tag="CYME_CMF057C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535667.1"
                     /db_xref="GeneID:16993074"
     CDS             complement(145107..146489)
                     /locus_tag="CYME_CMF057C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535724.1"
                     /db_xref="GeneID:16993074"
                     /translation="MLDTKQRERSGQAFVFHTWACSVATREQVTASARRCRTLQLQSR
                     RLGVASAPRQQLAPEARWGSHRCHLGFHKLSTRSARRLRVSASPLAPLQLRAATPAPE
                     NDPDASEAKTMPRRRASDSGSSSSSSSSPRARERRFRNRDSADEADGDDADLEVDEVD
                     DDDDEELDAEQELLADITERYETWKSQAQRKSLSAMRGSEEVFFDAYDLNERFRPDYW
                     QRLRVILQPEEAFANIFKLEGVLSANAHAIEYASWKQLAEELDKEPPDEDIVQQTYHL
                     RPERIVQGVLRWTDSWREVLSIVYRQQEIYRERFLAEQHRPTRGLLRWLELLQRYDMP
                     CAVYSRLDRVSVEKALTDMGVADFFKERITAESEVETAIQFLLVACVKMQRAPQKCVV
                     YEDTPKGILAAHEVFSKAIGLVGLFPAFDLRLADLTVEDFDDLRVMNVRRLFADQEEP
                     APQFEYERRW"
     gene            complement(<147823..>149127)
                     /locus_tag="CYME_CMF058C"
                     /db_xref="GeneID:16993073"
     mRNA            complement(<147823..>149127)
                     /locus_tag="CYME_CMF058C"
                     /product="probable zinc transporter"
                     /transcript_id="XM_005535668.1"
                     /db_xref="GeneID:16993073"
     CDS             complement(147823..149127)
                     /locus_tag="CYME_CMF058C"
                     /codon_start=1
                     /product="probable zinc transporter"
                     /protein_id="XP_005535725.1"
                     /db_xref="GeneID:16993073"
                     /translation="MLGEEQPLLRARGPMSDATAPEQAQKLWQQQREQRKERAARDQR
                     ARRKLLFSAVLCFAFMVAELLGGYITGSLAVMTDASHLLSDFASFIISLVALQKSQRR
                     ANQLLTYGYGRAEVLGAFTSILLIWTLTAVLVLESIRRIITPEPVKGRLMFIIAVMGI
                     CINLVMMTVLGHGHGHGHAHDHHHDHFAQVNAEAESSTSEEHRSHGRHRHRQRSGNVE
                     SIEPDQAGPSESGLNRPRDQQPGHDDMRATATDDIEAPLSVADMSHRHPVSESVNVHA
                     AYLHVLGDLIQSIGVAIAALVIWWRPSWSLADPLCTLLFSVIVLYTTLRMIGDIVQVL
                     MEGTPANIRVRDVYEALISIDGVSEVQDLHIWSLSVGRTALSAKLRCDASVKDAHQIT
                     MAAEQVCLKNFGIEHATIQVNCVNLSCCPPVEHVECASPGRM"
     gene            complement(<151859..>152473)
                     /locus_tag="CYME_CMF059C"
                     /db_xref="GeneID:16993072"
     mRNA            complement(<151859..>152473)
                     /locus_tag="CYME_CMF059C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535669.1"
                     /db_xref="GeneID:16993072"
     CDS             complement(151859..152473)
                     /locus_tag="CYME_CMF059C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535726.1"
                     /db_xref="GeneID:16993072"
                     /translation="MEPALSVHKVPPSDATGNGPSYSPGELRRIPVPQHRFAALKSNW
                     LALYEPLTKELALQVRMNLKQRAVELRCSPQTPDRTALQRGYEFMQAFLLGFAVEDAI
                     ALIRFDDLRIDSFEVQDVRRLQGDHLSRAIGRIAGTGGRTKFAIENACRVRIVLAGSK
                     VHILGGHMQVRLARDAICSLILGTPPGKTYEKLRRVSARLRERF"
     gene            <153509..>158293
                     /locus_tag="CYME_CMF060C"
                     /db_xref="GeneID:16993071"
     mRNA            <153509..>158293
                     /locus_tag="CYME_CMF060C"
                     /product="similar to dishevelled associated activator of
                     morphogenesis"
                     /transcript_id="XM_005535670.1"
                     /db_xref="GeneID:16993071"
     CDS             153509..158293
                     /locus_tag="CYME_CMF060C"
                     /codon_start=1
                     /product="similar to dishevelled associated activator of
                     morphogenesis"
                     /protein_id="XP_005535727.1"
                     /db_xref="GeneID:16993071"
                     /translation="MNASSAIPAAGRAPIGCIGRAGRARASPDAMTAGAGVRSPARNA
                     DANSTYALCLRLEQTPQIAAFMKKLLWSGRSNASSFPQSLAESFLSTIGIHRSKAGAS
                     RVHTGTGSTSAYLVDASRARVYCGCYDALSPESFFHLAGKLNGKLERDEAQNGQVNWL
                     YLDATPTGFLTQHAGTAFFPSAGDAGSLGSATTTVIPLAPFRNLIVPGIDQMVELCEL
                     VYKWILGGHAAGECSCVCVLTTSGRAHRGVLARPHTVATLFVACYLLFIGLFDSGLDA
                     IEYTVRRQLKGLRRHRRKTRARALPRREDLVTAAVCEYAALFGYLIQMSTILPQHLQQ
                     LNPSELPNRAPVLLRRAIVNGEVLLGDKPAHLTLRIRNQVGDGDEVLLDERFENECAP
                     GDGIMSYRLRAVVVGDVAILLELNGCLALLAVVRHTSTLRAPVCRIRREDMDICNGYE
                     QLPLHVASDFAMDLYIEEMTSESCADEPIAVTELEQAQHVAESEIAALETAFSRAPLL
                     DPKYIARNRTMQGSLSHRRGRGAGAWRARPHVPSPFLSELRDEQSRRKLATGGEGTIS
                     LHALLQESVAEREPVGAPATHSTLDAGLDGIVARRHVSTSDDLDQAADQDWKQRCLEA
                     DSASMVESTNEEASDASSGTGVLTSSSRSSSSTDSSSTYWAKRAAQRSARRRRLDRRR
                     QQLLESETQWETSPRRMAHDMQIDEDAVAAFLLGEESQRLSPAQRSLLVQTARETLQK
                     RRELLLQSTERSMGASRDQNHRELLGDTQSEHCSSFVTSVSFIDEHAVSNTDLETAHT
                     PPRAWHQTAQEAGAAAAAAAHGPASYQASATVHVSDAALEGAQESSLSIAGATEESFA
                     FSKTRWIAGGDGALLRSSETTADAYSLSRGPCATEEPSAMRAFQVAGAGAEAFGKCAT
                     DADAQTAPGVVASMSSDRKDWKDRGSPRAPVSTRSSPRVILPVHIGASESSPPFELQD
                     ERDRLQVQAPTAPPPPPPPPPPPPPPLLDTAAFDVCPRDTESYSRDHGDRQGLANEAN
                     GMGVPPPPPPPLPATVPMANGAHMGGILGAARFARKPRRNVKQLHWNTIPPHQVPQTI
                     FSRGLHRMLDTDLENSSSEIDQMFMNRPTIEQRRMDSQRTAFDLDETADQKANAHRTQ
                     LHFLESKRATNFEIMLSKFSVDVGAIANAVIALDAAEKPVLTTENLLALRMNMPKQEE
                     LEVALHWAKQAQPKALAPQNHPETASMDPGSHADPRLDAKSDVEELLKSRAERLVYRM
                     ATSLEVLAPDSAEQATLHQRLRAKLDAAIAIRQLGHQVEEVQHLIEVVLTACRQVFES
                     DRLASVLSAILAIGNYLNQGTNRGNALGFRLSSVLKLSETRATLDRRTTLLHYLVKFV
                     SRRMPDAALFTSDLSAVAAAARVDLGELDAEIRALRLALALVRKESQDHPSDAVNGFL
                     QRETPKVEQVEQAYARMRRQLERTTTYLGGHPTSVPAPALHTGSVASLAEEHDIPETL
                     FFTLHRFMDMFDRCRAELQRLEATMQQHAKRFARSYVTQVIQQAIGRATQGSSLLATQ
                     SSPRRIAPHERKERVYAHQPEEAGKSGVASLVAGVGVSRASG"
     gene            complement(<158919..>159377)
                     /locus_tag="CYME_CMF061C"
                     /db_xref="GeneID:16993070"
     mRNA            complement(<158919..>159377)
                     /locus_tag="CYME_CMF061C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535671.1"
                     /db_xref="GeneID:16993070"
     CDS             complement(158919..159377)
                     /locus_tag="CYME_CMF061C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535728.1"
                     /db_xref="GeneID:16993070"
                     /translation="MDAGVFEQGTGNRWQSVRVCLLGMHATEPARVLRKLSSLTGIFL
                     DIVNKVRSWMSIQKLTDDPNEHRRSISEQAVEDYSVQDENSGLCVRLICWMDRVSHDA
                     QIIHHLEEVSGAACANGWSQRFPSGKHSHTIYRFKQRLPPSLLESLTRFT"
     gene            <160941..>161651
                     /locus_tag="CYME_CMF193C"
                     /db_xref="GeneID:16993069"
     mRNA            <160941..>161651
                     /locus_tag="CYME_CMF193C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535672.1"
                     /db_xref="GeneID:16993069"
     CDS             160941..161651
                     /locus_tag="CYME_CMF193C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535729.1"
                     /db_xref="GeneID:16993069"
                     /translation="MLGNSDTLEPALILTFERFVAEVDLLVKSEATVRVVARLGQVLA
                     ELGLLVLEYRRKRVLAYFKGQLPSDVYIGSLVEITGRVYTVSRRRPGAEHQPNGATFR
                     GARVPVWVFDERFVGLGAGPTGTWLSDGDATDRKGDAPTSKVIVDVLTLRTMAEGFDI
                     MAWEEVLREREFYLREYFACLAAAETLTDQTGKAPPVQQLYEGAVAVEAALRTGPAKA
                     ADGTEEVACKSLSPTAKN"
     gene            complement(<162213..>163286)
                     /locus_tag="CYME_CMF062C"
                     /db_xref="GeneID:16993068"
     mRNA            complement(<162213..>163286)
                     /locus_tag="CYME_CMF062C"
                     /product="mitochondrial general import pore subunit Tom40"
                     /transcript_id="XM_005535673.1"
                     /db_xref="GeneID:16993068"
     CDS             complement(162213..163286)
                     /locus_tag="CYME_CMF062C"
                     /codon_start=1
                     /product="mitochondrial general import pore subunit Tom40"
                     /protein_id="XP_005535730.1"
                     /db_xref="GeneID:16993068"
                     /translation="MASTFKTTAGTGAGEETHARDSYPGRDTTIRREELPSGLRDALP
                     YTSSSWWWRAIERTELPNPGAYEEINQEANTVLRPNLFDGTRFDMNLPLTPTLSTGHS
                     IEMGSTQTTPGYALSVNYITNTLIAVSRMDMTGRFNGRLFYTHTPRLISKLLVSRQPA
                     EDPAAAAAMLAAATGGAAIQPPPPTSATTTVMYDLDYRGSDYSANLKLGTGGVISLAY
                     MQSIVPSFSMGGEGFFQLRNKFSALTAAARFLTTDGIFSATVASFGPVVASYVHRVNP
                     RVSLAAELFWDTRSRESYVTAGYKFDLRSATVIGQVTSLGKVAALLEEKLSPGVSFLL
                     SGEIDHWQQQYKFGFGLQVGGTA"
     gene            <164722..>165501
                     /locus_tag="CYME_CMF063C"
                     /db_xref="GeneID:16992949"
     mRNA            <164722..>165501
                     /locus_tag="CYME_CMF063C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535674.1"
                     /db_xref="GeneID:16992949"
     CDS             164722..165501
                     /locus_tag="CYME_CMF063C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535731.1"
                     /db_xref="GeneID:16992949"
                     /translation="MPGSEARNLAGPPHSSGPETQVPVGAPANEDSPERHQEPVLNAT
                     QAAGISFGVFATTTLTSGYLVYRLRRRELASSPESSSGLQPLPKTVDAWTERGTLVGD
                     TAAVQAAAVRTASLALLSGTLLCASFGYIGWRLLLWYTGTNDLENFATALKQPNSMPK
                     RLRRSLEEGSLGRSLRNWYASMTTETFEDAGRSGIRSIEPAATGAVDTGTMTWLQRVA
                     NRARRSGLILWFQKRMHGPSTEANGHSRPPRETSPSNPTSP"
     misc_feature    complement(166290..168173)
                     /note="repetitive element"
     gene            <169513..>170499
                     /locus_tag="CYME_CMF065C"
                     /db_xref="GeneID:16992943"
     mRNA            <169513..>170499
                     /locus_tag="CYME_CMF065C"
                     /product="mitochondrial ribosomal protein L3 precursor"
                     /transcript_id="XM_005535675.1"
                     /db_xref="GeneID:16992943"
     CDS             169513..170499
                     /locus_tag="CYME_CMF065C"
                     /codon_start=1
                     /product="mitochondrial ribosomal protein L3 precursor"
                     /protein_id="XP_005535732.1"
                     /db_xref="GeneID:16992943"
                     /translation="MSTGLRHCIRAVGRLVRTLCTQAETAARSSGPHVPPLRLRLPPP
                     NTEPVAELYGRFVRRIGVVARKIGMLPHWDANGVYRCVTVLHIDNNHVIQVKQLPSNA
                     SNLKGLSEWSVQIGAGSMRPYQAKKPHRYHCAYAGTDVKEKLVEFRVAPAAAACIEPG
                     TPITARHFIPGQYLDVIGTSIGKGFQGAMKRHGFGGLPASHGVSLTHRSLGATGQRQD
                     PGRVFKGKRMPGRMGGERTTVQSLRLERVDCKRNLLFVSGPVPGHTGNWVLVRDAVKK
                     SGLKWWAELPHLPPFPTFVADPQQQVEHEAPADWFAAPRRNVWLQEVLSARA"
     gene            complement(<171508..>173853)
                     /locus_tag="CYME_CMF066C"
                     /db_xref="GeneID:16992987"
     mRNA            complement(<171508..>173853)
                     /locus_tag="CYME_CMF066C"
                     /product="flavin-dependent tRNA:m5U methyltransferase
                     trmFO"
                     /transcript_id="XM_005535676.1"
                     /db_xref="GeneID:16992987"
     CDS             complement(171508..173853)
                     /locus_tag="CYME_CMF066C"
                     /codon_start=1
                     /product="flavin-dependent tRNA:m5U methyltransferase
                     trmFO"
                     /protein_id="XP_005535733.1"
                     /db_xref="GeneID:16992987"
                     /translation="MFLAELSFSRVFHSGATKWCESRSSRQLELQTTRSTNGWLCPSS
                     GRHLFRQHRTGLRASQQGVEEGSSSRPSQAPSPLPAPSLPAEHFSNQAQSMRSSRGGP
                     LYPEGEYDVIVIGAGHSGCEAALASARLGARTLLLTLNLDRIAWQPCNPAVGGPAKST
                     LVHEVDALGGWIGKIADRTYLQRRVLNRGKGPAVWALRAQTDKREYSAEMRRVLEEAE
                     NLEIREGMVYDLALGPNGEVVGVETYFGGAFRARAVVLTTGTFLGGTIWVGNKSMPAG
                     RAGEPASFGLTETLQRMGFETGRLKTGTPPRVDGRTIDYTVMEPQPSDPEDHWFSFDP
                     AEWNPRSDTMPCYLTRTTAETHRIIRENLHLTPKYGGFMCSTGPRYCPSIEDKIVRFA
                     EKESHQIFIEPEGRTIPEVYVQGFSTGMPESIQLAMLQSIPGLERCRMVRPAYSVDYD
                     YLPGWQVYHTLHSKKIEGLFLAGQVLGTTGYEEAAAQGIIAGVNAAQFAKRGSDADLV
                     MLDREDSFLGVMIDDLCTKELDEPYRVLTSRSEYRLLLRADNADERMTPLGRSIGLID
                     DRRWNIFQEKLKRIERQRMRLETTMLRGDSEEALLIQQQCDVGKIAANVSLADLLRRP
                     RLSLSVLKQVGVLADSEPNMTVFDWETLETRIKYQGYIDQQQETVRRIKAEYGRKIPD
                     DIDYYSITQLSRESMDRLSKIRPATLGQATQVGGVKPADILILLVWLERERRRAAETA
                     SVGKRGITEPDAASATRDAAATDGGERISTIQSMQVGASPP"
     gene            <174551..>174898
                     /locus_tag="CYME_CMF067C"
                     /db_xref="GeneID:16993067"
     mRNA            <174551..>174898
                     /locus_tag="CYME_CMF067C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535677.1"
                     /db_xref="GeneID:16993067"
     CDS             174551..174898
                     /locus_tag="CYME_CMF067C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535734.1"
                     /db_xref="GeneID:16993067"
                     /translation="MDTAGKQDIAASVGPKRRCIDAQRIFSGASVSRDAWRAQRDTEG
                     GCTSAEDDALGSVCSLSIADRKRSLSETRGCWRRSPRDSASTCFCMRLAPPRIHSDDK
                     CSQAAWYPQARWI"
     gene            <175380..>178580
                     /locus_tag="CYME_CMF068C"
                     /db_xref="GeneID:16993066"
     mRNA            <175380..>178580
                     /locus_tag="CYME_CMF068C"
                     /product="2-oxoglutarate dehydrogenase, E1 component"
                     /transcript_id="XM_005535678.1"
                     /db_xref="GeneID:16993066"
     CDS             175380..178580
                     /locus_tag="CYME_CMF068C"
                     /codon_start=1
                     /product="2-oxoglutarate dehydrogenase, E1 component"
                     /protein_id="XP_005535735.1"
                     /db_xref="GeneID:16993066"
                     /translation="MLRVVRALNPILFRSLSPTGVSKRLLGLTGCNVLGARLLSTASA
                     SSSSDAATGAAAAAAAATAAQTTHRQPTLAESGLSSAEDFLNGTNANVLEEMYELWLR
                     EPSKVHGSWQAFFRNIETGAPLGQATSLLSRPQRERISRAAPSVTAGRDVLEVARDTV
                     RVMSMIRAFRHRGHLVANLDPLNLSQASGHVVAGAHEESALSPARVRYDLDPVSYGFT
                     EADMDRIFYVGGDLPGRPLRTLREIHSMLKNAYCGTIGFEYRHMLSKEEKDWIASRVE
                     VFGPMFRFTPEEKRQIWNFTAEAELFEKFLSYKYATAKRFGLEGGESIIPGIQAMLLR
                     GSELGIENVIIGMPHRGRLNVLAQVVKKPLEQIFHEFNPDESRTRVYLAGGSGDVKYH
                     LGTSSDRTLANGKQMHLSLVANPSHLEAVDPVVVGKTRAKQFFTYDVDRRRTMALLLH
                     GDAAFAGQGVVAETLELSDLHDYTIGGTVHVIINNQIGFTTDPKHARSSPYPTDVAKC
                     VGIPIFHVNGDDVEAVVHVFRLAIEYRQRFRKDVVVDVFCYRRHGHNELDEPSFTQPL
                     MYKKIAAHPTILQLYTHRLVNEQIVQPSEVQQMRDQHMRRYEISFRNAPNWKPRDSDW
                     LASHWKGFKSEFQLSPIRQTGVDRDVLMRVGRALCRIPESLHIHPHLKRLLEHRKQML
                     EGEIGIDWALAEQLAFGALMCEGTHVRLSGQDSERGTFSQRHAALIDQDTEERYVPLD
                     HIEGDPPGQFRVCNSSLSEYAVLGFEVGYSLESPRALVMHEAQFGDFMNGAQVIIDEF
                     IASGEKKWRRQCGITMLLPHSFGGQGPDHSSARLERFLQLADDDPDEIPAELGMDNRM
                     QIQRANLQVVNATTPANYFHVLRRQIHRDFRKPLILLTPKELLRLPECRSPLADFLTG
                     TRFHRLIPETDPEIATGEKTRRLIFCQGKVYYELVAERKKRQIRDVSIVRLEQISPFP
                     YDRVAETLSAYPKAELVWCQEEPKNAGAWFYVQPRIRTTLRGLIDEAHGKHRVVAYAG
                     RKPAAAPATGIYTIHVAEQKELIDQALSDEPLPVTV"
     gene            complement(<178541..>181252)
                     /locus_tag="CYME_CMF069C"
                     /db_xref="GeneID:16993065"
     mRNA            complement(<178541..>181252)
                     /locus_tag="CYME_CMF069C"
                     /product="chromosome assembly complex Condensin I, subunit
                     H"
                     /transcript_id="XM_005535679.1"
                     /db_xref="GeneID:16993065"
     CDS             complement(178541..181252)
                     /locus_tag="CYME_CMF069C"
                     /codon_start=1
                     /product="chromosome assembly complex Condensin I, subunit
                     H"
                     /protein_id="XP_005535736.1"
                     /db_xref="GeneID:16993065"
                     /translation="MRGRRAEHQDKSQRSEASEPEHQHRAPTSLSSGEAQPTERASSS
                     FLALEDSLCWNDDARERQQARVARQSKNTLRTGLSLRSPQARRGLDESFLAAAEPDAS
                     VKKLSDPELLQLYATTIRLCAENRVNAVNSWQLNLIDHIAAVAFRSEGSHDAQRGRAP
                     RHSVQDDLTREALDTNFALAGSTIDAGVKIYAYRVDSVHNNAYRVLNGLAQHAADEDE
                     SPEETATDSATVAGDEEPAEATPSSRSRQRSKLVKCGWGEATLESNPEHLTLQSLEEG
                     CSIDPLFMKLSELFDQSGSQELLVRVLDLLADGTMALDAEEHAEAVGDASHPDDQDET
                     AADPYIEIAAELFPNAMLAWTQRGQKALCPNFQRLFHQLENDAAEAWRTAGTNIASGE
                     VGLHGLVPGTSAKEGHLFPEDDMFGPPRDYGDGFEHMELFPSSVATAYEAVPALSGSA
                     DASDAVSDTESASAAVAAAAAAAAAAAAAATHDDDDDHEDDHDDHAALRLAESHASSS
                     GGGGSDDALHTSLFGSAAMAPGCADAFQLYLNLFRNGQAAGSLLRAIPRELFSSWAGP
                     EHWRPPHAAGLLAGQPHPSSAKRPRPKAGQQQQQQLDWRKPVSDPAFDNKFQVCRRRG
                     VTQLSAAVLERHSEQRTTLPPDHQYTIDALMRLFTQPSCSIMVAAARPHASRDNARSG
                     AGAGAGASASAPYTDTNLQALQTELDWRAFEDENFCAPLERSSSQLSTADAESSDTEL
                     ETAFHALDLVSDVDALGCIDARHLVPLVDAPAAVERIDLAHATRAKRVDMHLLKNVLW
                     EVIQRHLATHCAETEASCENPGIRPGNETRLRALLPEIWPRLGQDLRSEVSLSYIFIA
                     LLHLANERALILESCRPLLDDMRIASGTSSSASSFQTVTGNGSSLSA"
     misc_feature    181615..183233
                     /note="possible transcribed region"
     gene            complement(<183468..>186350)
                     /locus_tag="CYME_CMF070C"
                     /db_xref="GeneID:16993063"
     mRNA            complement(<183468..>186350)
                     /locus_tag="CYME_CMF070C"
                     /product="probable mannosyl-oligosaccharide glucosidase"
                     /transcript_id="XM_005535680.1"
                     /db_xref="GeneID:16993063"
     CDS             complement(183468..186350)
                     /locus_tag="CYME_CMF070C"
                     /codon_start=1
                     /product="probable mannosyl-oligosaccharide glucosidase"
                     /protein_id="XP_005535737.1"
                     /db_xref="GeneID:16993063"
                     /translation="MRKRLLSRRQSRCCARRYAAYLVALALVLVFGAFQQIETAVARA
                     TAHRNGTSLRTSSEREPVQTKPTLDPHTMSSLVPGVFAGYRRPVPHSPVLGIMWYPAD
                     EPFESVRLRLECGTELDAAGPLRYGWLQHNGRNYGVRHIEERGWHLNITHVAHTENLN
                     LLQPDAQLSSEQQPLRSPEFSVRIQGTGQERRTVSFIVYWTAQHDEIDPERLQESAAR
                     GMEPPTLQHCSSPSITVASSNEVHLECGPDHDHRWRIVAVQGLPERSQWRQRRHRRRR
                     QRASASRPVSAEILRELPDPGRIYYRKGRVNVGATTEVKSMVESWLRESYDHQRTRLR
                     EFYEKHEQLPDTAFRGADVFKDAAHARETPTAAPFPIITRIEDVDARARREVNADAEL
                     EPDAQHHSGIDDGLPSNLLVVQITVQTPFDIMITSSARMDASALSVLLEQADSRFRER
                     FQQLFPRMHRGDFGSAQIAQARAALAGLLGGVSYFYGSFIAGENTQDRGSDQLRVSPP
                     RALVSAVPSENKFPRGFLWDEGFHQLLIQRWDPELSLICLDSWLGFMQPSGWIPRELA
                     LGIEARNRFPRELASLLVQSEKVANPPTLMLPLYRHWQLLQDTFPVLELETFSSLCSQ
                     GGDGSLSDYAAMVLNQSVGDCKAVAQTTNTARLVSHLGFRKMKQYIRWLNATQKNHGW
                     FGRHLTTLLAQDGGYPLTLASGFDDFPRSTDPSPYDAHVDLLSWILDGVRRLLVWRRT
                     AGDLAEASAVSPPELGALEAVLQQRLYEVHWNADAGMFCDAGPRGNSSTSIVDTWRHH
                     CHLGYPTLLPLSLGLLPVNATSTGALLKAVADPRQMYSDFGLRSLSAADPFYMRGDRY
                     WTGPIWVPMNYLILAALREKYARMPGPYQKLAQQLYERTRNAMIQTILREHQRTGFFW
                     EHYDPETGKGGGGHAFTGWTSLLVLLMEEDFRGVIVIDETGTVLKS"
     gene            <187169..>187510
                     /locus_tag="CYME_CMF071C"
                     /db_xref="GeneID:16992948"
     mRNA            <187169..>187510
                     /locus_tag="CYME_CMF071C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535681.1"
                     /db_xref="GeneID:16992948"
     CDS             187169..187510
                     /locus_tag="CYME_CMF071C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535738.1"
                     /db_xref="GeneID:16992948"
                     /translation="MLPMRNDTGTLPQKHNRLQFDGGFSICMHQRCAKRRTFVASRKH
                     GMSGCAFTVLLHQRFRASAPATVRSLSQVLAIQLPRMGLSVKFGLFRIAFSQWKPNLD
                     VPDICATAVPL"
     gene            complement(<187545..>189315)
                     /locus_tag="CYME_CMF072C"
                     /db_xref="GeneID:16993062"
     mRNA            complement(join(<187545..188540,188626..>189315))
                     /locus_tag="CYME_CMF072C"
                     /product="glutamate decarboxylase"
                     /transcript_id="XM_005535682.1"
                     /db_xref="GeneID:16993062"
     CDS             complement(join(187545..188540,188626..189315))
                     /locus_tag="CYME_CMF072C"
                     /codon_start=1
                     /product="glutamate decarboxylase"
                     /protein_id="XP_005535739.1"
                     /db_xref="GeneID:16993062"
                     /translation="MPLHKTNVEKGGAKRFQHIDTSSLAFETGFASFALEEFPKYQLR
                     AEPMPSAVAEGIITQELELDGNPALNLASFVTTRFDETTHKLCDRMLPVNWIDFDEYP
                     QTVEIHNRCVNIIANLFHAPLEEGQQAVGTSTVGSSEAIMLAVLAMKWRWRAARKAAG
                     KDYARPNMVMGSEVQVCWEKATAYFDVEPRYVPLHDDVYVMNPEKAIELCDENTIGIC
                     GILGTTYTGQFEDIATLDALVTQMNEQKGFDIGIHVDAASGGFIAPFCYPNLRWDFRL
                     KNVRSINVSGHKYGLAPCGIGWLIFRSAAYLPEELVFHVNYLGADQASFTLNFSRGSA
                     QIVASYYLLLRLGRRGYQNLMHTLKELASYFATRITEDGRFRLLSDNESLPLVAFAIP
                     DDQRTKLGFDEFAIAGELRKRGWIVPAYTLAPNLQHQKLLRVVVRVGFTRDRADMLVQ
                     DIRAAYDHLVAMAGLLNLFGQGLAVDDTASTKKPESEHTATALGKMLHGNKSLQEHAE
                     ELRRTHDLPGARHLIHMQNWGTIHAKEGTKDAEPRRSPVDRHQRHKKRSGAVC"
     gene            <191267..>193609
                     /locus_tag="CYME_CMF073C"
                     /db_xref="GeneID:16993061"
     mRNA            <191267..>193609
                     /locus_tag="CYME_CMF073C"
                     /product="probable high-affinity potassium transporter"
                     /transcript_id="XM_005535683.1"
                     /db_xref="GeneID:16993061"
     CDS             191267..193609
                     /locus_tag="CYME_CMF073C"
                     /codon_start=1
                     /product="probable high-affinity potassium transporter"
                     /protein_id="XP_005535740.1"
                     /db_xref="GeneID:16993061"
                     /translation="MRVAARRGTPRVTHKTRVDDRYWACPLNNARSLRPVQVWQRSAL
                     NLLAGDWKSFSSSSTHERHHMSSEESGESVTHKDGAEEDPQELDDPGTVEACHSRTTK
                     IQYRKTLLDSRRRSTSRSGALSREISRENVLEEALPSPSVDAYRYEPERLQGWHLFLR
                     TLQAVGLIYGDLGTSPLYTISSLYDGNVAPSEFTILAGASMIFWLLLLIPSIKYAFLV
                     AMADHNGEGGALAMIGLMRQRRLSGRWARLAVIIAVIGAGALVADGILTPAITVVSAF
                     QGIQVGSPSFPTGAVVGLSIGVLFLVFLGQFLGSSRLGITYGPVLVVFFVAQAMLGMY
                     GITKYPAIFKALNPYYALKGIGVYWNDGKVGFLKIADALLCVTGSEAMYADMGHFGRL
                     PMRLGWFTIVLPSVLLSYLGQLALLASNPSLAETAGNALYFYQAPRSVLWPLIVLTTL
                     AAIVASQAIISGAFSIVSQAISLDLLPRMHIKRTDWRIYGQVFIPEMDLVMGILTVAV
                     TAGFQTSNALTSAYGVAVTTSFITTTCLFVIVLVFVWKQRFYVWLSYLAVFGLVDLLL
                     WSSAITKFPTGGYIPVIISTVFILAMLLWDWGTKREHEYYERKLRVWKAQQSEGIRQD
                     SSPVLKGTFVFLAGLQHGVPYSFQVFVSKIGVIPQTTIFVTVRNVPVPFVDDHRRFVI
                     VEEAPGRFRARIYVGYAQSIRSLMESLREVPAAFFHESFGEKVVFVKGYTDILVDSQR
                     HWLHRLLVYCYHYLKTIAASVDSELGIPRDRVEIGMPILL"
     misc_feature    complement(192554..195065)
                     /note="possible transcribed region"
     gene            <195491..>196579
                     /locus_tag="CYME_CMF075C"
                     /db_xref="GeneID:16993059"
     mRNA            <195491..>196579
                     /locus_tag="CYME_CMF075C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535684.1"
                     /db_xref="GeneID:16993059"
     CDS             195491..196579
                     /locus_tag="CYME_CMF075C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535741.1"
                     /db_xref="GeneID:16993059"
                     /translation="MTLRGRFPSDVWPGRNRFYCRGRCISGPDPWGALLTFALIAVAT
                     GLFLAIPVPFLLENYVRTGVAVLATTLPLLVVTLTSFFLTVFDDPGILPRQSVDLFAR
                     RIRRNAPLLRKKEVYYDGQRFVLKYCETCQLYRPPRCSHCSSCNNCVERFDHHCPWVS
                     NCVGLRNYRTFFIFISSCLVLSGLVVAYTILYLVDVSNQKVSIGASSTGFAGFARSLS
                     NGPTAASLVSLIIALFGVVFTGALTVFHTVLIFTNKTTAESFKYTFRGHASPFQPKGL
                     KNLAKVLCSRKPPSKVKVNAHIDPKFLEMILIDPRDLEAAAQNMELDLSWYHPLDLQR
                     APASYKYDRVILPVPNSARTSAVQQQGE"
     gene            <198261..>199046
                     /locus_tag="CYME_CMF076C"
                     /db_xref="GeneID:16993058"
     mRNA            <198261..>199046
                     /locus_tag="CYME_CMF076C"
                     /product="similar to dnaJ protein"
                     /transcript_id="XM_005535685.1"
                     /db_xref="GeneID:16993058"
     CDS             198261..199046
                     /locus_tag="CYME_CMF076C"
                     /codon_start=1
                     /product="similar to dnaJ protein"
                     /protein_id="XP_005535742.1"
                     /db_xref="GeneID:16993058"
                     /translation="MCVRSNSAIAGRRVSRWVLLITTLLFLVVSQPPDWLGRQTQQLP
                     VSREPDWSSSLRSTAALLRVSSWLPRVALAEAAQSYYTVLGVSRDATEREIKRAYLKL
                     AKRYHPDKNRGDKKAERKFRLIARAYEVLSDTEKRRVYDQLGEEGLRQQEQGGSQTGP
                     YQGQSGQFQQFFFPGGGPFGHQHGSNFRFSFQDNGGRAGGAFDTGFPFEDLFNEFMGS
                     NPGGSRQRRTFQQRRRPGGYQRCEETKICSNGRCQTRITCSTI"
     misc_feature    complement(200459..201238)
                     /note="possible transcribed region"
     gene            <201390..>202637
                     /locus_tag="CYME_CMF078C"
                     /db_xref="GeneID:16993056"
     mRNA            <201390..>202637
                     /locus_tag="CYME_CMF078C"
                     /product="26S proteasome ATP-dependent regulatory subunit"
                     /transcript_id="XM_005535686.1"
                     /db_xref="GeneID:16993056"
     CDS             201390..202637
                     /locus_tag="CYME_CMF078C"
                     /codon_start=1
                     /product="26S proteasome ATP-dependent regulatory subunit"
                     /protein_id="XP_005535743.1"
                     /db_xref="GeneID:16993056"
                     /translation="MGSTTAVLPVGNADGSLTLTKHTATEKESRTLALEDAFLRLKRL
                     QRHYELLCIQEEYVKDELRHLQREFVHAQEEVRRIQSVPLVLGSFLEAIDEHYVIVSS
                     TTGANSYVRCLSTVNRELLKPNATVALHRHSNALVDTLPPESDSSIAILEQSEKPDVT
                     YADIGGLDTQKQEIREAVELPLTNPELFLSIGIDPPRGVLLYGPPGTGKTLLAKAVAH
                     HTTAAFIRVQASQLVQKYLGEGPRMVRDIFRLARENQPAIVFIDEIDAVATKRFDAQT
                     GADREVQRILMELLQCMDGFDQQDNVKVIMATNRADTLDPALLRPGRLDRKIEFPVPD
                     RRQKRQIFQVITGKMNLAEDVDLEEFVSRPDHLSGAAIAAICQQAGMLAVRNNRYVVL
                     HKDFDIAYKENVGKDETEFAFYR"
     gene            complement(<203149..>204072)
                     /locus_tag="CYME_CMF079C"
                     /db_xref="GeneID:16993055"
     mRNA            complement(<203149..>204072)
                     /locus_tag="CYME_CMF079C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535687.1"
                     /db_xref="GeneID:16993055"
     CDS             complement(203149..204072)
                     /locus_tag="CYME_CMF079C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535744.1"
                     /db_xref="GeneID:16993055"
                     /translation="MPTRHKVRRKDQGHKPSALTRLQSQLEARLRAAHFRYLNEQLYS
                     LDSHEVFQLFLKQPELFALYHKGYQEQVAKWPLNPTQVCLELLKRRIHQFHRMRGTKA
                     HPLNTTFNAQAFSIVDMGCGEATIAASLDSRLANSWSARNGFTVEVHSYDLVAANELV
                     TACDLARGTGLPNDCADAVVFCLSLMGPNYGAMVKEGLRLLRCDPTRSGLLLIIEITS
                     RFQSRAETRDTPGARVQLQRGASTTASTMSSSVEADFVVALESLGLRLQEHRQLHDYF
                     TLFVFEATESAARRIHIIEMPSLKPCLYKKR"
     gene            complement(<210077..>211864)
                     /locus_tag="CYME_CMF080C"
                     /db_xref="GeneID:16993054"
     mRNA            complement(<210077..>211864)
                     /locus_tag="CYME_CMF080C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535688.1"
                     /db_xref="GeneID:16993054"
     CDS             complement(210077..211864)
                     /locus_tag="CYME_CMF080C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535745.1"
                     /db_xref="GeneID:16993054"
                     /translation="MSSFTESLAQYREPVGSAGDSVDFLLNKRKLPSTAIERVPGVAE
                     LEVMISGSLDAPGSARSGRQQDQGQELARSLQSANFLVPKAVLARGSGESFSPSLLSR
                     LKFGRSGASPMDFSPVFSNFPHVKPQLLERDTPEAQAIRRKLLRGAQVLIFQAGYSGK
                     RFIFEHLKELGVKVSILDGPDSWAKCLVDEDVIESYIELDFTDYNTLFERAVDAILDS
                     GITFDAVATFYEDAVAVVARLAEALNLPGNPSAACQAARNKYVTREIMRQHGLATPKC
                     YRITDVVDLEPAGQHVGFPAILKPAFGAASMGVHKVSSQDELVDTFRAIRATMDVHLD
                     TIWTQGTDLLLEEFYDGDEFDVDALMSKGEVVYASLSDNWACWEPWFQETGMNIPSLY
                     PEEKQAELKAFASQTLRALGFTDGAFHVEVKYTSRGPRLIEVNARMGGMCVRDANLRT
                     WGVDLVEEHIMTALGIPIRPRMPPEPLVCFAQAAVNAPYSGIVERSDWLEGLDKYAHC
                     RLKRYLAKAGAKVTGPEDGMPDWVAEIIFEGPDVSELLREMREAVQSLPVPIRPFKED
                     ARRGWFFPDFAYPFVRPEVHAVSENSANN"
     gene            complement(<214378..>215793)
                     /locus_tag="CYME_CMF081C"
                     /db_xref="GeneID:16993053"
     mRNA            complement(<214378..>215793)
                     /locus_tag="CYME_CMF081C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535689.1"
                     /db_xref="GeneID:16993053"
     CDS             complement(214378..215793)
                     /locus_tag="CYME_CMF081C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535746.1"
                     /db_xref="GeneID:16993053"
                     /translation="MKRCWRVFLQLCKILLTRILFFHRAGLFTHDLAGIENRNLDQRD
                     KQWGMVRLLSPYAVLQSSGSEGPATATAWYNGSSPWNAATPRNAFMVAPGNAWFNESF
                     PWTLLTPQHILHRRVSEDIPDSMKRSSMDRSSSMRQTHARGQVIVVPFAKHQFEAVER
                     WIHWNLPLACPVETAERTSSQTVLAFYINTIWDSDLYLRVVDALRKATAPTWPSCLDH
                     GVYLIEARLDSTADRYRPSSWLSERDSAGTGSMFYPLVFALSLAAAGGKPAERSAEPW
                     MNTEHRALRFHRLSLGRQSSQRSIFSGPHESTSLPRVRYLFWCEPDCNAVQAQYNDAL
                     RRIVALADARRLWMLGSPLRSTNLDARISWRLQYHQDAHRTQMNGNALYRVGDLDFCR
                     WLWRVWNRHRSAAFDVAIDRQLFASTEEFWDRSFRLQYFAQIEFIHNLGNEPYRWHEY
                     RYRHPYCFFIHGKNRLPPVTS"
     gene            <217757..>220540
                     /locus_tag="CYME_CMF082C"
                     /db_xref="GeneID:16993052"
     mRNA            <217757..>220540
                     /locus_tag="CYME_CMF082C"
                     /product="similar to oxygen regulated protein precursor"
                     /transcript_id="XM_005535690.1"
                     /db_xref="GeneID:16993052"
     CDS             217757..220540
                     /locus_tag="CYME_CMF082C"
                     /codon_start=1
                     /product="similar to oxygen regulated protein precursor"
                     /protein_id="XP_005535747.1"
                     /db_xref="GeneID:16993052"
                     /translation="MQLQSLGQQRGQRFSAIYHALVVRVVALCLLVAFASLAIRARAA
                     TTQAALSGELAAFGIDLGSENVRFAASQAIAGIQVLTNEQSKRETPALIAFVPVSDAR
                     IERRFGEAGTSPAYGRWPEYAVRSVRRLFERGNCSAGTDRVVTLHDQRVQPHRTCHVQ
                     LGGRQDLAFTDTELASMLFRYVQRRAYAAIRATGVSSREQSTTTPAPEDVLGTDAVLT
                     VPIWFRQSQRAALVHAAQLANWNVRGLVSTPLAGAIRFALDREVEQPQTVLFVDIGAQ
                     GTTAALIRFTPANDSAFRSQTGGGLAPIQEVEVLGYRWHPEAGGAALDECLVEDVLSR
                     LRAQSLLAPSIDNDERFRLRLSREVHRVREILSANQEALLTVELPTGEEHHLLVTRAA
                     FQHACRNVFERIAAPVQQVLADHRVGTDQQPLHALIPLGGGSRTPAIAEEIQRLVPGH
                     LWRKTVNAEEAAVMGAAFYAAALSPFFRVRPLVLSDVYPRPCKVCVANASSKGPPYDR
                     CVIVTPRMNSNTNHILQVRMPVTRFDTELYWFEAGNAANFWDDAALVSHWNLENMSLG
                     QDNYPAELELAFEIDPLTAPVLKRAELYVLQMPHAHASASNTMHRKDEEASTAPPQQL
                     SNAGTEQQPQQRVRGRGSGTGAAAAPRGSASTVPTGEAETEPSPSVVPRGQRHSLRAT
                     MLYSVWTFPETSAKASRIRLEALDALDRERERSAYLRNALEAMTLRLHEELALGAPSG
                     TLSKLPARLCLEPERSLILERLHQVELRIHQESSAALAVNDLEQLLWSLENATKPVYA
                     RMERYQKTLEILQQLEQWIRQHQKDALQLRKGRGVQRKPPDMQELLARVTHLAEQLQA
                     QPSAELVDAAEQQARLFSEHFATALLSLNQTQAETFTAPLGSQTKTGQTAEPPSSATQ
                     TVAPEHGMDHTEL"
     gene            complement(<222782..>225967)
                     /locus_tag="CYME_CMF083C"
                     /db_xref="GeneID:16993051"
     mRNA            complement(<222782..>225967)
                     /locus_tag="CYME_CMF083C"
                     /product="adaptor-related protein complex 1, gamma
                     subunit"
                     /transcript_id="XM_005535691.1"
                     /db_xref="GeneID:16993051"
     CDS             complement(222782..225967)
                     /locus_tag="CYME_CMF083C"
                     /codon_start=1
                     /product="adaptor-related protein complex 1, gamma
                     subunit"
                     /protein_id="XP_005535748.1"
                     /db_xref="GeneID:16993051"
                     /translation="MGCLCPSMRRHRPLSHSCALERDPVAAAYRRFTTCAPQHHRPDL
                     KRRLLGVVHQMQKELDKAVRSAKNAISTAKKQYIVYALRDTVKLFRKQRTASAEREFV
                     KKQLAQIRDLSRQEDRYFRRRNVAKLVFFYLNGYGVDFGIMECVKLCASPKFKDKRIG
                     YMALQVLLDEQSEVLLLVVNVLKQDLQSDNHQIVALALHVVANLASAEIGQDLAPDVE
                     RLLHSRNPFIRKKAALAALRLCRRTPEPADSFRAAALELLKMPHHHGVLISGLALLEE
                     LLTVAPGALYGMLANEYQALLVQQLRETATAGFNPEYGFQGVCDPFLQCSILKMLRRL
                     GQHDSAATEELHRTLIDVARSSERSHGVVLECVRTILALESSPSRNLAFAIQILGDFL
                     RSRDPNLRLVALELLPQAAERSMASVAAHQETIFECLRDADPTIQRRALSLLFAIGTA
                     ASLQRFCKELVSYLQSVREALHRYEILQRLWLLLEETEPDVYRRLDLFVEVAQTLPTG
                     DDDIDDDAFRGGAGDPGSGASGDQRNRIYEPRVGGGSDVAGDAYAGPGLSVVQEIEAE
                     LADEVVTAMLANPEAGMAIFYRLMDIVLEQIARRRSAVTLLMHIGLAFAAEHDIPHSA
                     RPRTYAKDADASAQIGQASKRERGTSKAPRATNAAIEQAPDFELGTSKAPTATSAAVL
                     SERAGEDSEAAENGVSSVNSADIPSAAEDSLNWKLAELVLHLPGDRDLSLRQRQRPAY
                     LHRTSTLGRLAVDVLFRTALRTRLKTSEVFGACARLLSEQSKALSLDVQQRAREYLVV
                     LENAPSETFEQLESAFSLPDSSSLLAWRRQGAARSRIVSIRFLGSQHRSRMNAGAAQL
                     ISFDDEEESAETSGSRAPDEQPAVQAPRQRTLLADAVPVAVSSESTNENDSRAAWHLD
                     ILESVLDQVNSSEEASAGSASASRVIYDDEKLRIQIQRTSSETVDGQQRQVYHLEAQF
                     MNKSPRTFTEFLFQISVPNYILLEMMPATSGSLPPSTQPQRVTQRFRLHKDGHDTRPL
                     TFRFRFTYVDPSGQRIVRQGLVGDVLDALDS"
     gene            complement(<226961..>227365)
                     /locus_tag="CYME_CMF084C"
                     /db_xref="GeneID:16993050"
     mRNA            complement(<226961..>227365)
                     /locus_tag="CYME_CMF084C"
                     /product="Sm protein D1"
                     /transcript_id="XM_005535692.1"
                     /db_xref="GeneID:16993050"
     CDS             complement(226961..227365)
                     /locus_tag="CYME_CMF084C"
                     /codon_start=1
                     /product="Sm protein D1"
                     /protein_id="XP_005535749.1"
                     /db_xref="GeneID:16993050"
                     /translation="MTPLLYFLTRLRGATVTVELKDGTKATGTVQRVDNEMNVYLLNA
                     SVTGKPPAELPSASLETHAAQVVAPWTERFSEPDASAMSRRNQPQQKAREYRIRGSTV
                     RYIILPESLNLESALKETRKFSPRTRYQKERH"
     misc_feature    complement(228911..230648)
                     /note="possible transcribed region"
     gene            complement(<230884..>232188)
                     /locus_tag="CYME_CMF086C"
                     /db_xref="GeneID:16993048"
     mRNA            complement(<230884..>232188)
                     /locus_tag="CYME_CMF086C"
                     /product="probable myo-inositol dehydrogenase"
                     /transcript_id="XM_005535693.1"
                     /db_xref="GeneID:16993048"
     CDS             complement(230884..232188)
                     /locus_tag="CYME_CMF086C"
                     /codon_start=1
                     /product="probable myo-inositol dehydrogenase"
                     /protein_id="XP_005535750.1"
                     /db_xref="GeneID:16993048"
                     /translation="MNSVLMAFVSLNIVPRDDCNSQCAGFCLRFTGENNRYVFRSRTR
                     AFPRRRSGCSALRGLRSQSASPAPASASPASGPSAKKGVVARDKVNVAVIGAGRIGQV
                     HAENIAFRLRRANLCGVASGTRELAERCSLAAGCKPYFDYHQLLDDPNVDAVCICSAS
                     TQHTRQMIEAAQAGKHIFVEKPIDIDLGRIDEALTAVRKAGVKLQVGFNRRFDTNYMR
                     VRKAIETGEIGETHIFHIVSRDPEPPPAHYSATSGGIWMDCAIHDFDMARFLIGNEVD
                     EVFAYGAVRISPEIAQYGDVDTSVVMLKFRNRTIGTIDNSRSAVYGYDQRCEVFGSAG
                     SISINNSYPNTAIVSTAHHIQRDLPMHFFMERYTDSFIREMDAFCSSLLDGTPIQCTG
                     FDGRAPVVIAMAARQSYQTGMPVKISEVDRPLPPELHDWDGQ"
     gene            <233600..>234163
                     /locus_tag="CYME_CMF087C"
                     /db_xref="GeneID:16993047"
     mRNA            <233600..>234163
                     /locus_tag="CYME_CMF087C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535694.1"
                     /db_xref="GeneID:16993047"
     CDS             233600..234163
                     /locus_tag="CYME_CMF087C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535751.1"
                     /db_xref="GeneID:16993047"
                     /translation="MATLPKDLPSLEELFVNCLQKRLEGRNSAELEVVDAVEEEFTQL
                     YNATYPVATLRGSLADLERSLDNARENRLHLHRERTRVMLEEIESMQRQLAAEKEVLD
                     RLTRRRNELLERWSAAAHRRVLQNALQEQAAAVEDARQALIQCRRECTFDEIRSYGEN
                     FLQKRTRQRMIEDMIGRSEDFLTRNHA"
     gene            <237796..>238941
                     /locus_tag="CYME_CMF088C"
                     /db_xref="GeneID:16993046"
     mRNA            <237796..>238941
                     /locus_tag="CYME_CMF088C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535695.1"
                     /db_xref="GeneID:16993046"
     CDS             237796..238941
                     /locus_tag="CYME_CMF088C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535752.1"
                     /db_xref="GeneID:16993046"
                     /translation="MWPETLSETPLWKRVRFEERLSISPAVLQGPKTVFNAIYRSLFN
                     RLFRYDPLLQGTVVSLRAVPGAALDPLHKRRANTYTAAEPKLDLEVTDRGFFHVRLHV
                     EALVFSPPVVDGEASIVVKNGTRTRQLPRLYGRVVFLGTRHVALRVFGIFHAAISVDD
                     FPGEYRREHDRWIPLAVDAPGVDLSEKQVRVGDVLCFEVKDLQHASNGIFVIRGGVPV
                     PDANCVETTPAPGAPQADTTTRPLEYTLPDYEALHDELLRNQVERFLTAAWRASTLGD
                     HVDIATFQELVSLEIPGHDGAAKLPRTTTDTETNLGVIRLTADAIDREIIWDADSDSI
                     SENSTAHEDPSASKLEALSGEFFTLGNADSDPLAELVAASRGHPTVG"
     gene            <243861..>246179
                     /locus_tag="CYME_CMF089C"
                     /db_xref="GeneID:16993045"
     mRNA            <243861..>246179
                     /locus_tag="CYME_CMF089C"
                     /product="1-deoxyxylulose-5-phosphate synthase"
                     /transcript_id="XM_005535696.1"
                     /db_xref="GeneID:16993045"
     CDS             243861..246179
                     /locus_tag="CYME_CMF089C"
                     /codon_start=1
                     /product="1-deoxyxylulose-5-phosphate synthase"
                     /protein_id="XP_005535753.1"
                     /db_xref="GeneID:16993045"
                     /translation="MEVQQRLAFVGSVASKQSTWTPCQTDALKALNQCTCAQLQTSRR
                     RAARTRSRAALLRCAADDGSLGESHSVEYTSAAPLSTPLLDAVRFPADMRQFTVGEVK
                     QLAHELRWELLRAVSKTGGHLGASLGVVELTVALHYVFNTPEDAIVWDVSHQTYPHKI
                     LTGRRHRMHTLRKSGGISGFTRRVESEYDVFGAGHSSTSISAALGLAIGRDLAGKKQH
                     VIAVIGDGALTGGMAYEAMNNAGYLNSRIIVILNDNGQVSLPTGTKSAAGTGPAGALS
                     GYMSRLLTSKEFQDVRAIAKEFSRLFPDPLQRTAAQLDEYARAWVAQGAGGNRATLFE
                     ELGFYYVGPVDGHDVEVLVNVLKNIRDAPGNKPIFLHVKTEKGRGYPPAESALDKYHG
                     VSKFDLATGKQMVPMHSPPSYTSVFAKALIAEADEDRRIVGITAAMPGGTGMGAFGEA
                     HPTRCFDVGIAEQHAVTFAAGLSIQGFKPFCCIYSTFLQRGYDQVIHDVALQKLPVRF
                     ILDRAGLVGNDGPTHHGTFDLAYLGCIPNMMIMAPSDEIELVHMVATARAYDEGPCAL
                     RYPRGTAVGLDVLREHFGYDLEAIPVRGKVLPIGKGRIIREKKSASTADGAEIPRGVA
                     ILSLGTRLLEAVHAAGQLEALDVACTVADARFMKPLDTDLIRRLIRNHEVLITIEEGS
                     IGGFGDHVLHYAALNGLLDEGKCKVRPMVIPDVFIETGTQAEQYEEAGLTAAHIVRTA
                     LQLVGKGNLRFGGNGVANPSAGTAAASRNART"
     gene            <247719..>249968
                     /locus_tag="CYME_CMF090C"
                     /db_xref="GeneID:16993044"
     mRNA            <247719..>249968
                     /locus_tag="CYME_CMF090C"
                     /product="probable phosphatidylethanolamine
                     methyltransferase"
                     /transcript_id="XM_005535697.1"
                     /db_xref="GeneID:16993044"
     CDS             247719..249968
                     /locus_tag="CYME_CMF090C"
                     /codon_start=1
                     /product="probable phosphatidylethanolamine
                     methyltransferase"
                     /protein_id="XP_005535754.1"
                     /db_xref="GeneID:16993044"
                     /translation="MELPSVQENAVATLGGRRNSKSRKSRRVPSRAPSTSSLSDEASS
                     LRSTERRRGRTSLGSPSLSTLDHDEQGPVRAGIDVTLKQSATTNSGDRVHFGVPPASP
                     MTERAASQVQGASNAHGEELRPTQRYGTGLISGERFRVPVTRTMAALVFDVRNWGPLE
                     FVVHALFLVQLFATFWVFPRLDPLCTDALSGSCAAGVISSVMLFLSWRLAYNVGLGWL
                     LRRQSRHAAITHWWAGLSPKWKRIIRRCFRSSLLPDERVASRARYGPSPPWPVDFEAW
                     AAFRCLATIVLANDGWSYLLLCCRVFHFPWIERWYARPDVWLCYLLGVALIAFSLWAK
                     ASAHRVVGDFAWYWGDFFFIMEGELTFDGVFELFPHPMYTVGYTAYYGFSLICRSYTL
                     LIASLIAHMSQLLFLMSVEEPHIEKTYGPSERAQSPSCAAESVSPERICTVSCCSRNK
                     IEKEAVVLANLDPFRNSDLSLLIMACMTIFTPALSGWTLTSRYYAMQVVGWMVFHWCG
                     LGTVLYLQSTRRWWTRHFEQRGHCAAEAFRQWQRTFNMSLVMNHLVFVMLALHDAQPI
                     RIPSVWSLVSGRTAALVGGSALIIVGASSSISAYRILGDYGWFYGDFFLEPCALSNHQ
                     GPWKRPASVEASLRPSYAGIYRYLNNPDCVLGYLWMYGLSLATESWRAFWFAVCSQAL
                     HVLFLVLVEVPHMHRTYGPHCRRAAALELLLRRQVQRIRDQPLLREVTCKVEARVDEL
                     RGRLLHKYR"
     misc_feature    complement(249635..251670)
                     /note="possible transcribed region"
     gene            complement(<252696..>254003)
                     /locus_tag="CYME_CMF092C"
                     /db_xref="GeneID:16993042"
     mRNA            complement(<252696..>254003)
                     /locus_tag="CYME_CMF092C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535698.1"
                     /db_xref="GeneID:16993042"
     CDS             complement(252696..254003)
                     /locus_tag="CYME_CMF092C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535755.1"
                     /db_xref="GeneID:16993042"
                     /translation="MTDIVQFSASPLRFSRGAFSRCAWVATSTGAVRCPSTGRRRHWR
                     PIPAGRTGTRLGRQPCAEQIHSLKCVLGEGSDSEGARESTNEGNGRQEQGYAVDQGTL
                     EEHKNASVSFGGARTSGQRVRSICASTPAHDTDANLIRDFATDRAVRTIIYYLTEFRD
                     EPARRWLLDFDDYGKWFGGASIGSRRHEQAYHFLRNTVEYLSGMMSAPSEMHTMVVGT
                     RIRREFTFTLEPFRYAQRIMAARESIAEELRRDLGLVSVENSEILSELVHEQSGQAHQ
                     AQRILDHDDFTTDESPLRYHNYRYVKALLTRRATVRFLNRLRFEGRHAEHEWLSKWPR
                     WEEEIGDGDDFIRSLLRLGNVRCEGQKFFVENHDRVVEREGVGARTEKSVGFMPSDFV
                     DELLILRSLLAREWRSHLAPEKIKEEHLTILRSHLKRSMPNSE"
     misc_feature    254349..255647
                     /note="possible transcribed region"
     gene            <256833..>257822
                     /locus_tag="CYME_CMF094C"
                     /db_xref="GeneID:16993040"
     mRNA            <256833..>257822
                     /locus_tag="CYME_CMF094C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535699.1"
                     /db_xref="GeneID:16993040"
     CDS             256833..257822
                     /locus_tag="CYME_CMF094C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535756.1"
                     /db_xref="GeneID:16993040"
                     /translation="MKRVQALVELGARLAELSGTLEQTLSDVESRYGKLRTLSDLYSS
                     GFLLYGFALWWSIFLASFLVYSVVPVSRTFRTCLSFSQKVEWISRVVSNVNAVIMVVV
                     SSGLLQQTFWSLIQGKVLGRALPHEASFYISQALLLSYFCYDAVLILLFMRSISSPCS
                     SLAHHLFSALSIMFCFYIGEKQPLALIWATGIALTEVSTPLVNARWFLSFRYRERWQY
                     KVIGLGMLVAFVLGRVIYIPVLVAGIVLAAPMYLNPGEALCAFWLGLVGSASSVTIWI
                     LNVYWTMLMLRGARKLFKSQARNSMTDQAAMYSAIRGRPPALGDNENTHLKTV"
     gene            complement(<258510..>259292)
                     /locus_tag="CYME_CMF095C"
                     /db_xref="GeneID:16993039"
     mRNA            complement(<258510..>259292)
                     /locus_tag="CYME_CMF095C"
                     /product="TATA-box binding protein"
                     /transcript_id="XM_005535700.1"
                     /db_xref="GeneID:16993039"
     CDS             complement(258510..259292)
                     /locus_tag="CYME_CMF095C"
                     /codon_start=1
                     /product="TATA-box binding protein"
                     /protein_id="XP_005535757.1"
                     /db_xref="GeneID:16993039"
                     /translation="MTDSSTPERPEESKAGESSVENSVSTTTPERLRRPVVVADVEVR
                     LQNVVASVNLLCPLDLRHIAMRARNAEYNPQRFAAVIMRIRDPRTTALIFSSGKVVIT
                     GARSEEDARLAARKYAKIVRKLGYADVKLADFELHNLVASADVRFPIRLEALAHAHSN
                     YAHYEPELFPGLVYRMLEPRLALLIFVSGKVVITGAKSRDDLNEAFQRLYPVLCQFRK
                     ADSRAVSRATTATPTSNANAGSGAPSGPSIPEHRKMVEESTL"
     misc_feature    complement(262231..263832)
                     /note="possible transcribed region"
     gene            <263994..>266285
                     /locus_tag="CYME_CMF097C"
                     /db_xref="GeneID:16993037"
     mRNA            <263994..>266285
                     /locus_tag="CYME_CMF097C"
                     /product="D-ribulokinase, ribitol kinase"
                     /transcript_id="XM_005535701.1"
                     /db_xref="GeneID:16993037"
     CDS             263994..266285
                     /locus_tag="CYME_CMF097C"
                     /codon_start=1
                     /product="D-ribulokinase, ribitol kinase"
                     /protein_id="XP_005535758.1"
                     /db_xref="GeneID:16993037"
                     /translation="MQPLPVYLSIDVGTGSARAALFDELGRCLARADAPFPTHNPKPD
                     YFEQSTVHILKAVASSTRQVLETLSQNATTSVSTAGTVLTRSLQTLGASERAELGPAV
                     PQPTGHGNEQRPAWQLCGVGVDATCSLALVSAEQAAFFRNCYSDECASPEGLWSCVPG
                     GVALDVEHNDDDGGTLPQAVWDIIVWMDHRAEAEAAEMNADTAECTQDVLRFYGGSLS
                     PESEPPKLLWLLRHRPELFLRCTAVMDLSDFIVFALTGNLEARGLCPLAAKWAYRTDE
                     MRWDTSFYQRWGLGDLFTRGCFGREIRLPGQRVHGIGDSVGLSKIAAFLLFGSPTSDV
                     TSRASNCTLTARGEPVDGGAAAQLVWDYREVVVAAGMVDAHAGAVGAYSMRIPATGER
                     SDWWIQPTGMKEAPSGLSAGTRPMSAACTPTGHACTTANTQAMHVLDEHGLNITQCAT
                     GSIVDDRSNISNETAPSLMTIDLTGARVTSVGTAAAAAAAAAMVPFDWCQRIALIAGT
                     STCHMVCSREPVFVRGVWGPHRTAVLPDLWLNEGGQSVTGRLLDYLVESHAHALGFGN
                     TPLAVVHARLCQLGKHQMKRAAGIHVYPDFHGNRSLLADPRMSGAIVGLRLDTFANEE
                     AFAALYLATVQSLGYGTRQIIERLNEAGHDIRVILLCGGMLKNELFVQSLADTCQLPV
                     VFAERPFDVMLLGGAICARCAHLEGDLLQVIEAMNGGPDQLFYRLDPDPKWRMYHEAK
                     YRIFQRMQQEQIAYRAAMMNVWT"
     gene            complement(<268577..>269131)
                     /locus_tag="CYME_CMF098C"
                     /db_xref="GeneID:16993036"
     mRNA            complement(<268577..>269131)
                     /locus_tag="CYME_CMF098C"
                     /product="similar to glycine cleavage system H protein"
                     /transcript_id="XM_005535702.1"
                     /db_xref="GeneID:16993036"
     CDS             complement(268577..269131)
                     /locus_tag="CYME_CMF098C"
                     /codon_start=1
                     /product="similar to glycine cleavage system H protein"
                     /protein_id="XP_005535759.1"
                     /db_xref="GeneID:16993036"
                     /translation="MNRVLVRCMTASWPSALRQRTPSLFRRVAGPAGELVQMAPQAAH
                     DRGRRLLASAAGTFPADRKYMKSHEWVKVENGTGTVGITSHAASQLGDIVFVDLPAIG
                     SQLEKGATFGAVESVKAASDVYSPVSGEVVEVNAVLSEDPAQVNKDPHDAGWMIKVRV
                     SNADELQDLMDAKAYEEHVASEHH"
     gene            complement(<270052..>272373)
                     /locus_tag="CYME_CMF099C"
                     /db_xref="GeneID:16993035"
     mRNA            complement(<270052..>272373)
                     /locus_tag="CYME_CMF099C"
                     /product="casein kinase-related protein"
                     /transcript_id="XM_005535703.1"
                     /db_xref="GeneID:16993035"
     CDS             complement(270052..272373)
                     /locus_tag="CYME_CMF099C"
                     /codon_start=1
                     /product="casein kinase-related protein"
                     /protein_id="XP_005535760.1"
                     /db_xref="GeneID:16993035"
                     /translation="MRGPVGGRTAAVEPAVGATPAASASEPKDPVPTVVGQSCPCTGG
                     KGFIVEKDVFLGSGHFGDVYKGRNALTGEPVAVKLEYRSRTIAYREWEVLMRMQGLGA
                     PTVYYTGHVGRYFVCVMQLLGPTLQKALESRVSRRFTWPQVSQIALKCLALIKRVHDI
                     GYVHGDVKPENFLLEYREPKNQTSSRQNTGGSCVDPLALLEVNIDARDASGTGANGTT
                     SVSDPKYARVTPAKIDVNVPLYIIDMGLATRWREDDATGKHVPYGQRIDHFSGTVRYA
                     SVNAHLGRHLSRRDDLESLAYMLIYLLKGQLPWQGFVGDDKNMQVCESKGRMLVNDIC
                     RAVPDELRYFLAYVRQLKFAEQPDYEYMARILDCKQGIVWIHQQMRLMAEGVPLVPPY
                     QARTPAAETVDVDSAAPSANIINLASDVSQNSAGAAEVLLVESSVPGTVGGKRRNGMS
                     GQASAQAPKRARTPGAAAELQNTAQAVSRASSTEPDVGIRGGALAEHALSLALQDVGM
                     RRGRFEIIAPRTTKTHQWVIISTSANNASSCAPASQVYTSHTSYKNLVREVERKWAQG
                     MRISVLCFDGGMWTSVLNARDPVLVEQAMHYCPGNEVPRDWIRSKWDEGFYITACSAN
                     HTSWGIVASTMNRNKRYKQQSYIVSSTFPAKWCADKWTNGYAITSLCVQGPPSAEQWL
                     VVMSRGTAFKEQVVELEFGYPSESIHHRWDEGYMLTAVACGSDISAYVMSRGHASGEE
                     QRCTRTSHGPLCKIREDWSDGLFITATAFGRIT"
     misc_feature    273111..276009
                     /note="repetitive element"
     gene            <276190..>278154
                     /locus_tag="CYME_CMF101C"
                     /db_xref="GeneID:16993034"
     mRNA            <276190..>278154
                     /locus_tag="CYME_CMF101C"
                     /product="similar to Muconate cycloisomerase related
                     protein"
                     /transcript_id="XM_005535704.1"
                     /db_xref="GeneID:16993034"
     CDS             276190..278154
                     /locus_tag="CYME_CMF101C"
                     /codon_start=1
                     /product="similar to Muconate cycloisomerase related
                     protein"
                     /protein_id="XP_005535761.1"
                     /db_xref="GeneID:16993034"
                     /translation="MRSDSVRLVSTTFPSLVDIHRNIHDAVTVQAELLRAASPRATPV
                     MAGARSPIAKASPRPRTVVYFGTYTRVLHHSRGTGKGVFGFWLDNDTGYLAPLKTDSP
                     EEADESGLVVRADGLLCPAYFCRDRGPSGEYLWAVNETSKFDYARPDIFGSVTLFRWL
                     RREGGLLERLGEFATAGHGACHPWTDHLGRFLLIANYWSGSVVVFHIEREAVEREHTT
                     SPRLHLVQHVQFISPVDAVDEETKPCAASLLGLTEAMQQAQKAKSSLLGFRRDRQDGP
                     HSHQIVVDPTERFLYVPDLGTDRIYQFILRFDEVASELAHGKDQESLRCVPHAALSGS
                     DAQLCTEAQDAVAAHVRGTSPGPDEQNGRPIQAQQQRFITPAGVVSDYPFQAPQGGVL
                     YQTEFARATGTACCLLPHPSAAFVSVPPSGAGPRHMLLHPSGRWALVLCELNATLLCY
                     AWDGPTPVETVLGHQTASGLLSSTPASMLDLLPAHYRQRYSPEILHQYNISSALRLHP
                     LRTDRLYASNRGHDSVAVIEFSEQNGCMRILQWVPSGGRTPRDIALDPRAEFLYVANQ
                     DSDRVAVFKLDPDTGLVLSTGHHAPCHEQAADAGQSADLGAAPNPEQDGMSADSMDDL
                     TLAGCEQRCTPYQTLSIREPCTVFVEEVPL"
     gene            complement(<278855..>280822)
                     /locus_tag="CYME_CMF102C"
                     /db_xref="GeneID:16993033"
     mRNA            complement(<278855..>280822)
                     /locus_tag="CYME_CMF102C"
                     /product="similar to cell division cycle protein cdc16"
                     /transcript_id="XM_005535705.1"
                     /db_xref="GeneID:16993033"
     CDS             complement(278855..280822)
                     /locus_tag="CYME_CMF102C"
                     /codon_start=1
                     /product="similar to cell division cycle protein cdc16"
                     /protein_id="XP_005535762.1"
                     /db_xref="GeneID:16993033"
                     /translation="MSDILRAREDLRLGRFESAAYNAERLLAGEPENPAAVEVLAQAL
                     LSAGEARRALHRLERYRTRLPLEETVFIRLIEARCLAELRLYEDQVAIFEERGLPSTT
                     GERDAARGNANPLIAAYYVLVGDAYEALENPQKASECYIAALQADESCVEALERLFYS
                     NAVVASVPLGALPPSTSSGAQHKALSVDQIALQALWPFETPFPKDSSPSKVYLMLAND
                     LRFDDWRKRWSLVPCFFLTMVATRFWRLGFCQEAYRLVSFLVAERKELELKRSFPLFV
                     ALLAHHQDLITLFRYAHQLVQEFPRAAESWYAVGMYYFASGKYDASRAYFQKATLLNS
                     NLAYVWVAYGHAFAAVDDSEQALAAYRTAMRLRPNDPTPLLHVGMEFARQNHLAIARN
                     FFERAAAAAAVVVAPVLTSSADSDADEDALANGIERSRPWNELGVLCYRDGEYAEAVA
                     YFQKAARPLQAYKKAWSMRLGLDQRYRISDGGGGFAPEKQAEAAVQRPVLQQSGIENS
                     QSTSSDTNAPSATSVWCDPTSTFYGCQEARSLLATICSNLGHALIRLQAIDLAAEALE
                     EALLVGHAVRLAPGCAGSDALARADTLSALGYVEHVRGSVQRAAQLYHEAARELALAG
                     INGSTLLLDALLERAVDELAMQSISEIATTE"
     gene            <281829..>287009
                     /locus_tag="CYME_CMF103C"
                     /db_xref="GeneID:16993032"
     mRNA            <281829..>287009
                     /locus_tag="CYME_CMF103C"
                     /product="clathrin heavy chain"
                     /transcript_id="XM_005535706.1"
                     /db_xref="GeneID:16993032"
     CDS             281829..287009
                     /locus_tag="CYME_CMF103C"
                     /codon_start=1
                     /product="clathrin heavy chain"
                     /protein_id="XP_005535763.1"
                     /db_xref="GeneID:16993032"
                     /translation="MAAAPVVFEELFTLPSVGISPTHISFSNVTMESDRVICVRETSD
                     QGNKLAIIDVTKPDQIVRRPITADSAIMNPESRIIALRAGAQIQLFDITSKTRIKSYL
                     LSEGDIVFWKWLSGRTLGIVTANAVYSWSIDASSTAPPAKVFDRHPALAACQVINLVA
                     GVGERWLALVGIRADDTAPGGVLGKIQLYAVDRGVSQILDGYAAGFCDRYRIDSQDVT
                     GTHLFAFASKTKFHVVEVAQDRKPDGAPRFEKRITNIVYAPGMDNDFPVALQVSSKLS
                     VAYLLTKYGYIHAFDLESGKLIYANRISESPVFVSTSHRETGGLIGINRRGQVLVFAI
                     DPSLVVEYILRETNDLDLAIKFAARNALPGADDLFAQQFRLLFDSGKYREAAQVVAES
                     PAGNLRTPQTMEMFKAATPQPNVPSPLLLYLQVLLEHGNLNNVESIELGRQVVAYSRL
                     GLLERWIKENRIECSEELGDLVRAANDHRLALAIYLKAGAHRKVFDGLIQLGEYKRAA
                     EYAKRNGIPVDALSLIQSALATSPKVALEVAESLATDTADHAAVADLFLQRGMVQEAT
                     SYLLDVMREDRPEQGDLQTKVLEINLTLGAPQVADAILAQEMYTHFDKQRIAVLCERA
                     GLAQRALQLYTRLSDVKRILVTLSHAIQPEYFLSIFANLSPDDSLELLDELLTNDLRG
                     NIQRVVQVAIRYSDALGPSRLIDLFEKHQCYEGMYLYLGAILATSKSPYVVAKYIEAA
                     CRTQQWSEAERVTRESDLYNPEQVKELLFELRPKDPRPIINVCEKGGDVEDMVRYFVK
                     QNQLEIVKGYVQRINPGNTPAVVAALLDSDSSSVDDVYIKSLLMSIKSLVPIEAVTQV
                     LEERQKLKLMLQLLEALVAEGSKDRAVHTALAKVYVDANINPEHFLETNEFYDARIVG
                     NFCERRDPLLAFIAYAHGACDDDVLRVTSDHGLWREQARYVIERMNPELWARVLEESN
                     PNRKTLLTQVIGSALMENRNPEQVSAAVKALMRAGLQNELLELLEKLVLQAGGTFANN
                     TSLQNLLLLTSIRSAPERTGDYIRRLDAFDGATIGQLCLEHDLYDEAFATFAKFEMHV
                     EAVSVLIDQKKDIVMANEYAAQHDRADIWARLGDGLLRLGELTKAVQVYMRAGVTNRY
                     RPLIQACRKTGAFADLATYLQFVRSKQLGIDEELIDSELVYALACCDPPKLSQLEELL
                     ASPQSADLDAVGDRLFSEGKYEAARLLFVAANNYARLAECLVYMREFTAALEAARKAN
                     KLRTWKTVCYACVEAQEFRIAELCALHLIVVPEELDEVIRVYETRGYFDQIMSVLENG
                     LGLDKAHNGMFTELAVLYSKYAEQKVMEHLLVYWSRCNLAKVIRALESAHLWNELCFA
                     HMRYEEYDAAAMIMMEHAPLAWSHKGLEECLAAVTGAEVLYRAVSFYMDEHPDLLIEL
                     LGVLQSRLDPGRVLSMARQHGLDKFGPLGHVPLLKPYMLRVQDKNLAEVNEALNEVLI
                     MEEDVDALVLSVERYPNFDQMALAQRLEKHELPLMRQVAVLLLRRSQKYERALELCKR
                     DMAFREAAEIAAESGSASLAESIARYFLESNLKEAFTMALYLCYPLLRPDLVLEWTWR
                     FGASDYAMPFYIQTLHDYGKRLEALERAERDHRTTNRKERTNAASGSESLLRSLTAST
                     PMLMAGTPPTGPTPPSSLYFGASGPVPSMRMPSPAASAPAAAGMAGNSARGRNPYFGT
                     "
     gene            complement(<289463..>289861)
                     /locus_tag="CYME_CMF104C"
                     /db_xref="GeneID:16993031"
     mRNA            complement(<289463..>289861)
                     /locus_tag="CYME_CMF104C"
                     /product="similar to Tsi1-interacting protein TSIP1"
                     /transcript_id="XM_005535707.1"
                     /db_xref="GeneID:16993031"
     CDS             complement(289463..289861)
                     /locus_tag="CYME_CMF104C"
                     /codon_start=1
                     /product="similar to Tsi1-interacting protein TSIP1"
                     /protein_id="XP_005535764.1"
                     /db_xref="GeneID:16993031"
                     /translation="MFILTPFKGCKLTAVTDGGENASEGDWIDERAVGHGTQLWQQRR
                     SLELGWAYQTRDRQAPPVVCRVCRGSGSVPCRFCHGTGVMALGDRLACSVTARNCDCY
                     ACRARGQQRCTRCAGSGFIASWLAPLEELP"
     gene            <290905..>292437
                     /locus_tag="CYME_CMF105C"
                     /db_xref="GeneID:16993030"
     mRNA            <290905..>292437
                     /locus_tag="CYME_CMF105C"
                     /product="similar to MtN3-like protein"
                     /transcript_id="XM_005535708.1"
                     /db_xref="GeneID:16993030"
     CDS             290905..292437
                     /locus_tag="CYME_CMF105C"
                     /codon_start=1
                     /product="similar to MtN3-like protein"
                     /protein_id="XP_005535765.1"
                     /db_xref="GeneID:16993030"
                     /translation="MFATQGTARIILDYVVPSIGIVLSFLLFLAPFPRVLAVRRRLTA
                     VANSVRVSAERARCDAPLPTQPAATPMFSETILEYNVHSNVATGHHSGADSSDLASVP
                     STGDSTELAPVELVLQVTPNELNGRIAGIPMNEVPTPLSSKFGPTMDEPSVDENILGP
                     VNPLPYPLMLGNAIGWISYAFVQSDYFVFWANAPGMMLCIFYVVVAYAALRLDEWRKR
                     QITSGERQRPEAVRALPLAPASSGHWWTHIRNASGLLNRRNATGAVSGTQSESNTGLP
                     PRIEDPLRPTDLPIGNGALTSSLVRSDTTESLVPKPLPAELQRHPWVAGLSMRRMFEG
                     LLFIIALVLTVSAFFVFIPLASNGVWRNQSARVLISGLVANIILGFMYSSPLFLIRTV
                     FRTRDASMIDRNLAIMSLVNGTLWTAYGFAKQEPFIYVLNIFGASLGAIQLALIGIFG
                     GRRSHRNPAVVQSGVEPAFTTAPAQLVNVARNEPDTTMPSTTLVLAERPLHLPVATVV
                     VS"
     misc_feature    complement(293889..295542)
                     /note="possible transcribed region"
     gene            <295523..>297943
                     /locus_tag="CYME_CMF107C"
                     /db_xref="GeneID:16993028"
     mRNA            <295523..>297943
                     /locus_tag="CYME_CMF107C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535709.1"
                     /db_xref="GeneID:16993028"
     CDS             295523..297943
                     /locus_tag="CYME_CMF107C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535766.1"
                     /db_xref="GeneID:16993028"
                     /translation="MPRVQPLSQRQGQPLGLSVKRRPAPRCTAPASTFERSTVAAVEL
                     HLLGTHLSTCLRSERICNGCQRPTHAVKGMPGASGPKRDAADRVQDGDFVILQYGEGR
                     YEKHRKILQVRKTTATLQDVHDAAGTAAAADTLIRVGTRYVHPSALIGVPWGVRLSYP
                     DPAEQAVSPAPQATDKQMLLALRTDADAVATDGQDVDAEAPEQRSNPSATACATTEKP
                     PTLTQVVPGTSQESFTSQFRGTNHQTRATAETVSERVSAAQSKRLERKHQRHGFSLRV
                     IRPSLCTLTDTLYQKMEGKSLWMHAEALGFVLLQAGVWAGTKRVLILEELAERTGLVT
                     AACTQRMRYPGRVPNPAEGILVITAAGVGMKTSHGAALRILGLRRSKRAEHSASTDPL
                     RGDAENASRQSYSNSTSEDRLEAAGLPLIQHLPLEWLQKTPGSFGGRPRGHLHDARAP
                     TGGTVPPMGTDGSIGAENSGDVDAQLLEVNDHLQHHAVKRSPEGPEEREERPESSKTM
                     DVLESSVQRWLDNADRGNEAIIIAFKEQVPGGAGDLVQLMALLLPLLSPGYPFVIWSP
                     WLQPLAELQAFMSISDDSRSESAPVSIDAPGNLASSARKLDTSTWQGVGIEAIDDAKL
                     DQWKRSRRQPFVNRPERERMVTTPDSIAVAEIPRKPPGIPEGSTRPAHAPDESSVNRA
                     VMSAAEHPADTESLIPAAERIAQRESPSTQSLSMDAVADSRQAHVKDPNPVPVGHVGQ
                     VFQDDHAGTTDDATGDVDLRVLQQVAHVRLTEITTFGHQFAAERTHPWMSQTPPSGFV
                     LSGFRIQP"
     gene            complement(<299119..>300021)
                     /locus_tag="CYME_CMF108C"
                     /db_xref="GeneID:16993027"
     mRNA            complement(<299119..>300021)
                     /locus_tag="CYME_CMF108C"
                     /product="similar to cleavage stimulation factor subunit
                     2"
                     /transcript_id="XM_005535710.1"
                     /db_xref="GeneID:16993027"
     CDS             complement(299119..300021)
                     /locus_tag="CYME_CMF108C"
                     /codon_start=1
                     /product="similar to cleavage stimulation factor subunit
                     2"
                     /protein_id="XP_005535767.1"
                     /db_xref="GeneID:16993027"
                     /translation="MSRGSCTVFIGNIPYGVTEDMLLERLQQVGPVVSLRILYDKETG
                     KPKGYGFCEYRDPETAESAVRNLNERIEFGGRMLRIAPSSQTRNQASAGGSTAPGAGA
                     APEGGRSGPGLGPGASAASWGAYDALADATAPSQPTGPTVTAAQVVQPFLLPSGQPSL
                     QGLSLQQIFDVLAELKTIAQQNPNEVRAMLAAHPPIAHAILQAQVLLGLLSAQQAQQY
                     LQSMTASVTTNASLAAMQRVQSGAAAGAAAPLPGGIVPGQGAATEEALIQQLMSLTPA
                     QIQALPPDQRQQVLAFRMQMAARR"
     misc_feature    300336..301780
                     /note="repetitive element"
     gene            <302200..>303198
                     /locus_tag="CYME_CMF110C"
                     /db_xref="GeneID:16993026"
     mRNA            <302200..>303198
                     /locus_tag="CYME_CMF110C"
                     /product="replication factor C subunit 2"
                     /transcript_id="XM_005535711.1"
                     /db_xref="GeneID:16993026"
     CDS             302200..303198
                     /locus_tag="CYME_CMF110C"
                     /codon_start=1
                     /product="replication factor C subunit 2"
                     /protein_id="XP_005535768.1"
                     /db_xref="GeneID:16993026"
                     /translation="MLDHQPWIEKYRPRTLSEVVGNQPVVERLRALALSGNVPHLLLV
                     GPPGVGKTTVALALARDTLGDALIQQAVLELNASDERGIDVVRNKIKMFCQQHVTLPP
                     GRHKLIILDEADSMTPAAQQALRRIMELYSSTTRFALAANVSSKIIEPIQSRCAVIRF
                     RRLGDEAVRSRLVSVLEEEHVPYEPDGIETIVFTADGDMRQALNNAQATWFGFGVITT
                     EHVLRVCDSPSPARLRRFLELCETQKFEQAVGEIEAIWRSGYAASDLVATLFRVARTQ
                     AMITEGGERGRDLRLEFLREIGLTHMRITDGLSSLLQLTALASKLVRCAERIHTAQ"
     gene            complement(<304168..>304881)
                     /locus_tag="CYME_CMF111C"
                     /db_xref="GeneID:16993025"
     mRNA            complement(<304168..>304881)
                     /locus_tag="CYME_CMF111C"
                     /product="similar to putative vesicle transport protein"
                     /transcript_id="XM_005535712.1"
                     /db_xref="GeneID:16993025"
     CDS             complement(304168..304881)
                     /locus_tag="CYME_CMF111C"
                     /codon_start=1
                     /product="similar to putative vesicle transport protein"
                     /protein_id="XP_005535769.1"
                     /db_xref="GeneID:16993025"
                     /translation="MPKITFISRLTDGLPLAASLADEKDAFALELQEYERQAKRILKG
                     LTAEYLAGGRGSVPASRKAASIESGAFTFHYLLGDQVAFLTLSEKAYPRKLAFAFLDE
                     LRREFEAVYGAQVALANRPYEMIRFDSFIQKTKKVYLDASAVRNLERLNSELLDVRDI
                     MTRSIQEVLGRGERLESLQNTSAMLSAESRKYLRRAKHARWMLRIRQYGPMMVILVII
                     AVLLWFFKLRGRGATAGFT"
     misc_feature    complement(305804..307017)
                     /note="repetitive element"
     misc_feature    complement(309483..310554)
                     /note="possible transcribed region"
     gene            <312530..>314641
                     /locus_tag="CYME_CMF114C"
                     /db_xref="GeneID:16993023"
     mRNA            <312530..>314641
                     /locus_tag="CYME_CMF114C"
                     /product="probable calcium/calmodulin-dependent protein
                     kinase kinase"
                     /transcript_id="XM_005535713.1"
                     /db_xref="GeneID:16993023"
     CDS             312530..314641
                     /locus_tag="CYME_CMF114C"
                     /codon_start=1
                     /product="probable calcium/calmodulin-dependent protein
                     kinase kinase"
                     /protein_id="XP_005535770.1"
                     /db_xref="GeneID:16993023"
                     /translation="MIRSHTRRMESAASVPSVFAVPIEDVLAAVQGTRVQCIDPSFFS
                     CWGRQERARSYRVWVTDDFLELRSCPSWPNLFCLFDLVAVRADTCALSLEFQVSSMRL
                     ERSNSGSLNSFVDETVPASRGHTNSVPIAKVRRLVLVFEQQRIMHQWLNALTACAPSS
                     CQFMLHALPVQGSRRSSNERRWQGAHILGFHDELGPIDGLHWRGKPLTNYPKHGADGR
                     YVFLRVLGRGSMGEVLLAMDLYSRRFYAVKQAILRCRFDAQTGSLRDTSACCDHNNER
                     MLMEMELMRGLRHPNLVELIDILPAERRDASQAPSDAGTEAIVNGDTGRDSAQPLPPL
                     FHGAGDRRTWQKTDASLVSSTDPKSCSASPTEQMNGQSMDSDLPTASDSLVLARERDR
                     LRWIRDSGLKPLVSDGSSRELSVPLQLVVEFVPGFPVLQSNQLVMNQSLSEDVALFVL
                     WQVANGLATLHARNIVHRDIKPDNLLLHVDGTIKLNDFGTACVADAPDVQCLVGAPAF
                     VAPEIISRVCQICDEEDDDVSTHTARSLVIDPIRNPGERGAPQCPTSGATPDSEISKR
                     SDIWSLGATLYYLLFGRPPFLGDTLYELCENIMHQSVSFDRELHRKWSNSSGRSTDRA
                     RPAPWYRRRLSRTRSNALSEACTALLQGMLTKDPRIRLDIHGVLAHAALDRYRHMTVT
                     EMEYFTERLRDQSTKSGAFRR"
     misc_feature    complement(316564..317566)
                     /note="possible transcribed region"
     gene            complement(<318927..>319751)
                     /locus_tag="CYME_CMF115C"
                     /db_xref="GeneID:16993021"
     mRNA            complement(<318927..>319751)
                     /locus_tag="CYME_CMF115C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535714.1"
                     /db_xref="GeneID:16993021"
     CDS             complement(318927..319751)
                     /locus_tag="CYME_CMF115C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535771.1"
                     /db_xref="GeneID:16993021"
                     /translation="MTDALEALAALFPQRSRKELELVLEAHRNNVERAAAYLLEEAHD
                     TGHLSAVNLSEPEEGNSEPQNVEEVLRDCDLVQCTSGSVDNDAEPVAGTDDNVVDEDA
                     LLARHLQAEFDREWAVALSVRERNRDGLGSRGTSSPPTPGEQHRGPQETDRSLSTDVR
                     EVLDQAQETISHWWHGVKDTVQSWVGEYRSASRSTRAPPQEDPFVGPPHNYAIPEVMS
                     EEHSETAPESSDASEQAWDRPQHDVEPRLAMTPRPRLAASKDSRTLVPPSYTKKDL"
     gene            <322534..>323583
                     /locus_tag="CYME_CMF116C"
                     /db_xref="GeneID:16992947"
     mRNA            <322534..>323583
                     /locus_tag="CYME_CMF116C"
                     /product="unknown iron-sulfur protein"
                     /transcript_id="XM_005535715.1"
                     /db_xref="GeneID:16992947"
     CDS             322534..323583
                     /locus_tag="CYME_CMF116C"
                     /codon_start=1
                     /product="unknown iron-sulfur protein"
                     /protein_id="XP_005535772.1"
                     /db_xref="GeneID:16992947"
                     /translation="MRCETRAVVTGLFVYPIKSCRGIAIEQSALSLTGLAYDRLYVIG
                     RPGVEDGGRTARFVSQRQEPQLCQLVPELDLESSTLRVRSKVRPELEPLELPLEVSKE
                     RTADTQVRIWSDIVPAIDFGGEDWFAAALDDQLSYPVHIYRMPATFERTVDPERAFLS
                     PSFDSVVGFADAFPVLLTSMQSLAELNRRIASQSGVAHQVPMSRFRPNIVIDALPLNE
                     ERVSAVQRRSLEPFEEDTWKRIQIGEQVTLLVAKPCSRCRITTTDQDTGRVDDAFREP
                     LRTLETFRKQPLGLIFGQNLAPEYPRRSGQLLRVGDVVQVLEWQTNDSSPWWWQRLYR
                     GFWGRASRPERPTAS"
     gene            <325582..>326916
                     /locus_tag="CYME_CMF117C"
                     /db_xref="GeneID:16993020"
     mRNA            <325582..>326916
                     /locus_tag="CYME_CMF117C"
                     /product="phosphoribulokinase"
                     /transcript_id="XM_005535716.1"
                     /db_xref="GeneID:16993020"
     CDS             325582..326916
                     /locus_tag="CYME_CMF117C"
                     /codon_start=1
                     /product="phosphoribulokinase"
                     /protein_id="XP_005535773.1"
                     /db_xref="GeneID:16993020"
                     /translation="MVLGFNVAGAVRTTAVRERPPVCGVGAQSSRFRGDTMVSVARTR
                     AFLAVPPLRSTRLPKPTRQTWLHMQTSTMQKARYAEKAPRGVHKEAAVGAVKSEALQR
                     KNIQRPVMVGVAADSGAGKSTFLRRVMRMFGSDIPKGHTPQGELITVICLDDWHNRDR
                     QGRKEDNITALDENCQNFDLMAEQLEALKNGFDIMKPIYNHETGRIDPPELVSPNHIV
                     VVEGLHPMYDERVRKLLDFSVYLDLDDEVKIAWKIQRDMAERGHTLEAILASIEARKP
                     DFERFILPQRQYADAVIQVKPTELIPEDKERKILKVRLLQREGVQGFKTAYLFDEGST
                     IEWIPCGRRLTCSYPGIKFHYGPESFYGADFSTIEVDGEFAKLEELVYIESHLSNTGT
                     KYYGELTQLMLAAQNTPGAYNGTALFQTIIALKIREIYEQLTGRKVDPVVRS"
     gene            <327831..>329945
                     /locus_tag="CYME_CMF118C"
                     /db_xref="GeneID:16993019"
     mRNA            <327831..>329945
                     /locus_tag="CYME_CMF118C"
                     /product="similar to serine/threonine protein kinase AKT"
                     /transcript_id="XM_005535717.1"
                     /db_xref="GeneID:16993019"
     CDS             327831..329945
                     /locus_tag="CYME_CMF118C"
                     /codon_start=1
                     /product="similar to serine/threonine protein kinase AKT"
                     /protein_id="XP_005535774.1"
                     /db_xref="GeneID:16993019"
                     /translation="MGVCWSDSEESSTKKRPRSRVVPELTLQPRGRTSPEERAQGNVR
                     SAAAATTFVLHSVSRNALSTSQHEQHEQQPQQPQQPQQQQLWGHPLKPKAAETIFNLP
                     SCDLVRFLGQGMLGTVVLVRERATGKFYAVKVMSLQRVRQRGQERNVQLELEIVRNCG
                     AHPFIVKVEAGYQTRQALVLVLEYVSGGDMYNLLERYRCIPEDALRFYVAELALALGH
                     LHARGYVCRDLKVENVLIDSRGHVRLTDFGLAGRDADGCTDRSGTPIYQAPEVLRGER
                     HGRQVDWWALGILAYFLLAGTPPYYAPTEREVYRMILDERSEPAWQGGYMTGASAVCK
                     DFLRRLMDRNPRTRLGSGASGTADDVDEVLAHPFFSGVSRRWLTERGNVSPTLLSMMR
                     DDDQPGIDVDKFLRYQVVPPLEPAKQPAADFEPVDEDVLRADENLYAALTGDNRPQAQ
                     HLANMVQTSTESMARAKLTTENAFVPGYKVYFWGEHHGDVVANRATRRSPWRSGSRHG
                     LGRRSPLAHARASEVAVPPLAVQRTYSMPAWIGTVDQDRAERSPTERRPYSGRTDQNS
                     AVAQAFGITSTTGSSIQRHREHDLKAFRSAKTLGKLWMRLGRQQRLAIRSDGDAEELV
                     LPTSVSSSDVSAMHGNVDNDADEESSGIWEISEAQETPHAGASRSRTSIGLNFSRTRQ
                     YLFERTWTGTDDDEGRVYRLAG"
     misc_feature    331030..332526
                     /note="possible transcribed region"
     gene            complement(<331814..>332761)
                     /locus_tag="CYME_CMF120C"
                     /db_xref="GeneID:16993017"
     mRNA            complement(<331814..>332761)
                     /locus_tag="CYME_CMF120C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535718.1"
                     /db_xref="GeneID:16993017"
     CDS             complement(331814..332761)
                     /locus_tag="CYME_CMF120C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535775.1"
                     /db_xref="GeneID:16993017"
                     /translation="MARKLFAAFQSSIIRARLCAQYKAAKCTLATENKSKKPLVKVPE
                     AAIQGAPLLSTTGSGSLVRVQEACTADEVWKAAQVYAICFRSNATQDSAHQVKDNQSS
                     AGAPESFYRGWREEWELFLLTLEAWLGFRLRMKFRPNNHRLFIAKASVCSKDKALTPR
                     PPRDSLHAPGGASEPVAEMVVGIVEMSLEPVRVQVTSFTAALLDLLERIAGKNVSGRA
                     HGRNCNQGIVRRVYLYNLATHPDYRRRGIARYLLAQCESQTRAWQHRTIYLHVERENA
                     GALSLYKRAGFRVITAEARQRSANAPCLLGRWVGHNRTP"
     gene            complement(<340364..>344212)
                     /locus_tag="CYME_CMF121C"
                     /db_xref="GeneID:16993016"
     mRNA            complement(<340364..>344212)
                     /locus_tag="CYME_CMF121C"
                     /product="alpha-xylosidase"
                     /transcript_id="XM_005535719.1"
                     /db_xref="GeneID:16993016"
     CDS             complement(340364..344212)
                     /locus_tag="CYME_CMF121C"
                     /codon_start=1
                     /product="alpha-xylosidase"
                     /protein_id="XP_005535776.1"
                     /db_xref="GeneID:16993016"
                     /translation="MFSSEQGLNGDSKISKEDCRYSYNIGSYGDTPRQQSTPPLSPAG
                     LTGSLGALSQRSHRRRRGILGLPAVSSLPNAAADEPARASTGTAAFAVAPCNETAEAA
                     GLLSVPLHLLQPSSSSALCLARWGSPLAPKERIVSGKWIDPNRISEFQARFTVLNEYA
                     VRCECVPLNPPHNRFEDRPTMRFWRRDLGQEFEMSVRRRQDGLLLIRTKVFTLLYDPA
                     KSHGAFENGALRIILNDIGPIAGLQSDFNLAGWITQPVGEVNPFEFVFGISDPSIGNC
                     GGTCRTLDGANGWAYDKRSQREYHFGRYVDLGNGIISRRGWAIVDDSTSPIFDAHGWI
                     CERARDPRSVDLYVFAYGDQYSRALQTFTSIAGKVPLLPRYALGNWWSRWWPYSQSEI
                     IQWVNEWKNGRNIPLSVCILDMDWHLPGWTGYTWNPELFPDPLEALRALKQLGVRIGL
                     NVHPADGVHAHESMYTAMATALGVDASSGTPLYLNVASPSFMKAYFEFLHNPHERIGV
                     DFWWIDWQQGTQSGVAGLDPLIYLNHLHCLDSAREFGRAEPRALILSRYGGLGNHRYP
                     VGFSGDTHSTWESLAVQPVITATAANVGFFFWSHDIGGFMGGVQPDGELYVRWVQLGV
                     YSPILRLHGHKSEFIRRWPWSYEKTYAVAATAALRYRHRLIPYIYSQCVKASLKSTPL
                     CRPLYYQYPTQNPLAYTACCTQYFFGDELLVAPFLEPILPSVGCARRVLWLPPGTWRH
                     LPSGEAYAGNRWICVYGGVDDVPVFAASGAIVPLASSPGCRSGIANDFAALMDDQNFD
                     ADAGLENPEMFDVTVVAGGEHTFQMIEDDGSGGDDPLRCARVTCFSTDFQVVDSNPGS
                     RKAACETLTVQIWSDAVGPDAGQDPARSIWSPMRQFTIHFVGVVDLNALAQRGEAANI
                     RVSVDDGHGYREIVEGYETSYDAFRETWTCALPKLGLDTRIRIEICGAALLSARDRRS
                     EKLRDILQRFRLDCWSKICLARELHSFLEGMKSIHDILREDSTLTDYEYAGYLSEEQI
                     RALYEIGFECGVEWLRTGYHPLWPHPAPVVAWNPRRSVAFVAPTSTSPEIRRGRYLSE
                     RRELQMINEVLAEAIMREQRALSQASDGGRLSRPPPVSSAESEGYSDSLPPRIPSRSS
                     NIGLTTGSVPSAFAARLSGLQPGSPMQLGIPLSTGTSPGGSFTNKAAQLNMFAGIGGL
                     DSERKPPAQSGIFPDPALAGFRVVRDQELVFPADPLDDWSLEYHYGPDLAVHIASNAA
                     RTTLAALGSSVSRHQAEAES"
     gene            <344330..>344824
                     /locus_tag="CYME_CMF122C"
                     /db_xref="GeneID:16993015"
     mRNA            <344330..>344824
                     /locus_tag="CYME_CMF122C"
                     /product="similar to nitrogen fixation associated protein
                     HesB"
                     /transcript_id="XM_005535720.1"
                     /db_xref="GeneID:16993015"
     CDS             344330..344824
                     /locus_tag="CYME_CMF122C"
                     /codon_start=1
                     /product="similar to nitrogen fixation associated protein
                     HesB"
                     /protein_id="XP_005535777.1"
                     /db_xref="GeneID:16993015"
                     /translation="MLLHLRCLWQAASRVPEQKVSAASFKRLLSTGSFAKESAASGTE
                     TMRGAGGFSLSVTEECVRRLRELATRAPKHLPFALRVTVNSGGCAGFQYEFKLEHSGP
                     AAEDVVFEKDGVRVYVDAISAPLLSGATIDYEDELIRSAFKVEGNPNAEANCSCGTSF
                     APRF"
     gene            <347613..>348278
                     /locus_tag="CYME_CMF123C"
                     /db_xref="GeneID:16993014"
     mRNA            <347613..>348278
                     /locus_tag="CYME_CMF123C"
                     /product="similar to maleylacetoacetate isomerase"
                     /transcript_id="XM_005535721.1"
                     /db_xref="GeneID:16993014"
     CDS             347613..348278
                     /locus_tag="CYME_CMF123C"
                     /codon_start=1
                     /product="similar to maleylacetoacetate isomerase"
                     /protein_id="XP_005535778.1"
                     /db_xref="GeneID:16993014"
                     /translation="MERAVLYSYWRSSSSYRVRIVLNLKKVDYEYRPINLLKLSQGEQ
                     PPAEFLRLNPGGQVPTLLIDGHVLTQSVAICEYLEEAVTGGVKLLPEDPAQRAQVRRV
                     VEIVNSGIQPLHNSAVLDYLSSKFGDAARTEWSKHWIHKGLIQLETILQHSVGQGPYS
                     FGKQLTLADAFLVPQIGHAERFGVNMEEFPTLRKIYHTLIELPEFAAAHPSRQPDAEE
                     HLA"
     gene            complement(<348888..>352553)
                     /locus_tag="CYME_CMF124C"
                     /db_xref="GeneID:16993013"
     mRNA            complement(<348888..>352553)
                     /locus_tag="CYME_CMF124C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535722.1"
                     /db_xref="GeneID:16993013"
     CDS             complement(348888..352553)
                     /locus_tag="CYME_CMF124C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535779.1"
                     /db_xref="GeneID:16993013"
                     /translation="MLSESLQSFLKLRTAPLVLVAATPGVETLLERLFAELFQRNELV
                     DARSLGSVSIAELAVQAAPRIFGVSLTETDKQTNLSKAGSEDSRATPTPFLRFLSVHD
                     AVQYLNLREDDPSSESHNALAWNSPISSGALPPRDVLRCWQAALRKQKREQLSLGNAS
                     SLILSVLSLAPFGLPHFIFDHPIAQVVFASVNDSEDDILNCLLRDDASGCRFHTGTLD
                     SRRPLFILEISAESSAGSDGMKRTEIEFSTQDGSRGTRIMVDAAEWSRSADLREYISL
                     YFGRWIHSIIQSEIESRVDQRDRAGRIVRNQFRAWFSSGQSKTREGVIPGHRLGLSPR
                     VMPYIYLWNSAEMRAFFLGYMLVAQEKYSEALAVFRMLSSDFRADHSLIYSAAASECQ
                     AIALILKGSNESLEVMELLQHATENYRNAGRFLDAVRTLTLLATTCIEYNNLSRAADL
                     LLEESLPEIDWLRKAPNALGRLRKLCTAACLELAGECFRVLRRPRRHRTCQMCLSMAA
                     ECFTAAKFFDEGHRLFARICDHLAKKSWSWIEAYVNLCTGRTAWMCGNISDAYQRYTA
                     FLSDLKPSRVDDIAVLRETVLVASALGEATRASSCRFPLLDHRSIVFAEENRILESPQ
                     LSEWKAMWGALDAFREAQRTLEAAGASIDQQHWDAELTSLDTVMDLLGGQERHVHGML
                     RVSAGEKIVVTCRLENPLRAPIELDDIILRMRRVSMNHLLRESGSSARLCVPVETAET
                     VRISHNSDGLLRGVFAISESGAFEVEGISWRVHSPLFEPSLICYAFYELNESPKAMNS
                     KDLRKGLGASSRESCGHLAVEVGPPAPLLTLNTPLIPKTVMNGEIWHTSITLANSSLV
                     DIHNISLSWSPESDLSMRVMQCTSSSTEVTVQHGRRVVSVRCTLQHGDSLEFKVALWC
                     RHHISERSMDLRIAPRFLRLLIFSTSETPTARRSKLLPVRIGVLAEDSVSVLPCHLEH
                     LALETTSPSSITGQGSAVSYGNCDGTIIGLQIQNVNPNGMTLEIQHLHACHRGQYLWY
                     EPLFTFASPKLALQQYDKANLLLHSKPETSHSGDDPELLSFVSGTDFEVFLPEIFPSE
                     PGTTRKPFDLDDLFVCLFWRTLDNGDGGQRTGLTALNITAAQRPPQTNDYVQKEESLL
                     LAADTLAIVPCEHGVRGEVLVPKNNAYSSLACVDTSKIPSDFAVWSGHIFKSVALRKF
                     ASDAQLDVFLISRDPKR"
     misc_feature    complement(355652..355937)
                     /note="possible transcribed region"
     gene            complement(<356386..>357516)
                     /locus_tag="CYME_CMF125C"
                     /db_xref="GeneID:16993011"
     mRNA            complement(<356386..>357516)
                     /locus_tag="CYME_CMF125C"
                     /product="probable RNA helicase RH2"
                     /transcript_id="XM_005535723.1"
                     /db_xref="GeneID:16993011"
     CDS             complement(356386..357516)
                     /locus_tag="CYME_CMF125C"
                     /codon_start=1
                     /product="probable RNA helicase RH2"
                     /protein_id="XP_005535780.1"
                     /db_xref="GeneID:16993011"
                     /translation="MQQSFLDFGLKPAVQCGLLRCSFFIPSGIQAKALPFIIKEENII
                     LQDHSGSGKTTLLAIAVNHVVNPAENCLQAVLLSPTKELAQQTAVLIERIGSKYVCLR
                     CSVCHGAVQVKGAAHVWSGTPGKILQQFSNTGTMSANTVRLLVIDEIDEMLSAGLEKQ
                     VSRICRIMPETCQVVVVSATASMSGMESLHDFLRRDMHFITTGSTEAYWHAGIQHYRV
                     EVPEEKWKLSAVFDIFSRYLVRSQCIIFTNESKKADWLEKKISLRGFEVQGIHGGKPQ
                     DKRVAAIDKFRSGTTNVLVATDVASRGLDIPGVVLVINFDVPLKPSIYVHRVGRCGRF
                     GRRGIGITIITKENKLQLQQIEQFLKIRIRSLPAELVEKNPL"
     gene            357787..360377
                     /locus_tag="CYME_CMF126T"
                     /db_xref="GeneID:16992946"
     misc_RNA        357787..360377
                     /locus_tag="CYME_CMF126T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461261.1"
                     /db_xref="GeneID:16992946"
     gene            complement(<360915..>362729)
                     /locus_tag="CYME_CMF127C"
                     /db_xref="GeneID:16993010"
     mRNA            complement(<360915..>362729)
                     /locus_tag="CYME_CMF127C"
                     /product="probable DNA polymerase alpha, subunit B"
                     /transcript_id="XM_005535724.1"
                     /db_xref="GeneID:16993010"
     CDS             complement(360915..362729)
                     /locus_tag="CYME_CMF127C"
                     /codon_start=1
                     /product="probable DNA polymerase alpha, subunit B"
                     /protein_id="XP_005535781.1"
                     /db_xref="GeneID:16993010"
                     /translation="MATSVAVEFLLRRYPSLANASVSSARAALSRLASTCSELGIDLE
                     ATAAKLELYLLNTRKELSEDTVEEFTSKLAASAKKSKCSRARVSESTELIAEAVRRRA
                     PLPVDKPEEHSLPEVQRQTAPVSPENPYLSSDTLTESSHPKHGFMPESTQSQEEFLDL
                     FPHRDPFVDLSSHGVDGVVVNSSRANLRPSFRITRPPPGLDLEVWPEKLMFDCLEKRK
                     ESQRKRIHDAFDALQSSGRIESLMETSGEPVDGRFIVGQVLFSIQGHERNREVFLEDD
                     EGVMVQLELSKLHTYLLYPGKVAGFVGLDLPGHIFEVHQIVDDMFVTEEVPRQRKRVV
                     SMKPSSLRPKWRILLMVGPYIQPEDPDWDIFDFLKKKVAELEPDAVCIMGPLVEENPD
                     AGDATLNLVDKFVQGERVLQALQNIAREMRSTTFLISPAIDDLMHHLPVFPQKPYEFS
                     ADPIVKIGNPTSFRIELDRRDSMRVAIMNLPILDEMRLSCLCGGSKIPRMEECSAEII
                     RQDTLFPYDPSGSKIPIDYSLVQELKPMRPDLLVIGGSESNFACEAHGCCIVCPGKFC
                     NRTSPTEFAIVDLVSGDAEEAWHVLFGNGGAMPGRDNR"
     gene            complement(<363194..>364645)
                     /locus_tag="CYME_CMF128C"
                     /db_xref="GeneID:16993009"
     mRNA            complement(<363194..>364645)
                     /locus_tag="CYME_CMF128C"
                     /product="probable kynureninase"
                     /transcript_id="XM_005535725.1"
                     /db_xref="GeneID:16993009"
     CDS             complement(363194..364645)
                     /locus_tag="CYME_CMF128C"
                     /codon_start=1
                     /product="probable kynureninase"
                     /protein_id="XP_005535782.1"
                     /db_xref="GeneID:16993009"
                     /translation="MHASVLQQLFAATRESCKTVAELVDEKGAESLDENDVLAVFRQE
                     FYCPGRGPTGTLSSSCPSLELASDAPKNHLRGGICDQHDEKAAVYLCGHSLGLLPKRA
                     YRLVSEHLELWARLGVRGHFEGPDPWYTFDERPLNVGGAEIVGALPHEVVYMNSLTVN
                     LHLMMIAFYRPTAKRHRILIEKHSFPSDRCVVLSQVAYHGYDPATAILEVGAGSEDAG
                     LIDLNQLESVLNEYSDEIALVLLPGVQYLTGQLLPMEELVNIVRKTSKDIKIGFDLAH
                     AVGNVVLKLHEWAPDFACWCCYKYMNGGPGAVAGCFVNEKHTCATDLERLPRLCGWWG
                     LERSCRFETPRALSLPSGAKSFQLSNPPILALAPVVASLEIFRMAGGMQAIRQKSVLL
                     TGYLELLLEQLVKEKVLIITPQDPNSRGCQLSLKLNCSATAKELCERLANEGFICDAR
                     EPNILRVAPVPLYNSFSDVHSFVRALVRLTSIP"
     gene            complement(<366314..>366619)
                     /locus_tag="CYME_CMF129C"
                     /db_xref="GeneID:16993008"
     mRNA            complement(<366314..>366619)
                     /locus_tag="CYME_CMF129C"
                     /product="mitochondrial chaperonin hsp10, precursor"
                     /transcript_id="XM_005535726.1"
                     /db_xref="GeneID:16993008"
     CDS             complement(366314..366619)
                     /locus_tag="CYME_CMF129C"
                     /codon_start=1
                     /product="mitochondrial chaperonin hsp10, precursor"
                     /protein_id="XP_005535783.1"
                     /db_xref="GeneID:16993008"
                     /translation="MSALSRRILPLLDRVLVEKIVPKKTTPAGVLLPESATAKALNEG
                     KVVAVGPGSYTREGQVLPVSCKVGDTVLLPEFGGTQIKLDGKDFMIYRDDEILAKLE"
     misc_feature    366800..367242
                     /note="possibel transcribed region"
     gene            <370196..>372025
                     /locus_tag="CYME_CMF130C"
                     /db_xref="GeneID:16993006"
     mRNA            <370196..>372025
                     /locus_tag="CYME_CMF130C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535727.1"
                     /db_xref="GeneID:16993006"
     CDS             370196..372025
                     /locus_tag="CYME_CMF130C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535784.1"
                     /db_xref="GeneID:16993006"
                     /translation="MSSLYTRSVTPSEASTKDHMTELDSERPVEDYSLGSFGRRTLAE
                     RNEEGTSASYSGRYDSPETDNEWLESQRLAEAVTERSPIRFRVRNANLLQTALSLKPE
                     SESQTDRVALDPPAFSDGQENTHAAERPKQSTYALGSCGRDLGGLAGRNSTSADEPSL
                     DEASDKTNREDDPDSLHLQVSDGSNPQPLLSKMTVLSDEEPQPRRITSEATSLSIAGT
                     AADEHRGIAPPLMGSNSVVASAVMSKSSTVSTSSTPVSSNSNNRLSSRRTLSCGECDN
                     SREQHSERVRNSAKLQADSSDTPGSRHADLLCEEDEILSAVHVDCSSTANVAWRTLTQ
                     ADAHQRTANDDPHLDAENTSLSTIFPDIRSAEAVESLRQQIQDLEAQRARLLSELDLM
                     RLNMERRFSVVEREIAETKLSIIRSLSSEGRSERLEVSESAVSEFPAATQIAVHADGS
                     RIGIPHEKSCDDQIAANSSMERNCIREHLLESNYSLTAAQVSSLAPSRVSDGAKNLRM
                     TIVQELHKTDIYGNMLKAWQTVFKPAGKHVDWNLFRIAVIKILRNHWLADRKVSDAEK
                     LMTTFTEPPDEIIYAVWKDIVGEQMGATMQWKHFVDLYGSMGV"
     gene            complement(<372576..>374906)
                     /locus_tag="CYME_CMF131C"
                     /db_xref="GeneID:16992945"
     mRNA            complement(<372576..>374906)
                     /locus_tag="CYME_CMF131C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535728.1"
                     /db_xref="GeneID:16992945"
     CDS             complement(372576..374906)
                     /locus_tag="CYME_CMF131C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535785.1"
                     /db_xref="GeneID:16992945"
                     /translation="MGFDASEKQIMHELLELSDEADVCVSARALARCFADKVQRKRPP
                     PPQISKSHEYPLEKKRRISFLSEELCATLPCGQEINVDFVGFLKDRLDSWYLDSTVEG
                     DSVDDAKLAQKLSMPPSVALEDVDIFMTRSPVLYVCKNCRRPVIESRVYEHILRCCPD
                     RWVPLLNECAKQVTNVATQFQRNMCDSDLHNVVLSFEFPEIYFSQLLDDEDGAPKTRF
                     GRHAKRVGKVYDSQLLFMHGMQSARAISGNRDQQHHTAPVDADLSLYRSFAALSTVKV
                     TRNAGIAETNSRITAGNVATEAAKCRAFHRKYFWPRIPYASKPNSAETESMPDRLDPL
                     ARLLYLNMSWERIMQMTLPPAMKKKVTSARGYVHPAKEQLSTKEELLPASTNTIAHAI
                     LRLQSKRSFGSSWLIDPRQLSQNRTTNGIFHGQSFFAQPGTFWTDPSRQLLPRLHQAP
                     TSTQRAVAASLSSASNGPSSIRSQLSDLVQRRNSVPDEASNAASTERNQVANAAAESK
                     SSQASAGIPQRLSSLQYRASMPSPLGAVSRQSAQPASGANAGHGTGLLTPGREVVQET
                     MRHRIAPDLVEWLRRDPFFLQMTEAAKERVLVMPNLTPEMQQQALEALEQRLMQERLR
                     AIAQAVVFAREMPQNSRARMSATSLLSTLHPMNESQRKALGEMVRQLLITQRASTQPP
                     RPPDRITEAVASEHSSSSIPSPASFASRTQRQGLDARPLQRLDAPREASNGSKADTDA
                     EPLHGKPGKGAQGRHRSDVDLLAAIDRALGIRRDPE"
     gene            375223..377146
                     /locus_tag="CYME_CMF132T"
                     /db_xref="GeneID:16993005"
     misc_RNA        375223..377146
                     /locus_tag="CYME_CMF132T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461262.1"
                     /db_xref="GeneID:16993005"
     gene            <377306..>378970
                     /locus_tag="CYME_CMF133C"
                     /db_xref="GeneID:16993004"
     mRNA            <377306..>378970
                     /locus_tag="CYME_CMF133C"
                     /product="ethanolaminephosphotransferase"
                     /transcript_id="XM_005535729.1"
                     /db_xref="GeneID:16993004"
     CDS             377306..378970
                     /locus_tag="CYME_CMF133C"
                     /codon_start=1
                     /product="ethanolaminephosphotransferase"
                     /protein_id="XP_005535786.1"
                     /db_xref="GeneID:16993004"
                     /translation="MSPALSKDAHSPVRRVRKVAGKFWNKGTYGACSDQVEQERRRSQ
                     LEHRGRQIPRKRCLRDRKGRIGRFRKHYLSTEELSRLAAYQNSGTDLSITYRYVLSPI
                     YARLVELLPKSIAPNSVTLAGLVFTVTGHLAVVFLACDGGIRDIKSLAQWVLHAKLGL
                     TGEPSNILKRSPNDSYVVSSLLSMPESCASGSSARIAYGFSAFCLGMYQLLDNLDGRQ
                     ARRTGSSSPLGHFFDHGCDALNVTFAGLTFALTAQFGWSLWTTVLLLFVGMMPFFFAT
                     LEEYFSGALVLREINGPNEGLLLMQLLTWLTAIWGPAFWKRLVVVPVFPSSIFSKHIC
                     LPSAVISILSSGGYLEIALSRSEWSMYHEMLRNRRAVALPLNRLFFLFTLLPVLPTVI
                     SNFITIFRNGSQLSESQRKLRRRHLVRLAVAYSFPFFTLAIAMIGWPLCSPAVVLANG
                     LLYHWLCGLTFFYICSRLILAHLTSSVYGSAFPALIPLWAGFLNALLGRPLPEFLVLL
                     TSFLFILFIVSRRVVGVVREISTFLGIRPFSIVGASSERMHGTDSR"
     misc_feature    381203..382680
                     /note="possible transcribed region"
     misc_feature    complement(381746..383632)
                     /note="possible transcribed region"
     gene            <383275..>384377
                     /locus_tag="CYME_CMF136C"
                     /db_xref="GeneID:16993077"
     mRNA            join(<383275..383595,383778..>384377)
                     /locus_tag="CYME_CMF136C"
                     /product="similar to UDP-N-acetylglucosamine
                     pyrophosphorylase"
                     /transcript_id="XM_005535730.1"
                     /db_xref="GeneID:16993077"
     CDS             join(383275..383595,383778..384377)
                     /locus_tag="CYME_CMF136C"
                     /codon_start=1
                     /product="similar to UDP-N-acetylglucosamine
                     pyrophosphorylase"
                     /protein_id="XP_005535787.1"
                     /db_xref="GeneID:16993077"
                     /translation="MYEASPKRLPLSEVVKQAPQQLGHKRLVCKPQEQQVAVVLAAGS
                     GTRFHSETPKVIYPLDGKPLVRHVVEAVEQVDVPTVVIIGHEGSRVMKALADKNVIFI
                     EQTERLGTAHAVYLAQYALPEQFDGDIIVLYADVPGVDKDLLQAVLERKQNHRRADPT
                     FGALVVTGSRSLSLMSASGNYGRIVRDEQDPLCIREIVEKKQIDSMPETNPRKRMLAD
                     CDEFNSGIFVARAPALFRALGSVLPHRVGQHRCEYYATDFVEHMVAYGLHVYAWQVPA
                     ALQFKIEGANTLEEAQELERRLRTQSSSGR"
     gene            complement(384576..386666)
                     /locus_tag="CYME_CMF137T"
                     /db_xref="GeneID:16993001"
     misc_RNA        complement(384576..386666)
                     /locus_tag="CYME_CMF137T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461263.1"
                     /db_xref="GeneID:16993001"
     gene            complement(<387229..>389079)
                     /locus_tag="CYME_CMF138C"
                     /db_xref="GeneID:16993000"
     mRNA            complement(<387229..>389079)
                     /locus_tag="CYME_CMF138C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535731.1"
                     /db_xref="GeneID:16993000"
     CDS             complement(387229..389079)
                     /locus_tag="CYME_CMF138C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535788.1"
                     /db_xref="GeneID:16993000"
                     /translation="MMPYVFACGTKDDVCLSRARGLVAGGACEIGDALGARCLSFCGV
                     SAQGLINSKHAPEAAYSRRCGARGSNWTKRSARLVRRSRMHLGESPVPTLPVPVAATR
                     STRESVSVETRKKSPLSVKLQCRVSTIAPLHRPWSMGLQEFPESRVRSMGTALGRHRS
                     LKLCAAASDTARFSSAQVSKHRRSMEYVFRLEVVRASLIAVWEMSLFLMTGYLLHRTH
                     ILDPQTVQGLSKAVYHIFLPALCFVNISAHVASSGHTSMLPLFFAAFLHIIAGIAAGE
                     LLSALLQVSSNKRRFIRIACGFGNSTSLPGLFYSSIFASDPSRATSSLGLMSIYCITW
                     TAAFWPYLHANFGAPNVENAQQLEGTKTGAPDMDPQRSGDPPKYEATSKILHSGLYTV
                     AIRRIGSLIYALGTPPAFASIIGLLCGLVAPLRNLLFQNNHVLSVGLVLTVKSLAAAN
                     GACAMLVLAASLASRPGHGSSARYSFVARNGSSTTASHPTKLFLPLSFIVGLYQRALR
                     LLGSADFEIVVPALITRCILLPCLTFALIFPLADAFGLIPAGPTGTLMRFVMILQAVM
                     PPAQNIVVGLQLEGDADEAAYAGRQLLVTYLLSLIPLCILLTLFLGILNV"
     gene            <389730..>391337
                     /locus_tag="CYME_CMF139C"
                     /db_xref="GeneID:16992999"
     mRNA            <389730..>391337
                     /locus_tag="CYME_CMF139C"
                     /product="serine/threonine protein kinase SNF1"
                     /transcript_id="XM_005535732.1"
                     /db_xref="GeneID:16992999"
     CDS             389730..391337
                     /locus_tag="CYME_CMF139C"
                     /codon_start=1
                     /product="serine/threonine protein kinase SNF1"
                     /protein_id="XP_005535789.1"
                     /db_xref="GeneID:16992999"
                     /translation="MSSRPGPEFSGAPFRSQESNIVAAVPPGSSPPVKIGSYVLGKTL
                     GVGSFGKVKEGYHELCGQKVAVKILNRSKVHVMDMTPKVRREIMILRLLNHKHLIKLY
                     EVIECPSDIFVVTEYISGGELFDFIVERGRLPENEARRFFQQLIGGVEYCHRHMIIHR
                     DLKPENLLLDENLNIKIADLGLANIARDGEFLRTSCGSPNYAAPEVISGKPYAGPEVD
                     IWSCGVILYALLCGSLPFDDESIAALFRRIKSGQYQMPSYLSPGARDLISRMLIVDPL
                     ARITIEQIRKHPWFVENLPRYLSLPPPTGCARSRSINVEVLRECIRRTGFPEEKIVWS
                     LKHGKRNAYTVAYELIHDAMNRMDDSMLQPVDIRSLFSFPGIGTGSREKNVPESIDTG
                     AHGDAASRAAVLPSSATSAASASPLQYLDELDEDDIMPCFVFGSASRRIQLGIVNSYL
                     SASEIMMELYRALSVLQWRWKSPSVYHIRVIAASIESALPGAKQVRLVIQLYRTTSRF
                     VVDIALHDGDLFSFILACHMIVCELRI"
     gene            complement(391624..393887)
                     /locus_tag="CYME_CMF140T"
                     /db_xref="GeneID:16992998"
     misc_RNA        complement(391624..393887)
                     /locus_tag="CYME_CMF140T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461264.1"
                     /db_xref="GeneID:16992998"
     gene            <397391..>398044
                     /locus_tag="CYME_CMF141C"
                     /db_xref="GeneID:16992997"
     mRNA            <397391..>398044
                     /locus_tag="CYME_CMF141C"
                     /product="similar to prefoldin subunit3"
                     /transcript_id="XM_005535733.1"
                     /db_xref="GeneID:16992997"
     CDS             397391..398044
                     /locus_tag="CYME_CMF141C"
                     /codon_start=1
                     /product="similar to prefoldin subunit3"
                     /protein_id="XP_005535790.1"
                     /db_xref="GeneID:16992997"
                     /translation="MKLKLFNATAHLRPAICRQCRRDVSNYAVPTHFRVVLLDGMASQ
                     VPVLEPQTLLEDPTGLVKSSPQGARPYLEQLELQIRYRRALELRLNSRLQGLESKVSD
                     LESALETLEFLHTDNTGELQLLGELETRFELCDGVYARAVIDRQSLKTVFLWLGAKTM
                     VEFSCEEAKALLERNLDLARKSVRELKEQLNTVRSEIVTAEVNMSRLYNAEVELRRK"
     gene            complement(398191..400227)
                     /locus_tag="CYME_CMF143T"
                     /db_xref="GeneID:16992996"
     misc_RNA        complement(398191..400227)
                     /locus_tag="CYME_CMF143T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461265.1"
                     /db_xref="GeneID:16992996"
     gene            <398377..>398778
                     /locus_tag="CYME_CMF142C"
                     /db_xref="GeneID:16992994"
     mRNA            <398377..>398778
                     /locus_tag="CYME_CMF142C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535734.1"
                     /db_xref="GeneID:16992994"
     CDS             398377..398778
                     /locus_tag="CYME_CMF142C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535791.1"
                     /db_xref="GeneID:16992994"
                     /translation="MSYTSPGPDPGAREPKTELIQRYPNDCLFFCAFHSMRTLTMTPK
                     HAAGCRVSTPFIRMVMKSHRWNTQKHAAMGGLCASHTWSSIPYGNTSSYSAGNGRLPL
                     SMRHVQLRTLDMWLGTPRRAYCRPTRRHKRA"
     gene            complement(<400441..>401472)
                     /locus_tag="CYME_CMF144C"
                     /db_xref="GeneID:16992995"
     mRNA            complement(<400441..>401472)
                     /locus_tag="CYME_CMF144C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535735.1"
                     /db_xref="GeneID:16992995"
     CDS             complement(400441..401472)
                     /locus_tag="CYME_CMF144C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535792.1"
                     /db_xref="GeneID:16992995"
                     /translation="MFANVSFFLPKAPRASYKCVRVGHVRFPTATARGRRPRMCVNGL
                     DSLQRAPPRLDENSRRALWKRIFHLEEEVRRAVEEERFEDAARLRDEAHEARQTDRFV
                     YLKQALLKAEEAKREEEIQALREALSKESPPPVEHAVEKRTGPQKKDTGRKASDTRRS
                     AFPEAGRKRGSRHPKPSPELSAALKRLEAAFGSTPNPAPASSQEAEQRLTNVTDTVDN
                     GVRVRVETFYRLEDSKPEAGEYLFGYNVRIVNETSKTIQLVARYWRIQTKEGLVSEVR
                     GPGVIGKQPVLERGEEFTYTSACPIKLKRPAAAGELVGSMEGSYRFVTGALGELSFEV
                     KIGRFGFFI"
     misc_feature    403535..406764
                     /note="repetitive element"
     gene            <406805..>408088
                     /locus_tag="CYME_CMF146C"
                     /db_xref="GeneID:16992993"
     mRNA            <406805..>408088
                     /locus_tag="CYME_CMF146C"
                     /product="similar to phosphate/phosphoenolpyruvate
                     translocator precursor"
                     /transcript_id="XM_005535736.1"
                     /db_xref="GeneID:16992993"
     CDS             406805..408088
                     /locus_tag="CYME_CMF146C"
                     /codon_start=1
                     /product="similar to phosphate/phosphoenolpyruvate
                     translocator precursor"
                     /protein_id="XP_005535793.1"
                     /db_xref="GeneID:16992993"
                     /translation="MDTRPKGSGHRFRAAGAFVVWTVISVLHLYVTRELLARFFVSEV
                     LLTFIQTLLSAIYGIILLRFVRGADSLRKLFRKKLLVKLLPVAAVAVFRDVSKFGGLA
                     RISVNLTVTIRSLSPVASVVLQKLFWGEDFPLETVITLIPIVGGVSLASAGDLLEASA
                     ASMERLQDVQSEPALHSLLGQGLGDLSRFLVGCLSCIFSVFLGVGHSMLTKRQFAGAQ
                     DRLDPLSMQIAQSVLSLAFLAPYFGLRFFVGCFGVSRGKNTFVQILTGRAVRLFQECT
                     ASGSRFRASKMVLQSLVGASGDPEIIQRRKSLFCMLALKGLVNFVQSLFSLISLNELN
                     NVSFTIASSMRRMISGMITVVLFYRASVSSYGILGIAMSIAGCVLYERTSSLGHRNPW
                     GKTLKWERDTHERAPERSSRVCETHQVSISDKSLP"
     gene            <411053..>411940
                     /locus_tag="CYME_CMF147C"
                     /db_xref="GeneID:16992992"
     mRNA            <411053..>411940
                     /locus_tag="CYME_CMF147C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535737.1"
                     /db_xref="GeneID:16992992"
     CDS             411053..411940
                     /locus_tag="CYME_CMF147C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535794.1"
                     /db_xref="GeneID:16992992"
                     /translation="MERSGGRGDGAAPPHEQPGVPCPGDSLAGQALSRALSGSPAESS
                     PESSQSTSRGILSTSGGFMQSEPSAGAGSSMSRAPTRAGLSPLSASPVLLEIPYGYTA
                     QQPFVGTAGMIARHGHFFHAVSGIRHELRTPVLAPFPMQNISSIDAAGRIWLPYIQTM
                     CSGAGNTASMGYFVDPRRYYRIVSRRERRFLQWMRIRGRETSVQQSFHDMHVMSHAMF
                     VQRNMSLCAGRRRRRHESRRAHALRRRRDNSGRFLSGPATRPHSTVSQQSHSTASMEP
                     RTGTESVEKNDQASFHGES"
     gene            complement(<413122..>413652)
                     /locus_tag="CYME_CMF148C"
                     /db_xref="GeneID:16992991"
     mRNA            complement(<413122..>413652)
                     /locus_tag="CYME_CMF148C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535738.1"
                     /db_xref="GeneID:16992991"
     CDS             complement(413122..413652)
                     /locus_tag="CYME_CMF148C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535795.1"
                     /db_xref="GeneID:16992991"
                     /translation="MKRGAVKEALLQSRHPATMPCVQPPRSKSLATRLSITRIVATDR
                     KLSELEELHKILQEKSYPYGAPPPPKSYLFGGLGWVFGFGCAVGGPFLGIGAGYALSA
                     PGAVGGLVLPRPIAVFGGGFGAGAVCGIGFSAGLVTGIGNGYVPIGFWVPFQFAPRFL
                     RLEKLLDQLLQKFQSR"
     misc_feature    complement(415655..417159)
                     /note="possible transcribed region"
     gene            <416814..>419183
                     /locus_tag="CYME_CMF150C"
                     /db_xref="GeneID:16992989"
     mRNA            <416814..>419183
                     /locus_tag="CYME_CMF150C"
                     /product="B regulatory subunit of protein phosphatase 2A"
                     /transcript_id="XM_005535739.1"
                     /db_xref="GeneID:16992989"
     CDS             416814..419183
                     /locus_tag="CYME_CMF150C"
                     /codon_start=1
                     /product="B regulatory subunit of protein phosphatase 2A"
                     /protein_id="XP_005535796.1"
                     /db_xref="GeneID:16992989"
                     /translation="MQAPKTGIWEGHAEREPTPTQQGMDSERSRAESAVRSAPVAIPR
                     RGAQSTGGRSASTSSGGSGSTGSRNFEDVMPEDLRPSSPKTAHDWPRAMSPRGPAFLA
                     FRNTAGNDSREVPQAESNGARDTTEAAVLEIDEQIDSRPTAPSSPPPPASTLHVQQRM
                     PPDASVHPAVAAAAAAAASSSNSPRTQPTNAGSIGLSGSLNTDLLTSARSGTPGSWDA
                     RRSPSPTPEPTSVFYGLPALSEVQNPRARRELLCRKLHLCCEIYDFMDPTKDIVDKEG
                     KRIALIEIADALSNMKGILTDEVCAALVEMITKNLFRTLHMSPPTAPEAILAGELEED
                     EPTLEPAWPHLHVVYEILLRFVTSPDLDPRTARRYIDQKFLLGLLDLFDSEDPRERDY
                     LKMILHRIYGKFMPLRPFIRRSIANVFFYFVFESERHNGIAELLEILGSIINGFALPL
                     KEEHKNFLRKALIPLHIPRTVALYHQQLVYCMTQFVEKYPPLAVDILRGLLRYWPLTN
                     SQKEVLFLAELEEIIEQTHPREFSIVLEDLFRRIAKCMQSPHFQVAERTLFLWNNEYL
                     VSLILQYRERVFPIVFGALVHNERNHWNPTVTNLTCNVRKLMIEMDLPLFERCARLHE
                     RLHAQKADAERDDDGKRHPDGDNMPHMSVVNAPMAVPGSRGASKLPLTEPIPIQSTGN
                     AAGARRRTPRTLGAPDAPETLRASCVDPGEHLSSSATGTGAHQEESWSTNGASEDPSD
                     ETLYARSSSTRERMLVKPRETTTFESYRGQAGQDFVAKMHAMDLGHEKH"
     gene            420028..422906
                     /locus_tag="CYME_CMF151T"
                     /db_xref="GeneID:16992988"
     misc_RNA        420028..422906
                     /locus_tag="CYME_CMF151T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461266.1"
                     /db_xref="GeneID:16992988"
     gene            <422666..>423226
                     /locus_tag="CYME_CMF152C"
                     /db_xref="GeneID:16992986"
     mRNA            <422666..>423226
                     /locus_tag="CYME_CMF152C"
                     /product="3-hydroxyanthranilate 3,4-dioxygenase"
                     /transcript_id="XM_005535740.1"
                     /db_xref="GeneID:16992986"
     CDS             422666..423226
                     /locus_tag="CYME_CMF152C"
                     /codon_start=1
                     /product="3-hydroxyanthranilate 3,4-dioxygenase"
                     /protein_id="XP_005535797.1"
                     /db_xref="GeneID:16992986"
                     /translation="MNDASAEESCTRLSPIHLEAWIKKNRDLLRPPVGNVVLADGGFL
                     VMLVGGPNVRTDYHIENYEEIFYQIEGDISLKIVDEHQSPPAFKEVRIREGELFVLPA
                     RVPHSPQRPAGTVGLVIERKRAADDLDILRWYCQSCSAVLHSSEFHCKDIGKDLVPII
                     REYFADRCLRTCRHCGWIEPAPTEQR"
     misc_feature    complement(422851..424445)
                     /note="possible transcribed region"
     misc_feature    complement(424831..426906)
                     /note="possible transcribed region"
     gene            <426486..>429566
                     /locus_tag="CYME_CMF155C"
                     /db_xref="GeneID:16992983"
     mRNA            <426486..>429566
                     /locus_tag="CYME_CMF155C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535741.1"
                     /db_xref="GeneID:16992983"
     CDS             426486..429566
                     /locus_tag="CYME_CMF155C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535798.1"
                     /db_xref="GeneID:16992983"
                     /translation="MDKVAISRTNTASATPEAGKSHKPVHLPAGSLQETVETPDGRAA
                     SDPLERYFVNTEQLWTTLEQEFRQSDYEFGVSAAALLAQIPEAYRVSAKNFELTSTPE
                     FQYLSRKLGASHDLVETEAELTRSLERYIRFSNRCFEMQVAAEDPSAPTLRRCTSLGA
                     VAETESSLRDLVSELSSEWPRQLKTLSGALGALNLSRQRLERERQRLGSLIAVLEQLK
                     SVRDISRAAELYEEHQDLLKAAYTYQRLDACAHEVFRKWDAVPHASDVRSAGPAERSA
                     SADRQFDIADVRLVEDFSRHHRALRRRLGTALEHQIVAQFQITLSFVWSAAAEPAPPI
                     PTSTSMSTRTPERLTSEQTPGSSLALLCTLREEITPFVAALYQIGMASGALYRVTTGL
                     LHELNNIVSAEQDAWACDSAQAFTTFLSKCRTFVPGAVAVIDTFFEVASQLESLEASG
                     HVPHRSHVERADVLSAFRDGFGARFRDAVDSVVQACRPADFEQVRFLLKIHVETRDFL
                     KFLDRILEVRNDRPAASSSVVLVDLRDRIRNTMQAAFEKKLESMQVSLNAERWVPATS
                     TAALQSLLDRLVRDTSAPLYAESMTMEDGKVREHSEGQPATVVLMGERFVLVDASQDL
                     FELLDACALCFRDALHCEEVALAHALSMRVLEALRTFNQRSLQLVLGAGAMKTAHLKA
                     ITAKHLAVCARTVDLLLRLLHPQESDRYQGLQRWFCPTLRQADVGMDPDAKPALERNS
                     PRAEDAARQHAIELSDATAGKLHVVPGVPQEPSSSPQTEGGAATVHAVPELATPREPS
                     AQSVVRDADLERAFERTIADLQVHRAQLLNKIVIIMQTRLRNRIAELRRLPLEQYAVV
                     SETGCAAPSTWASALIRDITTLERILSSVLPTVALRSLFEQIIAAYSQNLRAEFVRLT
                     EEYLGGNRGPSTNVEAGAVPPLGTMLNQVAADATALAEAVRNLVSSLNANISESYVAD
                     FDAIAHTYHNLAEKHASASSPVDPAEAPCAATTGGSACENEVTPSTDPIEGDAR"
     gene            <431419..>433608
                     /locus_tag="CYME_CMF156C"
                     /db_xref="GeneID:16992982"
     mRNA            <431419..>433608
                     /locus_tag="CYME_CMF156C"
                     /product="cystathionine gamma-synthase"
                     /transcript_id="XM_005535742.1"
                     /db_xref="GeneID:16992982"
     CDS             431419..433608
                     /locus_tag="CYME_CMF156C"
                     /codon_start=1
                     /product="cystathionine gamma-synthase"
                     /protein_id="XP_005535799.1"
                     /db_xref="GeneID:16992982"
                     /translation="MRRGRGEPCETGARRELACTLSFVPPGSAGGWTRGKPPPPPPTP
                     TPRAPLSPRSPPGSCQQVSRTIPASARANNCERVRIHAVDSCVSLVALRRRDSSGIGV
                     LGRDRARSSSSSSSSSSFWLANTPTRRWCTGLEARGTGFFVPRSSEHLLYNWGSRRHV
                     VQRGTCQRASAGALMLSLTSHRRQETPCSSRTNAGDTFTSDELATVEQLLEVAPQERA
                     ELDRGGTLSESDGNGRGEAEGVAATAPAATEGMDRQRARLIQDARSSTRAVHGGERAK
                     GGKKAKATADSLTTPIVQSSTFTFRNTRECIQYNLGKYSSFEYGRYGNPTTRAAEEKL
                     IDLECGNLAQQDAHPDSAVYDALLSASGMNAVTTMLFALFALDNADVRGAGLGTTVSE
                     EGTGGCLITTTDCYRRTRQFIEEMMPRLNVRVVIMDPSDLALLESTLREIRESTDGAI
                     TQQRVVFFSESPTNPLLRLVDVPRIVALARQYDMMVCIDSTFATPINHRPLELGADLV
                     LHSATKYLGGHNDILAGALIGRAELIAKVRRAHGILGGVIDPHTSYLLLRGLKTLKIR
                     VDAHNQNAAALAHRLANDERIACVHWPGLPEHPDYHLGRRLHEAYAQFRAADGGCGFG
                     GVLSFELRGHLRGGADDPYGAETFRRTGKFIDALRIPYIGPSLGGTETLVEQVCIMGY
                     FDQPLWRRRRLGITCGLVRFSCGIEDAEDIVQDVMHALDVAFEDTYV"
     gene            complement(<435336..>437273)
                     /locus_tag="CYME_CMF157C"
                     /db_xref="GeneID:16992981"
     mRNA            complement(<435336..>437273)
                     /locus_tag="CYME_CMF157C"
                     /product="probable U3 snoRNP component Utp7p"
                     /transcript_id="XM_005535743.1"
                     /db_xref="GeneID:16992981"
     CDS             complement(435336..437273)
                     /locus_tag="CYME_CMF157C"
                     /codon_start=1
                     /product="probable U3 snoRNP component Utp7p"
                     /protein_id="XP_005535800.1"
                     /db_xref="GeneID:16992981"
                     /translation="MVEERVTTLEATPGYKRYQRLPPAATALLSDHTMVRVSQRSLRH
                     KIEQVVHQSREAAERSAELDLLLDREGRRGFIEPESELERHTSHVSQQALQEASSLYA
                     QRGRFRLDFEDYSRTRASQVLRKQERAASSNGVEHPTMGYRARYSASSRVLLLGGLHN
                     GHVVVLDWRRKRTMAPELHLGEHLRDVVMLHTDGLFAAAVERAVAIHDAVSGAQIHCL
                     RQHSRPHSLDFLRYHLLLLSMSETGELHYTDVSNGMTVAQFPTHLGRPSAALTTSPYH
                     GVAFTGHANGTVQLWSPAMPNEPLAKVLAHPGYGGVAAVATDHGGRYLVTAGAASRHF
                     AVWDMRKLFRPIHSYESKSGGLITSMDVSQTGLLAIGHSAGGRVIIWKDWALYEAKAY
                     EPYLQTRVGVGAGGTRISAVAFAPFEDVLGVGYSTGFESCLVPGSGEPEFDALEPNPY
                     WQKAQRRAAQVQLLLEKLPPETIALDPNFIGRVERDHRRVQRTGRRVSQLRYRPPAET
                     APNEAAPREDQSSAPEDAQTDENGGLSASVPPWRRRVKHPSLRKSRGRNALANRLRRR
                     QQNVIDTKAEALRTRLVQMLQHRRRRRQRGHPRVHDHETGQRSSKDATQATLRSERHT
                     NRAHLAKLMPRALQSFHQHQR"
     gene            <439573..>439983
                     /locus_tag="CYME_CMF158C"
                     /db_xref="GeneID:16992980"
     mRNA            <439573..>439983
                     /locus_tag="CYME_CMF158C"
                     /product="dihydroneopterin aldolase"
                     /transcript_id="XM_005535744.1"
                     /db_xref="GeneID:16992980"
     CDS             439573..439983
                     /locus_tag="CYME_CMF158C"
                     /codon_start=1
                     /product="dihydroneopterin aldolase"
                     /protein_id="XP_005535801.1"
                     /db_xref="GeneID:16992980"
                     /translation="MQGRLFLRGLRFFGYHGAVAAERTLGQVFQVDLEVATSVLGRAA
                     RSDSLQDTLDYVKLYEIVKEVVQGPPRNLVETLALDIIQRVFQSFQDAEEVSCAVHKP
                     AISIPGKVDQGSIGVQFTRTRQASCSSNSAATPC"
     gene            complement(<440792..>443332)
                     /locus_tag="CYME_CMF159C"
                     /db_xref="GeneID:16992979"
     mRNA            complement(<440792..>443332)
                     /locus_tag="CYME_CMF159C"
                     /product="AAA-metalloprotease FtsH, mitochondrial
                     precursor"
                     /transcript_id="XM_005535745.1"
                     /db_xref="GeneID:16992979"
     CDS             complement(440792..443332)
                     /locus_tag="CYME_CMF159C"
                     /codon_start=1
                     /product="AAA-metalloprotease FtsH, mitochondrial
                     precursor"
                     /protein_id="XP_005535802.1"
                     /db_xref="GeneID:16992979"
                     /translation="MQALCSRRLLVHLWRGSALSGAQKAAVHLRCSGADSQNAGLLRR
                     EVVHRVVRAPDELLARCLSANRWNSSFRDLYPRGWKKGKPPEEQPTLKPGVGSPADRE
                     GLASDTQPERGDASRAKGSRSGGGAPGPNWWALLVFGSGLAAALWLSGSESGASNPFS
                     TPKPRQISFQEFSREYLERGLVSHIVVVNRSEARVFLKREAQGRASARPGNGSPWESP
                     WQRPVATFVVPSVDVLERRLEDIQSRMGLEPIDYIPIVYRNETSALSTLVNWAPTILL
                     IGAYIYIVRRMSGLGGFGARGGTGAGFPFGGMLRPPGSSGSTGSGSGAGGITGGGIFN
                     VGRASVTVLNRDPKSRIGTRFSDVAGLDEAKEEIMEFVSYLKSPERYKRIGAKIPKGA
                     LLHGPPGTGKTLLAKATAGESGVPFLTINGSDFMELFVGVGPSRVRDLFAQARQLAPC
                     IVFIDEIDAIGRSRGRGGLIGGNDERENTLNQLLVEMDGFQPNSGVVVLAGTNRVDVL
                     DPALLRPGRFDRQIAIDPPDIKGRKDIFLVHLRPLKLDPSIDREAIAKELAARTPGFA
                     GADIANVCNESALIAARAGAKGVARAHFEAAIDRVIGGIEKKTMVMSPEEKRTVAYHE
                     AGHAVAGWFLEYASPLLKVSIVPRGSAALGYAQYQPRDQRLYSREQLLDLMCMTLAGR
                     VSEEIFFGQISTGAADDFSKITTMAYNQVTQWGMGDALGNLAFQRRNDDTSPRFYKPY
                     SDKTAQKIDEEVRQLVRSAYERTRSLLEEKKEQVRLVAEELLANEMITREGMETLLGK
                     RPFVEHKTFDELAQGASPTGKAATVAQDKALSGADPGQGVETVGGPTP"
     misc_feature    443797..444981
                     /note="possible transcribed region"
     gene            <447980..>448546
                     /locus_tag="CYME_CMF161C"
                     /db_xref="GeneID:16992977"
     mRNA            <447980..>448546
                     /locus_tag="CYME_CMF161C"
                     /product="similar to cleavage and polyadenylation specific
                     factor 4, 30kD subunit"
                     /transcript_id="XM_005535746.1"
                     /db_xref="GeneID:16992977"
     CDS             447980..448546
                     /locus_tag="CYME_CMF161C"
                     /codon_start=1
                     /product="similar to cleavage and polyadenylation specific
                     factor 4, 30kD subunit"
                     /protein_id="XP_005535803.1"
                     /db_xref="GeneID:16992977"
                     /translation="MTINQNEQEIIYEFEKYTGLAQQEYDDQTAPGKDTDICQAWLEN
                     RCERGDLCQYRHSRSKSLIVCKHWLRGLCKKGIECEFVHRFELDKMPECFFFSRYGEC
                     TNDECMYRHVVADSRRMECPFYARGFCKHGPRCRYKHVQKVACANYLGGFCPKGPACR
                     FGHAKFEIDLQQVLHEAERFGDRSVSWR"
     gene            complement(<448574..>455206)
                     /locus_tag="CYME_CMF162C"
                     /db_xref="GeneID:16992976"
     mRNA            complement(<448574..>455206)
                     /locus_tag="CYME_CMF162C"
                     /product="similar to general negative regulator of
                     transcription cdc39"
                     /transcript_id="XM_005535747.1"
                     /db_xref="GeneID:16992976"
     CDS             complement(448574..455206)
                     /locus_tag="CYME_CMF162C"
                     /codon_start=1
                     /product="similar to general negative regulator of
                     transcription cdc39"
                     /protein_id="XP_005535804.1"
                     /db_xref="GeneID:16992976"
                     /translation="MNFGDSSTTRQIGLGELWPLLADVDLKWFARFLRVLLQLAEPSD
                     EDTGRMPRLEASGIVTGNRSGCRSGRRFTAEDRFRLPLSACALLWEQARASNDAPGRR
                     GPGEVAAGDEPSASERKFDWEDSQACVVFTLAELSSLVPASIREDFDSVLRCLLEDED
                     EVIILTENTQLELLDAVYVTVTGQPGIPACVLVERSYANVEAHISLLCWGLCEQRLSF
                     PTCTPDSSLENRLCPIAPIEGLHQSTVKLIQEHDAYWRWGVVQILEYLLSFGDTALRP
                     KAQAALEQGIQEAPEVLACALAETPKPTSMGGAALREHALDVLLPSFLMGGTNPNSAA
                     VARRVWQHDRAALIRAAMHCWQKDRAAAARLLDVAQDLKAVPETLAVVRPYEFAIDLA
                     LLASRREYINLRKWLRDRLHDHGSEFFGACLNYLSERAAQGDAAALFSLEATATMLKV
                     LTENVGLVDERMREELDQLCRTSAKEGDSQDAFPPEIEERANQFFQRIYAEKTSIAQA
                     ITELQELQNSHTESDDMLVRCIIHNLLDEYRFFSRYPDRELRITAELFGALIKNEIVV
                     PHSLMFTLIMRYLLESLRKSPPNKMFQFGLMALGTFQHRLAEWPQYARYIVQMPHLRQ
                     TAPEFFQSVLAIVEGAEGHEAFHGEAPDESDAFRSGAKKPVAVELSTGADAKSTSASA
                     ERASPRVRGETVAGAGMQDMHKNIMGAAERASTSASPSSAVAAFGLSTPTTLEVLLRA
                     SRDEQRPMSVPDTSIQDKVHFIFNNLSPENMDSKVRECFEIVHEEYWDYLAQYIVVKR
                     ASIEPNFQATYVMFLEHAPHLIPLVLRKSYDNVRILLNSEKIRYSTAERSVLKNIGMW
                     IGSLTLARNRPILRRDLDLKALILQAYTTGLLIAVIPFVCKILDACRVSRIFRLPNPW
                     IAAIFGLLREIYELSDLKLNLKFEVEVLCKNVEIDLHSVKPTHLLASRSRPVGRENPD
                     FTFKEGSDLLASPSSRREMLTPHSATPSTLPTAATPGLATTGTERPPGAATAAAGAGA
                     GAGAATAALASTPAGALASATRADRSDDRSSFDLGALRSSLHLATTAPPLAAARAAQL
                     AAQTAAIADGVTVIPNLSQYISVNEHPELFQNPSVLKRIVAVAIDRAIREFIQPVTER
                     SALIALVTTRELVAKDFSQADGELALMAGQRMAQALASGLAHITCKDPLRISMIGHLR
                     SVFSNIGGDQTIVEQAVQGIVAENLDTACAIIERAAAERATRELDANMLVAAMSSHRR
                     MPQLPPSLVSVMQQPPIPLLQPPASVYEAFSMRATALWNYGAMENHVVKTTGYPSAFA
                     SAPPSVAPLSVAGQSTSAPMGVGGVATAVTSSAIPIAVATTDATGAGPAAAQRFPSGA
                     AAAAAAAAAAAAPPPPAAVASAVSTPGGLTESPDALMRMVSAEERFMQAYALLMNVAN
                     AELQANPEMTLSAAGGTKRVLQQIAALVRRFGDMERLCVSLAMKVFRWLLDARVRLLV
                     ETHVVLLKLLSDPAPRIHADVASWCAALSAKGNNTNVDADHPLGVGVELTPDILHALQ
                     RGGFDVLHSRLLDAAAPQTPGPAYAGGISNAGGGAGGGGSSAAAAPSLAPMEMAGAGA
                     GAAGMLPPAPPLAGVPVPGTSLQASPLMMQKCGTAGAVSNTSEREQIAHLMDAWQHIR
                     NSGSSLSELLPLLSRFQLDALVPAVVAYALEPGHQVLPSAVDEAALLVVALVREVPGL
                     DLSERMVLLQAALQEAVQQLLRNAGDPRPPAWFLRSLARALHDTDRERYSKDASDDDR
                     PASNEVAGSEGPASSTPDLSMSSPQILSLFGVALHAIRPAVAPVFAFSWLELVSCPLL
                     MPRMLLSRQRAGWPAFQRLLVDALEFLQPFLNAVPKGQPLRSAVRLFYRGVLRLLLVV
                     LHDFPELLVESAPVLCDYIPLHCVQLRNLVLSAFPSKLRLPDPFSPEVTIESATKIHT
                     VPRLSANPASVLGRSELRAVLDEYLQQGAPTGFMLNLSARLRADDPLGRYVVPLVNAA
                     VLYVGQYAVQARAMESFIPVFLHFAEELDDEGRFLLICAMANQIRYPNAHTSFFALSL
                     LHLFRHGHVRIRELIARVLVERLFAARPHPWGLLVVFLELVRNPEYGFWQSDFIQLAP
                     ELHRLMDNVARTCLGVADARAAAAAGLSSERKSAPRGMNATSLSPSMGAAAETPGGST
                     GAGGGAGDKSRQNLPDDTNR"
     gene            <459572..>461500
                     /locus_tag="CYME_CMF163C"
                     /db_xref="GeneID:16992975"
     mRNA            <459572..>461500
                     /locus_tag="CYME_CMF163C"
                     /product="similar to heterogeneous nuclear
                     ribonucleoprotein H3, isoform a"
                     /transcript_id="XM_005535748.1"
                     /db_xref="GeneID:16992975"
     CDS             459572..461500
                     /locus_tag="CYME_CMF163C"
                     /codon_start=1
                     /product="similar to heterogeneous nuclear
                     ribonucleoprotein H3, isoform a"
                     /protein_id="XP_005535805.1"
                     /db_xref="GeneID:16992975"
                     /translation="MASTGPDYLLFLDIQRLFGDRGASEVFRLAWLVGDRRARVLDAK
                     QLYVRPVSAALRQRLRSLLQPSDAGAERIVEALEAESDRRGVYPVLISNDIAVMYNLV
                     DAIEELAAYSRQAFVQYDRRFGTVVASKGILMQLVHDLEQQLLQQAAVGPESETVIRN
                     SLDLVLGDYYICPVRSAVGADAFAACREMHTRFAQDGGMFIPEHFSWNSGLMRSMPRN
                     GYASGTLPYIGADMMVGGSSWPGAFMPAQSVAMGIPAQMPPVRSHRDALGIGTPFAGG
                     ELLGTASTARAPQSVVIPSSTASAASTVAPATPVGSVVRLRGLPWSATTRDVAEWIRQ
                     PPAKATMGADSSLLEDFIRRPLQVLPGGIVFVYNHQGRKTGEVFVQFASPEDASRCLH
                     KHEDRMGHRYIEVFLSSHQDMWNLLSRYEAKRAALGLGAAGSPAATSGAQVRNGNRTD
                     RELGLSPANVSQQASAVAMGVPLRQPGDWTPSSATFRPEMVSHTPPEGLAPVVQAGTS
                     ASTREGPMDLMSATQSPCLRLSGVDATVTERDVHRFIAPFQLDTSQGASILACFADHG
                     VRVPPGTTIPPVFTVRNSTGQPSGEFTLVFQNVSERDRALCKSGQLLGSRPVKLSSIS
                     CFELAAALGILGITRAGV"
     gene            complement(460143..462992)
                     /locus_tag="CYME_CMF164T"
                     /db_xref="GeneID:16992974"
     misc_RNA        complement(460143..462992)
                     /locus_tag="CYME_CMF164T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461267.1"
                     /db_xref="GeneID:16992974"
     misc_feature    462380..463941
                     /note="repetitive element"
     gene            complement(<464950..>466158)
                     /locus_tag="CYME_CMF166C"
                     /db_xref="GeneID:16992973"
     mRNA            complement(<464950..>466158)
                     /locus_tag="CYME_CMF166C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535749.1"
                     /db_xref="GeneID:16992973"
     CDS             complement(464950..466158)
                     /locus_tag="CYME_CMF166C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535806.1"
                     /db_xref="GeneID:16992973"
                     /translation="MQTAKTTVQRRGRPYPALLFVQQPTRTLPGHRFPLRALSRLQRP
                     GLASRLSSWRLVTERETSPTSLLIVPLGYVTTAVACLWVHGKHCETSPQPHSGAEDSA
                     PALPQSVVACYRQGSEVADYRLLLQDRVCLSLSQCVEPDHLKLITHVLVHGEWISWLE
                     HVVGDGLLPSLRWIGLLSSTSLYAPGGESWIDESAPLDLSTEKAAACWQAEQRAGELA
                     HRLEVRLARFRLGAVYGPIPPSLRGKRGWTRRSVLDTMLAYHEHSETRQGSRRPRDTL
                     VNRIHVADAARLLLSGVAQRAKGVFNLVDNEPATRAQVEDYAAQSRTGQLSAISSESR
                     LQKRIRNHTAKAVLLGGSADLWYPSYREGIRAIAEGEMFPFHVDQLPERLSATSDAHK
                     SRNANPGRIE"
     gene            complement(<468180..>470504)
                     /locus_tag="CYME_CMF167C"
                     /db_xref="GeneID:16992972"
     mRNA            complement(<468180..>470504)
                     /locus_tag="CYME_CMF167C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535750.1"
                     /db_xref="GeneID:16992972"
     CDS             complement(468180..470504)
                     /locus_tag="CYME_CMF167C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535807.1"
                     /db_xref="GeneID:16992972"
                     /translation="MATAAPPFHYGTRVFLDCTDLSAHKLEWEQRLSCRVSERRLSPR
                     DAVWNLTPASESLKRPDEGQVPSGSLELERLIQARVPSVGFLARDPEAVSTLRLTALE
                     VPNCFQGTASNWKLARLAALENRYASIWQSVSSQFLPKRSTYFAPALVLQLDVLPGAS
                     ALRPRLQTRSQKEHIEAALASKQCSMSAHTVHPRLDVRLRTPPASRVTPSPKAEAEPL
                     PSLTRTECDTRVAATDNNNNNSSSSSASVLHAGGVHDSASPFLESTSSASVLRAGGAH
                     HSAAPFLEKAAHMPASSVLAQQTDTAVAERTSSPGHVCIHFAVQCDDSVLQQMEAAAN
                     HLSLCMTGNMMELGSWNLNVARKLEFSVQRRTFYLTVALFSTGALTSESIRYVYFFLD
                     DRLGDRRATRVIFEVPAYSVQRTGAASITTAESILRHSSTDNAWLDAFRPRVRSVSRS
                     SASKPVRVHDYIEAVQDAFTLIKLRVHIERPVAPAQPEHLIKKVYATGDVYQLGLWTQ
                     PGLVALQRAASEPDTWELSIVRPPWDDVEYIYAIESEAEDAIQYEHRPTRFRRLCDET
                     TCLNHTMVCEDIVSPPSTATTPTLISLSVNPAVLVGPFLSATQLQTTLVSLVAASTDR
                     SLGLVIVFLPHERVHCTNPAEREQLQVSATRLGIRLLLVPLPSNRLLMTAEWPDDGSL
                     AAETGTDQGALLKAVATAEAVLQRGSAVYFTSAGSYRVLATVLAVLSQRAVSTDREAP
                     RERLYEMLECIRRETGLIGLPNYALWRLLLNVAP"
     gene            <470971..>473694
                     /locus_tag="CYME_CMF168C"
                     /db_xref="GeneID:16992971"
     mRNA            <470971..>473694
                     /locus_tag="CYME_CMF168C"
                     /product="similar to autoantigen"
                     /transcript_id="XM_005535751.1"
                     /db_xref="GeneID:16992971"
     CDS             470971..473694
                     /locus_tag="CYME_CMF168C"
                     /codon_start=1
                     /product="similar to autoantigen"
                     /protein_id="XP_005535808.1"
                     /db_xref="GeneID:16992971"
                     /translation="METHIISDEDERLARQRKMLFEKFGIEADTLGDAAPSAVPPNKS
                     AEYTEADRVGVLGKTSCGQAQGQRAISPPSTPSVVQIAEESQDADLHNATPDPQRDYG
                     LRLLGSRFHYRASLHEQARASRELFAVTPVTAYASPLVESSAHRIAVHDHWIAYAVKN
                     HIRLLDRLQIQRALLKGHEGPVEELSHAPQCPQLLLSSAADGSVIFWRLEGWDGTSRS
                     PSEHLQWRFQLSNRRSSRIALSPDGRWIAFTEDARVHVLPVTADGDVESRQHTVIPTT
                     HEVRDIAFVAKAAAAGWLLVLASAHGMVHIAEPEHGTIVGEFCAHSGAPVERVLSLAP
                     QVLVTATSCCTELWYWRLVGLWAPPQSGSVQLLARCSFHEYASLGPLATDPEGEFLFL
                     ANHETRQLFVLHHASGTFIPDYLVQVPLRYSIASFCATRSVRRERDLDEKSGLPQLRE
                     NVFLDLWCMHEKCIQGYHVRREHLAPAGEAPPAELSLESSNHDENYNDLDDPVHDDDD
                     DRHRAVGAAGDDDDHGDAAGNRVHGRPVLDVSASQPLEGLMSTSPPVLVTHTHTLYEA
                     FRKIAPQLKQRSSSSRKHSAIGVGSAASSSPSPNAGDAASSLPVDVRTLAPESNGEAG
                     AATPKRGDFPDQATSAGMPLFTEKRILELEARLTRIEQLLHELMGTVNHTRSETASTM
                     HGLLQQIAKEHLVPALMRTSAETATSLSRALDEAIRVRFKPVTEQLEQALQRTLQWPT
                     SGPVSSAGMTATTLVPTGYTAPTPTPREQILRWLHQQPMPDEDRAFHAALNLSDLETL
                     VWLCKQCSPELVCEKLSQPVLLSLVQQLGFDLRTHLECKLSYLEEAVPLIQPKDPIIA
                     RHMEPTMRQLVHNLDEQVLHAGEEVAPALRTRARLLRKVATLLLLSPSPAS"
     gene            <474176..>474814
                     /locus_tag="CYME_CMF169C"
                     /db_xref="GeneID:16992970"
     mRNA            <474176..>474814
                     /locus_tag="CYME_CMF169C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535752.1"
                     /db_xref="GeneID:16992970"
     CDS             474176..474814
                     /locus_tag="CYME_CMF169C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535809.1"
                     /db_xref="GeneID:16992970"
                     /translation="MVGGTFPAKNCTRGNRIWSFRILDTNKYEDARRVKEITCVQIGF
                     ILTCKRSEKERCLFISLVEPAFEGNARHVHGNSSSGKHVFLNKRQATVKTASVLASMG
                     SYGCLYIATRIGMFNKLCFFIGAFLGFFFAQLSHLISDKMVFYRAKAVVEHAAATDIE
                     LLFMPAYSIQFSRVKSVFSVVERHHFAQRSMDWSFESVTPLFDMSTSVVINP"
     gene            complement(<477450..>479777)
                     /locus_tag="CYME_CMF170C"
                     /db_xref="GeneID:16992969"
     mRNA            complement(<477450..>479777)
                     /locus_tag="CYME_CMF170C"
                     /product="vesicle coat complex COPII, subunit Sec23"
                     /transcript_id="XM_005535753.1"
                     /db_xref="GeneID:16992969"
     CDS             complement(477450..479777)
                     /locus_tag="CYME_CMF170C"
                     /codon_start=1
                     /product="vesicle coat complex COPII, subunit Sec23"
                     /protein_id="XP_005535810.1"
                     /db_xref="GeneID:16992969"
                     /translation="MSIDFAQLEEVDGTRWTWLFWPTTKAAASQCVLPFACLFTPLRP
                     LPNMPPPLPYPPVTSREGTVLNPYCSVDINARMWVCPFTFQRNQLPPQYASIPDNQLP
                     SELIPEYTVVEYRLNRPPAPPPAFLFVLDTTVPEKQFTVVKEYLLKALSLLPPGTTVG
                     LITYGQHLQVHEIGFTEGFRSYILRGNKSYDAASLQPLLGLGGASAAAGAGASAAAKQ
                     RADATAAGAHSKLAPPDRFLQPIQECEYMMATLLEGLQRDAWPVPADERPKRCTGAAL
                     AAAAALLECTYRGYGAHICLLQGGPCTEGPGTIVGPKLDEELRSHIDIEKDNAPHLKK
                     ALKHYDEVATRLVNAGHALSVFGCSLDQVGFYEMKACVDRTGGVFVMAESFEHDMFKR
                     SFEKFFECDENGHLKRHFLATLEVDCSREFKIAGVIGPSASLEKKGPSVSTDTEIGIG
                     GTCAWRIGSISPDTSLSVFFDVVNQQSNGIPENHYRYIQFRTTYQHSSGEFRMRVATH
                     AGRWCDGNDLVTLAAGFDQEAAAVTMARLAAFRTENEEAFDILRWLDRLLIRLCARFG
                     DYQKERPETFRLGPSMSFYPQFMYHLRRSALLQTFNTSPDESAFFRSHLCRVSTADGM
                     LMIQPSLIQYSLESAPTPVLLDVASVRPDVVLFLDAFFYIVIFYGDTVAQWRKAGYHL
                     QPNYRNLAELLEIPRRDAAACIAARFPYPRWVESDQYGSQARFLLAKLNPSATHTSGN
                     VDVLSGSAAAEFIYTDDVSMEIFLEHLRRATVATT"
     misc_feature    478807..479670
                     /note="possible transcribed region"
     misc_feature    479968..483245
                     /note="repetitive element"
     gene            <483331..>485637
                     /locus_tag="CYME_CMF173C"
                     /db_xref="GeneID:16992967"
     mRNA            <483331..>485637
                     /locus_tag="CYME_CMF173C"
                     /product="DNA replication licensing factor MCM5"
                     /transcript_id="XM_005535754.1"
                     /db_xref="GeneID:16992967"
     CDS             483331..485637
                     /locus_tag="CYME_CMF173C"
                     /codon_start=1
                     /product="DNA replication licensing factor MCM5"
                     /protein_id="XP_005535811.1"
                     /db_xref="GeneID:16992967"
                     /translation="MDWHAAPVYYTDQGVGVPGAEEQSGNVSIQERRIIEFLLQFRSA
                     PNVFPYRDQLVRQLHARKHWIQIKIEDVYAFDEELAGYIRQAPNEWIERLEQAVDRVV
                     RRLRLPLDHEIGGVSVQVLLQSQENAFPLRELQSDQLGRLVRVQGIVISASKVRAKAQ
                     VVWLRCQHCDYRKMIRASVGFGGFQVPRQCDRVTEMRCPLDSYEVMPHESVFVDHQTV
                     KLQELPESVPTGEVPRSLLLVLERNLIDRVAPGERVSAVGVYSTYASTRDRSSRSVAA
                     NIATRASGPDLVAAVRTPYIRVLGIDATQERRDRHPGFTPEEEEAMRSLSRLPNVYEV
                     LAASIAPEIWGLSDPKRAVLCQLFGGSRKTLPDGMRIRGDINVLLLGDPSTAKSQLLK
                     FAEKVAPVSVYTSGKGSSAAGLTASVIRDATHGEFHLEGGAMVLADGGIVCIDEFDKM
                     RLADRVAIHEAMEQQTISIAKAGITTVLNSRTAVLAAANPLFGSFDDTRTVADQMEFA
                     STILSRFDLIFLVRDVRNDERDRTIARHVLALHQRGHSLRPQGSGLDSAGDISDSGML
                     SLSPNGASEFTSSQMLNAVGLVPIDKLRRYVAYARRRCRPRLSAEAADLLRTAYVAVR
                     QELRDRTADGPTPVPIAVRQLESLIRLTEALAKMRLSDLASAADAEEALRLFRVATMA
                     AAHAGALPPGAFEGTLSGEFLIEVQAAEAAIRRRIAIGSMLALNRLVRELTQQHLSAA
                     ATQRAIQIMLGRQELEWRRQRTVLCRLR"
     gene            complement(<485938..>489996)
                     /locus_tag="CYME_CMF174C"
                     /db_xref="GeneID:16992966"
     mRNA            complement(<485938..>489996)
                     /locus_tag="CYME_CMF174C"
                     /product="similar to tight junction plaque protein
                     Symplekin"
                     /transcript_id="XM_005535755.1"
                     /db_xref="GeneID:16992966"
     CDS             complement(485938..489996)
                     /locus_tag="CYME_CMF174C"
                     /codon_start=1
                     /product="similar to tight junction plaque protein
                     Symplekin"
                     /protein_id="XP_005535812.1"
                     /db_xref="GeneID:16992966"
                     /translation="MDGSSESKPETTQSSERWKRWVEASEQTSRLLPPEHPLWWYRAV
                     SYEPNEHVQRTAALIPHLLKEPIDWIEQDLGTTSQAGSDAPWLSSCVAEWPRHLATLL
                     AKSLPVNGAAVLGAATATLRRLVENPEAPLRRMRLLLLVNSLLRSLRTILEALTCEDW
                     TLLGASRTTTAAEEVQHRPEPLEQPRQQVAADVAQLLDRVFAADTFADASGIARLQSQ
                     LFKLAELVVLSFTFSPVDWSSRSFSGRDAARLADVISPVKCQEWVEQALSRLAETPAG
                     ASFVPLLTRASSLASIARRRAELAVRTLVPLYDVAFKESLHVRRISQKQSIALNMRIL
                     FLCLLRCPHMLPFKEELYAALELFGAEDQAEAAANTAEECERQLALQQGSVAPWSRVV
                     QDGPTCRQLEDSEQVARLLVTRSAVSPASLEELVLETLRQMPTSRPIQAAPDDESSRM
                     DPRLRAQVLAAQQSQRTQVESIRKHLKTLLAEEVKRRRPVIRAQAPEVRALPLTAEQW
                     ETLGEQAVRRLLQAEDAMELCGANDLRLSLLARLLAQASYGESSLSEEVVDFIVQDFS
                     GRMELALRWLTALVACDAELRGAPEEPPRGLKRSHSEIRADLDASASKRERLAAPWQR
                     DAAAEPGTERDDRIPTAETLAAVDATNGNAAGVKRELPAHDHSRDTDDKSAPAADASR
                     VHQSASANSNQTGAAPKEAPNTAMPEQLDVDLDESKAKRLTVAALRAELARRHLDAKG
                     TKKVLLERLLHARAEERQRLSAEVGERAASTDAAVETSDASSNQASTDTPQDADKPVK
                     PQASQMDLASASSESPSSTLAAAAAAAAHTDTAQRIPDTALPMLTPADPALHTAELGV
                     IRARVAKALRESALLDEDKSASLLAIAESDTAFPEARYERLLDTLLERLTSHAKVPDS
                     LLARFLAELPRVPPWVYVLLSQMATEPRRAFSALAALKELCTLRYSVDRERALDTTLE
                     LCCSDDELVRGPASRLVADTLFAEHALLAPWIAHRLQLWLSKALERALLNASPSPAAE
                     RYRLRLERLAATYLALVRHDVTLLEFYVNELYARASTDASLAASLQRLCGDRALFRWS
                     ATSDRLEALIREAPIPETSPLIVQIVELVAETLFNQTGKLPSSLVDAVWQRYQREGRV
                     SLLLLLPVLRALSAEQARQVLPSLVQQLDADQRRLAWERLVLVASGRTTPPLTPSALV
                     EALHRLDSKSEAIPLKLQIEAVQTCFEMDTIFTAQCWASALQSMVRSPHPLPVMLMRT
                     LLQVVARYPKTQHLILQLLTTLVTERRIWEYPKLWPGFIRACVLLMPQSASLVVAHLP
                     SAVLDRALRESAELREALAAFAEAHAENEHRG"
     misc_feature    490134..491187
                     /note="possible transcribed region"
     gene            complement(<492915..>493760)
                     /locus_tag="CYME_CMF176C"
                     /db_xref="GeneID:16992964"
     mRNA            complement(<492915..>493760)
                     /locus_tag="CYME_CMF176C"
                     /product="similar to lysophospholipase II"
                     /transcript_id="XM_005535756.1"
                     /db_xref="GeneID:16992964"
     CDS             complement(492915..493760)
                     /locus_tag="CYME_CMF176C"
                     /codon_start=1
                     /product="similar to lysophospholipase II"
                     /protein_id="XP_005535813.1"
                     /db_xref="GeneID:16992964"
                     /translation="MVAFLLQEAGVRCTERRIGLVALCRARLLASKERRTLSFGCRLR
                     FLTSTMPRGDAHGGAGKTFEPLRGKHTATLVWLHGLGDTADGWSSAVPELRLSSTRVI
                     LPTADTVPVTLNFGTRMPAWADIYSLSENAREDREGILRSVSRILKIVEEECTNEGVR
                     PERIFLGGFSQGGAIALQAYLRSERDLGGFAGLSTWLALRNEVFAAVPKSRRKGRIAL
                     WHGDQDEIVNYHWGVHSAELLRQNLAPGFEVSFRTVQGLGHAVDREEFAELRKTLQEW
                     TRVEQ"
     gene            <494306..>495784
                     /locus_tag="CYME_CMF177C"
                     /db_xref="GeneID:16992963"
     mRNA            <494306..>495784
                     /locus_tag="CYME_CMF177C"
                     /product="similar to polymyositis-scleroderma overlap
                     syndrome associated autoantigen"
                     /transcript_id="XM_005535757.1"
                     /db_xref="GeneID:16992963"
     CDS             494306..495784
                     /locus_tag="CYME_CMF177C"
                     /codon_start=1
                     /product="similar to polymyositis-scleroderma overlap
                     syndrome associated autoantigen"
                     /protein_id="XP_005535814.1"
                     /db_xref="GeneID:16992963"
                     /translation="MHKPSSERIPSQWQNNAYPKPQTSWQVSNAPQTLEHDLEAESLI
                     HTAAAAAAAASGCVAQVQDLERRLAADAGLRPLATTPLRYIESALDLEAFLSDILADI
                     EPTTENSVSGSVSGTGSSGLSLDKTCAFKKAVAIDLEAHSYRSYQGFVCLVQISSVDC
                     DAVIDALALRSALADPSGAFIRLLRHPRVVKVMHGADSDVLWLQRDFTPAARIVNLFD
                     TARAAQLLGEPSVSLAHLISCYARDEDRTADPASLRNGSRDALASEKRVFQVADWRIR
                     PLPSSMLHYARQDTHYLLYLYRVLSTRLVQETDPNSPETNRLQQLWLKSADVALRRYA
                     LQEVAADAHLKVARQYKAMLSDTMLPLLRDLIHWRDQIAREADESPPYVFPNHFLIAL
                     VRETPRSPFQLDKLLRRLGLARGRCLLSRSTKCARRLLALIRARLSVARAPGRRHALH
                     SQRPAVERLAIEASGVRPPWRRPGTQATSHQRRHEEDDRRPT"
     gene            complement(<496684..>497388)
                     /locus_tag="CYME_CMF198C"
                     /db_xref="GeneID:16992962"
     mRNA            complement(<496684..>497388)
                     /locus_tag="CYME_CMF198C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535758.1"
                     /db_xref="GeneID:16992962"
     CDS             complement(496684..497388)
                     /locus_tag="CYME_CMF198C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535815.1"
                     /db_xref="GeneID:16992962"
                     /translation="MFVSATGIQRKSTGMAVQRVATCRRAGARARSPLRAAAAGAEPQ
                     GSAPRKPKTEGKTPKKTPSLSAEERAARVQQLKLRILLVHRQLQIAESKERDDSLSMW
                     RSFAHDMATPEVNREQVGSTNSKNIETMSADALRKELDALKAEIASLDADAYADVLRN
                     TDGIKTAEQRIKEHERKIQQAPKVSFQKVVAQDTDETPKQKPKPKRFQLFEGLKSWFV
                     RNEPIIEELEREIESI"
     gene            complement(<500781..>502595)
                     /locus_tag="CYME_CMF178C"
                     /db_xref="GeneID:16992944"
     mRNA            complement(<500781..>502595)
                     /locus_tag="CYME_CMF178C"
                     /product="glutamyl-tRNA amidotransferase subunit B"
                     /transcript_id="XM_005535759.1"
                     /db_xref="GeneID:16992944"
     CDS             complement(500781..502595)
                     /locus_tag="CYME_CMF178C"
                     /codon_start=1
                     /product="glutamyl-tRNA amidotransferase subunit B"
                     /protein_id="XP_005535816.1"
                     /db_xref="GeneID:16992944"
                     /translation="MDWISAARHRRTGFVQPCRALWSFVGYRALLKVCPNENVLGPAA
                     AAAARPHSERAAASLLASATGQRPKSGAAGRRRKGAEAIDRVLERYAATVGVEVHVQL
                     ATRTKAYCGCSCEQAPGPNTHICPVCTGQPGTLPALNQNVVELAVKAGLALHCRIALR
                     TKFDRKNYFYADTPKNYQISQYDMPIAENGYLELPSSGKRVHIRRAHMEEDSAKMFHS
                     QTAEEEPDEIPGQDPGAHEAKYSLIDHNRAGVPLLEIVTGPDMESGAEAAAFGEELQR
                     VLRYAAISDCNMQDGSLRVDVNVSIRPRGLSGVRSDDALGTKVELKNLNSFNAIERAV
                     DYEILRQAAMLDGNGTVRQETRLWDEREQATKVLRIKEGASDYRYFPEPDIPPILLEQ
                     AQVDAWKASLPELPAEKRLRYTSALGLTPYDAGVLTAEPATAFFFEDTVGHLAVEGLD
                     PRMLIDRAKAAANWITGDIAALIKQKPQARSIQETALTPSVLAELILLIEDGTISGKI
                     AKEILPELMEEPCSSVRDLVEKQGKTQIRSESVIADLIRQVMREHPENVQAYRQGKTK
                     LAGFFVGQVMKRGDGRLDPALTQRLVTELLSRDDSGES"
     gene            complement(<505731..>507224)
                     /locus_tag="CYME_CMF179C"
                     /db_xref="GeneID:16992961"
     mRNA            complement(<505731..>507224)
                     /locus_tag="CYME_CMF179C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535760.1"
                     /db_xref="GeneID:16992961"
     CDS             complement(505731..507224)
                     /locus_tag="CYME_CMF179C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535817.1"
                     /db_xref="GeneID:16992961"
                     /translation="MSSQAVSWLCPPSFSRCSWSGGAAATALWSTARSLRAHAPTRTG
                     FYVESHPRKFTRNPDTGSRLLGPRHRHVGRCRRTVERSQRHSLGACSLQFIQEVAETY
                     ADGAALRRADHALSSSSRSFWVMPATQEAYARAVDLAFPVLVHEHATTWGEWKEPTTD
                     ARYIVAHGTCPRLVREQRTGATYAVFYELQSAEDVHALEENLPCRSIVMVETKDWELI
                     PVENLVSVAYQRQTSILVVVSTTGMAEAQLASLERGVHGVILATGSASAVESFASLRN
                     RYQRLENSLVLDPAVVVDVREAGVGERVCLDTCSLLAFHEGFLVGSSASTLALVLSEA
                     AQNPYVASRPFRVNAGAVHSYILVPDGSTKYLCELRAGDELLAVDARSGRSRSVTLGR
                     AKIERRPLLLVQLSLHADGTGAAAGNKTESWSGDIAGNVIVQNAETVRFAMPTTSGTS
                     SSQHGNVAVTSLNRGQHQVLVHRPARDSNGTIARHLGRPVQEFILEQ"
     gene            <508078..>509919
                     /locus_tag="CYME_CMF180C"
                     /db_xref="GeneID:16992960"
     mRNA            <508078..>509919
                     /locus_tag="CYME_CMF180C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535761.1"
                     /db_xref="GeneID:16992960"
     CDS             508078..509919
                     /locus_tag="CYME_CMF180C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535818.1"
                     /db_xref="GeneID:16992960"
                     /translation="MHTATSGAFACLHQRTLPLDTVCVAAWSPVADLLALVFAPASVV
                     ILRLNWELVGVWRPSEASAGDSIPKVTCLCWSPHEPRLLLGQSDGTLTLLSVEHMQCM
                     TIYEADDEPFDVQYGGWKRLVWIPLTDRKESSLALGVREHGADIFIFIEGLYACGMFD
                     LARLGSVEDFTTSEDTRYLAALGAGNTLLIGALDEVRPRFHEWGRFAHWSVQTRERIF
                     QLQLATQGIQEHWQATARVMYQVLDTLTETLVRYRPEADRATAFRELLLLAYGMAPAP
                     AVRDWLANTMSESNQRSCSRTVVTSLRACVEIARTQLLPLLNALLAQVAGLPDAGPAF
                     TAETKACWRLGHGIALMLQRFRPLYVMFWSWLAGRSDENLRLVVDREKIEALFRERFF
                     GVADMDAQLESFTRALMTLETRLNDLARHHQSRRWPLKTAVSASIPQSTGEPSSLQPL
                     LQRQRLRPMVRWLPSMASFQVCTESGDLWLISTQGTVALSFSIRYLIQSSSETSFVRV
                     AWYRDPKICVLTSAGLWCLTSVKTGDASPPRATESHDLFRALELTAPASSTSSFGSAF
                     PEVLQIPALVCGITRGLACIFASASRVLVFDLEDSDVDADAATEALP"
     gene            complement(<510161..>510790)
                     /locus_tag="CYME_CMF181C"
                     /db_xref="GeneID:16992959"
     mRNA            complement(<510161..>510790)
                     /locus_tag="CYME_CMF181C"
                     /product="small GTP-binding protein of Rab family"
                     /transcript_id="XM_005535762.1"
                     /db_xref="GeneID:16992959"
     CDS             complement(510161..510790)
                     /locus_tag="CYME_CMF181C"
                     /codon_start=1
                     /product="small GTP-binding protein of Rab family"
                     /protein_id="XP_005535819.1"
                     /db_xref="GeneID:16992959"
                     /translation="MSTTDFDYLFKLLLIGDSGVGKSCLLLRFAEGSFSDSFMSTIGV
                     DFKIKSLQFEDGKVVKLQIWDTAGQERFRTITSSYYRGAHGIIIVFDVTDEESFKNVT
                     SWISEIENYASESVCKLLVGNKTDLTEQRVVTRQQAEELAQRLGIPYIETSAKTADHV
                     EEAFVMMTKEIRNRTGNLALAKGSGAGTSRSGVDVRAETEQVSQSGGCC"
     gene            complement(<514581..>517556)
                     /locus_tag="CYME_CMF182C"
                     /db_xref="GeneID:16992958"
     mRNA            complement(<514581..>517556)
                     /locus_tag="CYME_CMF182C"
                     /product="aminopeptidase N"
                     /transcript_id="XM_005535763.1"
                     /db_xref="GeneID:16992958"
     CDS             complement(514581..517556)
                     /locus_tag="CYME_CMF182C"
                     /codon_start=1
                     /product="aminopeptidase N"
                     /protein_id="XP_005535820.1"
                     /db_xref="GeneID:16992958"
                     /translation="MLSFVAPLRCVLLSAACAPLQRKLPLASLRTLNTRNSSCSLRLA
                     ERPLTATKRNALGNACLAHSLWGRRRVSRTSRRNARSVTMTATAASRARTVVRLADYQ
                     PPPFLVESIDLEIDLHETETKVRSRLCVRPNPTYATEPCSTLELDVGATVRLVPDSLL
                     LNGKRLDAERGAYHMHAGKLVIRQLPSGNDGFTLESCVLLNPSENTALEGLYLSKGTF
                     CTQCEAEGFRRIVPFIDRPDVLARYRTKIIADASKYPVLLSNGNLVEHGPCPRDPQRH
                     YAIYEDPWPKPCYLFALVAGDLARVSDEFVRASNRPVSLHIYVRHGDEARTAHAMESL
                     KKAMLWDEKTYGRVYDLDVFNIVAVDDFNMGAMENKSLNIFNSKYILASPQTATDSDY
                     NAIEAVVGHEYFHNWSGNRVTCRDWFQLSLKEGFTVFREQEFSADMRGNRAVKRIADV
                     ARLRSTQFPQDAGPTAHPVRPDTYETINNFYSVTIYEKGAEVIRMMKTLLGEQGFRRG
                     TDLYFARHDGEAVTCDDFVAAMADASPSVLSAADWEQFKLWYAQAGTPQVWISDSAYD
                     AQRRELTIVARQRVPPTPGQPVKKPHVIPIATGVLDASGKEVVPTTILCLKEAEQSFT
                     LQNVPPGHVVSYLRHFSAPIKLTRESWADQEREERELAFLMAHDTDDFQRWDAAQQLL
                     LNAAHRRDGSLTPVAITSFQRAFDALIDDPLILSQVLAPLSESYVMDEQPTLPVDPEL
                     VHKACLSIKRQLAEALRSRLEHVLDTAEQYEAGRSGFSLDSIEQGRRALEAVAFSLLV
                     TLPNPEPYLERALVRMRNAATMTTMLATLQTLVHADAASKEHREQALSVFYDRWQGDY
                     LLMDKWLRIQATAPRSDALMVVQSLLHHPAYNAGNPNNIYSVLGGFALANPYGLHGGS
                     NASSAYRFLADQILEIDGRNPQVAARLANAFTKWRRFSEDRQSAMRIEMERMLESPKL
                     STDVGEVIFKCLEMAPVSS"
     misc_feature    complement(517778..520997)
                     /note="repetitive element"
     misc_feature    519219..521393
                     /note="repetitive element"
     gene            complement(<522258..>523379)
                     /locus_tag="CYME_CMF185C"
                     /db_xref="GeneID:16992957"
     mRNA            complement(<522258..>523379)
                     /locus_tag="CYME_CMF185C"
                     /product="1-acylglycerol-3-phosphate O-acyltransferase"
                     /transcript_id="XM_005535764.1"
                     /db_xref="GeneID:16992957"
     CDS             complement(522258..523379)
                     /locus_tag="CYME_CMF185C"
                     /codon_start=1
                     /product="1-acylglycerol-3-phosphate O-acyltransferase"
                     /protein_id="XP_005535821.1"
                     /db_xref="GeneID:16992957"
                     /translation="MYLALGSKLQSHMSRSKLCGFVHASGYRGGFSSDSNTTQTLWAR
                     YICSVPVTDAKPFGVVVVGIGRAFVAASVRLPVQRRRRLQCCRLDTRMRSTATTSPGS
                     DDPTEETRSKEKETGVSAWAERQHRTRINLVGVFFLLVTFAWSLPLFIIMLILYPFVL
                     ILDPYRARVYDWIAMLWMRLSMLSTGIHPRVVGTENLLPPDATVLYVCNHNSYLDIYT
                     VAFLGRFFKFVSKRSIFAIPIIGWAMGMARQIGIERDSRRDQLRVFREMVSRLEHGVS
                     LLLFPEGTRSKDGTLRAFKQGPFRVAKQAGVPIVPLTITGTAEVMPPWALAPLRWPKQ
                     RITLTIHPAIQTADHSVTDLIEAARTAIASALPPGLCGR"
     misc_feature    complement(523470..525853)
                     /note="repetitive element"
     gene            complement(<528468..>529679)
                     /locus_tag="CYME_CMF187C"
                     /db_xref="GeneID:16992956"
     mRNA            complement(<528468..>529679)
                     /locus_tag="CYME_CMF187C"
                     /product="similar to ubiquitin-conjugating enzyme E2
                     variant"
                     /transcript_id="XM_005535765.1"
                     /db_xref="GeneID:16992956"
     CDS             complement(528468..529679)
                     /locus_tag="CYME_CMF187C"
                     /codon_start=1
                     /product="similar to ubiquitin-conjugating enzyme E2
                     variant"
                     /protein_id="XP_005535822.1"
                     /db_xref="GeneID:16992956"
                     /translation="MSCGNILNDSAPGTGMLDREALGMEKRSVQCEARVNACSTLAFL
                     SPTFSTILRMGRAIQSRRSVVAEVDPGLSRFRLGQVVAISAQSLASGRLSTGRKLHRG
                     RGAVGTLHSSADTDLIPERESIPALRRGMVRKPKKEATLVLERDRLESSPQEKVVVAA
                     TVSLGVFAMLRIFWEMHCLLAAETPQAAHLYPVVRVALEGATALFAYIMADFASGIYH
                     FFLDNYGSRETPIFGEQIAAFQGHHQYPWTITHRDFCNNVFKSCVNSLLPLLLVAFSG
                     AWGTSAEWTSIYLRSFSCVFFLSVAFAQEFHKWSHMIRPPSFAMFLQRSGWLISQRAH
                     GQHHQSPYHEKYCIISGWCNQLLDDTGFFRGLEMLIWHVTGVEPLTWRLGASRIPSPT
                     RESTKQEASRS"
     gene            529925..531145
                     /locus_tag="CYME_CMF188T"
                     /db_xref="GeneID:16992955"
     misc_RNA        529925..531145
                     /locus_tag="CYME_CMF188T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461268.1"
                     /db_xref="GeneID:16992955"
     misc_feature    531950..532939
                     /note="pseudo-gene of trefoil factor"
     misc_feature    533542..534809
                     /note="pseudo-gene of hedgehog protein"
CONTIG      join(AP006488.2:1..536163)
//
DBGET integrated database retrieval system